5AIRA

Structural analysis of mouse gsk3beta fused with lrp6 peptide.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
353
Chain Sequence
MKVSIGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Mouse Gsk3 Beta Fused with Lrp6 Peptide
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Low-density lipoprotein receptor-related protein 6,Glycogen
total genus 101
structure length 353
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5airA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5airA01
5ANGA 2QO2A 1BX6A 3MH2A 4FSYA 5JGDA 5AAFA 4APPA 4HYHA 1CKPA 1JSVA 4JQEA 4RIYA 3HDNA 5D7VA 2YAAA 1DI8A 5EHOA 4ZEGA 3QD4A 3WBLA 3ZU7A 3TUBA 2OG8A 3PJCA 4CT2A 5JH6A 5M4CA 3QLGA 2UW8A 3R01A 2CN5A 2WD1A 3HA8A 3RK9A 4FVRA 5BYLA 4ASXA 4ANLA 5J9YA 2PVKA 4FTKA 4GKIA 1OL1A 5L2IA 5L6PA 4XG9A 3PG1A 3TKHA 2VO3A 3EN6A 4U79A 4XEYA 1ERKA 4NFMA 4YJSA 3H3CA 4Q5HA 1PHKA 3DZQA 3LCDA 3MB6A 3QTSA 4YTCA 3UODA 4D4SA 2J0KA 3OUNB 5EM8A 2PMIA 4CLIA 2YJRA 4USEA 4L52A 4HVDA 4AFEA 4DH3A 1UNGA 4U7ZA 5LWMA 3E62A 2CMWA 3V5LA 4PMTA 3HMOA 2X0GA 4E5BA 3TV6A 2HK5A 3COMA 5ANOA 3AC8A 2XEYA 1UA2A 4E6CA 1YHVA 2XB7A 5KX8A 5KO1A 4QMVA 4QTDA 4EHVA 3E7VA 1PMNA 5E1EA 3KXGA 3PZHA 4DT8A 1OMWA 2CKEA 4D28A 2ITWA 3AD6A 4EOIA 4FTQA 5BUIA 3LCOA 5HORA 2BCJA 4L45A 3NUUA 3AC5A 4GUBA 4MKCA 1DAYA 2G2FA 2I0YA 3CBLA 4ITIA 4QMTA 4I5CA 4U3YA 5BVNA 2OF2A 4YC6A 5AA8A 4OTQA 4RIWB 3ORTA 4O2ZA 2E9NA 4Y95A 4PV0A 4X3FB 3ROYA 5DGZA 4N4SA 4ARKA 4AG8A 2XNBA 2E9UA 4B9DA 4BL1A 2PZPA 5DE2A 2G01A 3KRWA 3R8PA 4K6ZA 4BFMA 4D4VA 2WQMA 1WAKA 4I21A 4OTDA 1XR1A 1UV5A 3ODZX 4DCAA 3TNWA 5C4LA 3MY0A 4F0FA 4FG7A 3U54A 2R9SA 1QPCA 2R3OA 3GEQA 5GZAA 2LGCA 2DUVA 3A7GA 2YIRA 4S34A 2IVSA 3V04A 5HBEA 3PZEA 3MY5A 3KGAA 2RFDA 4CSVA 4AOTA 2OK1A 3DBDA 3Q4UA 4ITJA 3NAYA 3KXHA 4O7RA 3NYNA 1M2RA 4FF8A 3V6SA 4RJ8A 4B8LA 4F99A 4FIEA 2BFXA 2REIA 5CY3A 5HKMA 2X8EA 2XK3A 4O0SA 4X6RA 3OWJA 4A9TA 3MESA 1H1PA 4FNZA 2HWOA 4XJ0A 2VWZA 3KU2A 3NCGA 3FZRA 4PNKA 5AP4A 4D5HA 5BVEA 5BYYA 4QTEA 4IBMA 1IA8A 2CCHA 3W55A 4KSQA 1OIUA 2IG7A 3POZA 5CYIA 4M12A 1KOAA 2W5BA 4F1OA 4AT4A 4L00A 3F9NA 4C34A 3QQLA 3ZEPA 2GNHA 3EJ1A 5BYZA 4RVTA 2QOQA 4EC8A 3NDMA 4YJRA 5GJDA 3ZSIA 4PF4A 5HE0A 3PXFA 3WZUA 4D2PA 3UQFA 5CNOA 4FBXA 3ATSA 2G15A 3MVLA 3SRVB 4DA5A 4FNXA 1VEBA 3IW7A 2W1EA 3E64A 1U54A 4RJ3A 1ZZ2A 5L2QA 2Y4PA 2VO6A 3WE8A 3SC1A 3QD0A 4F6WA 3MIAA 4ANOA 5EYCA 1CKJA 1TQMA 1BL7A 2WEVA 2UZWE 1LUFA 5AUYA 1SVGA 4ZZOA 1FVVA 4Q2AA 5AP0A 2UVXA 2OLCA 2WTKB 1VYWA 2BKZA 4KS8A 4XLVA 2XRUA 3UJGA 3V8TA 1ZYJA 4DG2E 5KMMA 2CKQA 2QLQA 3PDTA 2RG5A 4RBLA 3PTGA 4RWKA 2PVLA 3NS9A 3PWDA 3LMHA 5EW9A 3EL7A 3IDPA 4AXAA 3HKOA 2G2HA 3DTCA 3CGFA 3O50A 4FI1A 3ALOA 5ITAA 4ITHA 4MWHA 4R1VA 4X3FA 3IW8A 1ZOHA 4R1YA 4RZVA 2Q83A 4BN1A 5EI6A 4YP8A 5BVDA 4WG4A 3E87A 3R22A 2XA4A 3R7GA 3GU6A 4FTCA 2W4OA 1FMKA 2R3RA 2PZRA 3PFQA 4EQCA 5EHLA 2FSMX 4CGAA 4HGSA 4RFYA 4AACA 3EWHA 2R3MA 4WSQA 3DTWA 2R3IA 5IA2A 4EH7A 3TDVA 3QRUA 3S3IA 5AEPA 5L2WA 2PVYA 4MD7E 5ANKA 3E93A 3IO7A 5FBNC 1SVHA 4A9UA 2Z02A 5KMJA 5CF8A 3TL8A 4IFCA 3Q4CA 3HP2A 3Q96A 3MH0A 2V0DA 3E8CA 2J51A 4RFZA 3R8ZA 5K4IA 2XIRA 2WMQA 3NW5A 3NZ0A 1LR4A 3GCQA 4FEXA 1XKKA 1YXTA 2Z7SA 5JFVA 5LWNA 3WF7A 5KMLA 1R39A 5AMNA 3NIEA 2P55A 4G3DA 3GVUA 4FZDB 2V22A 4IZYA 3SOCA 4LL0A 2R7IA 3MPAA 3SKCA 5HE3A 3ZC6A 3KVWA 3ID6C 3KL8A 4RIWA 2OXDA 4RIXA 4ALUA 2IPXA 5FXQA 3AT2A 3HX4A 4P90A 3WF6A 4E7WA 4HVGA 2FB8A 5HNBA 1DI9A 3RPRA 3ET7A 2ZM3A 4XRJA 4FICA 4OLIA 1I44A 1KSWA 4O84A 3LFFA 3UC4A 4R3RA 2PU8A 3FEGA 5ANEA 4BDDA 3SRVA 4KIQA 4HYIA 3A99A 4FG9A 3VWAA 2C68A 3UOLA 4YJOA 3UQCA 4AX8A 3QRIA 3F61A 4XG4A 4FTNA 4R77A 3H9RA 4I6FA 4OGRA 4Y73A 4U6RA 4C8BA 3QA0A 3D2KA 4A07A 3BHTA 4DF3A 4LQMA 4C02A 3F3UA 5EYMA 1JBPE 3LFEA 2PVNA 4CCBA 2WTKC 1O6KA 3ELJA 4BCNA 4JNWA 5A46A 3TJCA 5AA9A 2UW5A 3C0GA 3R8MA 5A4EA 1FGIA 4N57A 2X4ZA 5DVRA 4I3ZA 1GIJA 4FUYA 4IQ6A 2R2PA 4FK3A 4W8EA 2B1PA 4NL0A 4QP1A 1RQQA 4RQKA 3BYOA 5M56A 3ORIA 4KSPA 1QCFA 2C5XA 1ZAOA 4TYHA 4D58A 3K54A 2QLUA 3FZSA 5T68A 3FPQA 5HZNA 4MNEB 5J7HA 4EC9A 2ZV8A 1O6LA 4H3PA 3B2TA 2PSQA 3DKFA 1M2PA 5LVMA 3ANRA 2VNWA 3UP2A 3LFQA 4TRLA 3U4UA 5AUUA 4JBQA 4F7LA 3O51A 3AC3A 5HO8A 4IIRA 2R3QA 3EOCA 5D12A 4IVCA 3ZS5A 2YM7A 4I0SA 3CY3A 1RJBA 4EZ3A 1SYKA 2YCSA 3TI1A 3UG2A 1PKGA 3H4JA 4PWNA 2WMAA 3CPCA 3C0HA 2YJSA 2XK4A 5GINE 3F5GA 4S30A 2Y6MA 3WZKA 4JAJA 5G6VA 2NO3A 4ERKA 4BB4A 3L8PA 4NSTA 3PPJA 5CQWA 1YXXA 3CJGA 3QA8A 4M15A 3DLZA 2GCDA 2YCRA 5C9CA 4MYGA 3FLYA 2J0IA 3A8WA 4X6QC 3AG9A 4E93A 3U6JA 3ZO1A 4BI0A 2DS1A 4K0YA 3D5UA 3WZDA 3FMKA 5L6OA 3ZZEA 3WIKA 3VN9A 3DXPA 2GS7A 3OP5A 4QMUA 3FUPA 2RFSA 2PY3A 3VF8A 5EQEA 3COHA 2VTTA 2X2KA 3MPTA 4FV9A 3FY0A 3ORZA 3KCFA 3KXXA 3RAIA 4YPDA 4BDGA 4RC4A 4L44A 4NUSA 4NYEA 3NR9A 2QR7A 1ZYCA 5E8VA 4X3FC 2OXYA 2YM3A 4IAKA 4I93A 2HOGA 1PMEA 2J5EA 3QKKA 4AE9A 2BDFA 3P0MA 4IWOA 4NKSA 3HRFA 3PVGA 2PZ5A 3Q2MA 1XHAA 3HUCA 4DFZE 5KBRA 5EI8A 3D4QA 4BBFA 4C3RA 4RWIA 3QALE 4LOPA 3BU5A 5HCZA 4YHTA 5AR3A 2QOCA 5E7RA 5JFWA 3KMMA 1X8BA 3DNEA 2OSCA 4QP8A 4EK5A 4XG3A 3PLSA 4MXXA 4FKTA 3RCDA 3HV5A 5TF9A 3EQGA 4CRSA 5KBQA 4HNFA 3ORXA 4FKGA 4G34A 3UG1A 5IQDA 2VD5A 3NNUA 5M4FA 4FKVA 4AT3A 4CV8A 3NNXA 5IQBA 4C62A 3AD4A 3OC1A 3QQUA 2A4LA 4F7JA 2BUJA 3ACKA 1F3MC 3PPKA 1GNGA 1PKDA 4EOOA 4PPCA 2C3LA 3JY0A 4CZTA 2C6KA 4MXYA 4ONAA 5K5XA 4II5A 2B9HA 1F5QA 4NCTC 2X7OA 3NX8A 2WQEA 2BR1A 4UWCA 4XMOA 4D2TA 3BE2A 3GU7A 2YIWA 5E8XA 2VTNA 1W98A 1REKA 3R7EA 4AQCA 2QG7A 4E8AA 2XKEA 3DOGA 4M7IA 5I9UA 4JBPA 3RBWA 2JIIA 3G9LX 1L8TA 4BZDA 4KWPA 3V5PA 3W2RA 2WQOA 2XJ0A 3P5KA 4I20A 3R63A 4PUZA 3Q5IA 2PUIA 4FE2A 3D7ZA 4RFMA 4DGNA 3MH1A 5AUWA 5HEZA 2GMXA 4U43A 2RL5A 2WIHA 3P9JA 4P5QA 4EOQA 2JDTA 2FGIA 2UVYA 2VWBA 5LXMA 4BDEA 5I3OA 3V8WA 4F7NA 2YDKA 4F9YA 3GQIA 2X9FA 4ZS0A 4CYJA 4QMNA 3GFEA 3UZTA 3LAUA 2QCSA 5DN3A 2PMLX 3OY1A 3W8QA 4HCTA 4J53A 3F88A 2O5KA 3A60A 2UZDA 4U45A 4IJ9A 3R9RA 4DBXA 1JKSA 4OTGA 3SXRA 4O2PA 5IMEA 3C5IA 3C13A 4UXQA 3TN8A 2JAMA 4OT6A 4CFVA 5L8LA 1Q5KA 4K2RA 2WNTA 4FNWA 3OT8A 4MF0A 5J1VA 4GKHA 3SW7A 4GCJA 4U44A 4G17A 4DLIA 5D1JA 2JBOA 2EXCX 4QP2A 3PXQA 2EUFB 4A06A 3IPHA 5IEYA 3R30A 3FE3A 3TACA 4AW5A 4UX9A 2V7AA 2G9XA 2QO9A 2WMWA 3E7OA 1YVJA 2IVUA 5AAGA 3ZDUA 1Q99A 2UZBA 3KCKA 4I1ZA 5A14A 4GFOA 3Q52A 1OM1A 2XIXA 2PHKA 3KQ7A 2JKKA 2GS2A 2XNEA 3VS3A 3NUNA 4ZSAA 3G15A 4GG7A 5IZFA 1UU3A 2ZAZA 4M68A 4I4FA 1JSTA 5CU3A 3WIGA 2F57A 3DKGA 1OL5A 3U9NA 3KB7A 5M4IA 2XH5A 3OHTA 4IZ5A 4OTIA 3Q04A 4RX9A 3KC3A 5K5NA 2QO7A 3BWJA 3PXKA 3D94A 5KUPA 4C4HA 3V5JA 2WZJA 4XV9A 4O21A 2GNFA 4JLCA 3BELA 4RWJA 3PJ1A 3NW7A 1REJA 4L7SA 3DQWA 1K9AA 1OKYA 4IHPA 4RPVA 4TXCA 3WYXA 3WZJA 4J8MA 1Q3WA 4EK3A 5EYDA 4F7SA 3P4KA 2ITUA 4CFXA 4RG0A 2Y7JA 4L6QA 3VVHA 3ZLYA 4KA3A 4XP3A 4EH9A 3A4PA 4IDTA 2WFYA 3MDYA 3QF9A 3GP0A 3MVHA 1T46A 4D2RA 3D7TA 4AGDA 3QKLA 2QURA 1XH8A 5HX8A 2XKFA 3KXMA 3LZBA 1H1RA 4D1ZA 1R0PA 1CM8A 3HMMA 3TZ8A 2J90A 5LVOA 3GOPA 4F1MA 5HCXA 4L67A 2BIYA 1YI4A 4UWYA 5FEQA 5H9BA 4RX8A 4A9YA 5GIOE 3OFMA 3FHRA 5LVLA 4DITA 4AT5A 1UNHA 1OUYA 5IQAA 4XOZA 2OFVA 2YLFA 4DFNA 4QPMA 4AGCA 1GZ8A 4O86A 3KF4A 3MJ2A 2A19B 4DEEA 4MBIA 1M17A 3F3VA 3G90X 2ETKA 3MB7A 2WOTA 2ZV2A 4O1OA 4OAVB 2QOKA 4FSTA 3KK9A 3R9DA 3P7AA 3HVCA 5AP6A 5C8NA 4WNKA 2BIKB 3PVUA 2X2MA 2RGPA 1H24A 4FGBA 4ZLYA 1WBVA 4ANSA 5AFVA 1OUKA 4P5ZA 4JX3A 4YR8A 1SZMA 4MNEA 3SXFA 4ZTSA 2X9EA 4HJOA 5AADA 4WKQA 4DTKA 2E9PA 4G1WA 2BVAA 2BZHB 4YZBA 4DC2A 2YITA 3LLAA 2KULA 1GZOA 3R21A 2OICA 3CKWA 4O0VA 4ZY6A 3EL8A 5EQPA 3U55A 3VUTA 4PPAA 4AN2A 2R3HA 4RWLA 4M97A 5AP2A 4AE6A 4AUAA 4E26A 2VTAA 5BPYA 2IW6A 5FP5A 4PMSA 4M14A 5E8SA 3MA6A 4ZK5A 5IEXA 4KKEA 3DJ7A 3OOMA 4HVHA 3NCZA 4C58A 5AUZA 1Y6AA 2RKUA 3VO3A 3AGMA 1MP8A 4FTMA 4OTPA 4W9XA 3ROCA 3ZMMA 4UY9A 5JQ5A 3RP9A 3LHJA 3SG8A 4PTEA 2WGJA 3W18A 5AAEA 4G3EA 1LEWA 4KBCA 5CX9A 4EHZA 3GCVA 1BLXA 5HTBA 3VBVA 2GQRA 3VRYA 1M7NA 2J0MB 2GSFA 2QOBA 3JVSA 3KVXA 3O2MA 3P79A 3VJOA 2OH4A 4LV8A 3FI2A 4C33A 4JX7A 5TOZA 4F1TA 3OXIA 3C1XA 3KULB 3TCPA 2I6LA 4AF3A 3ZLXA 4FIHA 3T3UA 2CKPA 2QQ7A 2OIQA 4G3GA 4BDJA 4E1ZA 3QTZA 2XVDA 3O8PA 1H27A 4MBLA 4E20A 2JIUA 5CQUA 5FTGA 1JVPP 3EFKA 4IAAA 3ZFXA 4ACMA 5JZNA 3KKVA 3NRMA 3RNYA 3FZ1A 4HZRA 5FM2A 2AUHA 2V55A 3F7WA 3QUPA 5CT7A 3I60A 4XHKB 3VUKA 1R0EA 3ERKA 3FY2A 1UKIA 5J79A 3R1SA 4FV8A 4M69B 5AR2A 3EN5A 3QZIA 3COIA 3L1SA 4FV6A 1B39A 2Q0NA 5CANA 4A4XA 3E3PA 2HWPA 4G16A 1Q8YA 2JLDA 4V0GA 3KREA 4KBKA 3FPMA 4RIXB 1U54B 2X39A 3DLSA 3EZRA 3R71A 3TZ9A 4Y83A 1H07A 4J71A 4YJNA 2WTIA 3FLQA 4KRDA 4YZNA 3RJCA 4DBNA 4E5WA 3H0ZA 4TNBA 3RM6A 3W2QA 3QRJA 1ZWSA 1FOTA 4FL3A 4FYNA 4DG3E 3ALNA 4MBJA 3ZLSA 2PWLA 3SGCA 1DAWA 5LCJA 4BDCA 3CKXA 4FYOA 1GIHA 3FAAA 1HCLA 5M09A 3PA4A 4RLLA 5HIDA 3R7IA 3WOWA 5CEOA 4YBKA 4BDKA 1OBGA 3DPKA 3MI9A 4KBAA 1GOLA 1E1XA 5E8ZA 4ZS4A 5KCVA 4BI1A 5LMKC 5GIPE 2XNMA 2YIYA 3I0OA 3ZRKA 5I9VA 3VQUA 3EYHA 1W7HA 4XYFA 3N9XA 4DFUA 2C47A 4NM0A 4O0YA 4CMTA 4TL0A 4K18A 3MH3A 2PVRA 5HOAA 1OECA 4PY1A 5KKRC 2B0QA 5HHWA 4YHFA 5I5ZA 5EM5A 3VC4A 5IU2A 2I0VA 3C7QA 4GS6A 4O6LA 2YZLA 2NRUA 3DCVA 3VS1A 2Z7RA 4RX7A 5HG7A 4R7BA 2HZIA 3MFUA 1XWSA 1QPJA 5E92A 2IVVA 3PVWA 4W4WA 2B9JA 4EI4A 2P2IA 1UVRA 4H1JA 1KE5A 3FYKX 3LFCA 3S00A 2OFUA 2XCKA 4RLKA 4FVPA 4H58A 4IH8A 4Y46A 3LXPA 3COKA 4BWXA 2WMVA 2UW6A 3OEFX 4G5JA 4HVIA 3N4VA 4FL1A 1G8AA 3HRBA 4D4RA 4IACA 2YCFA 4N6YA 3QD2B 3PRIA 4WG3A 5EOLA 4YO4A 1KOBA 3QUEA 2F49A 5M57A 1OL7A 4YZDA 5EDRA 5LMBA 4E3CA 1RE8A 4PP7A 2PZYA 2XF0A 5CI6A 4AN9A 1Y8YA 5AM6A 5F20A 3LFDA 3DBFA 2WTJA 2GPHA 3EZVA 4GU6A 1V1KA 5KZIA 5LMAA 4QP6A 1PY5A 2OI4X 4O7WA 4CEGA 4FV3A 4IW0A 3MTFA 2O3PA 4LYNA 4WNPA 3AGLA 3GCSA 2ZB0A 1Y91A 2I0EA 1KE8A 2R64A 4G6OA 3ULZA 4B0GA 4BDIA 5CF5A 3F2RA 3DKOA 3O8UA 5I9ZA 4ZMFA 2C6OA 4ZTNA 2JDVA 4FTOA 3CLYA 4CFFA 3ZTXA 3AC2A 4L3PA 4UB7A 5IQFA 3ZO2A 4LRKA 4E6QA 5H2UA 4QYHA 3FV8A 2RFNA 4IEBA 1YWNA 2VRXA 4TN6A 4GFMA 4PX6A 4R3PA 4DFXE 3D15A 2GHGA 2ITZA 2W5AA 1NXKA 1PYEA 2BZKB 3QC4A 4JDIA 4RVMA 3S4QA 5HO6A 2OJFE 5H8EA 2QG5A 3RPOA 2ITQA 4TPTA 3EQFA 4QMSA 3KK8A 5JRQA 2F9GA 1XH9A 3G2FA 1MQBA 5A4CA 3MV5A 5KMOA 2OBJA 3HL7A 3BQCA 4ENXA 4CG8A 3UGCA 2A0CX 4GK2A 1PW2A 4O7VA 2W1IA 1YKRA 4NTSA 4FKIA 5IUIA 1HCKA 3CS9A 3NWWA 3QGYA 4CMOA 3MN3A 5IPJA 5K0KA 3QRKA 2IZRA 2UV2A 3FI3A 4GYGA 3DBEA 4YSMA 4HOKA 2JITA 4IX6A 4QMOA 4FT3A 4EYMA 5JK3A 3BLHA 4BTMA 4LI5A 1NT2A 3GBZA 3RHKA 3QZFA 4IM0A 4F4PA 3P1AA 2PE0A 4AU8A 4GK3A 3U6HA 3B8RA 1PJKA 4RJ5A 1SNUA 3EMGA 3O7LD 5H3QA 4ZSLA 2YIXA 4GVJA 4LMUA 1R1WA 2J0JA 2EWAA 1MRUA 5DRDA 1URCA 2ITOA 2Z7LA 4FTRA 1IR3A 4BIEA 4O7ZA 3M42A 4AGUA 4PL3A 4QMWA 5DOSA 2VTLA 5E8YA 3TTIA 1OBDA 1H26A 2CHLA 3IDCA 5AM7A 4AS0A 4NWMA 4MEDA 4USFA 3IK3A 1MRVA 4FKOA 4FTIA 1JKKA 3U6IA 3PE2A 3Q9YA 3OMVA 4O1PA 3E3BX 4E6DA 4GL9A 4ZLOA 4EBWA 3WI6A 2PVJA 4HCUA 2XEZA 4FTTA 5B7VA 3HZTA 4FV4A 1XJDA 4MTAA 3EB0A 2ITNA 3DB6A 5AP7A 2VTPA 4IDVA 4EH6A 3VUHA 4AA0A 5I9WA 1IRKA 1W0XC 2PVMA 2XNOA 3PY0A 1Q8UA 3JS2A 4UYAA 4EQMA 4AW1A 4NTTA 3QQJA 2VX1A 5A3XA 1R3CA 3BHUA 5CEKA 4Z3VA 4IVBA 2J4ZA 4JXFA 4X2FA 4BYIA 3RZBA 3B2WA 1OKVA 4FSQA 4J1RA 2WXVA 4PL4A 4HYSA 4DE4A 3LFAA 2QD9A 4K9YA 4IWDA 4YZCA 2VX3A 3K5UA 2CGUA 4DGMA 2BAKA 3OVVA 3PLAE 3QL8A 2A27A 3ACJA 3BEAA 2NRYA 2C6DA 2VWIA 4FT7A 4GU9A 4IFGA 4DEAA 1QPEA 3QC9A 2QOHA 3NGAA 3PG3A 3A61A 4FZ6A 2Z8CA 4FSZA 2C6EA 4O0WA 3LMIA 3FHIA 2XKDA 5M07A 4ACGA 5HIBA 3ULIA 2BRGA 3ZBFA 4RIYB 2KTYA 5T6KA 4NEUA 4FKSA 4ZTHA 5HGIA 3PWYA 4QMPA 5AR8A 4EH3A 1Q8ZA 3EQDA 4LUEA 3U9CA 2C0IA 5FUTA 3RZFA 2GFCA 3OCSA 4G9RA 3LQ3A 3G6HA 1M7QA 4FOCA 5CSWA 5FEEA 4I5PA 4GMYA 4PTGA 4DH5A 4NKAA 4NT4A 4YPSA 1YI3A 2ZV7A 4F9AA 3VAPA 1UNLA 3W2OA 4HYUA 1W82A 5A9UA 5HU3A 4IX5A 5M06A 4L7FA 1O6YA 1YDSE 3KMUA 3DGKA 2JKOA 2VWYA 3DB8A 2WIPA 2QOFA 5L8KA 1M2QA 2BILB 3CIKA 1PXIA 3ORNA 3OW4A 4M8TA 3RGFA 3TV7A 4M69A 3VF9A 1XQZA 1JKTA 2ETRA 1OPJA 3BYVA 4J98A 3VULA 1PXNA 2UW0A 3FLNC 4BBEA 3K5VA 2HENA 4I6QA 5IQCA 3E5AA 4H36A 5IA5A 3VS4A 4YSJA 5AX3A 4IX3A 3ZFMA 4AZFA 4DEDA 3WF5A 4H3QA 1OI9A 1EH4A 2BAJA 3MW1A 1WVWA 3PY1A 4TW9A 3LPBA 3U51A 3EQIA 1GZNA 5ETAA 4S33A 4ORKA 4ZZMA 3M11A 2ZJWA 4BTKA 5CF4A 4EOMA 3RVGA 1ZLTA 5CALA 3SHEA 2FUMA 5CXZA 1PXPA 2JIVA 4CMUA 5DT0A 1KE6A 4XNEA 4C36A 4K33A 2UW7A 3HV6A 2VWUA 4TT7A 1ZYSA 4F09A 2VZ6A 5DIAA 1Y57A 4FSRA 3HGKA 2ZMCA 3R9OA 3ZCLA 2JGZA 2X81A 1FQ1B 3HDMA 3R2BA 5JRSA 3W1FA 5HVKA 2J5FA 2BDJA 2OIDA 2I1MA 3GB2A 3DS6A 4PQNA 1S9JA 4DFBA 3BE9A 4ZY4A 3W16A 1BI7A 3DZOA 4MX9A 3PIYA 5CEMA 5F9EA 3F5XA 3VBWA 5C01A 3DAJA 4E5AX 1KV2A 3FSKA 3CQUA 3KEXA 1S9IA 5C26A 4TZRA 3BBWA 2GFSA 2JC6A 4LGDA 4D5KA 2XK6A 1GIIA 3RHXA 3MPMA 5CAVA 5J9LA 4O7YA 3ZLWA 4J97A 3FMMA 2ERZE 4AGWA 4OT5A 2EXMA 2E9OA 3QQHA 1PRYA 2GU8A 2ITPA 2W9ZB 2OGVA 2JAVA 5J87A 4E4LA 4TYIA 1ZRZA 5FEDA 3QGWA 2O64A 3CY2A 3QHRA 4DLJA 5IQEA 2B52A 2ZVAA 3TWJA 4FV0A 4JR7A 5B2KA 5BMSA 3LQ8A 4XG7A 2C5YA 2BROA 4OTFA 3OBJA 4O7TA 1NY3A 3BLQA 1OVEA 2VTOA 3NUSA 4QPAA 3QFVA 2J7TA 4YTIA 4ZTQA 5ACBC 2R4BA 4YBJA 3V3VA 2G1TA 4FC0A 2GHLA 4IC7A 4JL9A 4NM5A 3BYUA 4YC8A 5IF1A 3HNGA 1Z57A 4IWQA 5HG9A 1OPKA 4DN5A 2OO8X 2BHEA 2CN8A 1OB3A 3P7CA 3NEWA 3UMWA 4BDHA 3FZOA 4FODA 2Y4IC 2VO7A 3JVRA 4N70A 5FGKA 3DV3A 5D10A 5H8GA 1Q4LA 3QX4A 3D7TB 5F95A 3VS2A 3EKKA 4IC8A 2F7EE 4M84A 4ASZA 4BTJA 2GS6A 4WHZA 4Q9ZA 4CVAA 4OTWA 2F2CB 3W8LA 4DH1A 3H10A 5AR4A 5LQFA 2X6EA 3DBQA 2UZNA 4QQCA 4HGEA 2OKRA 4BCHA 3I79A 4XX9A 3G0EA 4LOOA 4RSSA 4C3FA 1YOLA 3F3TA 3HYHA 1NVQA 4QTCA 1FVRA 3R6XA 5AR7A 2BFYA 4DTAA 2HY0A 4RIOA 3DBCA 2PTKA 4CKIA 1XH6A 4X2GA 5DYJA 4MNFA 1Q61A 3PY3A 4JR3A 4UZDA 2W06A 3R73A 2C69A 5FM3A 3LKMA 2O0UA 3FSFA 5LCKA 3BPRA 3WZEA 3FXZA 1STCE 4PRJA 3RNIA 3FKOA 3WARA 4JIAA 5HLNA 2Y6OA 2C3IB 3F5UA 5DBXA 3AMAA 4MWIA 4RJ4A 4B4LA 1Q3DA 3UOHA 4NCTA 4O96A 3UVQA 1K2PA 1W84A 3H9FA 2ITXA 4QTAA 5B0XA 5F4NA 4XG2A 2OJGA 4O27B 3LCSA 3R7UA 5JKGA 5FD2A 3CD8A 3V5QA 4NM7A 4E6AA 2X7GA 4WD5A 4WT6A 4MXZA 3EFLA 1ZMUA 4H39A 4O38A 5EDQA 5E91A 4BC6A 4C7TA 4E4NA 5HIEA 3DXQA 4FTUA 2WMXA 4K8AA 1H0WA 2QOLA 4L01A 4PP9A 4R5SA 2OJJA 4FV2A 5EG3A 4IX4A 4DEGA 5AV0A 4CZUA 5DR9A 3IOPA 4EKLA 3EH9A 3HV3A 4HCVA 4LUDA 4X2JA 3NUAA 3QYZA 4IMYA 2IZSA 2GHMA 4XV1A 4BKZA 2W4JA 3DJ6A 3NYXA 2ZV9A 3QWJA 2VGPA 4U42A 3CTQA 1J3HA 4BDFA 2H9VA 4QRCA 4UMQA 4GT3A 5H8BA 5I3RA 3MBLA 4X2KA 1E9HA 3L9LA 5CF6A 2IVTA 1CTPE 1TVOA 2UUEA 2ZM4A 4FGRA 3IW4A 3FYJX 4A9RA 3UC3A 3FL5A 5A6NA 5E8TA 4FEWA 2VX0A 1JNKA 4CFMA 2C1AA 3ORLA 4JQ7A 2OH0E 2DWBA 2B55A 3FQSA 4IADA 1R78A 3SOAA 2F7XE 4FKJA 1OITA 1M14A 1H01A 5E1SA 2XIKA 4BBMA 2IZUA 4QNYA 3BQRA 4C0TA 3QHWA 4BI2A 3PP0A 3CEKA 4OR5A 3KY2A 3TIZA 1Q97A 4F9WA 4Z16A 2JBPA 2OZAB 3GENA 4P7EA 4TY1A 3GT8A 4AZTA 4EH2A 4X3JA 3VS5A 3F3WA 2OJIA 5FLFA 4D2SA 4YJUA 3D2IA 5JFXA 3Q32A 3CQEA 4L8MA 3LJ2A 3RWQA 5E9EA 2UZTA 2RF9A 2WMSA 3DK7A 1ZY4A 3P78A 3SLSA 3ZBXA 2VU3A 3AD5A 5AIRA 4KAOA 4RX5A 4EWQA 4JOAA 2C0OA 3ZRLA 4Q9SA 3PUPA 5FTOA 5JMSA 4DEIA 2YDIA 4MF1A 2CLQA 4GFGA 4V04A 5CT0A 5TO8A 4BHNA 5BQ0A 4BIBA 4XG8A 1DS5A 3BBTB 5IEVA 2QOIA 4GW8A 4YC3A 5K0XA 4AZSA 4QYFA 5IMXA 2JEDA 5DRBA 5EI2A 4BCGA 3BU6A 4QT1A 5AX9A 4GRBA 3DK6A 3F3ZA 4KKHA 2YACA 3R1NA 3DA6A 5D7AA 2QI8A 3L9PA 5HBJA 3HMIA 5AUVA 3AC4A 2JDOA 2WMRA 4TWOA 4XG6A 5M44A 5BX0A 5C1QB 2V5QA 3P23A 3QCQA 2R3GA 1PXJA 1OZ1A 2BDWA 3UE4A 1Q41A 3VW6A 5F1ZA 2XJ1A 2NPQA 4ZOGA 3TNIA 3BRBA 2EB2A 4FIJA 3P08A 2PULA 2P3GX 2JDSA 1HOWA 3HV4A 4OTRA 4U0IA 4ANQA 3W32A 1OGUA 1A06A 1GAGA 4IVAA 4IB3A 2E9VA 2QHMA 4I5HA 4QNAA 3TZ7A 2R0IA 3EHAA 3OOGA 4W4VA 4FEUA 3SAYA 5DH3A 1U5RA 2BTSA 2W1FA 1QPDA 4M0YA 4PMMA 4JG8A 1YHSA 4QP3A 3VHKA 4EK6A 4F65A 3NUPA 3A7IA 3GQLA 3GU4A 3L8XA 4Z55A 4UZHA 2HIWA 4D2WA 3IQ7A 2CGXA 2UVZA 3O0GA 3I6UA 1WBTA 3UIXA 2A1AB 4O7LA 2YHVA 3NIZA 2XRWA 4EWHA 3UVRA 3UMXA 4EZ7A 4FSMA 4QP7A 3EQHA 4XBRA 2C6LA 3NLBA 4EOSA 3QTIA 1FBNA 4BZNA 4NH1A 4U9AA 3I4BA 3QKMA 5CVGA 2GNJA 1CMKE 1VYZA 4HZSA 4L3LA 3L9MA 5M4UA 3QBNA 3ZHPC 3NNWA 2GQSA 3F5PA 3BV2A 3GC0A 3OCTA 4F6SA 1VJYA 4FG8A 3PXYA 1GJOA 3ZO4A 2EXEA 5HE2A 2PPQA 2VWVA 3R04A 5A4QA 2WKMA 1H25A 2FSLX 5DWRA 5EKOA 1ND4A 5JT2A 3QCSA 4LRMA 4G5PA 4ZJIA 3HA6A 4FZ7A 5CS6A 3WE4A 5D11A 3AOXA 2C3JA 2I0HA 3HUBA 3I5NA 5FDXA 3ZSGA 4EOJA 3FI8A 3KA0A 1PMVA 3CXWA 4JDHA 3E8DA 3R7OA 1FINA 2R3NA 4P4CA 4Y8DA 2HZNA 4CZYB 4JDKA 3I0QA 3QX2A 4EZ5A 1TQIA 4YURA 1ZOEA 2WU7A 4R5YA 4ZSGA 5I9YA 4OW8A 3MGYA 3QD3A 4DAWA 5HX6A 2YIQA 1A48A 1WVXA 2GNIA 3LMGA 2B4SB 2QU5A 3A7FA 2ZDTA 1U46A 3GC8A 4NW6A 1OIQA 2QU6A 2VWWA 1CKIA 4USDA 3UPZA 4FT9A 2WMBA 5AP5A 3E88A 2W4KA 3HRCA 3BEGA 5KHXA 4G31A 4NJDA 5DG5A 4RT7A 5M55A 3NUYA 2UZOA 5IA4A 2JDRA 3R9NA 5IA1A 5M53A 5HTIA 3BGPA 3MS9A 5T3QA 4IB0A 3W33A 2J9MA 5FP6A 3ORKA 4BDAA 2R5TA 3PYYA 5J5SA 3AXWA 1PF8A 3CP9A 5ETFA 2HW7A 1JWHA 2BHHA 3QAME 4WIHA 5K4JA 4EHEA 3SQQA 2FSOX 4FL2A 2XNPA 4FKUA 3W2PA 2VNYA 2HYYA 3GCPA 4GJ2A 4M66A 4W8DA 2X4FA 4DT9A 5DEYA 3PE1A 4S2ZA 4FZFB 4FT0A 2XK7A 1AQ1A 3S0OA 1ZYDA 4L3JA 4FKWA 5AUTA 5KNJA 3HAMA 2BTRA 3NYVA 3CSVA 3RAHA 5HG8A 3HMNA 2ONLA 2XM9A 4D9TA 5ETCA 4G3CA 4LRJA 2OXXA 2W99B 4F08A 4YU2A 4GUEA 5HI2A 4QYEA 5EW8A 5TKDA 3UO4A 3LFBA 2WEIA 4NM3A 5LMKA 4CQGA 4PDYA 4YNEA 1J7UA 5LARA 3UO5A 5AV1A 2VAGA 3V01A 4I6HA 4JG6A 5EHYA 5L3AA 2VWXA 3PSBA 3MVMA 3LW0A 5M51A 4GVAA 4AWIA 3OW3A 5E4HA 3IGGA 2PVHA 4FKPA 3OEZA 3EN4A 3AQVA 4R6VA 3QTWA 2UZEA 4C2VA 2PUNA 4S31A 3REPA 2R0UA 2RFEA 4NJ3A 3FLSA 4EOPA 4KD1A 4FTJA 4BCQA 2WELA 2YERA 4TYGA 3V51A 3O71A 3NYOA 4ZTMA 3G51A 2XJ2A 1H00A 4HGTA 4YJTA 5HLPA 1G3NA 1E1VA 2XBJA 3BI6A 4D1SA 3LFSA 2WMTA 3ZXZA 2CNVA 3VBTA 4ZSJA 3MJ1A 2R3LA 4MHAA 3RK7A 3OUKA 5I4NA 2XK9A 3MYGA 4R8QA 4PNIA 5BVKA 3FC1X 3R7VA 5HO7A 5DT3A 5IDNA 4ZP5A 5CAUA 4WOVA 3DFCB 4TTHB 3QRTA 4JBVA 5I0BA 2C5OA 2X2LA 3CC6A 4U3ZA 3DDQA 1YOJA 4RJ7A 5CSPA 1ZY5A 2PMNX 4FEVA 3E8EA 3UOKA 1FPUA 1GZKA 1RW8A 1ZMWA 4XH6A 5BUEA 3TKIA 4WRSA 3DFAA 5BMMA 4NW5A 2O8YA 4FSWA 4UMUA 5IQHA 3LJ1A 2OJ9A 2V7OA 4BCJA 4QMLA 4J52A 2R3FA 5IISA 1U4DA 2C0TA 2CNQA 4CG9A 2DYLA 3CE3A 3D5XA 4O91A 4CTCA 5HICA 4L43A 1Q8WA 3LIJA 1YDRE 3VHEA 1V0PA 5IA3A 4GV1A 3RPSA 5DNRA 3WF9A 3TIYA 3R02A 4D0WA 3V8SA 4O82A 2PVFA 3BHYA 2AC5A 3PJ2A 3Q2JA 4PMPA 3KN6A 4G6NA 4LFIA 5E8WA 5KKRB 5AV4A 4IANA 2ESMA 2WTDA 1WCCA 2OF4A 2BMCA 3FQEA 3NAXA 3BU3A 3PJ3A 4I0TA 5A4TA 2R3JA 2BALA 4QYYA 5EOBA 3KRLA 3LCKA 2F2UA 4TYEA 3Q60A 2F7ZE 1TQPA 1UWHA 1PXLA 5KE0A 4C4IA 2WPAA 2O2UA 3S2PA 1BI8A 3OXZA 5CZIA 4O0XA 4D2VA 1IEPA 4FKLA 1ATPE 2VGOA 2WTVA 3QTQA 2HXLA 3OD6X 3EN9A 2F4JA 4CD0A 5L2SA 4BWKA 2CDZA 4I22A 1MRYA 2PE2A 5CU0A 3GOKA 3PVBA 3SXSA 3T3VA 4PPBA 5C03A 3ZO3A 3UYSA 5HU9A 4FR4A 5KHWA 5CSXA 4XLIA 2B54A 3E92A 2Y9QA 2RG6A 3C9WA 3FZPA 3OBGA 5EM6A 4BCOA 3QCYA 3TKUA 3KXZA 1H1WA 2W1GA 3RI1A 4HGLA 3DY7A 4I5MA 3R1QA 4MH7A 4YJVA 1SMHA 4BYJA 5J9ZA 5IH5A 5CU6A 1AGWA 4IZAA 4KRCA 3TNQB 1SVEA 4MQ2A 4CQEA 3B8QA 4J95A 3FBVA 1PMUA 3QUDA 3FQHA 3WYYA 2LAVA 3ZZWA 4YTFA 4KINA 3TV4A 4B6LA 1YWRA 3SA0A 2YM4A 1JOWB 1PXMA 4FKRA 2IN6A 3I7CA 4YNOA 3SDJA 4D55A 4FV1A 4IAIA 3VS0A 3O96A 3FMNA 1OKZA 4H05A 3V6RA 5L2TA 5CEIA 2CGVA 3RMFA 4EH8A 4Z9LA 4BHZA 3FWQA 1UWJA 4PDPA 3BKBA 3PRFA 5HNIX 1T45A 4JAIA 4BCIA 3I6WA 3WILA 2W1DA 4G9CA 1U5QA 1AD5A 4ZAUA 5JZJA 4LL5A 4AZWA 3TUCA 3F7ZA 1JAMA 3DDPA 4NZWB 4TNDA 4Y72A 2UZVA 4YLLA 3ZFYA 2CLXA 3CPBA 4EBVA 3C51A 1Y8GA 4IM3A 4J99A 4HVSA 3IDBA 4I41A 3JR1A 5L4QA 4MXCA 2NNWB 1V0BA 2P2HA 2XBAA 4L53A 4UALA 4B7TA 5CAQA 4GYIA 4N0SA 3RINA 5DT4A 3ZONA 3T9TA 3O23A 5KMKA 3UZPA 3A8XA 4L46A 1U59A 1XBCA 3R7YA 4BICA 5FG8A 2FA2A 4ANMA 4UXLA 5A54A 4DH7A 4LV5A 2FO0A 2XP2A 2C1BA 4K1BA 1Q24A 3UDBA 4AP7A 3PA5A 4RC2A 3U4WA 5CAOA 4IB1A 3C4ZA 4JVGA 3H9OA 1IA9A 2XYUA 2YLEA 2NP8A 4L42A 4CT1A 3C4FA 3CTHA 4FZAB 4M3QA 5FBOA 4ZSEA 3H30A 4AA4A 4BGGA 3TNPC 3OWPA 4J96A 3BHVA 4CFNA 1BUHA 4ERWA 2Z7QA 4EUTA 4UV0A 4HPTE 2ZB1A 2CPKE 4C2WA 5J5TA 3Q9WA 4QMYA 3KFAA 3VJNA 3QZHA 5DEWA 3TG1A 4IVDA 5TR6A 5E90A 3VBQA 3T9IA 2G2IA 5CAPA 1H4LA 4EH5A 4XRLA 1UKHA 1GY3A 3CR0A 4UMPA 3GUBA 4FSUA 4U80A 4F9BA 3CQWA 1YOMA 4CFUA 4R7IA 4EOKA 2I7QA 2FSTX 5EYKA 2YCQA 3CJFA 3L8VA 4GSBA 4PDOA 4V0GB 3RWPA 5HQ0A 1F0QA 3D9VA 5J8IA 3RK5A 1ZXEA 4M67A 2HELA 3F69A 3ZUVA 1DM2A 2EVAA 4ALVA 4WRGA 3ZM4A 4UN0C 4TKSA 5FXSA 1KE7A 3DK3A 4QQTA 5B2LA 3QXPA 3BHHA 5GZ9A 2RSVA 1BMKA 1WBNA 2P4IA 1XBAA 4XCUA 3BYMA 5ETIA 4QMXA 3LLTA 5LVPA 2ERKA 2W0JA 3BZ3A 2C6MA 2JD5A 3L9NA 2ZMDA 3GC7A 3KN5A 3OWLA 5GHVA 4EKKA 4UWBA 5IH6A 1YWVA 3P7BA 3N4TA 3FMEA 5ACKA 4IAZA 3F2AA 4F64A 4N6ZA 3HECA 2WAJA 3BYSA 5IA0A 3NPCA 4FX3A 4U40A 3GNIB 2CCIA 5CU4A 4BRXA 3BCEA 1ZARA 4IXPA 4YLJA 4AZVA 1YXSA 3ZH8A 3ZUTA 1H1QA 2XZSA 4A4LA 3OTVA 4CRLA 5ICPA 1TKIA 4OUCA 3QTRA 3W10A 3IKAA 1JSUA 5CEPA 3SVVA 2IO6A 4JT3A 4GK4A 4EUUA 5EH0A 2DQ7X 3A4OX 3PJ8A 4RC3A 1BYGA 5D9HA 5J95A 4AAAA 4PTCA 4MD8E 4O22A 4A4OA 4XBUA 3W2CA 4JRVA 4MCVA 4UYNA 4ENYA 2B7AA 4DG0E 4AA5A 3FKNA 2X8DA 4DFLA 1J7LA 3EQCA 1P2AA 4OBQA 3GFWA 4QP4A 5A6OA 2WOUA 4F0IA 5BVFA 4LMNA 2J6MA 2ITYA 3Q3BA 4EL9A 3NVMB 5DR6A 4H1MA 1J1BA 1IG1A 1G5SA 1NA7A 2QC6A 3OF0A 4G2FA 4WSYA 4EYJA 3FMJA 4FV5A 5D41A 5HVYA 3T8OA 1KUTA 3E8NA 3ZDIA 4JJRA 4Q5EA 4D4YA 2AC3A 2CNUA 1Y6BA 3I1AA 3QXOA 4ZIMA 3EIDA 4U5JA 4GT5A 3OCBA 4RVLA 3KRXA 3ZSHA 2VTIA 1P5EA 3BIZA 2W05A 4QMZA 3FJQE 3FMLA 3EKNA 4ASDA 4BGQA 5A4LA 4JQ8A 3QWKA 3QLFA 1PYXA 3CCNA 3NW6A 5ANDA 4AFJA 2YFXA 3G33A 4AW0A 5FWKK 2CSNA 2QKRA 4FUXA 4L68A 3EQRA 5DA3A 1WBWA 3QYWA 4C59A 2B53A 2VTJA 2AYPA 3I7BA 3O17A 5LVNA 4U81A 3R00A 1PXKA 4QO9A 3A7JA 1OL2A 4CFWA 4QPSA 4BDBA 2W7XA 5JGBA 4HW7A 2VV9A 5AWMA 4E73A 4KUJA 2XCHA 4HPUE 4V01A 5GZ8A 1XBBA 1UU9A 2HZ0A 4FK6A 1APME 2YM8A 2XK8A 4MXAA 2CJMA 4RQVA 2FH9A 2J0LA 3FL4A 3MFSA 3K3IA 4GJ3A 4KIKA 5CU2A 5HD4A 1OL6A 3F6XA 4OAUC 4KIOA 2UW9A 3FLWA 3ZOSA 3Q9ZA 5K3YA 3ANQA 4FA2A 2WQBA 3IONA 4B99A 1H0VA 3NMUF 2YEXA 2FYSA 4ZZNA 4ZTLA 5FXRA 2BKKA 3QTUA 4WG5A 5CTPA 2P33A 5IH4A 1SNXA 3C4EA 2O65A 4EEVA 4JRNA 3V5TA 4EORA 5AP1A 1YI6A 4BCPA 2GDOA 3GGFA 5CENA 2X1NA 2P0CA 3DKCA 3OS3A 4BGHA 2OIBA 3EFJA 4C4JA 2GTMA 5KMNA 4CCUA 2YZAA 3PP1A 4TYJA 4EJ7A 4BF2A 3C50A 3AT4A 4YGAA 3ETAA 3VNTA 2FVDA 4WBOA 5AP3A 5EFQA 3SW4A 5B2MA 4IWPA 4BKJA 4ZJJA 3R9HA 3FXXA 5BVOA 2X7FA 3OCGA 2RIOA 5CSHA 2O63A 4F63A 4PL5A 5FTQA 3RKBA 3CTJA 3JUHA 5EKNA 1BL6A 5J1WA 5CNNA 2A2AA 5IDPA 1B38A 3M2WA 4CYIA 1O9UA 5ANJA 3ZYAA 4NU1A 1NVRA 3FMDA 4CKJA 3MFTA 3SD0A 3SX9A 1URWA 2PUUA 2WU6A 1YDTE 5L8JA 2YWPA 4BKYA 5BNJA 2W1ZA 4B8MA 1LP4A 4Y85A 1I09A 3D0EA 3KXNA 3LCTA 4I0RA 3IOKA 3VIDA 4GEOA 4TWPA 4K77A 4OBOA 5CWZA 4IM2A 1XO2B 3I5ZA 4R78A 2Y8OA 3H0YA 3ZXTA 4FNYA 4APCA 4LG4A 3GCUA 5JGAA 3D5VA 4O83A 2PE1A 2UW4A 2VUWA 3VRZA 4I6BA 1A9UA 4YJQA 3MSSA 4CV9A 2C3KA 1WBOA 3R8UA 5KMIA 1FGKA 4I94A 3EQPA 3TXOA 2PYWA 3UVPA 4O81A 2XIZA 2ZYBA 3FDNA 3OWKA 1WZYA 4ZJVA 4C35A 3EQBA 2XYNA 3R0TA 4JIKA 3FZTA 4W9WA 5AIKA 5C8MA 5IUGA 2UW3A 2HY81 3QQKA 3FC2A 3RAKA 3O8TA 1WFCA 2C30A 4TWCA 3KMWA 2PUPA 1YXVA 3IGOA 4LGHA 1WBSA 1UU8A 4GIIA 5CXHA 3IW6A 5AV3A 5HBHA 5BVWA 4A9SA 4X7QA 4Y5QA 3KULA 2C6TA 3R2YA 3TZMA 3S1HA 4WUAA 3DT1A 3RTPA 4QQ5A 4FEQA 2HCKA 5HE1A 5KZ0A 4ACDA 1P14A 4ZY5A 5IQIA 4I4EA 4X2NA 4QYGA 4DCEA 1Z5MA 4CKRA 3VBYA 2YM5A 1WMKA 4GH2A 3NSZA 3D14A 2WHBA 3ODYX 3VUGA 4NIFA 5AJQA 4KKGA 2PL0A 5CI7A 4D1XA 1JLUE 4MD9E 4RZWA 4K11A 3DAKA 5BUJA 2HAKA 5IKWA 2ITVA 4FSNA 3EN7A 2R7BA 4IZ7A 4WO5A 4O6EA 4S32A 5DMZA 2WQNA 3QTXA 2VTRA 3M1SA 5LOHA 2YA9A 4KS7A 3DNDA 3LJ0A 3RPVA 2BAQA 2EB3A 1LEZA 3TJDA 3UIBA 2QONA 4GIHA 3K3JA 3ZUUA 3BV3A 3KRJA 4XOYA 3Q6WA 5FRIA 5AR5A 2GTNA 4MK0A 3MWUA 5HNGA 2ETMA 3VS6A 4C3PA 5E8UA 4BCKA 4P2KA 5EDPA 1YW2A 4ALWA 1J7IA 3QQGA 4ID7A 3G5DA 5JFSA 2J50A 5M08A 4KIKB 1OPLA 1CSNA 4IE9A 2W5HA 3VBXA 1QMZA 3NNVA 2YN8A 4LM5A 4LGGA 3A7HA 4DH8A 4UBAA 3MTLA 4C38A 4BVUA 4JDJA 4FV7A 4YZMA 3OROA 4UMRA 3ZC5A 1ZOGA 2X8IA 4EK4A 3PPZA 4YJPA 4JG7A 2YDJA 5DLSA 3R8LA 4FOBA 2B9FA 4R7HA 4O0RA 5HD7A 3U87A 2GNGA 4R3CA 4D9UA 4G6LA 2VTQA 5IQGA 2BRHA 4C4GA 1KWPA 3NUXA 4XP2A 4G3FA 4DGLC 4I24A 3C4CA 3F82A 3UP7A 5G1XA 4WNMA 2BRMA 3MY1A 4QMMA 2YWVA 2IZTA 3AT3A 5CEQA 4BCMA 4BR3A 4AZEA 3G6GA 4EHGA 3N4UA 1YXUA 5LJJA 3PIXA 2OZAA 3G0FA 4MVFA 3PSCA 4ZLZA 3OG7A 5C8KA 2H6DA 5CASA 2X6DA 1YRPA 1YQJA 3RAWA 3U8WA 2UZLA 1YHWA 2C4GA 3OY3A 4RGJA 3MIYA 4RRVA 3SV0A 4E4XA 2WO6A 4OBPA 4EK8A 3E63A 4BTFA 3UO6A 3HMPA 4XV3A 4QQJA 3LXLA 4ANNA 4QOXA 5CZHA 5DR2A 2BPMA 5EW3A 1P4OA 3NVKI 1KE9A 1VR2A 3TUDA 3MVJA 3HP5A 1V0OA 4AOJA 4NIFB 2J2IB 3VS7A 2EU9A 4BCFA 3R83A 3BGZA 3ZRMA 1OIRA 4F0GA 3HLLA 1Q62A 1RDQE 4BWPA 3DU8A 5HESA 3OXTA 3Q6UA 4EOLA 5I9XA 1K3AA 1MQ4A 4PDSA 3CGOA 2ACXA 2JFLA 3C4WA 3GC9A 4FMQA 5AV2A 4TYHB 4DGGA 3BGQA 2JFMA 5AUXA 2XNNA 3FLZA 4TWNA 4KABA 4WUNA 3EYGA 3BLRA 4CNHA 1W83A 2YISA 2BZJA 1XH4A 3L8SA 3ORPA 1G8SA 2HXQA 2OWBA 3A2CA 3ATTA 2VTSA 2QOOA 1KV1A 3SG9A 4U41A 1JQHA 4MQ1A 3LFNA 1CDKA 3KF7A 3F66A 2XNGA 4EONA 3ZEWA 4EH4A 3UIUA 3D5WA 4I23A 2IW9A 4DTBA 2WTCA 3D83A 4XUFA 4CXAA 4EQUA 2V62A 2IW8A 4DFYA 3THBA 3VQHA 1W8CA 4FIIA 4M13A 5GJFA 4YHJA 3FXWA 1Z9XA 1MUOA 3R8VA 1XH5A 1JKLA 3LQ5A 1BKXA 4YO6A 3UTOA 1IASA 2R3PA 3R28A 5JEBA 4EJNA 4BZOA 5FDPA 4C57A 1FVTA 4XV2A 5DFPA 2WB8A 4ZMEA 3LM0A 3UNKA 4MAOA 4FTLA 2VN9A 3A62A 4X0MA 3R1YA 5TE0A 2BRBA 4FT5A 2QHNA 2ONLC 4JS8A 3TTJA 1NW1A 2GQGA 2R3KA 3VUMA 4X21A 2ZM1A 5HG5A 2QR8A 3ENMA 4IJPA 4O0TA 2QODA 3P86A 4BIDA 1UU7A 1J91A 2CKOA 3LM5A 2YM6A 5EQYA 4FIGA 3KRRA 3JXWA 1OIYA 3GXLA 3DJ5A 3RCJA 3UYTA 4YMJA 3DXNA 3ENHA 1NVSA 3IS5A 4BY9E 2YABA 3OTUA 2PZIA 5JQ8A 4DEHA 3Q5ZA 3PXZA 4KIPA 2ZDUA 2H8HA 3CD3A 4AN3A 4IAYA 4A7CA 3UOJA 2Q0BA 3K2LA 1J1CA 4UEUA 2BRNA 3Q4TA 3MFRA 4C4EA 3LE6A 4NFNA 4WA9A 3JPVA 2CGWA 2W9FB 4QD6A 4JI9A 5FQDC 2WTWA 4J7BA 2VO0A 3JYAA 4XP0A 1L3RE 3OZ6A 4FVQA 4F70A 2Y4IB 2XMYA 3FMHA 4ZXTA 4DEBA 3N51A 3QU0A 2YAKA 5HLWA 1H08A 2H96A 3PIZA 1ZZLA 5JN2A 3UNJA 4C61A 4Z7GA 4O7SA 2VTHA 2JKQA 4QP9A 3MA3A 3AC1A 5GNKA 2C5VA 5J7BA 5L6WL 1WBPA 1JPAA 3UNZA 2IWIA 4H3BA 1LPUA 1OKWA 5HCYA 3UIMA 2ITTA 2OU7A 3ITZA 1ZMVA 2GNLA 3HV7A 3Q9XA 4RA5A 1IAHA 1FMOE 2WMUA 3G9NA 2BZIB 3GU8A 5DI1A 2I40A 3FKLA 4M0ZA 5CVFA 4F9CA 4RA4A 4HNIA 3QQFA 3GI3A 3GU5A 2UZUE 4WBBB 3C0IA 4ACHA 2IJMA 4GT4A 4QTBA 4ACCA 3UZRA 3POOA 4CLJA 4GG5A 3Q4ZA 3DAEA 2ZOQA 4I92A 1SM2A 4W4YA 3TEIA 5JSMA 5C4KA 2W96B 3QCXA 5TT7A 3W2SA 4RVKA 4ANBA 4E4MA 3EFWA 3ZM9A 3HAVA 4RJ6A 3VUDA 4IB5A 1M52A 3IW5A 4V05A 4D0XA 4Y5HA 1VZOA 4NK9A 3UBDA 4DINA 2QNJA 4J8NA 4RMZA 4Z7HA 2QKWB 3I81A 2Z60A 3II5A 3OT3A 4CTBA 3F2NA 2XM8A 4DGOA 2OZOA 4YTHA 4DYMA 5K9IA 4C4FA 2C6IA 3DQXA 2C5NA 3UPXA 2VTMA 5EK7A 3FI4A 1QL6A 2SRCA 4YUQA 4F6UA 3LVPA 3LOKA 2W17A 2HW6A 3QZGA 4MXOA 3C4XA 4FIFA 1XH7A 2B9IA 1H8FA 4FTAA 4YLKA 5EM7A 3BWFA 4QMQA 3BX5A 2W1HA 3S95A 2XUUA 1B6CB 4JBOA 3PXRA 4YZ9A 5HVJA 2XKCA 3AMYA 2W1CA 5IUHA 4O7NA 3Q53A 3TDWA 5ANIA 4ZTRA 1Q8TA 3ORMA 3RALA 3VUIA 5DPVA 4OTHA 3O7LB 1H28A 5C27A 3V5WA 2QVSE 2XIYA 3UQGA 2HZ4A 3RM7A 5IG1A 1ZYLA 2JKMA 3JY9A 3LXKA 4XS2A 5CSVA 4AOIA 1PXOA 4KB8A 3AMBA 5CLPA 3PA3A 2XS0A 4DHFA 4IAFA 1P4FA 4LOQA 4WNOA 3LXNA 4AW2A 1IAJA 4UMTA 2Y0AA 4U97A 4W4XA 2Z2WA 1H1SA 3HEGA 4KNBA 3RPYA 3VW8A 4U8ZA 3WF8A 1WVYA 3PSDA 5F94A 3TT0A 3IG7A 5HTCA 4C37A 3TM0A 2H34A 3TNHA 3C5UA 2PMOX 5GJGA 4O0UA 5CVHA 3IECA 2OW3A 4ASEA 2PK9A 4L9IA 4FKQA 5DHJA 2E2BA
chains in the Genus database with same CATH superfamily
5ANGA 2QO2A 1BX6A 3MH2A 4F78A 2XAMA 4FSYA 5JGDA 5AAFA 4APPA 4HYHA 1CKPA 1JSVA 4JQEA 4RIYA 3HDNA 5D7VA 2YAAA 1DI8A 5EHOA 4ZEGA 3QD4A 3WBLA 3ZU7A 3TUBA 2OG8A 3TYKA 3PJCA 4CT2A 5JH6A 5M4CA 3QLGA 2UW8A 3R01A 2CN5A 2WD1A 3HA8A 3RK9A 4FVRA 5BYLA 4ASXA 4ANLA 5J9YA 2PVKA 4FTKA 4GKIA 1OL1A 5L2IA 5L6PA 4XG9A 3PG1A 3TKHA 2VO3A 3EN6A 4U79A 4XEYA 1ERKA 4NFMA 4YJSA 3H3CA 4Q5HA 1PHKA 3DZQA 3LCDA 3MB6A 3QTSA 4YTCA 3UODA 4D4SA 2J0KA 3OUNB 5EM8A 2PMIA 4CLIA 2YJRA 4USEA 4L52A 4HVDA 4AFEA 4DH3A 1UNGA 4U7ZA 5LWMA 3E62A 2CMWA 3V5LA 4PMTA 3HMOA 2X0GA 4E5BA 3TV6A 2HK5A 3COMA 5ANOA 3AC8A 2XEYA 1UA2A 4E6CA 1YHVA 2XB7A 5KX8A 5KO1A 4QMVA 4QTDA 4EHVA 3E7VA 3UDSA 1PMNA 5E1EA 3KXGA 3PZHA 4DT8A 1OMWA 2CKEA 4D28A 2ITWA 3AD6A 4EOIA 4FTQA 5BUIA 3LCOA 5HORA 2BCJA 4L45A 3NUUA 3AC5A 4GUBA 4MKCA 1DAYA 2G2FA 2I0YA 3CBLA 4ITIA 4QMTA 4I5CA 4U3YA 5BVNA 2OF2A 4YC6A 5AA8A 4OTQA 4RIWB 3ORTA 4O2ZA 2E9NA 4Y95A 4PV0A 4X3FB 3ROYA 5DGZA 4N4SA 4ARKA 4AG8A 2XNBA 2E9UA 4B9DA 4BL1A 2PZPA 2A98A 5DE2A 2G01A 3KRWA 3R8PA 4K6ZA 4BFMA 4D4VA 2WQMA 1WAKA 4I21A 4OTDA 1XR1A 1UV5A 3ODZX 4DCAA 3TNWA 5C4LA 3MY0A 4F0FA 4FG7A 3U54A 2R9SA 1QPCA 2R3OA 3GEQA 5GZAA 2LGCA 3BL9A 2DUVA 3A7GA 2YIRA 4S34A 2IVSA 3V04A 5HBEA 3PZEA 3MY5A 3KGAA 2RFDA 1W2FA 4CSVA 4AOTA 2OK1A 3DBDA 3Q4UA 4ITJA 3NAYA 3KXHA 4O7RA 3NYNA 1M2RA 4FF8A 3V6SA 4RJ8A 4B8LA 4F99A 4FIEA 2BFXA 2REIA 5CY3A 5HKMA 2X8EA 3O5AA 2XK3A 4O0SA 4X6RA 3OWJA 4A9TA 3MESA 1H1PA 4FNZA 2HWOA 4XJ0A 2VWZA 3KU2A 3NCGA 3FZRA 1G8JA 4PNKA 5AP4A 4D5HA 5BVEA 5BYYA 4QTEA 4IBMA 1IA8A 2CCHA 3W55A 4KSQA 1OIUA 2IG7A 3POZA 5CYIA 4M12A 1KOAA 2W5BA 4F1OA 4AT4A 4L00A 4QDVA 3F9NA 4C34A 3QQLA 3ZEPA 2GNHA 3EJ1A 5BYZA 4RVTA 2QOQA 4EC8A 3NDMA 4YJRA 5GJDA 3ZSIA 4PF4A 5HE0A 3PXFA 3WZUA 4D2PA 3UQFA 5CNOA 4FBXA 3ATSA 2G15A 3MVLA 3SRVB 4DA5A 4FNXA 1VEBA 3IW7A 2W1EA 3E64A 1U54A 4RJ3A 1ZZ2A 5L2QA 2Y4PA 2VO6A 3WE8A 3SC1A 3QD0A 4F6WA 3MIAA 4ANOA 5EYCA 1CKJA 1TQMA 1BL7A 2WEVA 2UZWE 1LUFA 5AUYA 1SVGA 4ZZOA 1FVVA 4Q2AA 5AP0A 2UVXA 2OLCA 2WTKB 1VYWA 2BKZA 4KS8A 4XLVA 2XRUA 3UJGA 3V8TA 1ZYJA 4DG2E 5KMMA 2CKQA 2QLQA 3PDTA 2RG5A 4RBLA 3PTGA 4RWKA 2PVLA 3NS9A 3PWDA 3LMHA 5EW9A 3EL7A 3IDPA 4AXAA 3HKOA 2G2HA 3DTCA 3CGFA 3O50A 4FI1A 3ALOA 5ITAA 4ITHA 4MWHA 4R1VA 4X3FA 3IW8A 1ZOHA 4R1YA 4RZVA 2Q83A 4BN1A 5EI6A 4YP8A 5BVDA 4WG4A 3E87A 3R22A 2XA4A 3R7GA 3GU6A 4FTCA 2W4OA 1FMKA 2R3RA 2PZRA 3PFQA 4EQCA 5EHLA 2FSMX 4CGAA 4HGSA 4RFYA 4AACA 3EWHA 2R3MA 4WSQA 3DTWA 2R3IA 5IA2A 4EH7A 3TDVA 3QRUA 3S3IA 5AEPA 5L2WA 2PVYA 4MD7E 5ANKA 3E93A 3IO7A 5FBNC 1SVHA 4A9UA 2Z02A 5KMJA 5CF8A 3TL8A 4IFCA 3Q4CA 3HP2A 3Q96A 3MH0A 2V0DA 3E8CA 2J51A 4RFZA 3R8ZA 5K4IA 2XIRA 2WMQA 3NW5A 3NZ0A 1LR4A 3GCQA 4FEXA 1XKKA 1YXTA 2Z7SA 5JFVA 5LWNA 3WF7A 5KMLA 1R39A 5AMNA 3NIEA 2P55A 4G3DA 3GVUA 4FZDB 2V22A 4IZYA 3SOCA 4LL0A 2R7IA 3MPAA 3SKCA 5HE3A 3ZC6A 3KVWA 3ID6C 3KL8A 4RIWA 2OXDA 4RIXA 4ALUA 2IPXA 5FXQA 3AT2A 3HX4A 4P90A 3WF6A 4E7WA 4HVGA 2FB8A 5HNBA 1DI9A 3RPRA 3ET7A 2ZM3A 4XRJA 4FICA 4OLIA 1I44A 1KSWA 4O84A 3LFFA 3UC4A 4R3RA 2PU8A 3FEGA 5ANEA 4BDDA 3SRVA 4KIQA 4HYIA 3A99A 4FG9A 3VWAA 2C68A 3UOLA 4YJOA 3UQCA 4AX8A 3QRIA 3F61A 4XG4A 4FTNA 4R77A 3H9RA 4I6FA 4OGRA 4Y73A 4U6RA 4C8BA 3QA0A 3D2KA 4A07A 3BHTA 4DF3A 4LQMA 4C02A 3F3UA 5EYMA 1JBPE 3LFEA 2PVNA 4CCBA 2WTKC 1O6KA 3ELJA 4BCNA 4JNWA 5A46A 3TJCA 5AA9A 3PFYA 2UW5A 3C0GA 3R8MA 5A4EA 1FGIA 4N57A 2X4ZA 5DVRA 4I3ZA 1GIJA 4FUYA 4IQ6A 2R2PA 4FK3A 4W8EA 2B1PA 4NL0A 4QP1A 1RQQA 4RQKA 3BYOA 5M56A 3ORIA 4KSPA 1QCFA 2C5XA 1ZAOA 4TYHA 4D58A 3K54A 2QLUA 3FZSA 5T68A 3FPQA 5HZNA 4MNEB 5J7HA 4EC9A 2ZV8A 1O6LA 4H3PA 3B2TA 2PSQA 3DKFA 1M2PA 5LVMA 3ANRA 2VNWA 3UP2A 3LFQA 4TRLA 3U4UA 5AUUA 4JBQA 4F7LA 3O51A 3AC3A 5HO8A 4IIRA 2R3QA 3EOCA 5D12A 4IVCA 3ZS5A 2YM7A 4I0SA 3CY3A 1RJBA 4EZ3A 1SYKA 2YCSA 3TI1A 3UG2A 1PKGA 3H4JA 4PWNA 2WMAA 3CPCA 3C0HA 2YJSA 2XK4A 5GINE 3F5GA 4S30A 2Y6MA 3WZKA 4JAJA 5G6VA 2NO3A 4ERKA 4BB4A 3L8PA 4NSTA 3PPJA 5CQWA 1YXXA 3CJGA 3QA8A 4M15A 3DLZA 2GCDA 2YCRA 5C9CA 4MYGA 3FLYA 2J0IA 3A8WA 4X6QC 3AG9A 4E93A 3U6JA 3ZO1A 4BI0A 2DS1A 4K0YA 3D5UA 3WZDA 3FMKA 5L6OA 3ZZEA 3WIKA 3VN9A 3DXPA 2GS7A 2XAOA 3AKKA 3OP5A 4QMUA 3FUPA 2RFSA 2PY3A 3VF8A 5EQEA 3COHA 2VTTA 2X2KA 3MPTA 4FV9A 3FY0A 3ORZA 3KCFA 3KXXA 3RAIA 4YPDA 4BDGA 4RC4A 4L44A 4NUSA 4NYEA 3NR9A 2QR7A 1ZYCA 5E8VA 4X3FC 2OXYA 2YM3A 4IAKA 4I93A 2HOGA 1PMEA 2J5EA 3QKKA 4AE9A 2BDFA 3P0MA 4IWOA 4NKSA 3HRFA 3PVGA 2PZ5A 3Q2MA 1XHAA 3HUCA 4DFZE 5KBRA 5EI8A 3D4QA 4BBFA 4C3RA 4RWIA 3QALE 4LOPA 3BU5A 5HCZA 4YHTA 5AR3A 2QOCA 5E7RA 5JFWA 3KMMA 1X8BA 3DNEA 2OSCA 4QP8A 4EK5A 4XG3A 3PLSA 4MXXA 4FKTA 3RCDA 3HV5A 5TF9A 3EQGA 2XALA 4CRSA 5KBQA 4HNFA 3ORXA 4FKGA 4G34A 3UG1A 5IQDA 2VD5A 3NNUA 5M4FA 4FKVA 4AT3A 4CV8A 3NNXA 5IQBA 4C62A 3AD4A 3OC1A 3QQUA 2A4LA 4F7JA 2BUJA 3ACKA 1F3MC 3PPKA 1GNGA 1PKDA 4EOOA 4AXFA 4PPCA 2C3LA 3JY0A 4CZTA 2C6KA 4MXYA 4ONAA 5K5XA 4II5A 2B9HA 1F5QA 4NCTC 2X7OA 3NX8A 2WQEA 2BR1A 4UWCA 4XMOA 4D2TA 3BE2A 3GU7A 2YIWA 5E8XA 2VTNA 1W98A 1REKA 3R7EA 4AQCA 2QG7A 4E8AA 2XKEA 3DOGA 4M7IA 5I9UA 4JBPA 3RBWA 2JIIA 3G9LX 1L8TA 4BZDA 4KWPA 3V5PA 3W2RA 2WQOA 2XJ0A 3P5KA 4I20A 3R63A 4PUZA 3Q5IA 2PUIA 4FE2A 3D7ZA 4RFMA 4DGNA 3MH1A 5AUWA 5HEZA 2GMXA 4U43A 2RL5A 2WIHA 3P9JA 4P5QA 4EOQA 2JDTA 2FGIA 2UVYA 2VWBA 5LXMA 4BDEA 5I3OA 3V8WA 4F7NA 2YDKA 4F9YA 3GQIA 2X9FA 4ZS0A 4CYJA 4QMNA 3GFEA 3UZTA 3LAUA 2QCSA 5DN3A 2PMLX 3OY1A 3W8QA 4HCTA 4J53A 3F88A 2O5KA 3A60A 2UZDA 4U45A 4IJ9A 3R9RA 4DBXA 1JKSA 4OTGA 3SXRA 4O2PA 5IMEA 3C5IA 3C13A 4UXQA 3TN8A 2JAMA 4OT6A 4CFVA 3UDTA 5L8LA 1Q5KA 4K2RA 2WNTA 4FNWA 3OT8A 4MF0A 5J1VA 4GKHA 3SW7A 4GCJA 4U44A 4G17A 4DLIA 5D1JA 2JBOA 2EXCX 4QP2A 3PXQA 2EUFB 4A06A 3IPHA 5IEYA 3R30A 3FE3A 3TACA 4AW5A 4UX9A 2V7AA 2G9XA 2QO9A 2WMWA 3E7OA 1YVJA 2IVUA 5AAGA 3ZDUA 1Q99A 2IEWA 2UZBA 3KCKA 4I1ZA 5A14A 1W2DA 4GFOA 3Q52A 1OM1A 2XIXA 2PHKA 3KQ7A 2JKKA 2GS2A 2XNEA 3VS3A 3NUNA 4ZSAA 3G15A 4GG7A 5IZFA 4MUQA 1UU3A 2ZAZA 4M68A 4I4FA 1JSTA 5CU3A 3WIGA 2F57A 3DKGA 1OL5A 3U9NA 3KB7A 5M4IA 2XH5A 3OHTA 4IZ5A 4OTIA 3Q04A 4RX9A 3KC3A 5K5NA 2QO7A 3BWJA 3PXKA 3UDZA 3D94A 5KUPA 4C4HA 3V5JA 2WZJA 4XV9A 4O21A 2GNFA 4JLCA 3BELA 4RWJA 3PJ1A 3NFGB 3NW7A 1REJA 4L7SA 3DQWA 1K9AA 1OKYA 4IHPA 4RPVA 4TXCA 3WYXA 3WZJA 4J8MA 1Q3WA 4EK3A 5EYDA 4F7SA 3P4KA 2ITUA 4CFXA 4RG0A 2Y7JA 4L6QA 3VVHA 3ZLYA 4KA3A 4XP3A 4EH9A 3A4PA 4IDTA 2WFYA 3MDYA 3QF9A 3GP0A 3MVHA 1T46A 4D2RA 3D7TA 4AGDA 3QKLA 2QURA 1XH8A 5HX8A 2XKFA 3KXMA 3LZBA 1H1RA 4D1ZA 1R0PA 1CM8A 3HMMA 3TZ8A 2J90A 5LVOA 3GOPA 4F1MA 5HCXA 4L67A 2BIYA 1YI4A 4UWYA 5FEQA 5H9BA 4RX8A 4A9YA 5GIOE 3OFMA 3FHRA 5LVLA 4DITA 4AT5A 1UNHA 1OUYA 5IQAA 4XOZA 2OFVA 2YLFA 4DFNA 4QPMA 4AGCA 1GZ8A 4O86A 3KF4A 3MJ2A 2A19B 4DEEA 4MBIA 1M17A 3F3VA 3G90X 2ETKA 3MB7A 2WOTA 2ZV2A 4O1OA 4OAVB 2QOKA 4FSTA 3KK9A 3R9DA 3P7AA 3HVCA 5AP6A 5C8NA 4WNKA 2BIKB 3PVUA 2X2MA 2RGPA 1H24A 4FGBA 4ZLYA 1WBVA 4ANSA 2XARA 5AFVA 1OUKA 4P5ZA 4JX3A 4YR8A 1SZMA 2IF8A 4MNEA 3SXFA 4ZTSA 2X9EA 4HJOA 5AADA 4WKQA 4DTKA 2E9PA 4G1WA 2BVAA 2BZHB 4YZBA 4DC2A 2YITA 3LLAA 2KULA 1GZOA 3R21A 2OICA 3CKWA 4O0VA 4ZY6A 3EL8A 5EQPA 3U55A 3VUTA 4PPAA 4AN2A 2R3HA 4RWLA 4M97A 5AP2A 4AE6A 4AUAA 4E26A 2VTAA 5BPYA 2IW6A 5FP5A 4PMSA 4M14A 5E8SA 3MA6A 4ZK5A 5IEXA 4QEBA 4KKEA 3DJ7A 3OOMA 4HVHA 3NCZA 4C58A 5AUZA 1Y6AA 2RKUA 3VO3A 3AGMA 1MP8A 4FTMA 4OTPA 4W9XA 3ROCA 3ZMMA 4UY9A 5JQ5A 3RP9A 3LHJA 3SG8A 4PTEA 2WGJA 3W18A 5AAEA 4G3EA 1LEWA 4KBCA 5CX9A 4EHZA 3GCVA 1BLXA 5HTBA 3VBVA 2GQRA 3VRYA 1M7NA 2J0MB 2GSFA 2QOBA 3JVSA 3KVXA 3O2MA 3P79A 3VJOA 2OH4A 4LV8A 3FI2A 4C33A 4JX7A 5TOZA 4F1TA 3OXIA 3C1XA 3KULB 3TCPA 2I6LA 4AF3A 3ZLXA 4FIHA 3T3UA 2CKPA 2QQ7A 2OIQA 4G3GA 4BDJA 4E1ZA 3QTZA 2XVDA 3O8PA 1H27A 4MBLA 4E20A 2JIUA 1TFFA 5CQUA 5FTGA 1JVPP 3EFKA 4IAAA 3ZFXA 4ACMA 5JZNA 4DDGA 3KKVA 3NRMA 3RNYA 3FZ1A 4HZRA 5FM2A 2AUHA 2V55A 3F7WA 3QUPA 5CT7A 3I60A 4XHKB 3VUKA 1R0EA 3ERKA 3FY2A 1UKIA 5J79A 3R1SA 4FV8A 4M69B 5AR2A 3EN5A 3QZIA 3COIA 3L1SA 4FV6A 1B39A 2Q0NA 5CANA 4A4XA 3E3PA 2HWPA 4G16A 1Q8YA 2JLDA 4V0GA 3KREA 4KBKA 3FPMA 4RIXB 1U54B 2X39A 3DLSA 3EZRA 3R71A 3TZ9A 4Y83A 3W0RA 1H07A 4J71A 4YJNA 2WTIA 3FLQA 4KRDA 4YZNA 3RJCA 4DBNA 4E5WA 3H0ZA 4TNBA 3RM6A 3W2QA 3QRJA 1ZWSA 1FOTA 4FL3A 4FYNA 4DG3E 3ALNA 4MBJA 3ZLSA 2PWLA 3SGCA 1W2CA 1DAWA 5LCJA 4BDCA 3CKXA 4FYOA 1GIHA 3FAAA 1HCLA 5M09A 3PA4A 4RLLA 5HIDA 3R7IA 3WOWA 5CEOA 4YBKA 4BDKA 1OBGA 3DPKA 3MI9A 4KBAA 1GOLA 3W0PA 1E1XA 5E8ZA 4ZS4A 5KCVA 4BI1A 5LMKC 5GIPE 2XNMA 2YIYA 3I0OA 3ZRKA 5I9VA 3VQUA 3EYHA 1W7HA 4XYFA 3N9XA 4DFUA 2C47A 4NM0A 4O0YA 4CMTA 4TL0A 4K18A 2X0PA 3MH3A 2PVRA 5HOAA 1OECA 4PY1A 5KKRC 2B0QA 5HHWA 4YHFA 5I5ZA 5EM5A 3VC4A 5IU2A 2I0VA 3C7QA 4GS6A 4O6LA 2YZLA 2NRUA 3DCVA 3VS1A 2Z7RA 4RX7A 5HG7A 4R7BA 2HZIA 3MFUA 1XWSA 1QPJA 5E92A 2IVVA 3PVWA 4W4WA 2B9JA 4EI4A 2P2IA 1UVRA 4H1JA 1KE5A 3FYKX 3LFCA 3S00A 2OFUA 2XCKA 4RLKA 4FVPA 4H58A 4IH8A 4Y46A 4QDEA 3LXPA 3COKA 4BWXA 2WMVA 2UW6A 3OEFX 4G5JA 4HVIA 3N4VA 4FL1A 1G8AA 3HRBA 4D4RA 4IACA 2YCFA 4N6YA 3QD2B 3PRIA 4WG3A 5EOLA 1G8KA 4YO4A 1KOBA 3QUEA 2F49A 5M57A 1OL7A 4YZDA 5EDRA 5LMBA 4E3CA 1RE8A 4PP7A 2PZYA 2XF0A 5CI6A 4AN9A 1Y8YA 5AM6A 5F20A 3LFDA 3ML1A 3DBFA 2WTJA 2GPHA 3EZVA 4GU6A 1V1KA 5KZIA 5LMAA 4QP6A 1PY5A 2OI4X 4O7WA 4CEGA 4FV3A 4IW0A 3MTFA 2O3PA 4LYNA 4WNPA 3AGLA 3GCSA 2ZB0A 1Y91A 2I0EA 1KE8A 2R64A 4G6OA 3ULZA 4B0GA 4BDIA 5CF5A 3P5JC 1XMMA 3DKOA 3O8UA 5I9ZA 3F2RA 4ZMFA 2C6OA 4ZTNA 2JDVA 4FTOA 3CLYA 4CFFA 3ZTXA 3AC2A 4L3PA 4UB7A 5IQFA 3ZO2A 4LRKA 4E6QA 5H2UA 4QYHA 3FV8A 2RFNA 4IEBA 1YWNA 2VRXA 4TN6A 4GFMA 4PX6A 4R3PA 4DFXE 3D15A 2GHGA 2ITZA 2W5AA 1NXKA 1PYEA 2BZKB 3QC4A 4JDIA 4RVMA 3S4QA 5HO6A 2OJFE 5H8EA 2QG5A 3RPOA 2ITQA 4TPTA 3EQFA 3BL7A 4QMSA 3KK8A 5JRQA 2F9GA 1XH9A 3G2FA 1MQBA 5A4CA 3MV5A 5KMOA 2OBJA 3HL7A 3BQCA 4ENXA 4CG8A 3UGCA 2A0CX 4GK2A 1PW2A 4O7VA 3W0QA 2W1IA 1YKRA 4NTSA 4FKIA 5IUIA 1HCKA 3CS9A 3NWWA 3QGYA 4CMOA 3MN3A 5IPJA 5K0KA 3QRKA 5BV3A 2IZRA 2UV2A 3FI3A 4GYGA 4BJJB 3DBEA 4YSMA 4HOKA 2JITA 4IX6A 4QMOA 4FT3A 4EYMA 5JK3A 3BLHA 4BTMA 4LI5A 1NT2A 3GBZA 3RHKA 3QZFA 4IM0A 4F4PA 3P1AA 2PE0A 4AU8A 4GK3A 3U6HA 3B8RA 1PJKA 4RJ5A 1SNUA 3EMGA 3O7LD 5H3QA 4ZSLA 2YIXA 4GVJA 4LMUA 1R1WA 2J0JA 2EWAA 1MRUA 5DRDA 1URCA 2ITOA 2Z7LA 4FTRA 1IR3A 4BIEA 4O7ZA 3M42A 4AGUA 4PL3A 4QMWA 5DOSA 2VTLA 5E8YA 3TTIA 1OBDA 1H26A 2CHLA 3IDCA 5AM7A 4AS0A 4NWMA 4MEDA 4USFA 3IK3A 1MRVA 4FKOA 4FTIA 1JKKA 3U6IA 3PE2A 3Q9YA 3OMVA 4O1PA 3E3BX 4E6DA 4GL9A 4ZLOA 4EBWA 3WI6A 2PVJA 4HCUA 2XEZA 4FTTA 5B7VA 3HZTA 4FV4A 1XJDA 4MTAA 3EB0A 2ITNA 3DB6A 5AP7A 2VTPA 4IDVA 4EH6A 3VUHA 4AA0A 5I9WA 1IRKA 1W0XC 2PVMA 2XNOA 3PY0A 1Q8UA 3JS2A 4UYAA 4EQMA 4AW1A 4NTTA 3QQJA 2VX1A 5A3XA 1R3CA 3BHUA 5CEKA 1VLRA 4Z3VA 4IVBA 2J4ZA 4JXFA 4X2FA 4BYIA 3RZBA 3B2WA 4DHZA 1OKVA 4FSQA 4J1RA 2WXVA 4PL4A 4HYSA 4DE4A 3LFAA 2QD9A 4K9YA 4IWDA 4YZCA 2VX3A 3K5UA 2CGUA 4DGMA 2BAKA 3OVVA 3PLAE 3QL8A 2A27A 3ACJA 3BEAA 2NRYA 2C6DA 2VWIA 4FT7A 4GU9A 4IFGA 4DEAA 1QPEA 3QC9A 2QOHA 3NGAA 3PG3A 3A61A 4FZ6A 2Z8CA 4FSZA 2C6EA 4O0WA 3LMIA 3FHIA 2XKDA 5M07A 4ACGA 5HIBA 3ULIA 2BRGA 3ZBFA 4RIYB 2KTYA 5T6KA 4NEUA 4FKSA 4ZTHA 5HGIA 3PWYA 4QMPA 5AR8A 4EH3A 1Q8ZA 3EQDA 4LUEA 3U9CA 2C0IA 5FUTA 3RZFA 2GFCA 3OCSA 4G9RA 3LQ3A 3G6HA 1M7QA 4FOCA 5CSWA 5FEEA 4I5PA 4GMYA 4PTGA 4DH5A 4NKAA 4NT4A 4YPSA 1YI3A 2ZV7A 4F9AA 3VAPA 1UNLA 3W2OA 4HYUA 3W0SA 1W82A 5A9UA 3W0OA 5HU3A 4IX5A 5M06A 4L7FA 1O6YA 1YDSE 3KMUA 3DGKA 2JKOA 2VWYA 3DB8A 2WIPA 2QOFA 5L8KA 1M2QA 2BILB 3CIKA 1PXIA 3ORNA 3OW4A 4M8TA 3RGFA 3TV7A 4M69A 3VF9A 1JKTA 1XQZA 2ETRA 1OPJA 3BYVA 4J98A 3VULA 1PXNA 2UW0A 3FLNC 4BBEA 3K5VA 3BLAA 2HENA 4I6QA 5IQCA 3E5AA 4H36A 5IA5A 3VS4A 4YSJA 5AX3A 4IX3A 3ZFMA 4AZFA 4DEDA 3WF5A 4H3QA 1OI9A 1EH4A 2BAJA 3MW1A 1WVWA 3PY1A 4TW9A 3LPBA 3U51A 3EQIA 1GZNA 5ETAA 4S33A 4ORKA 4ZZMA 3M11A 2ZJWA 4BTKA 5CF4A 4EOMA 3RVGA 1ZLTA 5CALA 3SHEA 2FUMA 5CXZA 1PXPA 2JIVA 4CMUA 5DT0A 1KE6A 4XNEA 4C36A 4K33A 2UW7A 3HV6A 2VWUA 4TT7A 1ZYSA 4F09A 2VZ6A 5DIAA 1Y57A 4FSRA 3HGKA 2ZMCA 3R9OA 3ZCLA 2JGZA 2X81A 1FQ1B 3HDMA 3R2BA 2NYAA 5JRSA 3W1FA 5HVKA 2X0OA 2J5FA 2BDJA 2OIDA 2I1MA 3GB2A 3DS6A 4PQNA 1S9JA 4DFBA 3BE9A 4ZY4A 3W16A 1BI7A 3DZOA 4MX9A 3PIYA 5CEMA 5F9EA 3F5XA 3VBWA 5C01A 3DAJA 4E5AX 1KV2A 3FSKA 3CQUA 3KEXA 1S9IA 5C26A 4TZRA 3BBWA 2GFSA 2JC6A 4LGDA 4D5KA 2XK6A 1GIIA 3RHXA 3MPMA 5CAVA 5J9LA 4O7YA 3ZLWA 4J97A 3FMMA 2ERZE 4AGWA 4OT5A 2EXMA 2E9OA 3QQHA 1PRYA 2GU8A 2ITPA 2W9ZB 2OGVA 2JAVA 5J87A 4E4LA 4TYIA 1ZRZA 4AQKA 5FEDA 3QGWA 2O64A 3CY2A 3QHRA 4DLJA 3W0MA 5IQEA 2B52A 2ZVAA 3TWJA 4FV0A 4JR7A 5B2KA 5BMSA 3LQ8A 4XG7A 2C5YA 2BROA 4OTFA 3OBJA 4O7TA 1NY3A 3BLQA 1OVEA 4O4BB 2VTOA 3NUSA 4QPAA 3QFVA 2J7TA 4YTIA 4ZTQA 5ACBC 2R4BA 4YBJA 3V3VA 2G1TA 4FC0A 2GHLA 4IC7A 4JL9A 4NM5A 3BYUA 4YC8A 5IF1A 3HNGA 1Z57A 4IWQA 5HG9A 1OPKA 4DN5A 2OO8X 2BHEA 2CN8A 1OB3A 3P7CA 3NEWA 4AXCA 3UMWA 4BDHA 3FZOA 4FODA 2Y4IC 2VO7A 3JVRA 4N70A 5FGKA 3DV3A 5D10A 5H8GA 1Q4LA 3QX4A 3D7TB 5F95A 3VS2A 3EKKA 4IC8A 2F7EE 4M84A 4ASZA 4BTJA 2GS6A 4WHZA 4Q9ZA 4CVAA 4OTWA 2F2CB 3W8LA 4DH1A 3H10A 5AR4A 5LQFA 2X6EA 3DBQA 2UZNA 4QQCA 4HGEA 2OKRA 4BCHA 3I79A 4XX9A 3G0EA 4LOOA 4RSSA 4C3FA 1YOLA 3F3TA 3HYHA 1NVQA 4QTCA 1FVRA 3R6XA 5AR7A 2BFYA 4DTAA 2HY0A 4RIOA 3DBCA 2PTKA 4CKIA 1XH6A 4X2GA 5DYJA 4MNFA 1Q61A 3PY3A 4JR3A 3NFFB 4UZDA 2W06A 3R73A 2C69A 5FM3A 3LKMA 2O0UA 3FSFA 5LCKA 3BPRA 3WZEA 3FXZA 1STCE 4PRJA 3RNIA 3FKOA 3WARA 4JIAA 5HLNA 2Y6OA 2C3IB 3F5UA 5DBXA 3AMAA 4MWIA 4RJ4A 4B4LA 1Q3DA 3UOHA 4NCTA 4O96A 3UVQA 1K2PA 1W84A 3H9FA 2ITXA 4QTAA 5B0XA 5F4NA 4XG2A 2OJGA 4O27B 3LCSA 3R7UA 5JKGA 5FD2A 3CD8A 3V5QA 4NM7A 4E6AA 2X7GA 4WD5A 4WT6A 4MXZA 3EFLA 1ZMUA 4H39A 4O38A 5EDQA 5E91A 4BC6A 4C7TA 4E4NA 5HIEA 3DXQA 4FTUA 2WMXA 4K8AA 1H0WA 2QOLA 4L01A 4PP9A