5AI2A

Anomalous neutron phased crystal structure of 113cd-substituted perdeuterated pyrococcus furiosus rubredoxin to 1.75a resolution at 295k
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Macromolecular Structure Phasing by Neutron Anomalous Diffraction.
pubmed doi rcsb
molecule tags Electron transport
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5ai2A00
1LKMA 2PVXA 1YUXA 1SMWA 2PYAA 1YV1A 4YWLA 2HR5A 4K9FA 1DX8A 1IU5A 1RDGA 1T9PA 3SS2A 4POGA 3KYYA 1ZRPA 1LKOA 1IU6A 1RB9A 2MS3A 1BFYA 1YK4A 2KN9A 2M4YA 1B2OA 1CADA 4AR3A 2RDVA 1R0IA 5AI3A 1QYBA 3KYXA 1RWDA 1R0HA 1YUZA 5RXNA 2LCQA 4AR5A 1S2ZA 1QCVA 2DSXA 1DVBA 1JYBA 1RYTA 3KYVA 1R0JA 8RXNA 1NNQA 3RYGA 1T9OA 4ME3A 4AR4A 2KKDA 2V3BB 2VL6A 4RXNA 3A44A 1S30A 1E8JA 3PZAA 1BQ9A 3RZTA 1R0GA 3KYUA 1LTLA 1FHHA 1T9QA 2GMGA 1H7VA 3KYWA 3RZ6A 4TPUA 1S24A 1BQ8A 1VCXA 2K2DA 1CAAA 2PVEA 1BRFA 1IRNA 1B71A 1BE7A 6RXNA 1FHMA 3MPSA 3PWFA 4AR6A 1C09A 1SMUA 5IY0A 5AI2A 1IROA 2QL0A 1B2JA 1YK5A 7RXNA 1LKPA 3QVDA 1B13A 1RDVA 1R0FA 4YWMA 1SMMA 4POFA
chains in the Genus database with same CATH superfamily
2XJTA 1NXGA 1WJVA 2AYJA 5MGNA 1SMWA 3M3YL 3WWNB 5FLML 4LHNA 3GTLL 4K9FA 1DX8A 4BXXL 2JA8L 1IW7D 1T9PA 3S17L 3SS2A 4AI3A 3S2DL 1ZRPA 1LKOA 2C6AA 2PPTA 2XJVA 1VZIA 3FKIL 2MS3A 3NFPI 3S1RL 2KN9A 3PKJA 4Y52L 3HOZL 3LWOB 3I4ML 1R0IA 4AI1A 5IP7L 1RWDA 5JVH1 3PIP1 5GADc 2RFKB 2LCQA 2CR8A 1NXEA 2DSXA 4TVMA 3IU3I 2M6OA 2JI3A 3S2HL 2A69D 2WB1P 2CKCA 2XJSA 2A6ED 2KKDA 4AR4A 3GTJL 4A3DL 2VL6A 1TWFL 3LNLA 5IYCL 1E8JA 2JI2A 3PZAA 4BBSL 3B08B 1LTLA 1FHHA 3MQKB 1H7VA 5M3FL 3HJWB 1S24A 2L0ZA 2R92L 2K2DA 5M5YL 2PMZP 2M4VA 2Z3RB 2B63L 2XJPA 1BE7A 4LHLA 4WFN1 3LWVB 5EINC 4AI0A 5C4XL 5C4JL 1I6HL 1RDVA 4ZN1B 5MFZA 4YWMA 4ZN3B 4B8CD 2PYAA 5DM71 4JAFA 1Z92B 2BE5D 1IU5A 5MLC3 3HAXC 3S16L 3KYYA 2E2JL 3J7Z1 2H12A 1IU6A 1RYQA 5C44L 2O5JD 1QYBA 3GTKL 3K7AL 3S1NL 4A3LL 3JR7A 3LPEB 3H99A 5M5XL 5JVG1 1QCVA 1RYTA 8RXNA 3B0AB 2ERSA 1NNQA 2NVTL 2V0FA 2NYDA 5H1Sc 4A3IL 3HOVL 5C3EL 5IYDL 4A3KL 1PFYA 5M5WL 4RXNA 1S30A 1BQ9A 2JA6L 3HKZP 3H3VM 2GMGA 3J7Y1 4BY7L 4TPUA 1OWCA 1BQ8A 3QQCE 3GTQL 2PVEA 3P2AA 5DM61 3GTGL 2XJQA 1IRNA 1F4LA 3PO3L 1R9TL 2XJUA 2VUML 1I50L 3MPSA 2E2IL 3PWFA 4AR6A 1C09A 1IROA 3HOUL 1YK5A 2R93L 3K35A 1QQTA 7RXNA 5MF6A 1LKPA 3RZDL 3PO2L 4C3IL 1PFUA 3WWLA 2M6PA 5K2ME 2J9UB 2Z3QB 1YUXA 2JI1A 4C2M1 1YV1A 4A93L 2R7ZL 2NVXL 5IP9L 3HOXL 4POGA 5GAEc 5GAHc 5M3ML 2JA7L 4JAGA 4BBRL 1BFYA 1SFOL 4QIWP 1YK4A 2M4YA 3RZOL 4AR3A 3GTOL 4UY81 2B5ID 2A68D 2C6BA 5IYBL 2CKAA 1R0HA 2NVYL 1PFVA 4AR5A 4AHXA 4E6YA 1DVBA 1JYBA 3KYVA 4G6BA 3LWRB 4A3CL 2AQCA 1T9OA 4AHZA 5AN9H 4ME3A 3LWQB 3GTPL 4AYBP 1PZXA 3H9BA 3P8BA 3H9CA 3A44A 1K83L 3M4OL 1I3QL 3KYUA 1T9QA 3KYWA 3RZ6A 3H0GL 1VCXA 3I4NL 1CAAA 4AI2A 3FDJA 3HOYL 3GTML 4XXBB 2WAQP 1ODHA 1B71A 6RXNA 1FHMA 4AHYA 5AI2A 3QVDA 1B13A 2Y0SP 1R0FA 1SMMA 4POFA 5MFPA 4A3ML 1LKMA 2PVXA 5FJ8L 4GS7D 4C3HL 4JAEA 4YWLA 2HR5A 4V196 3S14L 2XJRA 4A3EL 1RDGA 2AUSB 3LWPB 2PSMC 2A6HD 1RB9A 2YU9L 4U671 1B2OA 2HVYC 2V0EA 2ERJA 2APOB 1CADA 4C3JL 5EIOC 2RDVA 5AI3A 3HJYB 3KYXA 1VZGA 1YUZA 5RXNA 4A3JL 1P7PA 4A3GL 1S2ZA 1VZHA 1R0JA 4X6AL 1TWGL 2EY4E 3HOWL 3PIO1 1PFWA 3RYGA 4A3FL 3S1ML 3ZG6A 3S15L 2V3BB 3CQZL 1TWCL 2JA5L 3RZTA 4BY1L 1R0GA 4AHWA 3H97A 4JADA 3VPBE 1Y1VL 1OWBA 1BRFA 3MSUA 4A3BL 5GAGc 1SMUA 1WCML 3PKIA 2NVQL 5IY0A 1Y1WL 2QL0A 1B2JA 1TWHL 3S1QL 4XGHA 2E2HL 1TWAL 4Y7NL 2ZIXA 3PL5A
chains in the Genus database with same CATH topology
2M6PA 2XJTA 5K2ME 2J9UB 1NXGA 1WJVA 2AYJA 1LKMA 2PVXA 4ZN3B 2Z3QB 1YUXA 1SMWA 2JI1A 4B8CD 5MGNA 3WWNB 4GS7D 4LHNA 2PYAA 1YV1A 5DM71 4JAEA 4YWLA 2HR5A 4K9FA 1DX8A 4V196 4JAFA 1Z92B 2BE5D 2XJRA 1IU5A 1RDGA 1IW7D 1T9PA 5MLC3 3SS2A 4AI3A 4POGA 3KYYA 5GAHc 5GAEc 2PSMC 3J7Z1 1ZRPA 2H12A 1LKOA 2C6AA 2PPTA 2XJVA 2A6HD 1VZIA 1IU6A 4JAGA 1RB9A 2MS3A 1BFYA 1RYQA 1YK4A 3NFPI 2KN9A 2M4YA 1B2OA 4U671 2O5JD 2V0EA 2ERJA 1CADA 3PKJA 4AR3A 5EIOC 4UY81 2B5ID 2RDVA 1R0IA 2A68D 2C6BA 5AI3A 1QYBA 4AI1A 3KYXA 2CKAA 1RWDA 3LPEB 1VZGA 1YUZA 1R0HA 5RXNA 5JVH1 3PIP1 5GADc 2LCQA 2CR8A 5JVG1 4AR5A 1S2ZA 1NXEA 2DSXA 1QCVA 1VZHA 4AHXA 4E6YA 1DVBA 1JYBA 1RYTA 3KYVA 1R0JA 4G6BA 4TVMA 3IU3I 8RXNA 3B0AB 3PIO1 2M6OA 2JI3A 2ERSA 1NNQA 3RYGA 2V0FA 2NYDA 5H1Sc 1T9OA 2A69D 3ZG6A 2CKCA 2XJSA 4AHZA 5AN9H 4ME3A 2A6ED 2KKDA 4AR4A 2V3BB 2VL6A 3P8BA 3LNLA 4RXNA 3A44A 1S30A 1E8JA 2JI2A 1BQ9A 3PZAA 3RZTA 3B08B 3KYUA 1R0GA 1LTLA 1FHHA 4AHWA 1T9QA 2GMGA 3J7Y1 1H7VA 3KYWA 3RZ6A 4TPUA 1OWCA 4JADA 1S24A 1BQ8A 3VPBE 2L0ZA 1VCXA 3QQCE 2K2DA 1CAAA 2PVEA 3P2AA 1OWBA 2M4VA 2Z3RB 4AI2A 5DM61 1BRFA 2XJQA 1IRNA 3MSUA 2XJPA 4XXBB 2XJUA 1ODHA 1B71A 1BE7A 6RXNA 1FHMA 3MPSA 4LHLA 3PWFA 4AR6A 4WFN1 1C09A 5GAGc 1SMUA 5EINC 3PKIA 4AHYA 5IY0A 5AI2A 4AI0A 1IROA 2QL0A 1B2JA 1YK5A 4XGHA 3K35A 7RXNA 5MF6A 1LKPA 3QVDA 1B13A 1RDVA 4ZN1B 2ZIXA 5MFZA 1R0FA 3WWLA 4YWMA 1SMMA 4POFA 5MFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKM A;  2PVX A;  1YUX A;  1SMW A;  2PYA A;  1YV1 A;  4YWL A;  2HR5 A;  4K9F A;  1DX8 A;  1IU5 A;  1RDG A;  1T9P A;  3SS2 A;  4POG A;  3KYY A;  1ZRP A;  1LKO A;  1IU6 A;  1RB9 A;  2MS3 A;  1BFY A;  1YK4 A;  2KN9 A;  2M4Y A;  1B2O A;  1CAD A;  4AR3 A;  2RDV A;  1R0I A;  5AI3 A;  1QYB A;  3KYX A;  1RWD A;  1R0H A;  1YUZ A;  5RXN A;  2LCQ A;  4AR5 A;  1S2Z A;  1QCV A;  2DSX A;  1DVB A;  1JYB A;  1RYT A;  3KYV A;  1R0J A;  8RXN A;  1NNQ A;  3RYG A;  1T9O A;  4ME3 A;  4AR4 A;  2KKD A;  2V3B B;  2VL6 A;  4RXN A;  3A44 A;  1S30 A;  1E8J A;  3PZA A;  1BQ9 A;  3RZT A;  1R0G A;  3KYU A;  1LTL A;  1FHH A;  1T9Q A;  2GMG A;  1H7V A;  3KYW A;  3RZ6 A;  4TPU A;  1S24 A;  1BQ8 A;  1VCX A;  2K2D A;  1CAA A;  2PVE A;  1BRF A;  1IRN A;  1B71 A;  1BE7 A;  6RXN A;  1FHM A;  3MPS A;  3PWF A;  4AR6 A;  1C09 A;  1SMU A;  5IY0 A;  5AI2 A;  1IRO A;  2QL0 A;  1B2J A;  1YK5 A;  7RXN A;  1LKP A;  3QVD A;  1B13 A;  1RDV A;  1R0F A;  4YWM A;  1SMM A;  4POF A; 
#chains in the Genus database with same CATH topology
 2XJT A;  1NXG A;  1WJV A;  2AYJ A;  5MGN A;  1SMW A;  3M3Y L;  3WWN B;  5FLM L;  4LHN A;  3GTL L;  4K9F A;  1DX8 A;  4BXX L;  2JA8 L;  1IW7 D;  1T9P A;  3S17 L;  3SS2 A;  4AI3 A;  3S2D L;  1ZRP A;  1LKO A;  2C6A A;  2PPT A;  2XJV A;  1VZI A;  3FKI L;  2MS3 A;  3NFP I;  3S1R L;  2KN9 A;  3PKJ A;  4Y52 L;  3HOZ L;  3LWO B;  3I4M L;  1R0I A;  4AI1 A;  5IP7 L;  1RWD A;  5JVH 1;  3PIP 1;  5GAD c;  2RFK B;  2LCQ A;  2CR8 A;  1NXE A;  2DSX A;  4TVM A;  3IU3 I;  2M6O A;  2JI3 A;  3S2H L;  2A69 D;  2WB1 P;  2CKC A;  2XJS A;  2A6E D;  2KKD A;  4AR4 A;  3GTJ L;  4A3D L;  2VL6 A;  1TWF L;  3LNL A;  5IYC L;  1E8J A;  2JI2 A;  3PZA A;  4BBS L;  3B08 B;  1LTL A;  1FHH A;  3MQK B;  1H7V A;  5M3F L;  3HJW B;  1S24 A;  2L0Z A;  2R92 L;  2K2D A;  5M5Y L;  2PMZ P;  2M4V A;  2Z3R B;  2B63 L;  2XJP A;  1BE7 A;  4LHL A;  4WFN 1;  3LWV B;  5EIN C;  4AI0 A;  5C4X L;  5C4J L;  1I6H L;  1RDV A;  4ZN1 B;  5MFZ A;  4YWM A;  4ZN3 B;  4B8C D;  2PYA A;  5DM7 1;  4JAF A;  1Z92 B;  2BE5 D;  1IU5 A;  5MLC 3;  3HAX C;  3S16 L;  3KYY A;  2E2J L;  3J7Z 1;  2H12 A;  1IU6 A;  1RYQ A;  5C44 L;  2O5J D;  1QYB A;  3GTK L;  3K7A L;  3S1N L;  4A3L L;  3JR7 A;  3LPE B;  3H99 A;  5M5X L;  5JVG 1;  1QCV A;  1RYT A;  8RXN A;  3B0A B;  2ERS A;  1NNQ A;  2NVT L;  2V0F A;  2NYD A;  5H1S c;  4A3I L;  3HOV L;  5C3E L;  5IYD L;  4A3K L;  1PFY A;  5M5W L;  4RXN A;  1S30 A;  1BQ9 A;  2JA6 L;  3HKZ P;  3H3V M;  2GMG A;  3J7Y 1;  4BY7 L;  4TPU A;  1OWC A;  1BQ8 A;  3QQC E;  3GTQ L;  2PVE A;  3P2A A;  5DM6 1;  3GTG L;  2XJQ A;  1IRN A;  1F4L A;  3PO3 L;  1R9T L;  2XJU A;  2VUM L;  1I50 L;  3MPS A;  2E2I L;  3PWF A;  4AR6 A;  1C09 A;  1IRO A;  3HOU L;  1YK5 A;  2R93 L;  3K35 A;  1QQT A;  7RXN A;  5MF6 A;  1LKP A;  3RZD L;  3PO2 L;  4C3I L;  1PFU A;  3WWL A;  2M6P A;  5K2M E;  2J9U B;  2Z3Q B;  1YUX A;  2JI1 A;  4C2M 1;  1YV1 A;  4A93 L;  2R7Z L;  2NVX L;  5IP9 L;  3HOX L;  4POG A;  5GAE c;  5GAH c;  5M3M L;  2JA7 L;  4JAG A;  4BBR L;  1BFY A;  1SFO L;  4QIW P;  1YK4 A;  2M4Y A;  3RZO L;  4AR3 A;  3GTO L;  4UY8 1;  2B5I D;  2A68 D;  2C6B A;  5IYB L;  2CKA A;  1R0H A;  2NVY L;  1PFV A;  4AR5 A;  4AHX A;  4E6Y A;  1DVB A;  1JYB A;  3KYV A;  4G6B A;  3LWR B;  4A3C L;  2AQC A;  1T9O A;  4AHZ A;  5AN9 H;  4ME3 A;  3LWQ B;  3GTP L;  4AYB P;  1PZX A;  3H9B A;  3P8B A;  3H9C A;  3A44 A;  1K83 L;  3M4O L;  1I3Q L;  3KYU A;  1T9Q A;  3KYW A;  3RZ6 A;  3H0G L;  1VCX A;  3I4N L;  1CAA A;  4AI2 A;  3FDJ A;  3HOY L;  3GTM L;  4XXB B;  2WAQ P;  1ODH A;  1B71 A;  6RXN A;  1FHM A;  4AHY A;  5AI2 A;  3QVD A;  1B13 A;  2Y0S P;  1R0F A;  1SMM A;  4POF A;  5MFP A;  4A3M L;  1LKM A;  2PVX A;  5FJ8 L;  4GS7 D;  4C3H L;  4JAE A;  4YWL A;  2HR5 A;  4V19 6;  3S14 L;  2XJR A;  4A3E L;  1RDG A;  2AUS B;  3LWP B;  2PSM C;  2A6H D;  1RB9 A;  2YU9 L;  4U67 1;  1B2O A;  2HVY C;  2V0E A;  2ERJ A;  2APO B;  1CAD A;  4C3J L;  5EIO C;  2RDV A;  5AI3 A;  3HJY B;  3KYX A;  1VZG A;  1YUZ A;  5RXN A;  4A3J L;  1P7P A;  4A3G L;  1S2Z A;  1VZH A;  1R0J A;  4X6A L;  1TWG L;  2EY4 E;  3HOW L;  3PIO 1;  1PFW A;  3RYG A;  4A3F L;  3S1M L;  3ZG6 A;  3S15 L;  2V3B B;  3CQZ L;  1TWC L;  2JA5 L;  3RZT A;  4BY1 L;  1R0G A;  4AHW A;  3H97 A;  4JAD A;  3VPB E;  1Y1V L;  1OWB A;  1BRF A;  3MSU A;  4A3B L;  5GAG c;  1SMU A;  1WCM L;  3PKI A;  2NVQ L;  5IY0 A;  1Y1W L;  2QL0 A;  1B2J A;  1TWH L;  3S1Q L;  4XGH A;  2E2H L;  1TWA L;  4Y7N L;  2ZIX A;  3PL5 A; 
#chains in the Genus database with same CATH homology
 2M6P A;  2XJT A;  5K2M E;  2J9U B;  1NXG A;  1WJV A;  2AYJ A;  1LKM A;  2PVX A;  4ZN3 B;  2Z3Q B;  1YUX A;  1SMW A;  2JI1 A;  4B8C D;  5MGN A;  3WWN B;  4GS7 D;  4LHN A;  2PYA A;  1YV1 A;  5DM7 1;  4JAE A;  4YWL A;  2HR5 A;  4K9F A;  1DX8 A;  4V19 6;  4JAF A;  1Z92 B;  2BE5 D;  2XJR A;  1IU5 A;  1RDG A;  1IW7 D;  1T9P A;  5MLC 3;  3SS2 A;  4AI3 A;  4POG A;  3KYY A;  5GAH c;  5GAE c;  2PSM C;  3J7Z 1;  1ZRP A;  2H12 A;  1LKO A;  2C6A A;  2PPT A;  2XJV A;  2A6H D;  1VZI A;  1IU6 A;  4JAG A;  1RB9 A;  2MS3 A;  1BFY A;  1RYQ A;  1YK4 A;  3NFP I;  2KN9 A;  2M4Y A;  1B2O A;  4U67 1;  2O5J D;  2V0E A;  2ERJ A;  1CAD A;  3PKJ A;  4AR3 A;  5EIO C;  4UY8 1;  2B5I D;  2RDV A;  1R0I A;  2A68 D;  2C6B A;  5AI3 A;  1QYB A;  4AI1 A;  3KYX A;  2CKA A;  1RWD A;  3LPE B;  1VZG A;  1YUZ A;  1R0H A;  5RXN A;  5JVH 1;  3PIP 1;  5GAD c;  2LCQ A;  2CR8 A;  5JVG 1;  4AR5 A;  1S2Z A;  1NXE A;  2DSX A;  1QCV A;  1VZH A;  4AHX A;  4E6Y A;  1DVB A;  1JYB A;  1RYT A;  3KYV A;  1R0J A;  4G6B A;  4TVM A;  3IU3 I;  8RXN A;  3B0A B;  3PIO 1;  2M6O A;  2JI3 A;  2ERS A;  1NNQ A;  3RYG A;  2V0F A;  2NYD A;  5H1S c;  1T9O A;  2A69 D;  3ZG6 A;  2CKC A;  2XJS A;  4AHZ A;  5AN9 H;  4ME3 A;  2A6E D;  2KKD A;  4AR4 A;  2V3B B;  2VL6 A;  3P8B A;  3LNL A;  4RXN A;  3A44 A;  1S30 A;  1E8J A;  2JI2 A;  1BQ9 A;  3PZA A;  3RZT A;  3B08 B;  3KYU A;  1R0G A;  1LTL A;  1FHH A;  4AHW A;  1T9Q A;  2GMG A;  3J7Y 1;  1H7V A;  3KYW A;  3RZ6 A;  4TPU A;  1OWC A;  4JAD A;  1S24 A;  1BQ8 A;  3VPB E;  2L0Z A;  1VCX A;  3QQC E;  2K2D A;  1CAA A;  2PVE A;  3P2A A;  1OWB A;  2M4V A;  2Z3R B;  4AI2 A;  5DM6 1;  1BRF A;  2XJQ A;  1IRN A;  3MSU A;  2XJP A;  4XXB B;  2XJU A;  1ODH A;  1B71 A;  1BE7 A;  6RXN A;  1FHM A;  3MPS A;  4LHL A;  3PWF A;  4AR6 A;  4WFN 1;  1C09 A;  5GAG c;  1SMU A;  5EIN C;  3PKI A;  4AHY A;  5IY0 A;  5AI2 A;  4AI0 A;  1IRO A;  2QL0 A;  1B2J A;  1YK5 A;  4XGH A;  3K35 A;  7RXN A;  5MF6 A;  1LKP A;  3QVD A;  1B13 A;  1RDV A;  4ZN1 B;  2ZIX A;  5MFZ A;  1R0F A;  3WWL A;  4YWM A;  1SMM A;  4POF A;  5MFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...