5AI2A

Anomalous neutron phased crystal structure of 113cd-substituted perdeuterated pyrococcus furiosus rubredoxin to 1.75a resolution at 295k
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
b'MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Macromolecular Structure Phasing by Neutron Anomalous Diffraction.
pubmed doi rcsb
molecule tags Electron transport
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5ai2A00
3KYXA 2GMGA 3RZ6A 4RXNA 1T9QA 1CAAA 2M4YA 1RDGA 1SMMA 4AR6A 1ZRPA 2LCQA 1IROA 1SMWA 1LKMA 3A44A 3KYUA 1T9OA 2MS3A 4AR5A 1LKPA 1H7VA 1YV1A 3PWFA 1T9PA 2VL6A 3KYWA 1NNQA 6RXNA 1RYTA 1B13A 1FHHA 1QCVA 1C09A 5RXNA 4AR3A 1IRNA 1S30A 1YK5A 1YK4A 1RWDA 1YUZA 4TPUA 1JYBA 2HR5A 1DVBA 1LTLA 4YWLA 2QL0A 3QVDA 1R0FA 1BQ8A 1R0IA 1R0JA 1YUXA 4POGA 1LKOA 1B2OA 4AR4A 4YWMA 3SS2A 1RB9A 1B71A 2KKDA 1S24A 3MPSA 1SMUA 4K9FA 7RXNA 5AI3A 1FHMA 4ME3A 1IU5A 1R0GA 2PVXA 3RYGA 1VCXA 8RXNA 5AI2A 3KYYA 1R0HA 1BE7A 1BRFA 2KN9A 2K2DA 1BFYA 2V3BB 2RDVA 1RDVA 1B2JA 2PVEA 4POFA 1S2ZA 1CADA 3KYVA 2PYAA 1DX8A 3RZTA 3PZAA 1E8JA 1BQ9A 1QYBA 2DSXA 1IU6A 5IY0A
chains in the Genus database with same CATH superfamily
1PFVA 2JI2A 2AYJA 1TWAL 1R9TL 2E2IL 2R92L 1SMMA 1ZRPA 2VUML 2JI3A 3A44A 5MLC3 4AI2A 3JR7A 1RYQA 3KYWA 1NNQA 4QIWP 1RYTA 3S15L 1P7PA 1C09A 5RXNA 3GTGL 2C6BA 3PO3L 3HOZL 2B5ID 3M3YL 1PFWA 3RZDL 1YK5A 1WJVA 2WB1P 1YUZA 4C3IL 4A3EL 4TPUA 4C3HL 2HR5A 2QL0A 4LHLA 1PFUA 2JA7L 4A3IL 1SFOL 3RZOL 2NVYL 5AN9H 2AUSB 3SS2A 1K83L 4C2M1 1SMUA 4K9FA 2WAQP 3J7Y1 5EINC 5AI3A 4WFN1 1VCXA 4A3LL 8RXNA 3H3VM 5FJ8L 4AI1A 5C4JL 3S1ML 3I4ML 3GTJL 1BRFA 2KN9A 2K2DA 5DM71 4A3CL 3B08B 2M6OA 1BFYA 5MFZA 3LPEB 3GTQL 1B2JA 2V0EA 1OWCA 3GTML 1I50L 2PYAA 4E6YA 1DX8A 3K35A 3P8BA 4BY1L 4JADA 3KYXA 1OWBA 5GADc 1CAAA 2B63L 2A68D 5GAHc 3HJYB 2CKAA 1IROA 1LKMA 3KYUA 1T9OA 2MS3A 2VL6A 2JA6L 3I4NL 1FHHA 1QCVA 5K2ME 4X6AL 1ODHA 1Y1WL 1IRNA 1I3QL 2Z3QB 2PMZP 5H1Sc 2CKCA 1RWDA 3PKIA 3QQCE 1DVBA 1LTLA 2C6AA 2PPTA 2XJRA 3MQKB 3WWLA 1R0JA 2XJUA 3H0GL 4Y7NL 3S17L 4AHWA 2H12A 1S24A 4AHXA 3HOUL 7RXNA 3HKZP 3LWQB 4ME3A 1R0GA 2PVXA 4LHNA 3KYYA 2APOB 3LWVB 3H9BA 3GTLL 4A3JL 3HOXL 2RDVA 5M5YL 1RDVA 4Y52L 4POFA 3GTKL 4GS7D 1CADA 3RZTA 3S14L 4A3KL 2A6HD 5IY0A 1PFYA 2GMGA 1VZHA 1TWCL 3HOYL 2NVTL 2A6ED 2O5JD 4AR6A 2JI1A 4A3DL 5M3FL 1SMWA 1LKPA 2M4VA 1QQTA 6RXNA 4B8CD 1Y1VL 3B0AB 2PSMC 3MSUA 4AR3A 5IYBL 3GTOL 1PZXA 5EIOC 1Z92B 4AYBP 2R93L 1VZIA 1TWGL 5IP9L 4YWLA 3H9CA 5M5XL 5JVG1 1R0FA 1R0IA 2XJQA 2R7ZL 1YUXA 4POGA 1TWHL 4A3ML 3HAXC 2J9UB 4YWMA 4V196 1RB9A 4JAGA 1B71A 3MPSA 3H97A 3IU3I 4AI0A 5M5WL 1VZGA 1IU5A 3K7AL 3LNLA 5AI2A 4BBSL 3PKJA 4JAFA 1BE7A 2JA5L 4ZN1B 1NXGA 2V3BB 5M3ML 5GAEc 2XJVA 4A3FL 3GTPL 1IW7D 1S2ZA 3HJWB 2CR8A 3PZAA 2XJSA 4AI3A 1BQ9A 3P2AA 2NVXL 2DSXA 3M4OL 2V0FA 5FLML 3RZ6A 4RXNA 1T9QA 2A69D 3S2DL 3LWOB 3VPBE 3S1NL 1WCML 4AHZA 2M4YA 1RDGA 3H99A 2YU9L 2LCQA 2ERSA 1F4LA 3HOWL 4ZN3B 5MGNA 4AR5A 3S1RL 5C44L 1H7VA 4AHYA 1YV1A 3PWFA 1T9PA 2E2JL 2Z3RB 4JAEA 4C3JL 2Y0SP 4BXXL 1B13A 3S2HL 4XGHA 2JA8L 2BE5D 3ZG6A 2ZIXA 3FKIL 5MF6A 4A3BL 1S30A 1I6HL 5DM61 2ERJA 3PO2L 1YK4A 4BBRL 5IYCL 2E2HL 5IYDL 1JYBA 2L0ZA 4U671 2RFKB 3QVDA 1BQ8A 2AQCA 4BY7L 3LWPB 3CQZL 2EY4E 4XXBB 2M6PA 5JVH1 1LKOA 3J7Z1 3PIP1 2NYDA 1B2OA 4AR4A 1TWFL 4G6BA 2HVYC 2KKDA 5C4XL 3S1QL 4UY81 2XJTA 3S16L 3PL5A 1FHMA 3RYGA 2XJPA 3WWNB 3FDJA 1R0HA 5MFPA 4A3GL 3PIO1 4A93L 4TVMA 1NXEA 5IP7L 2PVEA 3HOVL 3KYVA 5C3EL 5GAGc 3LWRB 1E8JA 2NVQL 1QYBA 1IU6A 3NFPI
chains in the Genus database with same CATH topology
3KYXA 2GMGA 1VZHA 2JI2A 3RZ6A 4RXNA 1T9QA 1OWBA 2A69D 2AYJA 3VPBE 5GADc 1CAAA 2A68D 4AHZA 2M4YA 1RDGA 1SMMA 2A6ED 2O5JD 5GAHc 4AR6A 2JI1A 1ZRPA 2CKAA 2LCQA 1IROA 1SMWA 2ERSA 2JI3A 1LKMA 3A44A 5MLC3 4AI2A 4ZN3B 5MGNA 3KYUA 1T9OA 2MS3A 4AR5A 1LKPA 4AHYA 3NFPI 1H7VA 1RYQA 1YV1A 2M4VA 1T9PA 2VL6A 3KYWA 3PWFA 1NNQA 2Z3RB 4JAEA 6RXNA 1RYTA 4B8CD 1B13A 1FHHA 1QCVA 4XGHA 3B0AB 1C09A 2PSMC 5K2ME 1ODHA 2BE5D 5RXNA 3ZG6A 3MSUA 4AR3A 2ZIXA 1IRNA 2C6BA 5MF6A 1S30A 2Z3QB 5EIOC 1Z92B 2B5ID 1YK5A 5H1Sc 1WJVA 2ERJA 5DM61 1YK4A 2CKCA 1RWDA 1YUZA 1JYBA 4TPUA 2L0ZA 3PKIA 2HR5A 1VZIA 1DVBA 3QQCE 4U671 1LTLA 4YWLA 5JVG1 2C6AA 2PPTA 2QL0A 3QVDA 2XJRA 1BQ8A 4LHLA 1R0FA 1R0IA 3WWLA 4XXBB 1R0JA 2XJQA 1YUXA 2M6PA 4POGA 5JVH1 2XJUA 1LKOA 2J9UB 3J7Z1 3PIP1 2NYDA 5AN9H 1B2OA 4AR4A 4G6BA 4YWMA 4V196 3SS2A 1RB9A 4AHWA 2H12A 4JAGA 1B71A 2KKDA 1S24A 3MPSA 4AHXA 1SMUA 4K9FA 3IU3I 7RXNA 4UY81 4AI0A 3J7Y1 5EINC 2XJTA 5AI3A 1FHMA 1VZGA 4ME3A 4WFN1 1IU5A 1R0GA 2PVXA 3RYGA 1VCXA 4LHNA 3LNLA 8RXNA 5AI2A 3KYYA 3PKJA 2XJPA 4JAFA 4AI1A 3WWNB 1R0HA 1BE7A 5MFPA 4ZN1B 3PIO1 1BRFA 2KN9A 2K2DA 1NXGA 5DM71 3B08B 2M6OA 2V3BB 4TVMA 1BFYA 1NXEA 2RDVA 5MFZA 3LPEB 5GAEc 1RDVA 1B2JA 2XJVA 2PVEA 2V0EA 1IW7D 1OWCA 1S2ZA 4POFA 4GS7D 2CR8A 1CADA 3KYVA 2PYAA 4E6YA 5GAGc 1DX8A 3RZTA 3PZAA 2XJSA 3K35A 1E8JA 4AI3A 1BQ9A 1QYBA 3P2AA 2DSXA 3P8BA 1IU6A 4JADA 2A6HD 2V0FA 5IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYX A;  2GMG A;  3RZ6 A;  4RXN A;  1T9Q A;  1CAA A;  2M4Y A;  1RDG A;  1SMM A;  4AR6 A;  1ZRP A;  2LCQ A;  1IRO A;  1SMW A;  1LKM A;  3A44 A;  3KYU A;  1T9O A;  2MS3 A;  4AR5 A;  1LKP A;  1H7V A;  1YV1 A;  3PWF A;  1T9P A;  2VL6 A;  3KYW A;  1NNQ A;  6RXN A;  1RYT A;  1B13 A;  1FHH A;  1QCV A;  1C09 A;  5RXN A;  4AR3 A;  1IRN A;  1S30 A;  1YK5 A;  1YK4 A;  1RWD A;  1YUZ A;  4TPU A;  1JYB A;  2HR5 A;  1DVB A;  1LTL A;  4YWL A;  2QL0 A;  3QVD A;  1R0F A;  1BQ8 A;  1R0I A;  1R0J A;  1YUX A;  4POG A;  1LKO A;  1B2O A;  4AR4 A;  4YWM A;  3SS2 A;  1RB9 A;  1B71 A;  2KKD A;  1S24 A;  3MPS A;  1SMU A;  4K9F A;  7RXN A;  5AI3 A;  1FHM A;  4ME3 A;  1IU5 A;  1R0G A;  2PVX A;  3RYG A;  1VCX A;  8RXN A;  5AI2 A;  3KYY A;  1R0H A;  1BE7 A;  1BRF A;  2KN9 A;  2K2D A;  1BFY A;  2V3B B;  2RDV A;  1RDV A;  1B2J A;  2PVE A;  4POF A;  1S2Z A;  1CAD A;  3KYV A;  2PYA A;  1DX8 A;  3RZT A;  3PZA A;  1E8J A;  1BQ9 A;  1QYB A;  2DSX A;  1IU6 A;  5IY0 A; 
#chains in the Genus database with same CATH topology
 1PFV A;  2JI2 A;  2AYJ A;  1TWA L;  1R9T L;  2E2I L;  2R92 L;  1SMM A;  1ZRP A;  2VUM L;  2JI3 A;  3A44 A;  5MLC 3;  4AI2 A;  3JR7 A;  1RYQ A;  3KYW A;  1NNQ A;  4QIW P;  1RYT A;  3S15 L;  1P7P A;  1C09 A;  5RXN A;  3GTG L;  2C6B A;  3PO3 L;  3HOZ L;  2B5I D;  3M3Y L;  1PFW A;  3RZD L;  1YK5 A;  1WJV A;  2WB1 P;  1YUZ A;  4C3I L;  4A3E L;  4TPU A;  4C3H L;  2HR5 A;  2QL0 A;  4LHL A;  1PFU A;  2JA7 L;  4A3I L;  1SFO L;  3RZO L;  2NVY L;  5AN9 H;  2AUS B;  3SS2 A;  1K83 L;  4C2M 1;  1SMU A;  4K9F A;  2WAQ P;  3J7Y 1;  5EIN C;  5AI3 A;  4WFN 1;  1VCX A;  4A3L L;  8RXN A;  3H3V M;  5FJ8 L;  4AI1 A;  5C4J L;  3S1M L;  3I4M L;  3GTJ L;  1BRF A;  2KN9 A;  2K2D A;  5DM7 1;  4A3C L;  3B08 B;  2M6O A;  1BFY A;  5MFZ A;  3LPE B;  3GTQ L;  1B2J A;  2V0E A;  1OWC A;  3GTM L;  1I50 L;  2PYA A;  4E6Y A;  1DX8 A;  3K35 A;  3P8B A;  4BY1 L;  4JAD A;  3KYX A;  1OWB A;  5GAD c;  1CAA A;  2B63 L;  2A68 D;  5GAH c;  3HJY B;  2CKA A;  1IRO A;  1LKM A;  3KYU A;  1T9O A;  2MS3 A;  2VL6 A;  2JA6 L;  3I4N L;  1FHH A;  1QCV A;  5K2M E;  4X6A L;  1ODH A;  1Y1W L;  1IRN A;  1I3Q L;  2Z3Q B;  2PMZ P;  5H1S c;  2CKC A;  1RWD A;  3PKI A;  3QQC E;  1DVB A;  1LTL A;  2C6A A;  2PPT A;  2XJR A;  3MQK B;  3WWL A;  1R0J A;  2XJU A;  3H0G L;  4Y7N L;  3S17 L;  4AHW A;  2H12 A;  1S24 A;  4AHX A;  3HOU L;  7RXN A;  3HKZ P;  3LWQ B;  4ME3 A;  1R0G A;  2PVX A;  4LHN A;  3KYY A;  2APO B;  3LWV B;  3H9B A;  3GTL L;  4A3J L;  3HOX L;  2RDV A;  5M5Y L;  1RDV A;  4Y52 L;  4POF A;  3GTK L;  4GS7 D;  1CAD A;  3RZT A;  3S14 L;  4A3K L;  2A6H D;  5IY0 A;  1PFY A;  2GMG A;  1VZH A;  1TWC L;  3HOY L;  2NVT L;  2A6E D;  2O5J D;  4AR6 A;  2JI1 A;  4A3D L;  5M3F L;  1SMW A;  1LKP A;  2M4V A;  1QQT A;  6RXN A;  4B8C D;  1Y1V L;  3B0A B;  2PSM C;  3MSU A;  4AR3 A;  5IYB L;  3GTO L;  1PZX A;  5EIO C;  1Z92 B;  4AYB P;  2R93 L;  1VZI A;  1TWG L;  5IP9 L;  4YWL A;  3H9C A;  5M5X L;  5JVG 1;  1R0F A;  1R0I A;  2XJQ A;  2R7Z L;  1YUX A;  4POG A;  1TWH L;  4A3M L;  3HAX C;  2J9U B;  4YWM A;  4V19 6;  1RB9 A;  4JAG A;  1B71 A;  3MPS A;  3H97 A;  3IU3 I;  4AI0 A;  5M5W L;  1VZG A;  1IU5 A;  3K7A L;  3LNL A;  5AI2 A;  4BBS L;  3PKJ A;  4JAF A;  1BE7 A;  2JA5 L;  4ZN1 B;  1NXG A;  2V3B B;  5M3M L;  5GAE c;  2XJV A;  4A3F L;  3GTP L;  1IW7 D;  1S2Z A;  3HJW B;  2CR8 A;  3PZA A;  2XJS A;  4AI3 A;  1BQ9 A;  3P2A A;  2NVX L;  2DSX A;  3M4O L;  2V0F A;  5FLM L;  3RZ6 A;  4RXN A;  1T9Q A;  2A69 D;  3S2D L;  3LWO B;  3VPB E;  3S1N L;  1WCM L;  4AHZ A;  2M4Y A;  1RDG A;  3H99 A;  2YU9 L;  2LCQ A;  2ERS A;  1F4L A;  3HOW L;  4ZN3 B;  5MGN A;  4AR5 A;  3S1R L;  5C44 L;  1H7V A;  4AHY A;  1YV1 A;  3PWF A;  1T9P A;  2E2J L;  2Z3R B;  4JAE A;  4C3J L;  2Y0S P;  4BXX L;  1B13 A;  3S2H L;  4XGH A;  2JA8 L;  2BE5 D;  3ZG6 A;  2ZIX A;  3FKI L;  5MF6 A;  4A3B L;  1S30 A;  1I6H L;  5DM6 1;  2ERJ A;  3PO2 L;  1YK4 A;  4BBR L;  5IYC L;  2E2H L;  5IYD L;  1JYB A;  2L0Z A;  4U67 1;  2RFK B;  3QVD A;  1BQ8 A;  2AQC A;  4BY7 L;  3LWP B;  3CQZ L;  2EY4 E;  4XXB B;  2M6P A;  5JVH 1;  1LKO A;  3J7Z 1;  3PIP 1;  2NYD A;  1B2O A;  4AR4 A;  1TWF L;  4G6B A;  2HVY C;  2KKD A;  5C4X L;  3S1Q L;  4UY8 1;  2XJT A;  3S16 L;  3PL5 A;  1FHM A;  3RYG A;  2XJP A;  3WWN B;  3FDJ A;  1R0H A;  5MFP A;  4A3G L;  3PIO 1;  4A93 L;  4TVM A;  1NXE A;  5IP7 L;  2PVE A;  3HOV L;  3KYV A;  5C3E L;  5GAG c;  3LWR B;  1E8J A;  2NVQ L;  1QYB A;  1IU6 A;  3NFP I; 
#chains in the Genus database with same CATH homology
 3KYX A;  2GMG A;  1VZH A;  2JI2 A;  3RZ6 A;  4RXN A;  1T9Q A;  1OWB A;  2A69 D;  2AYJ A;  3VPB E;  5GAD c;  1CAA A;  2A68 D;  4AHZ A;  2M4Y A;  1RDG A;  1SMM A;  2A6E D;  2O5J D;  5GAH c;  4AR6 A;  2JI1 A;  1ZRP A;  2CKA A;  2LCQ A;  1IRO A;  1SMW A;  2ERS A;  2JI3 A;  1LKM A;  3A44 A;  5MLC 3;  4AI2 A;  4ZN3 B;  5MGN A;  3KYU A;  1T9O A;  2MS3 A;  4AR5 A;  1LKP A;  4AHY A;  3NFP I;  1H7V A;  1RYQ A;  1YV1 A;  2M4V A;  1T9P A;  2VL6 A;  3KYW A;  3PWF A;  1NNQ A;  2Z3R B;  4JAE A;  6RXN A;  1RYT A;  4B8C D;  1B13 A;  1FHH A;  1QCV A;  4XGH A;  3B0A B;  1C09 A;  2PSM C;  5K2M E;  1ODH A;  2BE5 D;  5RXN A;  3ZG6 A;  3MSU A;  4AR3 A;  2ZIX A;  1IRN A;  2C6B A;  5MF6 A;  1S30 A;  2Z3Q B;  5EIO C;  1Z92 B;  2B5I D;  1YK5 A;  5H1S c;  1WJV A;  2ERJ A;  5DM6 1;  1YK4 A;  2CKC A;  1RWD A;  1YUZ A;  1JYB A;  4TPU A;  2L0Z A;  3PKI A;  2HR5 A;  1VZI A;  1DVB A;  3QQC E;  4U67 1;  1LTL A;  4YWL A;  5JVG 1;  2C6A A;  2PPT A;  2QL0 A;  3QVD A;  2XJR A;  1BQ8 A;  4LHL A;  1R0F A;  1R0I A;  3WWL A;  4XXB B;  1R0J A;  2XJQ A;  1YUX A;  2M6P A;  4POG A;  5JVH 1;  2XJU A;  1LKO A;  2J9U B;  3J7Z 1;  3PIP 1;  2NYD A;  5AN9 H;  1B2O A;  4AR4 A;  4G6B A;  4YWM A;  4V19 6;  3SS2 A;  1RB9 A;  4AHW A;  2H12 A;  4JAG A;  1B71 A;  2KKD A;  1S24 A;  3MPS A;  4AHX A;  1SMU A;  4K9F A;  3IU3 I;  7RXN A;  4UY8 1;  4AI0 A;  3J7Y 1;  5EIN C;  2XJT A;  5AI3 A;  1FHM A;  1VZG A;  4ME3 A;  4WFN 1;  1IU5 A;  1R0G A;  2PVX A;  3RYG A;  1VCX A;  4LHN A;  3LNL A;  8RXN A;  5AI2 A;  3KYY A;  3PKJ A;  2XJP A;  4JAF A;  4AI1 A;  3WWN B;  1R0H A;  1BE7 A;  5MFP A;  4ZN1 B;  3PIO 1;  1BRF A;  2KN9 A;  2K2D A;  1NXG A;  5DM7 1;  3B08 B;  2M6O A;  2V3B B;  4TVM A;  1BFY A;  1NXE A;  2RDV A;  5MFZ A;  3LPE B;  5GAE c;  1RDV A;  1B2J A;  2XJV A;  2PVE A;  2V0E A;  1IW7 D;  1OWC A;  1S2Z A;  4POF A;  4GS7 D;  2CR8 A;  1CAD A;  3KYV A;  2PYA A;  4E6Y A;  5GAG c;  1DX8 A;  3RZT A;  3PZA A;  2XJS A;  3K35 A;  1E8J A;  4AI3 A;  1BQ9 A;  1QYB A;  3P2A A;  2DSX A;  3P8B A;  1IU6 A;  4JAD A;  2A6H D;  2V0F A;  5IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...