5AIRA

Structural analysis of mouse gsk3beta fused with lrp6 peptide.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
353
Chain Sequence
MKVSIGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low-density lipoprotein receptor-related protein 6,Glycogen
publication title Structural Analysis of Mouse Gsk3 Beta Fused with Lrp6 Peptide
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 353
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5airA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5airA01
2FH9A 3F5PA 4FSNA 3W2CA 3OW3A 5F20A 4QMQA 2VWBA 3TKUA 3QQGA 4RC2A 2OXDA 1PJKA 4J96A 5CVHA 1JWHA 2R3KA 2UZNA 2VNWA 3HV3A 2Q0NA 3FV8A 4YJTA 4BCFA 5IISA 5JFWA 2AYPA 3C4WA 2YWPA 4NEUA 2RFNA 2E9UA 4H3QA 4ASEA 2ZM1A 3D4QA 2BUJA 2WU6A 5HBJA 3TNPC 2OZAB 1B6CB 1H0VA 3A8WA 3GBZA 5BUEA 4RQKA 2FYSA 5I9VA 2UVZA 3NYXA 3OEFX 4UV0A 5IA1A 1J1CA 2I1MA 5HIDA 4F7JA 5M44A 4DFBA 1P5EA 3VS2A 3F82A 3ENHA 2EUFB 2R3HA 3EN5A 4DH8A 3N4UA 2WMWA 4H05A 4HPUE 1UNGA 3CXWA 1OL1A 3LFFA 4BHNA 2O5KA 4BDKA 4OTIA 3TXOA 4HVDA 4GS6A 4XHKB 4L8MA 1PXJA 3NPCA 3QWKA 3SG9A 3R7YA 3CY2A 5CU6A 3SD0A 2GCDA 4KBKA 5GZ9A 4ZTRA 2YDJA 4RT7A 3R1YA 4F1TA 3C5IA 2OKRA 5BPYA 1H26A 2B9JA 5IG1A 2PZ5A 4A06A 5FEDA 3K2LA 4BBEA 3P23A 3HGKA 4NU1A 4K6ZA 3PXKA 2E9VA 3QQLA 4S33A 5AUYA 3R8UA 4TYJA 4MQ1A 2XIRA 4WNOA 2ZV2A 3D14A 3W2SA 3AXWA 3NX8A 1KOAA 4AZVA 5C27A 5HTIA 3EZRA 3O51A 3ZXTA 4A9SA 4X2FA 4A9UA 4IDVA 4D4YA 4JIKA 2ETMA 1Q8UA 4RX9A 5JKGA 2VTJA 3GC9A 3CJGA 4EK8A 4CKJA 4IAAA 3QCXA 3BV3A 4BCPA 2VTLA 3SLSA 3IDCA 4H1MA 4IX4A 4FT3A 4FL3A 3IQ7A 2OH0E 3N4VA 4GUBA 5E8UA 4O96A 1ND4A 2JFLA 4EH3A 2UUEA 3NUXA 4I3ZA 2UVXA 1R0PA 3LCSA 4IAFA 3UO6A 3HZTA 2Z7SA 4FGRA 4BBFA 3R28A 3G0EA 4PMTA 2QR7A 3E88A 3PYYA 1GZOA 4UMRA 5HTCA 3PJ2A 1H07A 2PE2A 4FIJA 4X3FC 3BE9A 5A4TA 3EJ1A 4G6NA 2FUMA 4NCTC 2QVSE 5F94A 5IEYA 2XK3A 4FTLA 3UNJA 3G9NA 2VTIA 1XR1A 3PA4A 4X7QA 3UNKA 2W1FA 4X3FA 4ORKA 2AUHA 4BDBA 2AC5A 1KE7A 2VO7A 4R3PA 4TWNA 1YOJA 2R3IA 3Q3BA 4FV0A 3WARA 5M4FA 1PRYA 3K54A 3WI6A 4CT2A 3ZSIA 2PMLX 4X6QC 3W32A 2F2CB 2QLUA 4FT7A 5F4NA 4DEHA 5BVFA 2IJMA 3AG9A 4GKHA 2J50A 3OCTA 2Y0AA 3FMJA 5AA9A 2PULA 3JY9A 5FLFA 1CKJA 3QBNA 5HKMA 1KE8A 4HZSA 4MXXA 4M66A 3L9NA 5I3RA 4RA5A 3R7EA 1PKDA 2W1IA 3POZA 4TY1A 3HRBA 3R7OA 2ITXA 5EKNA 2UZVA 1UNHA 1UU9A 2BILB 3MY1A 1A9UA 3BBWA 4J1RA 1SYKA 3QCQA 5IQCA 3RAWA 1QPJA 2QHMA 3LCDA 4PL5A 4O7YA 4ZEGA 3MFTA 4D2VA 4RWJA 1UVRA 5DBXA 4TYGA 1YXSA 3HMPA 2RG6A 1SVHA 1W82A 4JDIA 1IR3A 3VUKA 3H9RA 4FYNA 4ZTSA 4AA0A 4EKLA 1AD5A 2BFYA 2JIIA 2WQOA 4C2VA 1Q4LA 1YI6A 1GOLA 4QTDA 4D4VA 4YLKA 5HG9A 4ZAUA 2QOLA 2UZBA 3IOKA 4ZMEA 1FPUA 4YJUA 1YKRA 4ZJIA 3LPBA 1R0EA 4EYJA 4EOPA 3KK9A 2P2IA 4C37A 5IQEA 1Y6AA 2Q0BA 3MGYA 3CE3A 4D2RA 4YBKA 1YXUA 4U43A 4AX8A 4C4FA 2IVTA 2PTKA 4TYHB 3ATTA 3S0OA 5DLSA 2W17A 4YJOA 3THBA 5HLPA 3RM6A 4DFNA 2Z7LA 4CTBA 4MH7A 2DQ7X 4FZFB 4I5CA 1OI9A 3FZSA 4B0GA 5D12A 2YCSA 4YUQA 2X7GA 4FNWA 3LMHA 2C30A 3EYGA 1FVVA 3W8QA 4BHZA 5KZIA 3SA0A 3QD3A 3MPAA 4L6QA 1XH6A 3O71A 3EQIA 4KSPA 1NVQA 4UYAA 2QI8A 3MIAA 4X2JA 1G3NA 3MN3A 3DB8A 3FKNA 4O38A 5I9UA 1ZMWA 4EC8A 4RGJA 3BYUA 5KBQA 2GTNA 1YWNA 3FWQA 5CEQA 2OFUA 2WTKC 3V5WA 4OTPA 5CQWA 5BQ0A 2R3JA 3FPMA 3QGWA 4EHVA 3QUEA 4KIQA 3QZFA 2IVVA 3M2WA 5AAGA 5KMNA 3HL7A 4FVRA 4A7CA 3FZPA 4R5YA 4IX5A 3IO7A 3AT2A 3DV3A 3R7VA 3FI4A 4HJOA 4QMPA 4G2FA 1WAKA 1Q41A 3G51A 2JDVA 4I6HA 4RC4A 5IQBA 1DI8A 3R1SA 4QP2A 4C3FA 5HORA 2QOHA 2QG7A 2PVHA 2W4OA 3KN5A 3H9OA 5EQPA 3C5UA 4QMMA 2SRCA 3R71A 4JQ7A 1J7IA 1OB3A 4FR4A 5FBNC 3CPBA 2GHMA 2R2PA 5GZ8A 4XMOA 1QPCA 2WTWA 3OG7A 4L7FA 3RBWA 3CGFA 5GINE 2ZV8A 2YIWA 1ZYJA 4MXZA 4UWYA 3HMIA 3DTCA 3OBJA 2OZOA 3OT8A 3AQVA 5A46A 3FI3A 4P90A 4Y83A 2KULA 2WFYA 1ZMUA 4BKJA 3PIXA 1PMEA 2PZRA 5DNRA 2VTAA 3RCJA 3F3TA 4ZXTA 3EN4A 2WEIA 3ZUVA 3S1HA 1XH9A 3PWYA 4UXQA 1CTPE 3KGAA 4FV1A 3RAKA 3LFBA 3G0FA 5CEMA 3CKWA 3O17A 2B1PA 2BFXA 3MPTA 4C7TA 4U80A 4LGHA 3AC1A 3PSDA 4CLIA 2EVAA 1PKGA 3E7VA 4TWCA 4YHJA 4EKKA 4RG0A 3ZRLA 5KMLA 3KCKA 2IWIA 2BDWA 5A54A 5J9YA 2R3MA 3ODZX 4O0YA 5BX0A 1K9AA 3WF7A 2I0YA 2GQSA 3NNWA 1FVRA 1ATPE 2GHGA 3MTLA 4KIKB 2BRMA 2VN9A 4R3CA 1TQIA 2XK9A 3FEGA 2YCQA 5GJDA 3R04A 4HGSA 3QZGA 3MI9A 4IHPA 4CFFA 2PPQA 2B9HA 3WF6A 4DH3A 5IU2A 4E7WA 2O63A 2R3RA 2YAKA 4FTKA 4OAVB 4L67A 3AC3A 3FMMA 3MB7A 4H58A 4X2GA 4ASZA 4EK5A 3DZQA 4GJ2A 5EYMA 3PDTA 1FINA 1O9UA 2CDZA 2BRHA 4GFGA 4JBOA 4KKHA 4XG6A 5ANDA 3UBDA 4H36A 3JPVA 3H10A 4MYGA 3TCPA 3ZMMA 4WG5A 2ONLA 3WF5A 3VN9A 3PXQA 4YZCA 3VUGA 3BHTA 1KE9A 3AD5A 4GK2A 4IADA 4WOVA 5ANOA 2QODA 1OPJA 4DLIA 4XBUA 5K9IA 3ZTXA 4MK0A 2BHEA 2IZSA 4BDCA 3LKMA 2C5XA 3PJ1A 4XOYA 1GIHA 4EQUA 3A8XA 2YM5A 4KS8A 5IMXA 3ULZA 3ORXA 3UOLA 3EFLA 4EOJA 4GFOA 2P33A 2C3IB 5CALA 4OTWA 5AP0A 5CT7A 4P5QA 1UNLA 3C7QA 3R7IA 4DYMA 4C33A 4GYGA 1JAMA 5EI2A 3G33A 4UMTA 2B52A 4FSMA 2BIKB 2YN8A 4FZAB 4QTBA 4F64A 2QONA 3PIZA 5HBHA 4TW9A 2X1NA 4YJRA 2VTMA 1TKIA 2JKKA 4PDSA 4P7EA 2PZYA 4AS0A 2HZNA 2BRBA 4J99A 5HCZA 3IDPA 3DJ6A 4PL3A 5AUVA 5JRSA 3SRVA 3EOCA 3FLYA 3NUAA 2HY81 3IK3A 3NNXA 1CDKA 3MESA 5I9WA 2JDOA 4QMSA 3HV5A 4ARKA 2VX3A 4BGQA 2WB8A 4D4SA 3ZUUA 4HCVA 4O21A 3RNYA 3VQUA 4I5PA 2W4KA 4IWDA 2I40A 4YTFA 2JBPA 3TNWA 2F2UA 1OITA 4GH2A 2R3QA 4YHTA 4O7RA 3OEZA 2OIBA 4MKCA 5D9HA 4ZTQA 1OM1A 3VF9A 3HEGA 4BCJA 3SGCA 3NZ0A 4RIXB 5IEVA 5E8TA 3W10A 3Q53A 5L6PA 4AWIA 5KBRA 4F6SA 2BRNA 4WBBB 4YZ9A 3ZDIA 5IMEA 2OF2A 3FKLA 2CNUA 2PVRA 1LEWA 5C4KA 2QQ7A 4O0VA 5AR7A 5G6VA 3D7TA 4U44A 2PMOX 3UQGA 1VEBA 2GNGA 2C69A 4IVDA 2VTHA 2YDIA 3PP1A 5I9XA 2WMXA 3BV2A 4QMLA 2C0IA 3W16A 4QYHA 4U9AA 3LXKA 4XLVA 1MUOA 3L8PA 4R77A 1J3HA 1XH7A 4H39A 4M14A 4RWIA 4L52A 2PVMA 4MTAA 1JOWB 4MBLA 4BTMA 2ZJWA 3UZTA 3C4EA 3B2WA 5HIEA 4LL5A 5CSVA 2G01A 5FUTA 4JG6A 4WNKA 2HZ0A 1U46A 2IZTA 1KV2A 1OIRA 1OPLA 4L7SA 4F1OA 5LCJA 2G2IA 4TN6A 2C68A 4MXOA 3RALA 1QCFA 4FUYA 2H6DA 4TNBA 4V0GA 4GL9A 3P0MA 1Q3WA 2CHLA 1ZLTA 3GC8A 3KCFA 2NP8A 2W1HA 3H0ZA 4NFMA 4L46A 4MXCA 4XV2A 4G3GA 3SXFA 2J6MA 3MH2A 4JG7A 4ZTHA 5AV2A 5D1JA 5LVLA 2JIVA 4IMYA 3C13A 3G6GA 5BVOA 5CASA 3CY3A 1YI4A 4JAIA 5AR8A 2OIQA 5CF8A 3VVHA 3BLHA 3OUNB 5LWNA 3FLZA 3OXTA 4HYUA 4XYFA 3VHKA 4CSVA 4EQMA 4YSJA 5HIBA 4EHZA 3GFEA 3LAUA 4PDPA 3RPOA 5ICPA 5K5NA 4YP8A 4A9YA 2O64A 4GYIA 4E5AX 2R3FA 2X8IA 2Z60A 1OGUA 3DJ5A 5HQ0A 3OP5A 3WOWA 2XNNA 5DH3A 4ZY5A 3KC3A 5CAQA 3C51A 4ZOGA 3PPKA 2J51A 3OWLA 3VS3A 4ZSAA 2JLDA 1IEPA 3MWUA 3V04A 4A07A 4FV5A 4BN1A 3E3PA 3ATSA 2WMUA 5E1SA 5E8VA 3W2QA 4ZLOA 1XH8A 1J1BA 2QO7A 4XS2A 5FGKA 1OKZA 4QTCA 4Q9ZA 2VWYA 3FZTA 3PSCA 3EQCA 4I0SA 1MRVA 2QHNA 3E62A 4TYEA 4IH8A 3DAKA 5LOHA 3OOGA 5E9EA 4ZZOA 3C0GA 2JAMA 4XOZA 3VBYA 2UZWE 4PP7A 3N51A 4BBMA 5M56A 2R7BA 3O8UA 4ASDA 1M2PA 2XF0A 2GS2A 2UW6A 5HO8A 1OBDA 2QOKA 1H1QA 2WELA 5EKOA 4E1ZA 3QC4A 4E5WA 4N6ZA 5HD7A 4YZDA 4DEEA 3R7UA 3FY2A 5DT3A 4J98A 3IONA 2ITPA 4S31A 3HV6A 3Q9YA 2CGVA 5LWMA 4M69B 1U5RA 3CC6A 3ZEWA 3TTJA 4YTCA 3QU0A 1UKHA 4PDOA 4IE9A 1UU8A 5AV4A 1WBPA 4A4XA 5A3XA 1F3MC 2WU7A 3FUPA 2IZRA 4KS7A 4K0YA 5EFQA 5BMSA 3RVGA 5H3QA 1UWJA 1WBNA 2A4LA 2IO6A 3VUMA 1RW8A 4F0IA 4UB7A 3BYMA 2Y4PA 2QO2A 4UMQA 3VF8A 5K4IA 4M67A 3P86A 4I4FA 3F61A 4XJ0A 5DR9A 2OJFE 4E3CA 5A4CA 5I9YA 1ZARA 1UU3A 3JS2A 2BPMA 1YHVA 4O83A 3VUDA 3EL8A 4E5BA 3NUPA 4M0YA 4FTJA 3BYSA 5E7RA 3C9WA 4FV6A 1YXXA 5DVRA 1M14A 4O2PA 5KCVA 4FI1A 3IGGA 5F1ZA 2VO0A 4RIWA 4AQCA 1IA9A 1V0OA 5CYIA 2YWVA 5LVNA 4BDHA 4Y73A 5CEKA 3COMA 2R3PA 2XMYA 4NSTA 2UZEA 3EQBA 4JBVA 5AP1A 4DLJA 2DS1A 4K18A 4XRJA 3QRUA 3BQRA 4XBRA 1LR4A 1XBAA 5EYCA 4NIFB 2HXLA 3COHA 5LMKC 2V62A 4PL4A 4USFA 4EUUA 3JYAA 3LQ5A 4IVBA 5EHYA 1YDTE 4BYIA 3IW4A 2YAAA 3PTGA 3HECA 2FSTX 4AA4A 3PFQA 4D9UA 5M4CA 3T9IA 2H96A 3LFQA 5KMIA 5LMKA 4R1YA 3TUCA 3HNGA 4HYSA 4I5MA 4U3YA 3ACKA 2XJ1A 3M11A 4TTHB 3KN6A 3T8OA 2WPAA 5L8KA 3CQWA 3BRBA 3Q2JA 3QYWA 1Y8GA 4AW5A 4G1WA 4FF8A 2XIYA 4IB3A 3PPZA 5CANA 5M4UA 4PNIA 3A61A 2AC3A 4YPDA 3W2RA 3LMGA 4U7ZA 3VS7A 3TM0A 2VTSA 1OKYA 3KMMA 4LUDA 3HDMA 3PA3A 4YNEA 3M42A 5DGZA 5HCXA 4BCKA 4I1ZA 3HDNA 1PXKA 4USDA 2LAVA 1U54A 4OTFA 3TV4A 4ENXA 2PWLA 2QOIA 4EOIA 2PMIA 5L2QA 2B53A 4GUEA 4XG8A 2J0JA 3UMWA 5L4QA 3RK5A 3MY0A 2GQRA 3B8RA 3D15A 4CFXA 3L9PA 4RVTA 5AUZA 3QQHA 4DGGA 1Y6BA 4IX3A 5CEIA 1OKWA 4Y5HA 5FBOA 2BCJA 4C58A 1UU7A 2YEXA 4LG4A 3TL8A 3W33A 4B7TA 3O8PA 5ANJA 4DEGA 1JSUA 4MF1A 5AP2A 3TACA 5HE3A 5KKRB 4HYHA 1PXOA 4RJ4A 2F9GA 5AP4A 2J0KA 4S32A 3F5GA 3VS5A 2JKOA 2ZB0A 1YOLA 3MBLA 2C3LA 1SVEA 3U8WA 4DG2E 4DBXA 4EJ7A 3PRFA 3DBFA 4OAUC 3CSVA 3R02A 3E93A 4CFNA 4DITA 3ZOSA 4FTUA 4U0IA 1Q5KA 3F3UA 3QKMA 1DM2A 2YFXA 2VWUA 2X81A 3C1XA 4JI9A 4U6RA 3VBWA 5CAPA 3FMHA 3A7GA 3O2MA 3ZU7A 2R4BA 4ZY6A 2VZ6A 2ZAZA 4PF4A 5HO6A 1H28A 3P79A 4YC3A 4KB8A 3VAPA 2FVDA 5EOLA 1JKKA 4ITIA 3UGCA 3JR1A 3W8LA 3OOMA 4DGMA 3MA3A 2CLQA 4WRSA 1L8TA 3NR9A 5KZ0A 5FEEA 5HG7A 2CKEA 3GFWA 4JXFA 2W7XA 4OTHA 4CT1A 4XV9A 4F7LA 1IA8A 4Y72A 4BVUA 4ZIMA 4ZMFA 4O82A 3IECA 2CJMA 5E92A 4MVFA 5FD2A 3DBEA 3KMUA 4ZZNA 5HE0A 2A19B 1OKVA 3B8QA 3NNVA 5A4QA 2Y4IB 3HMMA 2CMWA 3COIA 3L1SA 4R8QA 4U42A 3UPXA 3FQHA 4YR8A 3PE2A 5H2UA 4KUJA 3TZ8A 2F7XE 5AM6A 2QKWB 3FZRA 3RHKA 3ZO4A 4DT8A 4N6YA 2IVSA 3QA0A 5JGDA 2P55A 4RWLA 4F9WA 3VQHA 3EQRA 4RLLA 2VTOA 3LJ0A 3UQFA 4C4HA 3Q4TA 1ERKA 2WOTA 1TVOA 3R83A 3WF9A 3EYHA 4FTCA 4EHGA 4G17A 1HCKA 2EXEA 4EOSA 4KBCA 2ITZA 3CLYA 5H9BA 3DNDA 4DEAA 1BI7A 3DJ7A 4IVAA 4O22A 4YJPA 4CCBA 3OW4A 3QZIA 2PVLA 1T46A 2XEYA 4NM5A 5DR6A 3OCSA 4XNEA 2Y9QA 3ET7A 3VUIA 4D2TA 2QLQA 3DAJA 3F69A 3FQSA 3REPA 4EOMA 4LRJA 3DFAA 4WG3A 3QHWA 3BEGA 2X8EA 5IPJA 5K0KA 3LW0A 3VBTA 3VJOA 1H1SA 4FV7A 3RAIA 2HY0A 4IZAA 3R22A 4LRMA 5CSXA 4EOLA 1ZWSA 4EUTA 4OT5A 4QMTA 3BZ3A 5KE0A 4CMUA 3QA8A 1Q8ZA 3Q9ZA 5J8IA 2B54A 4JT3A 2BDJA 5DN3A 1Q61A 4E20A 5C8NA 2BRGA 3GOKA 3KMWA 2XNOA 3DKFA 4FT9A 3TZMA 1BLXA 1JLUE 4HVHA 2JBOA 4AT3A 5JGAA 5DE2A 1ZOHA 1FQ1B 3D5UA 2H8HA 3LMIA 2OSCA 2VX0A 3KVWA 3MJ1A 2BKKA 1JSVA 4D1SA 3O50A 1JKSA 2RGPA 3F3VA 5GHVA 4PTCA 3IG7A 5GNKA 5HU3A 4RJ6A 2VV9A 3LXLA 4NFNA 3F2RA 4TRLA 3BQCA 2P3GX 2GU8A 2XNEA 4FOBA 3TV7A 2YHVA 5CF6A 4O6LA 5IQGA 2R3OA 3F5XA 1VYZA 4ALWA 3R2YA 3SDJA 2WOUA 5FTOA 2XK7A 2DYLA 2FB8A 2GMXA 3SOCA 1WFCA 2UZOA 5J95A 1P4OA 2YA9A 3I4BA 3RP9A 1KUTA 3QQKA 3LFCA 3TN8A 4DG0E 3JXWA 4E26A 5AR4A 2WMAA 1BMKA 4KNBA 2IW6A 3VRYA 4IBMA 3W55A 3KXMA 4CQEA 4BTJA 4DHFA 3KQ7A 2I7QA 1H00A 2V5QA 4WSYA 5AX3A 4BIDA 1W8CA 4KABA 4FEXA 2H34A 4BC6A 2UZDA 5CU4A 3KXXA 4I22A 4F9AA 5JFVA 1BX6A 4W4VA 4RZVA 3ZBFA 3AGLA 4FKJA 4FA2A 3MPMA 1V1KA 5M57A 3CGOA 5CI6A 1F5QA 3DY7A 2C5VA 2CLXA 2ITUA 5KUPA 2ITOA 3R21A 4LFIA 4WUNA 1B39A 4FTMA 4ANBA 3G90X 4ZZMA 4D5HA 3EFWA 4LUEA 4OGRA 3UVQA 4EONA 4QQTA 2GNLA 3ZBXA 3OXIA 4ZSGA 4FV3A 2C1BA 2JGZA 4NCTA 4NUSA 5CZIA 3BBTB 4JX7A 5J7HA 3KK8A 3PP0A 5ITAA 1H01A 4GT4A 1A06A 2CN5A 5EM7A 3GB2A 4FBXA 3WYXA 1P2AA 3FBVA 1U59A 4F6UA 3NSZA 3IPHA 4RPVA 4ANQA 2F57A 4F6WA 1S9IA 2WHBA 4AW2A 1J7UA 5C01A 3VW8A 3RMFA 3KULA 2XEZA 3ZM4A 3FLQA 3IW8A 3P78A 4J53A 5DHJA 4D28A 4Q9SA 5EI8A 4EYMA 4QO9A 3ZFYA 4QYYA 3LLTA 2BHHA 5ETFA 2I0HA 4NKAA 1B38A 3QL8A 1MQ4A 4G3FA 4CTCA 4OBPA 3EWHA 4A4LA 4HVIA 3UPZA 2C0TA 3SG8A 5M4IA 1PF8A 2PHKA 5IF1A 3L8SA 4AF3A 3TTIA 3PLAE 4J8MA 5HNBA 3UO4A 2WD1A 5HVKA 4NZWB 2HCKA 4FT0A 5JH6A 1NY3A 3AMAA 2G15A 4M0ZA 3DU8A 3LJ1A 4EH8A 2I0VA 3HV4A 2UW8A 3OCGA 4CFUA 3POOA 3SW7A 3SKCA 5B2KA 2PU8A 4R1VA 3G5DA 1PXMA 3T3VA 4HNFA 3V51A 1CM8A 3OBGA 3ZO3A 4C0TA 3RM7A 4PTGA 5L8JA 2OO8X 3NIZA 4GK3A 5AWMA 4F08A 4O86A 2GHLA 4PV0A 3LFDA 4F65A 4IJPA 3NYNA 3QQJA 3IKAA 4BI0A 1G5SA 2HW6A 3ALNA 3CCNA 3HV7A 4DINA 1M2RA 3F2NA 4LV8A 2WGJA 3W2PA 4EH9A 4BDDA 1XHAA 1REJA 4O91A 4JAJA 3RCDA 4C4IA 1RDQE 3FHIA 1TQMA 3A60A 4OBOA 4L9IA 4Y46A 3WZUA 3LFNA 2XNMA 3BHYA 2QURA 5ANIA 1YI3A 5GZAA 4AAAA 5FQDC 5K0XA 3MVMA 3DT1A 1OL7A 3NS9A 4FKRA 5AAFA 3V5QA 4F1MA 2PZPA 4EHEA 4NWMA 4GFMA 2WTCA 3WZDA 4YU2A 1QMZA 3UNZA 4D55A 2W0JA 5IUIA 2HELA 4JS8A 3GC0A 5KMMA 4BB4A 1STCE 4FL2A 4IM2A 4CVAA 4L42A 3PIYA 3U87A 4ZY4A 2J0IA 3FMDA 5GJGA 3QRIA 1W83A 1QL6A 4K77A 2X9EA 4YO4A 4PPBA 3HRFA 1WMKA 3TNQB 2C6OA 3CJFA 2JKQA 1ZOGA 4RQVA 3PXYA 1WVWA 4O6EA 4O0RA 5JGBA 3ALOA 4F99A 2YACA 3G6HA 2IPXA 1XKKA 3MH0A 4AZWA 3DDQA 1XBBA 3Q96A 4D0WA 4DH5A 3LCKA 4EC9A 2HAKA 1P14A 4C57A 4FKVA 5AADA 3HUBA 3LLAA 3JUHA 4FSTA 4XV3A 2XK4A 2C6IA 4HGTA 4BL1A 3GI3A 3KU2A 3I5ZA 3W18A 3NEWA 5CQUA 4AUAA 2JDRA 3Q04A 2YIRA 4O1PA 3ZH8A 2YIYA 4YJSA 3ELJA 4EH4A 2GFCA 2PZIA 3UOKA 5IH6A 3GU8A 3PVBA 3VS0A 2PY3A 4G5JA 5HD4A 5CTPA 2B55A 4YSMA 4M15A 4IFCA 4WHZA 1YWRA 1PMVA 3C50A 4FT5A 4JJRA 2XKFA 1NVRA 5CI7A 4YJNA 2XKDA 5EG3A 5HNIX 4LL0A 2G1TA 1AGWA 4ACDA 2IW9A 1GZNA 3HMNA 4FK3A 4NK9A 3PA5A 3VBVA 3E3BX 1OPKA 3F7ZA 1WBTA 4LOQA 4L01A 4B99A 3UYTA 4FNYA 2BVAA 3KRJA 5EM8A 3UMXA 4DFLA 4IAIA 2A0CX 3BHHA 3R9OA 2W1DA 3R9HA 4FYOA 2XNBA 3H0YA 3QX4A 4BDEA 4J97A 4M13A 4O0XA 4FOCA 4Y95A 2Z7RA 4NTSA 3VBQA 3PJCA 1FMOE 5ACKA 2C6KA 5HX8A 5LVOA 1GAGA 3GXLA 3ETAA 3TV6A 4IM0A 5CXHA 2UW9A 5FM2A 5H8EA 3UC4A 3FL5A 2XYNA 3D5XA 4MEDA 4CRLA 2CPKE 1JVPP 4JX3A 4D0XA 3FI8A 4JR7A 3EH9A 5KHWA 5FP6A 2O0UA 4BICA 3OF0A 4ALUA 3R1QA 4C4JA 3FXZA 4FTOA 3FYJX 3AMBA 4FV4A 5TE0A 4Z16A 4B8MA 3C4ZA 2B0QA 4FKTA 2O3PA 3PZHA 4KSQA 3TJDA 5TO8A 4W9WA 4E8AA 4CZTA 2JFMA 2ZV9A 5AIKA 4FE2A 3MFUA 4X3FB 4FODA 4ZLYA 3OFMA 4BWKA 4DA5A 3OCBA 3VUTA 4NYEA 1M7NA 3G15A 2VAGA 2EU9A 4M7IA 4R5SA 5FTQA 3PPJA 3QTRA 3R8LA 3DZOA 4V04A 2ITQA 3BGPA 4QMWA 5EH0A 2XVDA 4TKSA 3ZHPC 3Q52A 4X2NA 5I4NA 1XH5A 4J71A 1YQJA 3ZC6A 1M2QA 1VR2A 2RFEA 3VRZA 3AD6A 3EMGA 1WBWA 3D9VA 4O27B 4Z7GA 2VO3A 2XH5A 3K3JA 3V5PA 4UEUA 4CCUA 3L9LA 4ZK5A 4AN2A 3A62A 5HVJA 5CENA 1Z57A 4RMZA 3F6XA 5C9CA 4MWIA 4FVPA 4FSWA 4P5ZA 5EHOA 5B0XA 3A7FA 4GK4A 5IA0A 5ETCA 3O0GA 4RIYA 4QMZA 5D10A 2VWXA 3R1NA 4GU9A 3UYSA 4RLKA 5CVGA 5IA3A 3MW1A 2WTVA 3I81A 3K5VA 1KSWA 4G3DA 4I4EA 4I6FA 2OFVA 4IANA 4QOXA 3RK9A 3TIYA 4QQJA 3V6SA 3NW6A 3KB7A 3FLSA 4RWKA 5K3YA 4O0UA 5FTGA 1JNKA 2R3GA 5KMOA 3Q2MA 1GZ8A 3ACJA 2QCSA 2VTRA 4LRKA 4U97A 3ZYAA 5HZNA 4XV1A 3UJGA 4JDHA 5HU9A 2X4FA 3IGOA 3W2OA 5IH5A 3QUPA 3LZBA 4XG9A 3ZCLA 4OTGA 4DH1A 1XBCA 3D2KA 5AUUA 2X6EA 4G5PA 4W9XA 2A27A 4BDFA 4IXPA 3DFCB 4FNZA 4EI4A 4E4LA 2NNWB 3RPSA 4YHFA 4Y8DA 2YJSA 4UBAA 1XWSA 3Q9WA 4BGHA 4F4PA 4NJDA 5DRDA 3U51A 3C4XA 3D94A 1URWA 3NIEA 3R8ZA 3VULA 3R9RA 3CEKA 4RBLA 3RHXA 4FNXA 2B9IA 4GG5A 5LARA 5BMMA 1Y91A 3OROA 2ZB1A 4MXYA 2CNQA 2DWBA 3DKOA 4M84A 2ZDTA 3OHTA 2HW7A 2XBAA 3D83A 3F9NA 3ZLWA 3DXPA 3GEQA 1YW2A 2VTNA 4AE9A 4R7IA 4QYEA 5AR3A 5CT0A 1G8SA 4EOQA 2W4JA 3CTHA 3FJQE 4FK6A 4AN9A 4AZEA 4AE6A 5L6OA 4YJQA 4LMUA 5DT4A 2JDSA 1ZZLA 4FMQA 4Y5QA 4I21A 3RK7A 4GT3A 3D0EA 4M97A 3QCYA 2WTKB 4HVGA 4G9CA 3FSFA 4RVKA 4UWBA 4CRSA 3OWKA 4IAKA 1WCCA 5ANGA 4JBPA 4X6RA 3FQEA 3SV0A 5G1XA 4LOOA 4MF0A 3F5UA 5KKRC 1H1WA 2BMCA 4GV1A 3RNIA 3UVRA 2C5OA 1CKIA 2CNVA 4WUAA 2JIUA 4O7SA 1JBPE 3ZM9A 3MDYA 3GCSA 3UQCA 5DG5A 2W5BA 1PYEA 3KRWA 3DDPA 3LFAA 4JRNA 3P1AA 1R3CA 3GUBA 2R3NA 3OD6X 4QMNA 1H0WA 1ZAOA 2BTRA 4ZTNA 2OIDA 2O8YA 2CKQA 3ODYX 4FC0A 2PVNA 2YM3A 3DLZA 5EW8A 2F4JA 5JN2A 4E4XA 2JEDA 4Z7HA 4QMXA 3HAMA 5I9ZA 3LXNA 4QP1A 2UZTA 3TDVA 2WAJA 4AG8A 3Q32A 2YDKA 4FTNA 4K11A 4CQGA 4OBQA 3T3UA 4CXAA 2VWWA 4CG8A 2XCHA 3KXZA 4BZNA 5DIAA 4YLLA 5ETAA 3CR0A 1UA2A 5EDQA 2Z02A 3Q4UA 4F7SA 4I6QA 5FWKK 3GC7A 1E9HA 2JDTA 2WXVA 4WNMA 1PXNA 5C26A 3MA6A 2OJIA 1JQHA 3UG1A 1PMUA 3QXOA 1U4DA 2PSQA 3TNIA 5J9ZA 2WMTA 2GNIA 3EB0A 3FKOA 5BVKA 4DG3E 1FGKA 4W4YA 5LCKA 4E4NA 4UZHA 3EN7A 3WZEA 4G3EA 4FEQA 2BKZA 2C0OA 2XZSA 1O6YA 1R78A 3MVJA 3NUYA 4APPA 1ZY4A 3P4KA 1DAWA 2QC6A 3MFRA 3Q5IA 5DFPA 4A9RA 3PWDA 4EK3A 1SNXA 2VNYA 3QALE 4O0SA 3RPRA 3CS9A 3LVPA 4O0WA 4FTIA 3DAEA 4IB5A 3ZLXA 5J1WA 2OJGA 2YM8A 4EH2A 3BLQA 2W1CA 4YC6A 5BUIA 4FIHA 4W4XA 4Z3VA 3SXSA 2OJJA 2PK9A 4UMUA 3RGFA 4GSBA 4H1JA 2VGPA 4AP7A 3GU7A 3QLGA 2XRWA 1NVSA 3HAVA 3FC1X 2Y6OA 4IX6A 4MNEA 4DC2A 2ZM4A 5IDNA 2R3LA 5EOBA 3RWQA 3ZRMA 2ESMA 3P7BA 2VD5A 3DB6A 3ORNA 2O2UA 2XA4A 2XB7A 3PRIA 5LJJA 5IQHA 4JBQA 1GNGA 1T45A 4OT6A 3QD0A 2IVUA 4I24A 4WIHA 3Q5ZA 4DFUA 3MV5A 4N0SA 2OZAA 4RC3A 5IQAA 4CG9A 2DUVA 4BI1A 1CSNA 2OI4X 4NM3A 4Z55A 2VO6A 2RFSA 3OT3A 5CAVA 5CVFA 5M08A 2OXYA 4JRVA 5AV0A 1M7QA 3SXRA 3EFJA 2OJ9A 2ZM3A 3Q60A 2QG5A 4FSQA 4ERKA 4CYIA 4MBIA 4RJ7A 3WE8A 3KRLA 1ZYDA 3ZRKA 3FC2A 2ITVA 3VW6A 4FIGA 4GEOA 4ERWA 5AR2A 2W5HA 3OWPA 2WMBA 3QUDA 4F9BA 3UC3A 3M1SA 5JSMA 3FYKX 3MFSA 1H08A 3LOKA 4C36A 3PXRA 4PDYA 2E2BA 3CBLA 3TZ9A 5FXSA 1YDSE 1J91A 2QU5A 3SRVB 1OIYA 3PUPA 3QTQA 3AC5A 3VJNA 4L53A 5IKWA 2OWBA 2OG8A 4ONAA 2PUPA 3RZFA 1OL2A 3NWWA 4U3ZA 3EZVA 4YJVA 5LMBA 4K2RA 1SM2A 2PVFA 5AIRA 4C62A 3MYGA 1WBVA 1W0XC 4K1BA 5EM5A 4QNAA 4H3BA 4AT4A 5FM3A 3SW4A 4O7NA 3ZFMA 3NGAA 2OXXA 5FDXA 3BELA 2I0EA 1FBNA 3ZFXA 3CQEA 4DF3A 5CF4A 4ASXA 4EBWA 4KKEA 5IEXA 4RVLA 1OL6A 2X4ZA 4MBJA 4QP7A 5J9LA 3DLSA 5BNJA 4USEA 3U54A 3LHJA 3QC9A 3NNUA 4MAOA 2VTQA 2GSFA 2QOBA 1Q24A 4L44A 1VYWA 2ACXA 5C1QB 2ERZE 3V8TA 2BZKB 3N9XA 3AT3A 3D7TB 4R7BA 4RVMA 3EHAA 3EL7A 2BAQA 4PMSA 4CZUA 4RSSA 3MB6A 4Q2AA 5HLNA 1IAHA 3KRRA 1YHWA 2UV2A 3FZ1A 4AU8A 3UP7A 4EZ5A 2B7AA 3KXHA 4MX9A 5TT7A 4QNYA 4WO5A 5CWZA 4DT9A 2XNPA 4BCQA 3LIJA 4TL0A 4LM5A 4XEYA 2OLCA 1KOBA 3UP2A 3F88A 3DXNA 3QTIA 1ZXEA 2HIWA 4QP8A 4EOKA 2UVYA 2R9SA 2ZMCA 4UZDA 4PQNA 5HE1A 5L2IA 3VNTA 3OY1A 3FXWA 4FL1A 4BF2A 3V8SA 4EZ7A 4ZLZA 2UW0A 4V0GB 2W1ZA 2ITTA 5HBEA 5AA8A 4MD8E 4J8NA 1K2PA 5AP6A 4XP2A 3AC8A 3HP2A 3DBDA 3IDBA 4CMOA 2Y7JA 2PUNA 3FZOA 4YNOA 2J9MA 4O2ZA 3F7WA 4YBJA 3E63A 5FG8A 4UMPA 3ZDUA 3EQGA 3VC4A 3HMOA 3LCOA 2WMQA 1I09A 4AZTA 4BFMA 3I1AA 2WQMA 5DYJA 4JQ8A 3WZJA 2CGUA 3R00A 3QZHA 4RJ5A 5LXMA 3QCSA 4FG8A 1YDRE 4FV8A 2ZYBA 2RKUA 4BCOA 5AUTA 1XH4A 5CSPA 2W5AA 4YGAA 3G9LX 4EQCA 2C3JA 2YZAA 3TEIA 2QOOA 4D2PA 4JDKA 3GP0A 2CCIA 2WNTA 3BU3A 2OF4A 4DFYA 5EYKA 4AT5A 4JOAA 4C3PA 3D2IA 3QWJA 3QLFA 5DOSA 3DGKA 4P4CA 5C8KA 3KFAA 4MNFA 5JZNA 5A4LA 4QYFA 4TYHA 2FA2A 4IWOA 4PPCA 1Y8YA 3FMLA 4KRDA 5C8MA 3RAHA 4QYGA 1GZKA 2VGOA 5CY3A 4IWPA 3ORMA 2OW3A 1GIIA 3I5NA 4QP3A 4ANMA 2WEVA 3WE4A 3F3ZA 3GCVA 4ITJA 3ZONA 1ZMVA 4IW0A 1KWPA 4PWNA 4FSRA 3H3CA 4UWCA 3EQHA 4FTAA 2XCKA 4EK6A 4X0MA 2YZLA 4E6DA 4QTEA 4HNIA 5IUGA 3I79A 1PYXA 4FZ7A 3QTZA 4Y85A 3O8TA 3PY1A 1ZY5A 3FDNA 2NPQA 5B2LA 4GJ3A 4X2KA 5KO1A 5T3QA 4Z9LA 2C6MA 3GVUA 2HXQA 3GU4A 4I6BA 4K9YA 4R7HA 4KINA 2XBJA 3BU5A 5M09A 4EOOA 3DK7A 1MRYA 3PJ8A 4U41A 1YOMA 5HEZA 4B9DA 2E9OA 4H3PA 2ZMDA 2QOCA 3HVCA 4L3PA 5DI1A 5A6NA 3QKLA 5CEPA 3QHRA 4ZSJA 1RQQA 4CMTA 1JPAA 3TDWA 2IG7A 3ULIA 1A48A 5BYLA 2C4GA 2C6LA 2P0CA 2Z8CA 4BTKA 3L9MA 4CKIA 1I44A 3QD4A 2BALA 4M68A 3TZ7A 4RIWB 4GG7A 3NUNA 4Q5EA 4YLJA 3PSBA 3ZZWA 2HWPA 5LMAA 2B9FA 2ERKA 2ETKA 3BGZA 4BDJA 4I0RA 4I93A 2A1AB 3GOPA 3F2AA 4S34A 3LFSA 1M17A 5TOZA 2HZIA 3D7ZA 4EEVA 1KV1A 3SHEA 5I0BA 2UW7A 4N57A 3KF7A 2Z7QA 5DA3A 4BYJA 2QO9A 1LP4A 4OTQA 2LGCA 3OTUA 3QTWA 4QRCA 5HX6A 4FV9A 2QR8A 3CPCA 3I6WA 5BVEA 2XM8A 5HOAA 3AC4A 3DK6A 5J5SA 3DQXA 4MQ2A 1NW1A 5B2MA 4E6CA 1H4LA 1H24A 4RIOA 4O7TA 1Q62A 3BYVA 4B6LA 4TNDA 5AX9A 2PUUA 2WTJA 3MVHA 1MP8A 2PE1A 2JD5A 2UW3A 3BU6A 4KIKA 4PUZA 3RI1A 3UZRA 5E90A 1U54B 4FZDB 1UKIA 3D5VA 4IWQA 1P4FA 2FGIA 3ITZA 2X2LA 4GIIA 1URCA 4MD9E 4ZJVA 3HA6A 4JG8A 3BHVA 3MJ2A 4M3QA 2X6DA 4MWHA 3R0TA 4DTBA 2X9FA 2PVJA 1G8AA 2X7FA 4YO6A 4G6OA 3ZS5A 3VS1A 5D11A 3SVVA 3UIUA 5EYDA 4G31A 4TWPA 4BKYA 4XG4A 3Q9XA 1UWHA 1Z9XA 2BAJA 5AP5A 5AAEA 1H8FA 2XP2A 3PJ3A 4BCNA 2PMNX 2Z2WA 3ORLA 1YHSA 3RINA 3SAYA 4D9TA 4BTFA 1E1XA 5J1VA 3F66A 2W9ZB 2BZIB 3OY3A 4QQCA 4UN0C 5D41A 3GNIB 4AW1A 3CQUA 3PG1A 3R6XA 4FG9A 4HCTA 3S3IA 5IQIA 1BI8A 4N4SA 4WRGA 4LI5A 4FKWA 5I3OA 2VTPA 5E8YA 1PXLA 4FKGA 3R9DA 1VJYA 1GJOA 4DTAA 4RFMA 4BWPA 3RZBA 3R30A 4JDJA 5IH4A 4R78A 3ZC5A 4ITHA 2J4ZA 2BZJA 2OU7A 1HCLA 3QXPA 4AZFA 4GU6A 2RG5A 3PZEA 2W9FB 3E64A 3O7LD 3EIDA 5M55A 4EH6A 5HCYA 4J52A 3O7LB 3E8EA 4RJ3A 3IW5A 4QPAA 3PY0A 4D1ZA 1YVJA 3NCZA 4IEBA 3UE4A 3HA8A 4AOJA 2XK6A 1QPDA 4G6LA 4F0FA 3BEAA 5HG8A 1Q8TA 1ZYLA 4MD7E 4QP4A 4TT7A 4BIBA 4R6VA 4FTTA 4FKLA 4F9YA 3BIZA 4DBNA 4DGLC 3IOPA 4QQ5A 5TR6A 5M51A 4WG4A 5C03A 1BL7A 5HG5A 4UX9A 2GNFA 3NUSA 2RSVA 4JVGA 1L3RE 4LV5A 2BROA 2XJ2A 5H8BA 3MVLA 4EL9A 3R73A 2BR1A 2YERA 5J87A 3KKVA 1APME 5CU0A 2CGWA 2EXMA 4HGEA 5CF5A 2G9XA 1DI9A 4ACHA 3MY5A 4BCMA 5AEPA 3MH1A 5AJQA 1WZYA 3FE3A 1Q99A 3OXZA 4B4LA 3R9NA 4IC8A 3VUHA 5EQEA 4FTRA 4UALA 2QKRA 5A14A 4DTKA 4WBOA 4KBAA 3FHRA 1KE6A 2YM4A 5ETIA 1GY3A 4IDTA 4KD1A 4RIXA 4W4WA 4AZSA 2C5YA 2Y6MA 4C59A 5I5ZA 5K5XA 5GJFA 3WIKA 3RWPA 1OIQA 5ACBC 4FUXA 4BCHA 4L3JA 3VIDA 4AGUA 4QMUA 3DKCA 3LM0A 3PG3A 4KA3A 5HICA 1WBOA 5E1EA 4U40A 5HESA 3S95A 1PHKA 4K33A 3UODA 2QU6A 3BKBA 2VUWA 5CZHA 3LJ2A 1S9JA 2WQNA 3H30A 3DOGA 3FL4A 5TF9A 2W1EA 4E6QA 4L68A 5EI6A 4U8ZA 2ITNA 3R63A 3WIGA 4AA5A 2OH4A 2WMSA 3BX5A 3PVGA 4CFVA 4TZRA 3A99A 5AV3A 2OK1A 3CKXA 5AP7A 4KWPA 3AGMA 1Y57A 5FXQA 4EWQA 3FI2A 1YRPA 4S30A 5JQ8A 4A9TA 2IZUA 1LUFA 2J5EA 2HZ4A 3TJCA 2BTSA 3CTJA 5JZJA 2ITWA 4D5KA 2YCFA 5EW3A 3WZKA 4ENYA 3FXXA 3VHEA 4APCA 2VWZA 2VWVA 3BLRA 2G2HA 4JQEA 4QPSA 2NO3A 3C4CA 3KEXA 4HGLA 3UVPA 1LEZA 4CNHA 1MQBA 3R8MA 4E4MA 4HYIA 3HRCA 5A4EA 3EQPA 4K8AA 1MRUA 3TNHA 3JVRA 5AUXA 4ANOA 1PY5A 3G2FA 3I7CA 4IACA 5BUJA 2R0UA 4NJ3A 5AMNA 3PXFA 4CV8A 4FIIA 4GCJA 4FVQA 3SC1A 4CEGA 4ZTMA 4C2WA 2EXCX 2OGVA 4W8DA 5DEYA 2V7AA 3C4FA 3E5AA 4GRBA 5GIOE 4FKOA 3QRJA 2PYWA 1V0PA 3BHUA 3PXZA 3H9FA 3OUKA 5DMZA 4I41A 3WYYA 3ROYA 4XG7A 4RFZA 3TT0A 5D7AA 3U6JA 2NRUA 4ANSA 5JK3A 5FDPA 5AM7A 2J7TA 3UOHA 3ZZEA 3OC1A 4FIFA 3VS6A 5E8SA 4BI2A 4LGDA 4CFWA 3AMYA 2HWOA 3BI6A 4AXAA 1AQ1A 2REIA 3KY2A 4W8EA 5FEQA 4BWXA 5B7VA 2QOFA 4IZ7A 3MTFA 2RFDA 3UTOA 3GGFA 3NRMA 4Q5HA 4L00A 4OR5A 1KE5A 5LVMA 2A2AA 5E91A 2BIYA 3FSKA 3BWFA 2RL5A 4XX9A 3NLBA 3S00A 3GENA 2GFSA 4F0GA 4XG2A 4MCVA 5E8ZA 4BCGA 4AFJA 4CV9A 1CMKE 2GPHA 3FMEA 2C3KA 4C02A 3U4UA 4IM3A 4DFZE 4RX5A 4G16A 4BDGA 1WVYA 4ACGA 5DT0A 3TG1A 4O7LA 2PL0A 3QQUA 4NM0A 1YXTA 4IB1A 2J0LA 3EFKA 2F49A 3FAAA 3P7CA 3AC2A 1W7HA 3ID6C 2WTIA 3W1FA 4M69A 3LE6A 1LPUA 1CKPA 5CSWA 1OUKA 4G3CA 2ONLC 5DWRA 2WQBA 4QTAA 5HO7A 4OLIA 2C6DA 1HOWA 3KULB 3NCGA 3U6IA 3KF4A 4IZ5A 2YISA 3WF8A 2ETRA 5AP3A 1SNUA 3NAXA 5L2TA 2GTMA 4NL0A 2VU3A 3BWJA 2W96B 5E4HA 4YURA 2QOQA 4F7NA 4OW8A 5IA2A 5KNJA 4I20A 5T6KA 5JT2A 1Q3DA 3ZXZA 5GIPE 5BVDA 4IJ9A 5M07A 5CNOA 2YLEA 1IAJA 1OIUA 4FKQA 4CYJA 3Q6WA 4IQ6A 2XKEA 3FLWA 3GCPA 5JMSA 2P4IA 4YC8A 4GVAA 2BZHB 2QNJA 3QTSA 4GVJA 3UZPA 1IG1A 3SOAA 4EH5A 4DH7A 3BYOA 1OECA 2PVYA 4PMMA 5DR2A 4KAOA 3UDBA 4PNKA 4O7WA 2W06A 5HE2A 3NAYA 2FSMX 3WILA 4DEBA 1FGIA 2E9NA 3LQ3A 4BIEA 4C34A 3FMKA 4PX6A 3H4JA 3BGQA 4XRLA 2C6TA 3QRTA 4TYIA 4DGOA 4HOKA 5JFXA 5L8LA 3OMVA 4LGGA 3DNEA 3ORKA 4JNWA 4NIFA 3U9NA 3FY0A 4F70A 4HVSA 4O7ZA 4O81A 3S2PA 2V0DA 3V6RA 3NVMB 4XUFA 3QKKA 3NUUA 1ZRZA 2CGXA 1ZYCA 4EH7A 2X7OA 3DBCA 3K5UA 1H27A 3LQ8A 4YZNA 4P2KA 4EWHA 2BDFA 1IASA 4IFGA 2GNHA 3PE1A 3Q6UA 3HLLA 3ROCA 5FXRA 3BCEA 5BVWA 2ZOQA 2WO6A 4QMOA 3AT4A 3RPVA 2C5NA 3A4PA 3MIYA 3PLSA 4KRCA 4NW6A 4XH6A 3GQIA 4YTHA 2V7OA 1X8BA 5IUHA 4ACCA 1YXVA 2C6EA 5M53A 2PUIA 5CU3A 3V5TA 4ZP5A 4HZRA 2KTYA 3R7GA 3UIBA 2R5TA 4BDIA 3L8VA 3L8XA 1R1WA 2GNJA 2WTDA 1PXIA 1DAYA 4TXCA 4CKRA 5HLWA 2CKOA 4BY9E 4PY1A 3FMNA 4ZSLA 4X3JA 2XJ0A 4D58A 1GIJA 2JAVA 4AN3A 2GS7A 1ZZ2A 1Q97A 4QMYA 3DQWA 1ZYSA 5LQFA 5IA5A 3DBQA 2H9VA 2J2IB 3JY0A 2EB2A 4LOPA 1FVTA 4FEWA 4C35A 1JKLA 4XG3A 1YWVA 2G2FA 2C1AA 3KA0A 5CXZA 3A7HA 2UZUE 3I6UA 4LQMA 4AFEA 3PY3A 3ZO1A 2Q83A 3NVKI 5DPVA 3E92A 2Y8OA 4BZOA 4ZJJA 5IZFA 4BR3A 3QQFA 4AGWA 4OUCA 3OS3A 3ORTA 1O6LA 1RE8A 1WBSA 2ZVAA 1Q8YA 3GCQA 2XK8A 3U6HA 3LXPA 3R2BA 3QRKA 4RFYA 4J7BA 3LM5A 4O1OA 3UOJA 3NW7A 2XNGA 3E7OA 4R3RA 3ZLSA 4GW8A 4F09A 5BVNA 4DE4A 4WKQA 3ZLYA 1BUHA 4I94A 4KIPA 3ZEPA 4E6AA 5CAUA 3NMUF 5CU2A 4EZ3A 2WKMA 2HK5A 3OWJA 2W1GA 4JL9A 4IB0A 4FKPA 4AGCA 3KREA 4UXLA 3QF9A 1TQPA 2XIKA 3P9JA 5AR5A 4CZYB 4KIOA 2RF9A 3NDMA 2XRUA 5KHXA 2PE0A 5J79A 4MXAA 4OTRA 4GIHA 3I60A 5H8GA 1FOTA 5HVYA 3EQFA 4U5JA 3WBLA 4E93A 3QFVA 1OMWA 2Y4IC 5A6OA 2EWAA 4A4OA 3PVWA 4XCUA 1QPEA 4BDAA 4EJNA 5TKDA 3ZSHA 4C38A 5ANKA 3CP9A 5JQ5A 2F7EE 4AOTA 4V05A 4AACA 4N70A 4UY9A 5AV1A 2JC6A 5EK7A 5CX9A 4RJ8A 4GT5A 2XUUA 2JKMA 1U5QA 3ANRA 4MHAA 5EHLA 3V01A 3R8PA 4BGGA 1H1PA 3NYVA 2QD9A 1J7LA 3VO3A 5ANEA 4CD0A 3A7JA 4HCUA 4II5A 1NXKA 2YM6A 3I0QA 4EBVA 3CTQA 5IQDA 1H1RA 3O23A 3DCVA 3QYZA 4I23A 4ZSEA 3U55A 3DS6A 2IN6A 3LFEA 1XJDA 4QP6A 3R8VA 4IZYA 3E8CA 1SZMA 2GS6A 2RIOA 4D2SA 1DS5A 1BKXA 1ZOEA 4V01A 5FRIA 5AFVA 3EN9A 2WIHA 4I92A 5BYYA 3V5JA 3V8WA 3CD8A 5EQYA 1PXPA 3CD3A 4PTEA 4YZBA 3ZSGA 3UIMA 4KKGA 4BKZA 3KL8A 3V3VA 1F0QA 1NA7A 2HENA 5JEBA 2J90A 3FLNC 3QX2A 2HYYA 3HP5A 3TUBA 2R0IA 3MSSA 3ORIA 3B2TA 2X39A 2WIPA 3MH3A 2WMVA 2W05A 2XM9A 3DPKA 1IRKA 4CLJA 4DCAA 3RTPA 1O6KA 5KMKA 1UV5A 1OL5A 2X0GA 2IW8A 4HW7A 5J7BA 1SVGA 2XYUA 1W84A 3GT8A 1REKA 4LYNA 4YTIA 4FSUA 2VTTA 5T68A 3S4QA 4EORA 5J5TA 3QTXA 5L2WA 2OICA 4O84A 5HTBA 4RX8A 4RIYB 4QT1A 5IA4A 2XIXA 4U79A 3QAME 5F9EA 3A4OX 4ZS4A 3EQDA 5AUWA 3GQLA 2BAKA 5L6WL 1M52A 5IQFA 4WD5A 1RJBA 5L3AA 4YPSA 3HKOA 1JSTA 3MS9A 4G9RA 3IW6A 3EKNA 4IAYA 4L43A 4X21A 5FP5A 4C8BA 3IW7A 4QD6A 4ANNA 3ORZA 1NT2A 2CCHA 2R7IA 4ZTLA 3TKHA 4DEDA 2ZDUA 3ANQA 5A9UA 3BE2A 4PPAA 4FX3A 4XLIA 4EK4A 4FKIA 3I7BA 4FSZA 3HUCA 3II5A 2CKPA 3CIKA 4C4GA 3SQQA 5E8XA 5F95A 3TI1A 4QMVA 2YABA 1H25A 2V22A 4ACMA 4AW0A 4DCEA 4M12A 1XQZA 5HGIA 3RKBA 3E87A 3D5WA 3FPQA 3GCUA 3DXQA 2PVKA 3C0IA 4FZ6A 3HX4A 2J0MB 3P5KA 4NT4A 2CSNA 4L45A 5HNGA 2R64A 4BZDA 4FEVA 4D1XA 1Z5MA 1VZOA 3AD4A 3KXNA 2CN8A 2VWIA 3OTVA 3ZUTA 4B8LA 4FEUA 2ITYA 5CAOA 2NRYA 2OBJA 4RA4A 4TWOA 2YITA 1W98A 3U9CA 2GQGA 4RZWA 2YLFA 3T9TA 5EM6A 2FSOX 4NKSA 2YIXA 3KVXA 4ALVA 4C4EA 4F63A 2X2KA 4XP0A 4PMPA 2VRXA 3A2CA 2C47A 3Q4CA 4M8TA 4DFXE 2B4SB 3EN6A 1PW2A 4JIAA 3A7IA 5CS6A 2EB3A 4ZS0A 4BCIA 1XO2B 3QD2B 4ANLA 3Q4ZA 3GU6A 2I6LA 3P7AA 5D7VA 4OTDA 5CSHA 4AOIA 4CGAA 1FMKA 3BPRA 3TIZA 1OUYA 1OZ1A 3NW5A 4IVCA 4IC7A 2ZV7A 3I0OA 1EH4A 4C61A 4LMNA 3VWAA 3RJCA 2GDOA 3F3WA 3GU5A 2W99B 5KMJA 2E9PA 5DEWA 3HYHA 4F9CA 3DK3A 4FKSA 2VX1A 4PRJA 3VS4A 5KX8A 1OVEA 3COKA 2J5FA 2UW4A 4WSQA 4JLCA 4U81A 1E1VA 1WVXA 4NM7A 4S2ZA 3ENMA 1BYGA 4BRXA 4C3RA 3O96A 2HOGA 4QP9A 3DA6A 3N4TA 3ZO2A 3U4WA 2UW5A 4I0TA 2JITA 2YIQA 4IIRA 4DN5A 5HHWA 3VBXA 3DTWA 4YZMA 4WT6A 4XP3A 2XIZA 3DKGA 4FKUA 2YM7A 4I5HA 4QPMA 3SX9A 4DAWA 4YMJA 4O7VA 1OBGA 1SMHA 2F7ZE 5HI2A 3E8DA 3P08A 3IS5A 3QTUA 3UIXA 3KXGA 5BYZA 5M06A 4AGDA 4CFMA 4GMYA 4FV2A 3K3IA 4IAZA 1R39A 4J95A 2O65A 3E8NA 5CLPA 3PVUA 3TKIA 2FSLX 3QGYA 5K4JA 4FICA 4NH1A 5EDRA 4D2WA 2XKCA 2YJRA 3RPYA 4GKIA 4WNPA 4FIEA 4D4RA 3TUDA 3R01A 3UG2A 5LVPA 3TWJA 1K3AA 2X2MA 1V0BA 2XS0A 4ID7A 4L3LA 4RX7A 4G34A 5CEOA 1JKTA 2WMRA 2X8DA 4PP9A 4RRVA 3OVVA 4JR3A 5L2SA 2UZLA 5E8WA 3AOXA 2WQEA 3ORPA 1Q8WA 1PMNA 3ERKA 2V55A 4DEIA 5CNNA 5IDPA 5JFSA 2YCRA 4TPTA 3JVSA 3V5LA 3UO5A 3C0HA 3NYOA 5EW9A 1BL6A 2FO0A 4HPTE 4WA9A 4DGNA 4E73A 4NW5A 3OZ6A 4NTTA 5DRBA 3KRXA 5JRQA 5EDPA 4FSYA 3EKKA 2P2HA 4UYNA 4FGBA 4O0TA 4FG7A 4U45A 4FTQA 5C4LA 4MNEB 3LCTA 2WZJA
chains in the Genus database with same CATH superfamily
2FH9A 3F5PA 4FSNA 3W2CA 3OW3A 5F20A 4QMQA 2VWBA 3TKUA 3QQGA 4RC2A 2OXDA 1PJKA 4J96A 5CVHA 1JWHA 2R3KA 2UZNA 2VNWA 3HV3A 2Q0NA 3FV8A 4YJTA 4BCFA 5IISA 5JFWA 2AYPA 3C4WA 2YWPA 4NEUA 2RFNA 2E9UA 4H3QA 4ASEA 2ZM1A 3D4QA 2BUJA 2WU6A 5HBJA 3TNPC 2OZAB 1B6CB 1H0VA 3A8WA 3GBZA 5BUEA 4RQKA 2FYSA 5I9VA 2UVZA 3NYXA 3OEFX 4UV0A 5IA1A 1J1CA 2I1MA 3AKLA 5HIDA 4F7JA 5M44A 4DFBA 1P5EA 3VS2A 3F82A 3ENHA 2EUFB 2R3HA 3EN5A 4DH8A 3N4UA 2WMWA 4H05A 4HPUE 1UNGA 3CXWA 1OL1A 3LFFA 4BHNA 2O5KA 4BDKA 4OTIA 3TXOA 4HVDA 4GS6A 4XHKB 4L8MA 1PXJA 3NPCA 3QWKA 3SG9A 3R7YA 2AEGA 3CY2A 5CU6A 3SD0A 2GCDA 4KBKA 5GZ9A 4ZTRA 2YDJA 4RT7A 3R1YA 4F1TA 3C5IA 2OKRA 5BPYA 1H26A 2B9JA 5IG1A 2PZ5A 4A06A 5FEDA 3K2LA 4BBEA 3P23A 3HGKA 4NU1A 4K6ZA 3PXKA 2E9VA 3QQLA 4S33A 5AUYA 3R8UA 4TYJA 4MQ1A 2XIRA 4WNOA 2ZV2A 3D14A 3W2SA 3AXWA 3NX8A 1KOAA 3W0QA 4AZVA 5C27A 5HTIA 3EZRA 3O51A 3ZXTA 4A9SA 4X2FA 4A9UA 4IDVA 4D4YA 4JIKA 2ETMA 1Q8UA 4RX9A 5JKGA 2VTJA 3GC9A 3CJGA 4EK8A 4CKJA 4IAAA 3QCXA 3BV3A 4BCPA 2VTLA 3SLSA 3IDCA 4H1MA 4IX4A 4FT3A 4FL3A 3IQ7A 2OH0E 3N4VA 4GUBA 5E8UA 4O96A 1ND4A 2JFLA 4EH3A 2UUEA 3NUXA 4I3ZA 2UVXA 1R0PA 3LCSA 4IAFA 3UO6A 3HZTA 2Z7SA 4FGRA 4BBFA 3R28A 3G0EA 4PMTA 2QR7A 3E88A 3PYYA 1GZOA 4UMRA 5HTCA 3PJ2A 1H07A 2PE2A 4FIJA 4X3FC 3BE9A 5A4TA 3EJ1A 4G6NA 2FUMA 4NCTC 2QVSE 5F94A 5IEYA 2XK3A 4FTLA 3UNJA 3G9NA 2VTIA 1XR1A 3PA4A 4X7QA 3UNKA 2W1FA 4X3FA 4ORKA 2AUHA 4BDBA 2AC5A 1KE7A 2VO7A 4R3PA 4TWNA 1YOJA 2R3IA 3Q3BA 4FV0A 3WARA 5M4FA 1PRYA 3K54A 3WI6A 4CT2A 3ZSIA 2PMLX 4X6QC 3W32A 3W0PA 2F2CB 2QLUA 4FT7A 5F4NA 4DEHA 5BVFA 2IJMA 3AG9A 4GKHA 2J50A 3OCTA 2Y0AA 3FMJA 5AA9A 2PULA 3JY9A 5FLFA 1CKJA 3QBNA 5HKMA 1KE8A 4HZSA 4MXXA 4M66A 3L9NA 5I3RA 4RA5A 3R7EA 1PKDA 2W1IA 3POZA 4TY1A 3HRBA 3R7OA 2ITXA 5EKNA 2UZVA 1UNHA 1UU9A 2BILB 3MY1A 1A9UA 3BBWA 4J1RA 1SYKA 3QCQA 5IQCA 3RAWA 1QPJA 2QHMA 3LCDA 4PL5A 4O7YA 4ZEGA 3MFTA 4D2VA 4RWJA 1UVRA 5DBXA 4TYGA 1YXSA 3HMPA 2RG6A 1SVHA 1W82A 4JDIA 1IR3A 3VUKA 3H9RA 4FYNA 4ZTSA 4AA0A 4EKLA 1AD5A 2BFYA 2JIIA 2WQOA 4C2VA 1Q4LA 1YI6A 1GOLA 4QTDA 4D4VA 4YLKA 5HG9A 4ZAUA 2QOLA 2UZBA 3IOKA 4ZMEA 1FPUA 4YJUA 1YKRA 4ZJIA 3LPBA 1R0EA 4EYJA 4EOPA 3KK9A 2P2IA 4C37A 5IQEA 1Y6AA 2Q0BA 3MGYA 3CE3A 4D2RA 4YBKA 1YXUA 4U43A 4AX8A 4C4FA 2IVTA 2PTKA 4TYHB 3ATTA 3S0OA 5DLSA 2W17A 4YJOA 3THBA 5HLPA 3RM6A 4DFNA 2Z7LA 4CTBA 4MH7A 2DQ7X 4FZFB 1G8KA 4I5CA 1OI9A 3FZSA 4B0GA 5D12A 2YCSA 4YUQA 2X7GA 4FNWA 3LMHA 2C30A 3EYGA 1FVVA 3W8QA 4BHZA 5KZIA 3SA0A 3QD3A 3MPAA 4L6QA 1XH6A 3O71A 3EQIA 4KSPA 1NVQA 4UYAA 2QI8A 3MIAA 4X2JA 1G3NA 3MN3A 3DB8A 3FKNA 4O38A 5I9UA 1ZMWA 4EC8A 4RGJA 3BYUA 5KBQA 2GTNA 1YWNA 3FWQA 5CEQA 2OFUA 2WTKC 3V5WA 4OTPA 5CQWA 5BQ0A 2R3JA 3FPMA 3QGWA 4EHVA 3QUEA 4KIQA 3QZFA 2IVVA 3M2WA 5AAGA 5KMNA 3HL7A 4FVRA 4A7CA 3FZPA 4R5YA 4IX5A 3IO7A 3AT2A 3DV3A 3R7VA 3FI4A 4HJOA 4QMPA 4G2FA 1WAKA 1Q41A 3G51A 3W0MA 2JDVA 4I6HA 4RC4A 5IQBA 1DI8A 3R1SA 4QP2A 4C3FA 5HORA 2QOHA 2QG7A 2PVHA 2W4OA 3KN5A 3H9OA 5EQPA 3C5UA 4QMMA 2SRCA 3R71A 4JQ7A 1J7IA 1OB3A 4FR4A 5FBNC 3CPBA 2GHMA 2R2PA 5GZ8A 4XMOA 4AXEA 1QPCA 2WTWA 3OG7A 4L7FA 3RBWA 3CGFA 5GINE 2ZV8A 2YIWA 1ZYJA 4MXZA 4UWYA 3HMIA 3DTCA 3OBJA 2OZOA 3OT8A 3AQVA 5A46A 3FI3A 4P90A 4Y83A 2IF8A 2KULA 2WFYA 1ZMUA 4BKJA 3PIXA 1PMEA 2PZRA 5DNRA 2VTAA 3RCJA 3F3TA 4ZXTA 3EN4A 2WEIA 3ZUVA 3S1HA 1XH9A 3PWYA 4UXQA 1CTPE 3KGAA 4FV1A 3RAKA 3LFBA 3G0FA 5CEMA 3CKWA 3O17A 2B1PA 2BFXA 3MPTA 4C7TA 4U80A 4LGHA 3AC1A 3PSDA 4CLIA 2EVAA 1PKGA 3E7VA 4TWCA 4YHJA 4EKKA 4RG0A 3ZRLA 5KMLA 3KCKA 2IWIA 1TZDA 2BDWA 5A54A 5J9YA 2R3MA 3ODZX 4O0YA 5BX0A 1K9AA 3PUFC 3WF7A 2I0YA 2GQSA 3NNWA 1FVRA 1ATPE 2GHGA 3MTLA 4KIKB 2BRMA 2VN9A 4R3CA 1TQIA 2XK9A 3FEGA 2YCQA 5GJDA 3R04A 4HGSA 3QZGA 3MI9A 4IHPA 4CFFA 2PPQA 2B9HA 3WF6A 4DH3A 5IU2A 4E7WA 2O63A 2R3RA 2YAKA 4FTKA 4OAVB 4L67A 3AC3A 3FMMA 3MB7A 4H58A 4X2GA 4ASZA 4EK5A 3DZQA 3UDZA 4GJ2A 5EYMA 3PDTA 1FINA 1O9UA 2CDZA 2BRHA 4GFGA 4JBOA 4KKHA 4XG6A 5ANDA 3UBDA 4FJVA 4H36A 3JPVA 3H10A 4MYGA 3TCPA 3ZMMA 4WG5A 2ONLA 3WF5A 3VN9A 3PXQA 4YZCA 3VUGA 3BHTA 1KE9A 3AD5A 4GK2A 4IADA 4WOVA 5ANOA 2QODA 1OPJA 4DLIA 4XBUA 5K9IA 3ZTXA 4MK0A 2BHEA 2IZSA 4BDCA 3LKMA 2C5XA 3PJ1A 4XOYA 1GIHA 4EQUA 3A8XA 2YM5A 4KS8A 5IMXA 3ULZA 3ORXA 3UOLA 3EFLA 4EOJA 4GFOA 2P33A 2C3IB 5CALA 4OTWA 5AP0A 5CT7A 4P5QA 1UNLA 3C7QA 3R7IA 4DYMA 4C33A 4GYGA 1JAMA 5EI2A 3G33A 4UMTA 2B52A 4FSMA 2BIKB 2YN8A 4FZAB 4QTBA 4F64A 2QONA 3PIZA 5HBHA 4TW9A 2X1NA 4YJRA 2VTMA 1TKIA 2JKKA 4PDSA 4P7EA 2PZYA 4AS0A 2HZNA 2BRBA 4J99A 5HCZA 3IDPA 3DJ6A 4PL3A 5AUVA 5JRSA 3SRVA 3EOCA 3FLYA 3NUAA 2HY81 3IK3A 3NNXA 3PFYA 1CDKA 3MESA 5I9WA 2JDOA 4QMSA 3HV5A 4ARKA 2VX3A 4BGQA 2WB8A 4D4SA 3ZUUA 4HCVA 4O21A 3RNYA 3VQUA 4I5PA 2W4KA 4IWDA 2I40A 4YTFA 2JBPA 3TNWA 4AQKA 2F2UA 1OITA 4GH2A 2R3QA 4YHTA 4O7RA 3OEZA 2OIBA 4MKCA 5D9HA 4ZTQA 1OM1A 3VF9A 3HEGA 4BCJA 3SGCA 3NZ0A 4RIXB 5IEVA 5E8TA 3W10A 3Q53A 5L6PA 4AWIA 5KBRA 4F6SA 2BRNA 4WBBB 4YZ9A 3ZDIA 5IMEA 2OF2A 3FKLA 2CNUA 2PVRA 1LEWA 5C4KA 2QQ7A 4O0VA 5AR7A 5G6VA 3D7TA 4U44A 2PMOX 3UQGA 1VEBA 2GNGA 2C69A 4IVDA 3W0NA 2VTHA 2YDIA 3PP1A 5I9XA 2WMXA 3BV2A 3NFGB 4QMLA 2C0IA 3W16A 4QYHA 4U9AA 3LXKA 4XLVA 1MUOA 3L8PA 4R77A 1J3HA 1XH7A 4H39A 4M14A 4RWIA 4L52A 2PVMA 4MTAA 1JOWB 4MBLA 4BTMA 2ZJWA 3UZTA 3C4EA 3B2WA 5HIEA 4LL5A 5CSVA 2G01A 5FUTA 4JG6A 4WNKA 2HZ0A 1U46A 2IZTA 1KV2A 1OIRA 1OPLA 4L7SA 4F1OA 5LCJA 2G2IA 4TN6A 2C68A 4MXOA 3RALA 1QCFA 4FUYA 2H6DA 4TNBA 4V0GA 4GL9A 3P0MA 1Q3WA 2CHLA 1ZLTA 3GC8A 3KCFA 2NP8A 2W1HA 3H0ZA 4NFMA 4L46A 4MXCA 4XV2A 4G3GA 3SXFA 2J6MA 3MH2A 4JG7A 4ZTHA 5AV2A 5D1JA 5LVLA 2JIVA 4IMYA 3C13A 3G6GA 5BVOA 5CASA 3CY3A 1YI4A 4JAIA 5AR8A 2OIQA 5CF8A 3VVHA 3BLHA 3OUNB 5LWNA 3FLZA 3OXTA 4HYUA 4XYFA 3VHKA 4CSVA 4EQMA 4YSJA 5HIBA 4EHZA 3GFEA 3LAUA 4PDPA 3RPOA 5ICPA 5K5NA 4YP8A 4A9YA 2O64A 4GYIA 4E5AX 3W0RA 2R3FA 2X8IA 2Z60A 1OGUA 3DJ5A 5HQ0A 3OP5A 3WOWA 2XNNA 5DH3A 4ZY5A 3KC3A 5CAQA 3C51A 4ZOGA 3PPKA 2J51A 3OWLA 3VS3A 4ZSAA 2JLDA 1IEPA 3MWUA 3V04A 4A07A 4FV5A 4BN1A 3E3PA 3ATSA 2WMUA 5E1SA 5E8VA 3W2QA 4ZLOA 1XH8A 1J1BA 2QO7A 4XS2A 5FGKA 1OKZA 4QTCA 4Q9ZA 2VWYA 3FZTA 3PSCA 3EQCA 4I0SA 1MRVA 2QHNA 3E62A 4TYEA 4IH8A 3DAKA 5LOHA 3OOGA 5E9EA 4ZZOA 3C0GA 2JAMA 4XOZA 3VBYA 2UZWE 4PP7A 3N51A 4BBMA 5M56A 2R7BA 3O8UA 4ASDA 1M2PA 2XF0A 2GS2A 2UW6A 5HO8A 1OBDA 2QOKA 1H1QA 2WELA 5EKOA 4E1ZA 3QC4A 4E5WA 4N6ZA 4O4CA 4YZDA 5HD7A 4DEEA 3R7UA 3FY2A 5DT3A 4J98A 3IONA 2ITPA 4S31A 4DHZA 3HV6A 3Q9YA 2CGVA 5LWMA 4M69B 1U5RA 3CC6A 3ZEWA 3TTJA 4YTCA 3QU0A 1UKHA 4PDOA 4IE9A 1UU8A 4O4BB 1WBPA 4A4XA 5AV4A 5A3XA 1F3MC 2WU7A 3FUPA 2IZRA 4KS7A 4K0YA 5EFQA 5BMSA 3RVGA 5H3QA 1UWJA 1WBNA 2A4LA 2IO6A 3VUMA 1RW8A 4F0IA 4UB7A 3BYMA 2Y4PA 2QO2A 4UMQA 3VF8A 5K4IA 4M67A 3P86A 4I4FA 3F61A 4XJ0A 5DR9A 2OJFE 4E3CA 5A4CA 5I9YA 1ZARA 1UU3A 3JS2A 2BPMA 1YHVA 4O83A 3VUDA 3EL8A 4E5BA 2X0QA 3NUPA 4M0YA 4FTJA 3BYSA 5E7RA 3C9WA 4FV6A 1YXXA 5DVRA 1M14A 4O2PA 5KCVA 4FI1A 3IGGA 5F1ZA 2VO0A 4RIWA 4AQCA 1IA9A 1V0OA 5CYIA 2YWVA 5LVNA 3BLAA 4BDHA 4Y73A 5CEKA 3COMA 2R3PA 2XMYA 4NSTA 2UZEA 3EQBA 4JBVA 5AP1A 4DLJA 2DS1A 4K18A 4XRJA 3QRUA 3BQRA 4XBRA 1LR4A 1XBAA 5EYCA 4NIFB 2HXLA 3COHA 5LMKC 2V62A 4PL4A 4USFA 4EUUA 3JYAA 3LQ5A 4IVBA 5EHYA 1YDTE 4BYIA 3IW4A 2YAAA 3PTGA 3HECA 2FSTX 4AA4A 3PFQA 4D9UA 5M4CA 3T9IA 2H96A 3LFQA 5KMIA 5LMKA 4R1YA 3TUCA 3HNGA 4HYSA 4I5MA 4U3YA 4QEBA 3ACKA 2XJ1A 3M11A 4TTHB 3KN6A 3T8OA 2WPAA 5L8KA 3CQWA 3BRBA 3Q2JA 3QYWA 1Y8GA 4AW5A 4G1WA 4FF8A 2XIYA 4IB3A 3PPZA 5CANA 5M4UA 4PNIA 3A61A 2AC3A 2IEWA 4YPDA 3LMGA 4U7ZA 3VS7A 3W2RA 2VTSA 1OKYA 3KMMA 4LUDA 3HDMA 3PA3A 4YNEA 3M42A 5DGZA 5HCXA 4BCKA 4I1ZA 3HDNA 1PXKA 4USDA 2LAVA 1U54A 4OTFA 3TV4A 4ENXA 2PWLA 2QOIA 4EOIA 2PMIA 5L2QA 2B53A 4GUEA 4XG8A 2J0JA 3UMWA 5L4QA 3RK5A 3MY0A 2GQRA 3B8RA 3D15A 4CFXA 3L9PA 4RVTA 5AUZA 3QQHA 4DGGA 1Y6BA 4IX3A 5CEIA 1OKWA 4Y5HA 5FBOA 2BCJA 4C58A 1UU7A 2YEXA 4LG4A 3TL8A 3W33A 4B7TA 3O8PA 5ANJA 4DEGA 1JSUA 4MF1A 5AP2A 3TACA 5HE3A 5KKRB 4BJJB 4HYHA 1PXOA 4RJ4A 2F9GA 5AP4A 2J0KA 4S32A 3F5GA 3VS5A 2JKOA 2ZB0A 1YOLA 3MBLA 2C3LA 1SVEA 3U8WA 4DG2E 4DBXA 4EJ7A 3PRFA 3DBFA 4OAUC 3CSVA 3R02A 3E93A 4CFNA 4DITA 3ZOSA 4FTUA 4U0IA 1Q5KA 3F3UA 3QKMA 1DM2A 2YFXA 2VWUA 2X81A 3C1XA 4JI9A 4U6RA 3VBWA 5CAPA 3FMHA 3A7GA 3O2MA 3ZU7A 2R4BA 4ZY6A 2VZ6A 2ZAZA 4PF4A 5HO6A 1H28A 3P79A 4YC3A 4KB8A 3VAPA 2FVDA 5EOLA 1JKKA 4ITIA 3UGCA 3JR1A 3W8LA 3OOMA 4DGMA 3MA3A 2CLQA 4WRSA 1L8TA 3NR9A 5KZ0A 5FEEA 5HG7A 2CKEA 3GFWA 4JXFA 2W7XA 4OTHA 4CT1A 4XV9A 4F7LA 1IA8A 4Y72A 4BVUA 4ZIMA 4ZMFA 4O82A 3IECA 2CJMA 5E92A 4MVFA 5FD2A 3DBEA 3KMUA 4ZZNA 5HE0A 2A19B 1OKVA 3B8QA 3NNVA 5A4QA 2Y4IB 3HMMA 2CMWA 3COIA 3L1SA 4R8QA 4U42A 3UPXA 3FQHA 4YR8A 3PE2A 5H2UA 4KUJA 3TZ8A 2F7XE 5AM6A 2QKWB 3FZRA 3RHKA 3ZO4A 4DT8A 4N6YA 2IVSA 3QA0A 5JGDA 2P55A 4RWLA 4F9WA 3VQHA 3EQRA 4RLLA 2VTOA 3LJ0A 3UQFA 4C4HA 3Q4TA 1ERKA 2WOTA 1TVOA 3R83A 3WF9A 3EYHA 4FTCA 4EHGA 4G17A 1HCKA 2EXEA 4EOSA 4KBCA 2ITZA 3CLYA 5H9BA 3DNDA 4DEAA 1BI7A 3DJ7A 4IVAA 4O22A 4YJPA 4CCBA 3OW4A 3QZIA 2PVLA 1T46A 2XEYA 4NM5A 5DR6A 3OCSA 4XNEA 2Y9QA 3ET7A 3VUIA 4D2TA 2QLQA 3DAJA 3F69A 3FQSA 3REPA 4EOMA 4LRJA 3DFAA 4WG3A 3QHWA 3BEGA 2X8EA 5IPJA 5K0KA 3LW0A 3VBTA 3VJOA 1H1SA 4FV7A 3RAIA 2HY0A 4IZAA 3R22A 4LRMA 5CSXA 4EOLA 1ZWSA 4EUTA 4OT5A 4QMTA 3BZ3A 5KE0A 4CMUA 4JMQA 3QA8A 1Q8ZA 3Q9ZA 5J8IA 2B54A 4JT3A 2BDJA 5DN3A 1Q61A 4E20A 5C8NA 2BRGA 3GOKA 3KMWA 2XNOA 1ST4A 3DKFA 4FT9A 3TZMA 1BLXA 1JLUE 4HVHA 2JBOA 4AT3A 5JGAA 5DE2A 1ZOHA 1FQ1B 3D5UA 2H8HA 3LMIA 2OSCA 2VX0A 3KVWA 3MJ1A 2BKKA 1JSVA 4D1SA 3O50A 1JKSA 2RGPA 3F3VA 5GHVA 4PTCA 3IG7A 5GNKA 5HU3A 4RJ6A 2VV9A 3LXLA 4NFNA 3F2RA 4TRLA 3BQCA 2P3GX 2GU8A 2XNEA 4FOBA 3TV7A 2YHVA 1W2CA 1W2DA 5CF6A 4O6LA 5IQGA 2R3OA 3F5XA 1VYZA 4ALWA 3R2YA 3SDJA 2WOUA 5FTOA 2XK7A 2DYLA 2FB8A 2GMXA 3SOCA 1WFCA 2UZOA 5J95A 1P4OA 2YA9A 3I4BA 3RP9A 1KUTA 3QQKA 3LFCA 3TN8A 4DG0E 3JXWA 4E26A 5AR4A 2WMAA 4QDEA 1BMKA 4KNBA 1XMLA 2IW6A 3VRYA 4IBMA 3W55A 3KXMA 4CQEA 4BTJA 4DHFA 3KQ7A 2I7QA 1H00A 2V5QA 4WSYA 5AX3A 4BIDA 1W8CA 4KABA 4FEXA 2H34A 4BC6A 2UZDA 5CU4A 3KXXA 4I22A 4F9AA 5JFVA 1BX6A 4W4VA 4RZVA 3ZBFA 3AGLA 4FKJA 4FA2A 3MPMA 1V1KA 5M57A 3CGOA 5CI6A 1F5QA 3DY7A 2C5VA 2CLXA 2ITUA 5KUPA 2ITOA 3R21A 4LFIA 4WUNA 1B39A 4FTMA 4ANBA 3G90X 4ZZMA 4D5HA 3EFWA 4LUEA 4OGRA 3UVQA 4EONA 4QQTA 2GNLA 3ZBXA 3OXIA 4ZSGA 4FV3A 2C1BA 2JGZA 4NCTA 4NUSA 5CZIA 3BBTB 4JX7A 5J7HA 3KK8A 3PP0A 5ITAA 1H01A 4GT4A 1A06A 2CN5A 5EM7A 3GB2A 4FBXA 3WYXA 1P2AA 3FBVA 1U59A 4F6UA 3NSZA 3IPHA 4RPVA 4ANQA 2F57A 4F6WA 1S9IA 2WHBA 4AW2A 1J7UA 5C01A 3VW8A 3RMFA 3KULA 2XEZA 3ZM4A 3FLQA 3IW8A 3P78A 4J53A 5DHJA 4D28A 4Q9SA 5EI8A 4EYMA 4QO9A 3ZFYA 4QYYA 3LLTA 2BHHA 5ETFA 2I0HA 4NKAA 1B38A 3QL8A 1MQ4A 4G3FA 4CTCA 4OBPA 3EWHA 4A4LA 4HVIA 3UPZA 2C0TA 3SG8A 5M4IA 1PF8A 2PHKA 5IF1A 3L8SA 4AF3A 3TTIA 4DHIB 3PLAE 4J8MA 5HNBA 3UO4A 2WD1A 5HVKA 4NZWB 2HCKA 4FT0A 5JH6A 1NY3A 3AMAA 2G15A 3TM0A 4M0ZA 3DU8A 3LJ1A 4EH8A 2I0VA 3HV4A 2UW8A 3OCGA 4CFUA 3POOA 3SW7A 3SKCA 5B2KA 2PU8A 4R1VA 3G5DA 1PXMA 3T3VA 4HNFA 3V51A 1CM8A 3OBGA 3ZO3A 4O4EA 4C0TA 3RM7A 4PTGA 5L8JA 2OO8X 3NIZA 4GK3A 5AWMA 4F08A 4O86A 2GHLA 4PV0A 3LFDA 4F65A 4MUQA 4IJPA 3TMOA 3NYNA 3QQJA 3IKAA 4BI0A 1G5SA 2HW6A 3ALNA 3CCNA 3HV7A 4DINA 1M2RA 3F2NA 4LV8A 2WGJA 3W2PA 4EH9A 4BDDA 1XHAA 1REJA 4O91A 4JAJA 3RCDA 4C4IA 1RDQE 3FHIA 1TQMA 3A60A 4OBOA 4L9IA 4Y46A 3WZUA 3LFNA 2XNMA 3BHYA 2QURA 5ANIA 1YI3A 5GZAA 4AAAA 1ST0A 5FQDC 5K0XA 3MVMA 3DT1A 1OL7A 3NS9A 4FKRA 5AAFA 3V5QA 4F1MA 2PZPA 4EHEA 4NWMA 4GFMA 2WTCA 3WZDA 4YU2A 1QMZA 3UNZA 4D55A 2W0JA 5IUIA 2HELA 4JS8A 3GC0A 5KMMA 4BB4A 1STCE 4FL2A 4IM2A 4CVAA 4L42A 3PIYA 3U87A 4ZY4A 2J0IA 3FMDA 5GJGA 3QRIA 1W83A 1QL6A 4K77A 2X9EA 4YO4A 4PPBA 3HRFA 1WMKA 3TNQB 2C6OA 3CJFA 2JKQA 1ZOGA 4RQVA 3PXYA 1WVWA 4O6EA 4O0RA 5JGBA 3ALOA 4F99A 2YACA 3G6HA 2IPXA 1XKKA 3MH0A 4AZWA 3DDQA 1XMMA 1XBBA 3Q96A 4D0WA 4DH5A 3LCKA 4EC9A 2HAKA 1P14A 4C57A 4FKVA 5AADA 3HUBA 3LLAA 3JUHA 4FSTA 4XV3A 2XK4A 2C6IA 4HGTA 4BL1A 3GI3A 3KU2A 3I5ZA 3W18A 3NEWA 5CQUA 4AUAA 2JDRA 3Q04A 2YIRA 4O1PA 3ZH8A 2YIYA 4YJSA 3ELJA 4EH4A 2GFCA 2PZIA 3UOKA 5IH6A 3GU8A 3PVBA 3VS0A 2PY3A 4G5JA 5HD4A 5CTPA 2B55A 4YSMA 4M15A 4IFCA 4WHZA 1YWRA 4LV7A 1PMVA 3C50A 4FT5A 4JJRA 2XKFA 1NVRA 5CI7A 4YJNA 2XKDA 5EG3A 5HNIX 4LL0A 2G1TA 1AGWA 4ACDA 2IW9A 1GZNA 3HMNA 4FK3A 4NK9A 3PA5A 3VBVA 3E3BX 2XAOA 1OPKA 3F7ZA 1WBTA 4LOQA 4L01A 4B99A 3UYTA 4FNYA 2BVAA 3KRJA 5EM8A 3UMXA 4DFLA 4AAYA 4IAIA 2A0CX 3BHHA 3R9OA 2W1DA 3R9HA 4FYOA 2XNBA 3H0YA 3QX4A 4BDEA 4J97A 4M13A 4O0XA 4FOCA 4Y95A 2Z7RA 4NTSA 3VBQA 3PJCA 1FMOE 5ACKA 2C6KA 5HX8A 5LVOA 1GAGA 3GXLA 3ETAA 3TV6A 4IM0A 5CXHA 2UW9A 5FM2A 5H8EA 3UC4A 3FL5A 2XYNA 3D5XA 4MEDA 4CRLA 2CPKE 1JVPP 4JX3A 4D0XA 2NYAA 3FI8A 4JR7A 3EH9A 5KHWA 5FP6A 2O0UA 4BICA 3OF0A 3BL9A 4ALUA 3R1QA 4C4JA 3FXZA 4FTOA 3FYJX 3AMBA 4FV4A 5TE0A 4Z16A 4B8MA 3C4ZA 2B0QA 4FKTA 2O3PA 3PZHA 4KSQA 3TJDA 5TO8A 4W9WA 4E8AA 4CZTA 2JFMA 2ZV9A 4FRFA 5AIKA 3MFUA 4FE2A 4X3FB 4FODA 4ZLYA 3OFMA 4BWKA 4DA5A 3OCBA 3VUTA 4NYEA 1M7NA 3G15A 2VAGA 2EU9A 4M7IA 4R5SA 5FTQA 3PPJA 3QTRA 3R8LA 3DZOA 4V04A 2ITQA 3BGPA 4QMWA 5EH0A 2XVDA 4TKSA 3ZHPC 3Q52A 4X2NA 5I4NA 1XH5A 4J71A 1YQJA 3ZC6A 1M2QA 1VR2A 2RFEA 3VRZA 3AD6A 3EMGA 1WBWA 3D9VA 4O27B 4Z7GA 2VO3A 2XH5A 3K3JA 3V5PA 4UEUA 4CCUA 3L9LA 4ZK5A 4AN2A 3A62A 5HVJA 5CENA 1Z57A 4RMZA 3F6XA 5C9CA 4MWIA 4FVPA 4FSWA 4P5ZA 5EHOA 5B0XA 3A7FA 4GK4A 5IA0A 5ETCA 3O0GA 4RIYA 4QMZA 5D10A 2VWXA 3R1NA 4GU9A 3UYSA 4RLKA 5CVGA 5IA3A 3MW1A 2WTVA 3I81A 3K5VA 1KSWA 4G3DA 4I4EA 4I6FA 2OFVA 4IANA 4QOXA 3RK9A 3TIYA 4QQJA 3V6SA 3NW6A 3KB7A 3FLSA 4RWKA 5K3YA 4O0UA 5FTGA 1JNKA 2R3GA 5KMOA 3Q2MA 1GZ8A 3ACJA 2QCSA 2VTRA 4LRKA 4U97A 3ZYAA 5HZNA 4XV1A 3UJGA 4JDHA 5HU9A 2X4FA 3IGOA