5AISA

Complex of human hematopoietic prostagandin d2 synthase (hh-pgds) in complex with an active site inhibitor.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
b'PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Identification of Indole Inhibitors of Human Hematopoietic Prostaglandin D2 Synthase (Hh-Pgds).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5aisA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5aisA01
10GSA 3DVWA 4ID0A 3HJMA 2LTKA 1JHBA 5E4WA 22GSA 4MA9A 2NDOA 2ALBA 4POBA 2QC7A 5B8AA 4MCUA 2IJYA 1YZXA 4DSSA 2L59A 1NSWA 4BVXA 1ZOFA 1ERUA 4LL1B 1A24A 1R7HA 1WP0A 4IELA 4ILFA 1OE8A 1WE0A 4OD7A 2JL4A 1ST9A 2C0GA 4F03A 4TR1A 4LMWA 4OFNA 2IFQA 1VF3A 5ABRA 4IP1A 2IN3A 2IPAA 1BAYA 1VF2A 1GL8A 1OKTA 2IMFA 2PGTA 4JBBA 2DIZA 3GSTA 1KTEA 2YZHA 1X9WB 1PRXA 2VCQA 4OCEA 5CREA 1EEJA 2VCZA 5F07A 2ZCTA 3H4KA 4IKHA 3UVTA 3H93A 2OE0A 1OC8A 1J0FA 3LFLA 3O6TA 4GLTA 6GSTA 4WKWA 3IC8A 1R4WA 3GX0A 3D0ZA 2P5QA 1ERWA 2P0GA 4E8HA 9GSSA 4WF5A 4ULXA 5GZZB 2YN1A 4ZL8A 1SK1A 4V1Ag 2LJRA 2PERA 4N11A 3APOA 3C71A 1JZRA 3ISOA 3C7MA 1QUWA 2XPEA 1EGRA 1BJXA 3M3MA 1E2YA 5KN0A 4EO3A 3IK7A 3R2QA 5IIZA 3F9UA 2RLIA 1TU8A 1XOAA 2FY6A 4FO5A 2WCIA 1RQMA 4JU5A 3RAZA 2MMAA 3F3QA 3ZMKA 2QSIA 1T3BA 1T4ZA 4PQ1A 3FR9A 4K6XA 3GHAA 1HD2A 3VPTA 2BTOT 3I43A 2B3SA 4GXZA 4BVYB 4K8MA 2GZZA 4HS1A 3GKMA 4X0XA 2C80A 4KDYA 4MZBA 2XBIA 4J56E 3ZIJA 2HYXA 2DJ2A 5DCHA 17GSA 5GSTA 3BCIA 3EMXA 3CXGA 3APSA 1FOVA 1U88A 1ML6A 1H4OA 4E8EA 4K0NA 1SK2A 3M1GA 2M80A 1G7OA 4KF9A 2X8GA 4IW9A 4PXOA 1M9BA 1EZKA 4ZILA 5DALB 3EC3A 4Q5NA 1VF4A 3FKFA 3UMAA 5IPGA 4K7NA 1OC9A 3KTBA 3BBYA 2H75A 4I8BA 1PQNA 1PMTA 3GURA 3CTGA 1GH2A 1ZL9A 4HU9A 4N0VA 1R26A 3GMFA 1GNWA 1MDJA 3GRXA 2R4VA 3HVXA 4Q5FA 5IQYA 3JCML 3QAWA 4TR0A 2GGTA 1W89A 2N5BA 2HZEA 4XS6A 4RUVA 2MMZA 1MEKA 4HDEA 1A0RP 4IP6A 2AHEA 1GRXA 2O89A 1A8YA 5JWRB 1A2LA 2C0EA 3HHVA 1TI1A 3A2WA 2CX3A 2JZRA 3TOTA 3L78A 1SU9A 3KEBA 5GAND 2B1KA 2MMOA 3P7XA 1AQWA 3BD2A 2H6XA 3SBCA 1FHEA 5IMFA 3RPNA 1PN9A 3HVVA 2VM1A 5ECHB 3MAKA 1Z5YE 5ELGA 2IWTA 3LQ7A 1BYEA 3HDCA 2C0FA 3D5JA 1H75A 4HJMA 5DBQA 3IE3A 4WBRD 1EOGA 4JEDA 3EYTA 2M46A 2DJ1A 1YEXA 4N30A 2MBTA 1Z7RA 1MDIA 3VI5A 1BX9A 1WOUA 1GLQA 2L57A 1TK5B 2V6OA 2LUSA 3PGTA 1ILOA 2N5FA 5DAKB 4AJ7A 1VF1A 5IM9A 1HNAA 3E0UA 4GSSA 1YEPA 4KW6A 2RUEA 4MJCA 2K8VA 3GL3A 2FHEA 2HSNB 4EKZA 2PN8A 1BG5A 4NXIA 1U87A 2LS5A 4HJ2A 4AJ8A 1O8XA 1K3OA 4OFTA 2E7PA 4FIWA 1B8XA 1U3AA 2GVPA 2CQ9A 6GSVA 2FWHA 1TRWA 5J5NA 2PBJA 2WULA 4O7HA 2XPDA 3EU4A 3DMLA 1U6TA 4L0WA 2UZ8A 1DE2A 1B4QA 3UAPA 2ON7A 2HE3A 5J4UA 2H76A 4GTUA 2CX4A 1T00A 1USBA 1XWAA 2OBKA 4GF0A 3IR4A 3VWUA 3TDGA 4JRRA 5CRGA 1TKDB 1Z6NA 2ES7A 3FZ4A 1ACVA 4KCAA 1AIUA 12GSA 2O7KA 3HZ8A 3TKPA 3G7YA 4G0IA 1GP1A 3D4TA 2WZ9A 4QL7A 3ZVJA 4XHMA 2HRKB 4V2NA 5ECMB 2HSHA 4TRXA 1ON4A 4BVYA 3KGKA 2H6ZA 3GH6A 5ECNB 2I9HA 3KM6A 4ZB9A 1TRUA 2WS2A 5JCUA 2F51A 1K0BA 2WRTA 5ECSA 3HCZA 4L5LA 1Q4JA 4TVEA 5GSSA 6GSUA 2EIQA 2GZPA 1WWJA 3PH9A 4IS0A 4MF7A 2H0GA 2DLXA 3UL3A 2IMEA 2BJXA 3UBKA 1GUKA 3TCOA 1G7EA 4V1Ap 4ZBDA 2HQTA 2LJKA 3A2XA 4EF0A 3C1SA 5DALA 3ERGA 5A4VA 4OCFA 4KDUA 3WT2A 1VGLA 4MMMA 2TRCP 3RHBA 2H0HA 1RK4A 1JFUA 1M2BA 4K7IA 4NAXA 1HNBA 3VWWA 4PURA 2DJKA 1FB0A 1TTZA 2YJ7A 5H5SA 3WD6A 1X5EA 2GDRA 5IMCA 2MYGA 2K6VA 5ECIB 2C3NA 13GSA 3EWLA 2J23A 4K7OA 3UBLA 4MF5A 1K0MA 2D2ZA 3UEMA 3IHQA 3L9SA 2E2GA 3DRNA 4POMA 4FYCA 3DEXA 1A23A 4IJIA 1A2JA 2O85A 2PPTA 1MD3A 3GKNA 5G31A 3TKSC 5HR3A 1AC1A 3J7Yk 2YOIA 3VURA 4ZXGA 5IMVA 4EUYA 5ID2A 2H70A 4LA1A 5D73A 4EE0A 1LBKA 4EXJA 4USSA 2GSTA 3FR3A 3GN3A 4CW9A 3EE2A 2L5OA 4NPBA 2LQQA 2F9SA 2JSYA 3KXOA 5FT3A 5CYYA 2FCHA 2R3XA 3IAM2 4O5RA 2OE1A 1GUHA 3FYGA 1JLVA 3LEFA 4GRFA 5ELAA 3TJBA 5LCZA 3TB2A 4ECCA 3ZIVA 2O87A 3GTUB 1UN2A 1ZGNA 2LV3A 2YP6A 2AUVA 3GUSA 1AUCA 3FR6A 4BL7A 3VK9A 3VWXA 2KHPA 5HR2A 1I9DA 5CRWA 2H8LA 4KGIA 4PTSA 4CDOA 2GSSA 3KIJA 1ZZYA 2V32A 4I6XA 3DGQA 2NBSA 3FEUA 2YJHA 3L9UA 3Q19A 1SKRB 4ECJA 2H6YA 5F8BA 3WYWA 4GQFA 4KUNA 4ZBAA 4ZL9A 3OR5A 2L6DA 1TOFA 5IO2A 4YQUA 2R5GA 1GSUA 5ECRB 4MF6A 3ZFBA 3H1NA 2NTOA 1QK8A 5J3RA 3HJPA 5LD0A 3GX8A 3HZ4A 1KBNA 2YWNA 5IMAA 1PKWA 4IJ3A 3M9JA 3D6IA 5HQPA 4MJBA 2IMDA 3ZMLA 5KN1A 2I1UA 5FWGA 1O6JA 1LJRA 4XTSA 2KLXA 2XHFA 1M9AA 1GSQA 3F3RA 1KEBA 1A0FA 2AV4A 3ZREA 2LKUA 3VFIA 5J9BA 3FZAA 4XS4B 2VD1A 2M72A 4BWSA 2GS3A 2G2QA 3I69A 2IIYA 2TRXA 1V2AA 2E2MA 4KA0A 4BA7A 1T8EB 3L9VA 3HXSA 3CSHA 2B7KA 3C1RA 3TJJA 1ERTA 3PINA 4TXOB 5G5EA 1V40A 3HYPA 4HQZA 3VWVA 1M2DA 1XOBA 1G6YA 1YY7A 1V9WA 3PPUA 2B1LA 1B9XC 3KZQA 5B6MA 3QCPA 1GTUA 2KP1A 2HFDA 5B8BA 5INYA 1THOA 2I4AA 1K0CA 5D9WA 4Q5RA 1XBSA 2WB9A 1XWBA 2OE3A 4MH3A 3W8SA 2CV4A 1ERVA 3FZ9A 2HLSA 3GKKA 2LQOA 3U6VA 1TI3A 3TJFA 1GSDA 3PR8A 4ZBBA 2HSYA 4WR4A 6GSXA 4WBJA 5IPHA 4ZB8A 4ML6A 4F0CA 2CAIA 1O73A 2X99A 1B48A 1IYIA 2JADA 3HA9A 5CP1A 2B5XA 4D73B 3GNJA 1N2AA 1LU4A 1V58A 1OE7A 3LGCA 3HVSA 5J9CA 2VCWA 5HFIA 3DD3A 2HNLA 4I2UA 1S3CA 1GNEA 1JZWA 2MMNA 2LSTA 1IYHA 4QL9A 4TW5A 2VD0A 2VO4A 7GSSA 3SWLA 1TK0B 2VLUA 3V1WA 4PUFC 4L8EA 3DVXA 1Z9HA 1ABAA 4IVFA 4XS1A 1DSBA 1S3DA 4MDCA 4G0KA 2PWJA 5HFKA 4GQCA 3IA1A 3FK8A 2F8AA 5FHIA 1X5DA 3RDWA 3QOUA 2LRCA 1JLWA 5ECKB 2WDUA 2LEGA 1BEDA 2L4CA 5B7CA 1M0UA 2CZ3A 3HY2A 3DIEA 1QQ2A 4MJAA 2VLVA 4ZIJA 5D96A 3DXBA 5KN2A 2HXKA 3F4RA 2RUFA 2VUPA 3NIVA 3F4SA 1GTBA 1X0RA 3QD9A 5BMUA 1DE1A 1V98A 3RBTA 2FA8A 4KX4A 1HQOA 5C04A 2N5AA 2AAWA 1BQ7A 5DJLA 3J7Yb 5AN1A 4IBPA 1NM3A 5JCWA 2FA4A 4GSNA 1FB6A 2FLSA 3QMXA 1T1VA 14GSA 3QDNA 4MK3A 5F0GA 1SL0B 4BVXB 3UARA 1SL1B 2H72A 4OFMA 5EVOA 1F2EA 2GT5A 2NVLA 2PU9C 6GSSA 2AYTA 4TR1B 2IFQB 3GV1A 4F82A 2HT9A 1B4PA 3M9KA 5JCGA 3IV4A 5D8IA 2YZUA 1ZMAA 1XZOA 1DUGA 1SK0A 4RQRA 2VL2A 1J9BA 2HI7A 4ACSA 4MJEA 4J57E 1KNGA 2CA8A 3ZYWA 2C4JA 3E3EA 5KEJA 4MZWA 4HU7A 3IRAA 5DQSA 2V2GA 3GKXA 4AF2A 2HSMB 2OADA 2Z9SA 2CAQA 2DJ3A 1K3YA 2V6KA 4WR5A 5H5QA 3F6DA 4OWYA 3W6GA 2X8CA 3G7JA 4P3YB 3M8NA 4H86A 1TJDA 2RIIA 4NHWA 1RW1A 5ENUA 3KH9A 5AGYA 2VL9A 4Q5QA 4NMUA 2JU5A 3FY7A 1UC7A 2AB6A 5A4UA 2C8UA 1PA3A 2YV7A 4V2LA 1OYJA 1YQ1A 2DBCA 2H1AA 1EP8A 3WT1A 3RHCA 3MWHA 4IHUA 1WRYA 5JWQB 4EL1A 2IMIA 3BJ5A 4N10A 4I5QA 2R6KA 4K0GA 4F2IA 6GSWA 3VLNA 5CNWA 4KSMA 4G10A 3D22A 2K9FA 2P5RA 1WIKA 4FYUA 1YJ6A 3D4MA 2ZUPA 2IL3A 1EEMA 5IOXA 1F3AA 3CSIA 4G19A 2YCDA 5G30A 3H79A 5EL8A 19GSA 2OKAA 4OMVA 1AAZA 4FYBA 1FVKA 2DIYA 3KH7A 3O76A 4X1UA 5G1KA 3FHKA 4CHSA 3DKSA 3F63A 1XWCA 4N0ZA 3LXZA 1XWKA 3LJRA 3KMOA 4IQ1A 11GSA 3EMPA 1TU7A 1GSFA 2DJJA 2K18A 3A3TA 3CYNA 5DVBA 2ON5A 2PMTA 5GAPD 3GH9A 1QXHA 4F0BA 1THXA 1F6MC 3TKQA 1R5PA 1OC9B 3KD0A 2E0QA 2AJQB 2GQLA 5ECOB 1XW9A 1W4VA 3TOUA 4KSOA 1NHYA 2VCXA 3UVHA 2PUKC 5JWOB 2DMMA 2HZEB 2GQKA 2NPBA 2O8VB 1WJKA 2B5YA 3ERFA 3U5RE 2H0IA 4RQXA 5EY6A 3IDVA 4JR4A 3P2AA 1SYRA 1UVZA 2GT6A 1G6WA 1OAZA 5C00A 4L5OA 5B6NA 1SD9A 3ZVJD 4HZ4A 1O81A 3P90A 2BMXA 4RI6A 2H1GA 3GL5A 3LG6A 1F9MA 5IO0A 5DAKA 1DBYA 3MDKA 3TRPA 2VCVA 3GSSA 4LMVA 5ECQB 4KAEA 2EIRA 2F8FA 2V41A 2FWGA 4PGTA 2WFCA 1TK8B 3ZRDA 4DEJA 4MH2A 3BOAA 3ZLPA 2VL2C 2KUCA 4YAVA 1O85A 1PKZA 4KCEA 5AIVA 3UJ1A 3I9V2 3QR6A 2WJUA 4ISDA 2JZSA 1AQVA 4GWRA 1C72A 3TRXA 1ZCPA 2H1DA 5D9VA 4PX1A 2H30A 4MPFA 2GQMA 3GFKA 5DQYA 2H01A 3L0HA 1WMJA 2FD3A 8GSSA 20GSA 2RM5A 1XWGA 2L5LA 3K8NA 2WGRA 1FO5A 2HSMA 4F9ZA 2GTUA 3O3TA 1YF1A 4MLYA 2I3YA 4WXTA 1ZYEA 1OKDA 4NV5A 4POKA 2VLTA 3MSZA 5DCGA 2LJAA 3WGXA 2VL3A 4WEYA 2C0DA 2YWIA 3N9JA 1SJ6A 5D9TA 2X64A 1Y6EA 1XW6A 2H19A 2ZNMA 1XFLA 4HOJA 5DJMA 1MDKA 4KB3A 2HRKA 1XXUA 2JACA 4JE1A 1YKAA 3VI7A 3GIXA 4K9ZA 1SJZA 3IOSA 4FQUA 4HQSA 1K0OA 2PVQA 2H66A 1Y25A 1B9YC 2YPMA 5IMDA 4ZL7A 3KCMA 1CQGA 16GSA 2HRFA 3KP9A 2L4QA 2F3MA 4TOPA 4BPYA 1SKWB 3IAS2 2B6MA 3TJKA 3F0IA 3RPPA 5CRDA 1SL2B 5A4WA 5E59A 1PX6A 2XBQA 1TRSA 1GUMA 4LLRA 4MP4A 1SD8A 4GCIA 2V1MA 2DC5A 4K1FA 1AQXA 2B5EA 5CAXA 5D9XA 5COHA 4ECIA 4XRDA 1GTAA 2FNOA 18GSA 4YAPA 3QPMA 4KE3A 4ML1A 5ECPB 1QMVA 3ME7A 3LYPA 3VPQA 4Z7XA 1M7TA 3D21A 1EV9A 1F3BA 3H8QA 3LWAA 2GLRA 1XVQA 5IMZA 3IXRA 5L71A 1E6BA 4V2MA 5J41A 5HFGA 4AJ6A 4KDXA 3LXTA 1NHOA 4BWQA 3G7IA 5KN3A 5F05A 3C73A 3ZFLA 4G0LA 4KNDA 3QAGA 3L4NA 2A2RA 1GSSA 1TRVA 5CRHA 4LL4B 3M0FA 1V57A 4HEA2 2H71A 3A2VA 3NZNA 4PUAA 1A2MA 3CTFA 3QFBC 4MZCA 2OJLA 4L0UA 1A8LA 4NWYA 1T4YA 1X9SB 1TXXA 5DDLA 1N8JA 4OO4A 4NHZA 2IMKA 3N5OA 3HD5A 3Q74A 3DYRA 3GA4A 2RM6A 4WF4A 5D93A 1SJIA 3FZ5A 1GSYA 4DSRA 4GSTA 4G9HA 4EDYA 1F37A 2LNSA 3UIWA 1VRSD 1UA5A 4YQMA 3IBHA 3EU3A 1PD21 3CRUA 1FAAA 1PL1A 2YWMA 3QFAC 4OO5A 2B7JA 2P31A 4JZQA 2H73A 4X43A 3AY8A 4TR3A 4G2EA 2OBIA 1EWXA 1YF0A 1U3IA 1K3LA 2PVOC 1J08A 2X8HA 2YWOA 3APQA 5H5RA 5ECLB 1PX7A 5ID2B 3GTUA 1GTIA 3ZTLA 4PNGA 3F8UA 4HI7A 5HR1A 5AIXA 3ME8A 5A5KA 2FWEA 2GZYA 3TRQA 3CRTA 1AXDA 2MZCA 2CZ2A 1OC3A 1FG4A 1O8WA 3TKSA 1MD4A 4YH2A 1Z3EA 1OVNA 5LNKe 1EP7A 1GLPA 1NW2A 1TP9A 1PSQA 2EIOA 4DSSB 3ERWA 3CSJA 4MABA 5G2ZA 2HZFA 2HRNA 1WPIA 2G0FA 3GYKA 5F06A 4FH8A 3I6AA 4BL7B 2KP2A 2LRTA 2A2SA 3NOFA 2I81A 1HYUA 2EC4A 2GSQA 3Q18A 3TKRA 1G0TA 1QFNA 3HJOA 4O32A 3WGDA 2GSRA 3LYKA 2L6CA 2LNTA 4EC0A 3EVIA 2FGXA 1YDKA 3MNGA 3IPZA 2R2JA 4I2TA 1XVWA 4EDZA 5CO3A 4DSQA 3US3A 2REMA 4RI7A 2XC2A 1K0NA 4XIHA 2FUG2 1M2AA 3F4TA 1X5CA 4ZB6A 1R5AA 1S3AA 1TW9A 3IC4A 4QQ7A 3ZITA 2VCTA 5EPFA 4XS4A 4JR6A 2VM2A 3TKSE 4TR4A 2CVKA 3WGEA 3EINA 3W8JA 1GSEA 2DJ0A 2MBSA 5AISA 1O7UA 4K2DA 4HZ2A 3ZZXA 1SENA 2JZTA 2C1YA 2VOCA 3S9FA 2CVBA 1Z6MA 2OA7A 5G1LA 4TXOA 3LORA 1XPVA 4DVCA 1FVJA 2CT6A 2TIRA 3CBUA 2DMLA 5IOWA 5HR0A 3E9JB 3TGZA 1JZDA 2C3TA 1HNCA 1EV4A 3LSZA 1SYXA 2DSAA 4TXVA 1X9MB 1PGTA 2K8SA 2FWFA 1PL2A 4J2FA 2C3QA 1XIYA 3FW2A 2VIMA 3TJGA 1GULA 1SKSB 2JSZA 4IN0A 4NV2A 2LRNA 4MPGA 4POLA 3A5WA 2J9HA 1QGVA 4D73A 3KP8A 1CQHA 3ED3A 1MTCA 3Q6OA 3QAVA 1GWCA 4IGJA 3CMIA 3P8WA 1JZOA 1Q98A 1T7PB 3G9BA 1I5GA 2CVDA 4XRAA 1Z7PA 3BCKA 1EGOA 2A4VA 2R37A 4I97A 4EVMA 3FRCA 3KJYA 4O92A 4PQIA 4PQHA 1EOHA 2YNXA 4TN8A 1M99A 1K0AA 2HRAA 1XW5A 2KOKA 3DWVA 3KTLA 3TUEA 4IQAA 3HKRA 3KMNA 3ZL5A 1TDIA 2H1BA 5G5FA 3R3EA 2OACA 2VAFA 2H74A 4ECBA 4KH7A 2QGVA 2YANA 3IK9A 6GSYA 3C8EA 1XCCA 4HUAA 1ZYQB 4AGSA 1FW1A 4WETA 2YV9A 4YQVA 3F6FA 1AW9A 4TKYA 4XCSA 4PNFA 2QKEA 1K0DA 3UOMA 1URMA 1YKCA 3EURA
chains in the Genus database with same CATH superfamily
10GSA 3DVWA 4ID0A 3HJMA 2LTKA 1JHBA 2X4AA 5E4WA 22GSA 4MA9A 2NDOA 2ALBA 4POBA 2QC7A 5B8AA 4MCUA 2IJYA 4FXYP 1YZXA 4DSSA 2L59A 1NSWA 4BVXA 1ZOFA 2WVXB 5KOWA 3RFRC 1ERUA 4LL1B 1A24A 1R7HA 1WP0A 4IELA 4ILFA 1OE8A 1WE0A 4OD7A 2JL4A 1ST9A 2C0GA 4F03A 4TR1A 4LMWA 4OFNA 2IFQA 1VF3A 5ABRA 4IP1A 2IN3A 2IPAA 1BAYA 1VF2A 1GL8A 1OKTA 4Z2RA 2IMFA 2PGTA 4JBBA 4EIPA 2DIZA 3GSTA 1KTEA 2YZHA 1X9WB 1PRXA 2VCQA 4OCEA 5CREA 1EEJA 2VCZA 3MYDA 5F07A 2ZCTA 3H4KA 4IKHA 3UVTA 3H93A 2OE0A 1OC8A 1J0FA 3LFLA 3O6TA 4GLTA 6GSTA 4WKWA 4GDFA 3IC8A 1R4WA 2O36A 3GX0A 3D0ZA 2P5QA 1ERWA 4MNNA 2P0GA 4E8HA 9GSSA 4WF5A 4ULXA 5GZZB 2YN1A 4Z2UA 4ZL8A 1SK1A 4V1Ag 2LJRA 2PERA 4N11A 3APOA 3C71A 1JZRA 3ISOA 3C7MA 1QUWA 2XPEA 1EGRA 1BJXA 3M3MA 1E2YA 2UV8G 5KN0A 4EO3A 3IK7A 3R2QA 5IIZA 3F9UA 2RLIA 1TU8A 1XOAA 2FY6A 4FO5A 2WCIA 4QMKA 1RQMA 4JU5A 3RAZA 2MMAA 2WW1A 3F3QA 3ZMKA 2QSIA 1T3BA 1T4ZA 4PQ1A 3FR9A 4K6XA 1SVOA 3GHAA 1HD2A 3VPTA 4CY8A 5A34B 2BTOT 3I43A 2B3SA 4GXZA 4BVYB 4K8MA 2GZZA 4HS1A 3GKMA 4X0XA 2C80A 4KDYA 4MZBA 2XBIA 4J56E 3ZIJA 2HYXA 2DJ2A 5DCHA 17GSA 5GSTA 3BCIA 3EMXA 3CXGA 3APSA 1FOVA 3HVNA 1U88A 1ML6A 1H4OA 4E8EA 4K0NA 1SK2A 3M1GA 2M80A 1G7OA 4KF9A 2X8GA 4IW9A 4PXOA 1M9BA 1EZKA 4ZILA 5DALB 3EC3A 4Q5NA 1VF4A 3FKFA 3UMAA 5IPGA 4K7NA 1OC9A 3KTBA 3BBYA 2H75A 4I8BA 1PQNA 1PMTA 3GURA 3CTGA 1GH2A 1ZL9A 4HU9A 4N0VA 1R26A 3GMFA 1GNWA 1MDJA 3GRXA 2R4VA 3HVXA 4Q5FA 5IQYA 3JCML 3QAWA 4TR0A 2GGTA 1W89A 2N5BA 2HZEA 4XS6A 4RUVA 2MMZA 1MEKA 4HDEA 1A0RP 4IP6A 2AHEA 1GRXA 2O89A 1A8YA 5JWRB 1A2LA 2C0EA 3HHVA 1TI1A 3A2WA 2CX3A 2JZRA 3TOTA 3L78A 1SU9A 3KEBA 5GAND 2B1KA 2MMOA 3P7XA 1AQWA 3BD2A 2H6XA 3SBCA 1FHEA 5IMFA 3RPNA 1PN9A 3HVVA 2VM1A 5ECHB 3MAKA 1Z5YE 5ELGA 1M3IA 2IWTA 3LQ7A 1BYEA 3HDCA 2C0FA 3D5JA 1H75A 4HJMA 5DBQA 5A5HB 3IE3A 2A2PA 4WBRD 1EOGA 4JEDA 3EYTA 2M46A 2DJ1A 1YEXA 4N30A 2MBTA 1Z7RA 1MDIA 3VI5A 1BX9A 1WOUA 1GLQA 2L57A 1TK5B 2V6OA 2LUSA 3PGTA 1ILOA 2N5FA 5DAKB 4AJ7A 1VF1A 5IM9A 1HNAA 3E0UA 4GSSA 1YEPA 4KW6A 2RUEA 4MJCA 2K8VA 3GL3A 2FHEA 2HSNB 4EKZA 2PN8A 1BG5A 4NXIA 1U87A 2LS5A 4HJ2A 4AJ8A 1O8XA 1K3OA 4OFTA 2E7PA 4FIWA 1B8XA 1U3AA 2GVPA 2CQ9A 6GSVA 2FWHA 1TRWA 5J5NA 2PBJA 2WULA 4O7HA 2XPDA 3EU4A 3DMLA 1U6TA 4L0WA 2UZ8A 1DE2A 1B4QA 3UAPA 2ON7A 2HE3A 5J4UA 2H76A 4GTUA 2CX4A 1T00A 1USBA 1XWAA 2OBKA 4GF0A 3IR4A 3VWUA 4K5SA 3TDGA 4JRRA 5CRGA 1TKDB 1Z6NA 2ES7A 3FZ4A 1ACVA 4KCAA 1AIUA 12GSA 2O7KA 3HZ8A 3TKPA 3G7YA 4G0IA 1GP1A 3D4TA 2WZ9A 4QL7A 3ZVJA 1N25A 4XHMA 2HRKB 4V2NA 5ECMB 2HSHA 4TRXA 1SVLA 1ON4A 4BVYA 3KGKA 2H6ZA 3GH6A 5ECNB 2I9HA 3KM6A 4ZB9A 1TRUA 2WS2A 5JCUA 2F51A 1K0BA 2WRTA 5ECSA 3HCZA 4L5LA 1Q4JA 4TVEA 5GSSA 6GSUA 2EIQA 2GZPA 1WWJA 3PH9A 2WW0A 4IS0A 4MF7A 2H0GA 2DLXA 1FOHA 3UL3A 2IMEA 2BJXA 3UBKA 1GUKA 3TCOA 1G7EA 4V1Ap 4ZBDA 2HQTA 2LJKA 3A2XA 4EF0A 3C1SA 5DALA 3ERGA 5A4VA 4OCFA 4KDUA 3WT2A 1VGLA 4MMMA 2TRCP 3RHBA 2H0HA 1RK4A 1JFUA 1M2BA 4K7IA 4NAXA 1HNBA 3VWWA 4PURA 2DJKA 1FB0A 1TTZA 2YJ7A 5H5SA 3WD6A 1X5EA 1S4BP 2GDRA 5J4YA 5IMCA 2MYGA 2K6VA 5ECIB 2C3NA 13GSA 4ICYA 3EWLA 2J23A 4K7OA 3UBLA 4MF5A 1K0MA 2D2ZA 3UEMA 3IHQA 3L9SA 2E2GA 3LW9A 3DRNA 4POMA 4FYCA 3DEXA 1A23A 4IJIA 1A2JA 2O85A 2PPTA 1MD3A 3GKNA 5G31A 3TKSC 5HR3A 1AC1A 3J7Yk 2YOIA 1BF5A 3VURA 4ZXGA 5IMVA 4EUYA 5ID2A 2EFDA 2H70A 4LA1A 5D73A 4EE0A 1LBKA 4EXJA 4USSA 2GSTA 3FR3A 3GN3A 4CW9A 3EE2A 2L5OA 4NPBA 2LQQA 2F9SA 2JSYA 3KXOA 5FT3A 5CYYA 2FCHA 2R3XA 3IAM2 4O5RA 2OE1A 1GUHA 3FYGA 1JLVA 3LEFA 4ZB7A 4GRFA 5ELAA 3TJBA 5LCZA 3TB2A 4ECCA 3ZIVA 2O87A 3GTUB 1UN2A 1ZGNA 2LV3A 2YP6A 2AUVA 3GUSA 1AUCA 5BMUB 3FR6A 4BL7A 3VK9A 3VWXA 2QA1A 2KHPA 5HR2A 3FMWA 1I9DA 5CRWA 2H8LA 4KGIA 3RGBC 4PTSA 4CDOA 2GSSA 3KIJA 1ZZYA 2V32A 4I6XA 2O5VA 3DGQA 2NBSA 3FEUA 2YJHA 4A5PA 3L9UA 3Q19A 2A4HA 1SKRB 4ECJA 2H6YA 5F8BA 3WYWA 4GQFA 4KUNA 4ZBAA 4ZL9A 3OR5A 2L6DA 1TOFA 2WW3A 5IO2A 4YQUA 2R5GA 1GSUA 5ECRB 4MF6A 3ZFBA 3H1NA 2NTOA 1QK8A 5J3RA 3HJPA 5LD0A 3GX8A 3HZ4A 1KBNA 2YWNA 5IMAA 1PKWA 4IJ3A 3M9JA 3D6IA 5HQPA 2R0GA 4MJBA 2IMDA 3ZMLA 1BG1A 5KN1A 2I1UA 5FWGA 1O6JA 1LJRA 2R0CA 4XTSA 2KLXA 2XHFA 2WVYA 1M9AA 1GSQA 3F3RA 1KEBA 1A0FA 2AV4A 3ZREA 2LKUA 3VFIA 5J9BA 3FZAA 4XS4B 2VD1A 2M72A 4BWSA 2GS3A 2G2QA 3I69A 2IIYA 2TRXA 1V2AA 2E2MA 4KA0A 4BA7A 1T8EB 3L9VA 3HXSA 3CSHA 2B7KA 3C1RA 3TJJA 1ERTA 3PINA 4TXOB 5G5EA 1V40A 3HYPA 4HQZA 3VWVA 1M2DA 1XOBA 1G6YA 1YY7A 1S3RA 3PPUA 1V9WA 2B1LA 1B9XC 3KZQA 5B6MA 3QCPA 1GTUA 2KP1A 2HFDA 5B8BA 5INYA 1THOA 2I4AA 1K0CA 5D9WA 5A1NB 4Q5RA 1XBSA 2WB9A 1XWBA 2OE3A 4MH3A 3W8SA 2CV4A 1ERVA 3FZ9A 2HLSA 3GKKA 2LQOA 3U6VA 1TI3A 1ZYNA 3TJFA 1GSDA 3PR8A 4ZBBA 2HSYA 4WR4A 6GSXA 4WBJA 5IPHA 4ZB8A 4ML6A 4F0CA 2CAIA 1O73A 4O5QA 2X99A 1B48A 1IYIA 2JADA 3HA9A 5CP1A 2B5XA 4D73B 3GNJA 1N2AA 1LU4A 1V58A 1OE7A 3LGCA 3HVSA 5J9CA 2VCWA 2EFHA 5HFIA 3DD3A 2HNLA 4I2UA 1S3CA 1GNEA 1JZWA 2MMNA 2LSTA 1IYHA 4QL9A 4TW5A 2VD0A 2VO4A 7GSSA 3SWLA 1TK0B 2VLUA 3V1WA 4PUFC 4L8EA 3DVXA 1Z9HA 1ABAA 4IVFA 4XS1A 1DSBA 1S3DA 4MDCA 4G0KA 2PWJA 5HFKA 3IA1A 4GQCA 3FK8A 2F8AA 5FHIA 1X5DA 3RDWA 3QOUA 2LRCA 1JLWA 5ECKB 2WDUA 2LEGA 1YVLA 1BEDA 2L4CA 2DKIA 5B7CA 1M0UA 2CZ3A 3HY2A 3DIEA 1QQ2A 4MJAA 2VLVA 4ZIJA 5D96A 3DXBA 5KN2A 2HXKA 2WVXA 4AKGA 3F4RA 2RUFA 2VUPA 3NIVA 3F4SA 5BRTA 1GTBA 1X0RA 3QD9A 5BMUA 1DE1A 1V98A 3RBTA 2FA8A 4KX4A 1HQOA 1PN0A 5C04A 2N5AA 2AAWA 1BQ7A 5DJLA 3J7Yb 5AN1A 4IBPA 1NM3A 5JCWA 2FA4A 4GSNA 1FB6A 2FLSA 3QMXA 1T1VA 4N3ZA 14GSA 3QDNA 2OT3A 4MK3A 5F0GA 1SL0B 4BVXB 3UARA 4AKIA 1SL1B 2H72A 4OFMA 5EVOA 1F2EA 2GT5A 2NVLA 2PU9C 6GSSA 2AYTA 4TR1B 2IFQB 3GV1A 4F82A 2HT9A 1B4PA 3M9KA 5JCGA 3IV4A 5D8IA 2YZUA 1ZMAA 1XZOA 1DUGA 1SK0A 4RQRA 2VL2A 1J9BA 2HI7A 4ACSA 4MJEA 4J57E 1KNGA 2CA8A 3ZYWA 2C4JA 3E3EA 5KEJA 4MZWA 4HU7A 3IRAA 5DQSA 2V2GA 3GKXA 4AF2A 2HSMB 1PFOA 2OADA 2Z9SA 2CAQA 2DJ3A 1K3YA 2V6KA 3HMJG 4WR5A 5H5QA 3F6DA 4OWYA 3W6GA 2X8CA 3G7JA 4P3YB 3M8NA 4H86A 1TJDA 2RIIA 4AKXB 4PI2C 4NHWA 1RW1A 5ENUA 3KH9A 5AGYA 2VL9A 4Q5QA 4NMUA 2JU5A 3FY7A 5J4VA 1UC7A 5A34A 2AB6A 5A4UA 2C8UA 1PA3A 2YV7A 4V2LA 1OYJA 1YQ1A 2DBCA 2H1AA 1EP8A 3WT1A 3RHCA 3MWHA 4IHUA 1WRYA 5JWQB 4EL1A 2IMIA 3BJ5A 4N10A 4I5QA 2R6KA 4K0GA 5A1NA 1Y1UA 4F2IA 6GSWA 3VLNA 5CNWA 4KSMA 4G10A 3D22A 2K9FA 2P5RA 1WIKA 4FYUA 1YJ6A 3D4MA 2ZUPA 2IL3A 1EEMA 5IOXA 1F3AA 3CSIA 4G19A 2YCDA 5G30A 3H79A 5EL8A 19GSA 2OKAA 4OMVA 1AAZA 4FYBA 1FVKA 2DIYA 3KH7A 3O76A 4X1UA 5G1KA 3FHKA 4CHSA 3DKSA 3F63A 1XWCA 4N0ZA 3LXZA 1XWKA 3LJRA 3KMOA 4IQ1A 11GSA 3EMPA 1TU7A 1GSFA 2DJJA 2K18A 3A3TA 3CYNA 5DVBA 2ON5A 2PMTA 5GAPD 3GH9A 1QXHA 4F0BA 1I1IP 1THXA 1F6MC 3TKQA 2X49A 1R5PA 1OC9B 3KD0A 2E0QA 2AJQB 2GQLA 5ECOB 1XW9A 1W4VA 3CQFA 2WVZA 4Z2TA 3TOUA 4KSOA 1NHYA 2VCXA 3UVHA 2PUKC 5JWOB 2DMMA 2HZEB 2GQKA 5A5HA 2NPBA 2O8VB 1WJKA 4AKHA 2B5YA 3ERFA 3U5RE 1YEWC 2H0IA 4RQXA 5EY6A 3IDVA 4JR4A 4K5RA 3P2AA 1SYRA 1UVZA 2GT6A 1G6WA 1OAZA 5C00A 4L5OA 5B6NA 1SD9A 3ZVJD 4HZ4A 1O81A 3P90A 2BMXA 4RI6A 2H1GA 3GL5A 3LG6A 1F9MA 5IO0A 5DAKA 1DBYA 3MDKA 3TRPA 2VCVA 3GSSA 1ZYPA 4LMVA 5ECQB 4KAEA 2EIRA 4W66A 2F8FA 2V41A 2FWGA 4PGTA 2WFCA 1TK8B 3ZRDA 4DEJA 4MH2A 3BOAA 3ZLPA 2VL2C 2KUCA 2HSNA 4YAVA 1O85A 1PKZA 4KCEA 5AIVA 3UJ1A 3I9V2 3QR6A 4X4JA 2WJUA 4ISDA 2JZSA 1AQVA 4GWRA 1C72A 3TRXA 1ZCPA 2H1DA 5D9VA 4PX1A 2H30A 4MPFA 2GQMA 3GFKA 2WW2A 5DQYA 2H01A 2EFCA 3L0HA 1WMJA 2FD3A 8GSSA 20GSA 2RM5A 1XWGA 2L5LA 3K8NA 2WGRA 1FO5A 2HSMA 4F9ZA 2GTUA 3O3TA 1YF1A 4MLYA 2I3YA 4WXTA 1ZYEA 1OKDA 3TU3B 4NV5A 4POKA 2VLTA 3MSZA 5DCGA 2LJAA 3WGXA 2VL3A 4WEYA 2C0DA 2YWIA 3N9JA 1SJ6A 5D9TA 2X64A 1Y6EA 1XW6A 2H19A 2ZNMA 1XFLA 4HOJA 5DJMA 1MDKA 4KB3A 2HRKA 1XXUA 2JACA 4JE1A 1YKAA 3VI7A 3GIXA 4K9ZA 1SJZA 3IOSA 4FQUA 4HQSA 1K0OA 2PVQA 2H66A 1Y25A 1B9YC 2YPMA 5IMDA 4ZL7A 3KCMA 4HSCX 1CQGA 16GSA 2HRFA 3KP9A 2L4QA 2F3MA 4TOPA 4BPYA 4PHZC 1SKWB 3IAS2 4AI6A 2B6MA 3TJKA 3F0IA 3MIXA 3RPPA 5CRDA 1SL2B 5A4WA 5E59A 1PX6A 2XBQA 1TRSA 1GUMA 4LLRA 4MP4A 1SD8A 4GCIA 2V1MA 2DC5A 1M3JA 4K1FA 1AQXA 2B5EA 5CAXA 5D9XA 1TXUA 5COHA 4ECIA 4XRDA 1GTAA 2FNOA 18GSA 4YAPA 3QPMA 4KE3A 4ML1A 5ECPB 1QMVA 3ME7A 3LYPA 3VPQA 4Z7XA 1M7TA 3D21A 1EV9A 1F3BA 3H8QA 3LWAA 2GLRA 1XVQA 5IMZA 3IXRA 5L71A 1E6BA 4V2MA 5J41A 5HFGA 4AJ6A 4KDXA 3LXTA 1NHOA 4BWQA 3G7IA 5KN3A 5F05A 3C73A 3ZFLA 4G0LA 4KNDA 3QAGA 3L4NA 4YKFA 2A2RA 1GSSA 1TRVA 5CRHA 4LL4B 3M0FA 1V57A 4HEA2 2H71A 3A2VA 3CHXC 3NZNA 4PUAA 5KOXA 1A2MA 3CTFA 3QFBC 4MZCA 2OJLA 4L0UA 1A8LA 4NWYA 1T4YA 1X9SB 1TXXA 5DDLA 1N8JA 4OO4A 4NHZA 2IMKA 3N5OA 3HD5A 3Q74A 3DYRA 3GA4A 2RM6A 4WF4A 5D93A 1SJIA 3FZ5A 1GSYA 4DSRA 4GSTA 4G9HA 4EDYA 1F37A 2LNSA 3UIWA 2DKHA 1VRSD 1UA5A 4YQMA 3IBHA 3EU3A 1PD21 3CRUA 1FAAA 1PL1A 2YWMA 3QFAC 4OO5A 2B7JA 4YKGA 2P31A 4JZQA 2H73A 3EPTA 4X43A 3AY8A 4TR3A 4G2EA 2OBIA 1EWXA 1YF0A 1U3IA 1K3LA 2PVOC 1J08A 2X8HA 2YWOA 3APQA 5H5RA 5ECLB 1PX7A 5ID2B 3GTUA 1GTIA 3ZTLA 4PNGA 3F8UA 4HI7A 5HR1A 4BIKA 5AIXA 3ME8A 5A5KA 4PI0C 2FWEA 2GZYA 3TRQA 3CRTA 1AXDA 2MZCA 2CZ2A 1OC3A 1FG4A 2EFEA 1O8WA 3TKSA 1MD4A 4YH2A 1Z3EA 1OVNA 5LNKe 1EP7A 1GLPA 1NW2A 1TP9A 1PSQA 2EIOA 3IHGA 4DSSB 3ERWA 3CSJA 4MABA 5G2ZA 2HZFA 1XG8A 2HRNA 1WPIA 2G0FA 3GYKA 5F06A 4FH8A 4E68A 3I6AA 4BL7B 2KP2A 2LRTA 2A2SA 3NOFA 2I81A 1HYUA 2EC4A 2GSQA 3Q18A 3TKRA 1G0TA 1QFNA 3HJOA 4O32A 3WGDA 2GSRA 3LYKA 2L6CA 2LNTA 4G01A 4EC0A 3EVIA 2FGXA 1YDKA 3MNGA 3IPZA 2R2JA 3CWGA 4I2TA 1XVWA 4EDZA 5CO3A 4DSQA 3US3A 2REMA 4RI7A 2XC2A 1K0NA 4XIHA 2FUG2 1M2AA 3F4TA 1X5CA 4ZB6A 1R5AA 1S3AA 1TW9A 3IC4A 4QQ7A 3ZITA 2VCTA 5EPFA 4XS4A 2WZSA 4JR6A 2VM2A 3TKSE 4TR4A 2CVKA 3WGEA 3EINA 3W8JA 1GSEA 2DJ0A 2MBSA 5AISA 1O7UA 2VKZG 4K2DA 4HZ2A 3ZZXA 1SENA 2JZTA 2C1YA 2VOCA 3S9FA 2CVBA 1Z6MA 2OA7A 5G1LA 4TXOA 3LORA 1XPVA 4DVCA 1FVJA 2CT6A 2TIRA 3CBUA 3A5IA 2DMLA 5IOWA 5HR0A 3E9JB 3TGZA 1JZDA 2C3TA 5J47A 1HNCA 1EV4A 3LSZA 1SYXA 2DSAA 4TXVA 1X9MB 1PGTA 2K8SA 2FWFA 2O3EA 1PL2A 4J2FA 5J40A 2C3QA 1XIYA 3FW2A 2VIMA 3TJGA 1GULA 1SVMA 1SKSB 2JSZA 4IN0A 4NV2A 2LRNA 4MPGA 4POLA 3A5WA 2J9HA 1QGVA 4D73A 3KP8A 1CQHA 3ED3A 4EIQA 1MTCA 3Q6OA 3QAVA 1GWCA 4IGJA 3CMIA 3P8WA 1JZOA 1Q98A 1T7PB 3G9BA 1I5GA 2CVDA 4XRAA 2QA2A 1Z7PA 3BCKA 1EGOA 2A4VA 2R37A 4I97A 4EVMA 3FRCA 3KJYA 4O92A 4PQIA 4PQHA 1EOHA 2YNXA 4TN8A 1M99A 1K0AA 2HRAA 1XW5A 2KOKA 3DWVA 4O5UA 3KTLA 3TUEA 4IQAA 2R0PA 3HKRA 3KMNA 3ZL5A 1TDIA 2H1BA 5G5FA 3R3EA 2OACA 2VAFA 2H74A 4ECBA 4KH7A 4K2XA 2QGVA 4CY6A 2YANA 3IK9A 6GSYA 2H1LA 3C8EA 1XCCA 4HUAA 1ZYQB 4AGSA 1FW1A 4WETA 2YV9A 4YQVA 3F6FA 1AW9A 4TKYA 4XCSA 4PNFA 2QKEA 1K0DA 3UOMA 1URMA 1YKCA 3EURA
chains in the Genus database with same CATH topology
10GSA 3DVWA 4ID0A 3HJMA 2LTKA 1JHBA 2X4AA 5E4WA 22GSA 4MA9A 2NDOA 2ALBA 4POBA 2QC7A 5B8AA 4MCUA 2IJYA 1YZXA 4DSSA 2L59A 1NSWA 4BVXA 1ZOFA 5KOWA 1ERUA 4LL1B 1A24A 1R7HA 1WP0A 4IELA 4ILFA 1OE8A 1WE0A 4OD7A 2JL4A 1ST9A 2C0GA 4F03A 4TR1A 4LMWA 4OFNA 2IFQA 1VF3A 5ABRA 4IP1A 2IN3A 2IPAA 1BAYA 1VF2A 1GL8A 1OKTA 4Z2RA 2IMFA 2PGTA 4JBBA 4EIPA 2DIZA 3GSTA 1KTEA 2YZHA 1X9WB 1PRXA 2VCQA 4OCEA 5CREA 1EEJA 2VCZA 3MYDA 5F07A 2ZCTA 3H4KA 4IKHA 3UVTA 3H93A 2OE0A 1OC8A 1J0FA 3LFLA 3O6TA 4GLTA 6GSTA 4WKWA 4GDFA 3IC8A 1R4WA 3GX0A 3D0ZA 2P5QA 1ERWA 4MNNA 2P0GA 4E8HA 9GSSA 4WF5A 4ULXA 5GZZB 2YN1A 4Z2UA 4ZL8A 1SK1A 4V1Ag 2LJRA 2PERA 4N11A 3APOA 3C71A 1JZRA 3ISOA 3C7MA 1QUWA 2XPEA 1EGRA 1BJXA 3M3MA 1E2YA 2UV8G 5KN0A 4EO3A 3IK7A 3R2QA 5IIZA 3F9UA 2RLIA 1TU8A 1XOAA 2FY6A 4FO5A 2WCIA 4QMKA 1RQMA 4JU5A 3RAZA 2MMAA 3F3QA 3ZMKA 2QSIA 1T3BA 1T4ZA 4PQ1A 3FR9A 4K6XA 1SVOA 3GHAA 1HD2A 3VPTA 4CY8A 5A34B 2BTOT 3I43A 2B3SA 4GXZA 4BVYB 4K8MA 2GZZA 4HS1A 3GKMA 4X0XA 2C80A 4KDYA 4MZBA 2XBIA 4J56E 3ZIJA 2HYXA 2DJ2A 5DCHA 17GSA 5GSTA 3BCIA 3EMXA 3CXGA 3APSA 1FOVA 1U88A 1ML6A 1H4OA 4E8EA 4K0NA 1SK2A 3M1GA 2M80A 1G7OA 4KF9A 2X8GA 4IW9A 4PXOA 1M9BA 1EZKA 4ZILA 5DALB 3EC3A 4Q5NA 1VF4A 3FKFA 3UMAA 5IPGA 4K7NA 1OC9A 3KTBA 3BBYA 2H75A 4I8BA 1PQNA 1PMTA 3GURA 3CTGA 1GH2A 1ZL9A 4HU9A 4N0VA 1R26A 3GMFA 1GNWA 1MDJA 3GRXA 2R4VA 3HVXA 4Q5FA 5IQYA 3JCML 3QAWA 4TR0A 2GGTA 1W89A 2N5BA 2HZEA 4XS6A 4RUVA 2MMZA 1MEKA 4HDEA 1A0RP 4IP6A 2AHEA 1GRXA 2O89A 1A8YA 5JWRB 1A2LA 2C0EA 3HHVA 1TI1A 3A2WA 2CX3A 2JZRA 3TOTA 3L78A 1SU9A 3KEBA 5GAND 2B1KA 2MMOA 3P7XA 1AQWA 3BD2A 2H6XA 3SBCA 1FHEA 5IMFA 3RPNA 1PN9A 3HVVA 2VM1A 5ECHB 3MAKA 1Z5YE 5ELGA 2IWTA 3LQ7A 1BYEA 3HDCA 2C0FA 3D5JA 1H75A 4HJMA 5DBQA 5A5HB 3IE3A 2A2PA 4WBRD 1EOGA 4JEDA 3EYTA 2M46A 2DJ1A 1YEXA 4N30A 2MBTA 1Z7RA 1MDIA 3VI5A 1BX9A 1WOUA 1GLQA 2L57A 1TK5B 2V6OA 2LUSA 3PGTA 1ILOA 2N5FA 5DAKB 4AJ7A 1VF1A 5IM9A 1HNAA 3E0UA 4GSSA 1YEPA 4KW6A 2RUEA 4MJCA 2K8VA 3GL3A 2FHEA 2HSNB 4EKZA 2PN8A 1BG5A 4NXIA 1U87A 2LS5A 4HJ2A 4AJ8A 1O8XA 1K3OA 4OFTA 2E7PA 4FIWA 1B8XA 1U3AA 2GVPA 2CQ9A 6GSVA 2FWHA 1TRWA 5J5NA 2PBJA 2WULA 4O7HA 2XPDA 3EU4A 3DMLA 1U6TA 4L0WA 2UZ8A 1DE2A 1B4QA 3UAPA 2ON7A 2HE3A 5J4UA 2H76A 4GTUA 2CX4A 1T00A 1USBA 1XWAA 2OBKA 4GF0A 3IR4A 3VWUA 4K5SA 3TDGA 4JRRA 5CRGA 1TKDB 1Z6NA 2ES7A 3FZ4A 1ACVA 4KCAA 1AIUA 12GSA 2O7KA 3HZ8A 3TKPA 3G7YA 4G0IA 1GP1A 3D4TA 2WZ9A 4QL7A 3ZVJA 1N25A 4XHMA 2HRKB 4V2NA 5ECMB 2HSHA 4TRXA 1SVLA 1ON4A 4BVYA 3KGKA 2H6ZA 3GH6A 5ECNB 2I9HA 3KM6A 4ZB9A 1TRUA 2WS2A 5JCUA 2F51A 1K0BA 2WRTA 5ECSA 3HCZA 4L5LA 1Q4JA 4TVEA 5GSSA 6GSUA 2EIQA 2GZPA 1WWJA 3PH9A 4IS0A 4MF7A 2H0GA 2DLXA 1FOHA 3UL3A 2IMEA 2BJXA 3UBKA 1GUKA 3TCOA 1G7EA 4V1Ap 4ZBDA 2HQTA 2LJKA 3A2XA 4EF0A 3C1SA 5DALA 3ERGA 5A4VA 4OCFA 4KDUA 3WT2A 1VGLA 4MMMA 2TRCP 3RHBA 2H0HA 1RK4A 1JFUA 1M2BA 4K7IA 4NAXA 1HNBA 3VWWA 4PURA 2DJKA 1FB0A 1TTZA 2YJ7A 5H5SA 3WD6A 1X5EA 2GDRA 5J4YA 5IMCA 2MYGA 2K6VA 5ECIB 2C3NA 13GSA 4ICYA 3EWLA 2J23A 4K7OA 3UBLA 4MF5A 1K0MA 2D2ZA 3UEMA 3IHQA 3L9SA 2E2GA 3LW9A 3DRNA 4POMA 4FYCA 3DEXA 1A23A 4IJIA 1A2JA 2O85A 2PPTA 1MD3A 3GKNA 5G31A 3TKSC 5HR3A 1AC1A 3J7Yk 2YOIA 1BF5A 3VURA 4ZXGA 5IMVA 4EUYA 5ID2A 2EFDA 2H70A 4LA1A 5D73A 4EE0A 1LBKA 4EXJA 4USSA 2GSTA 3FR3A 3GN3A 4CW9A 3EE2A 2L5OA 4NPBA 2LQQA 2F9SA 2JSYA 3KXOA 5FT3A 5CYYA 2FCHA 2R3XA 3IAM2 4O5RA 2OE1A 1GUHA 3FYGA 1JLVA 3LEFA 4ZB7A 4GRFA 5ELAA 3TJBA 5LCZA 3TB2A 4ECCA 3ZIVA 2O87A 3GTUB 1UN2A 1ZGNA 2LV3A 2YP6A 2AUVA 3GUSA 1AUCA 5BMUB 3FR6A 4BL7A 3VK9A 3VWXA 2QA1A 2KHPA 5HR2A 3FMWA 1I9DA 5CRWA 2H8LA 4KGIA 4PTSA 4CDOA 2GSSA 3KIJA 1ZZYA 2V32A 4I6XA 2O5VA 3DGQA 2NBSA 3FEUA 2YJHA 4A5PA 3L9UA 3Q19A 2A4HA 1SKRB 4ECJA 2H6YA 5F8BA 3WYWA 4GQFA 4KUNA 4ZBAA 4ZL9A 3OR5A 2L6DA 1TOFA 5IO2A 4YQUA 2R5GA 1GSUA 5ECRB 4MF6A 3ZFBA 3H1NA 2NTOA 1QK8A 5J3RA 3HJPA 5LD0A 3GX8A 3HZ4A 1KBNA 2YWNA 5IMAA 1PKWA 4IJ3A 3M9JA 3D6IA 5HQPA 2R0GA 4MJBA 2IMDA 3ZMLA 1BG1A 5KN1A 2I1UA 5FWGA 1O6JA 1LJRA 2R0CA 4XTSA 2KLXA 2XHFA 1M9AA 1GSQA 3F3RA 1KEBA 1A0FA 2AV4A 3ZREA 2LKUA 3VFIA 5J9BA 3FZAA 4XS4B 2VD1A 2M72A 4BWSA 2GS3A 2G2QA 3I69A 2IIYA 2TRXA 1V2AA 2E2MA 4KA0A 4BA7A 1T8EB 3L9VA 3HXSA 3CSHA 2B7KA 3C1RA 3TJJA 1ERTA 3PINA 4TXOB 5G5EA 1V40A 3HYPA 4HQZA 3VWVA 1M2DA 1XOBA 1G6YA 1YY7A 1V9WA 3PPUA 2B1LA 1B9XC 3KZQA 5B6MA 3QCPA 1GTUA 2KP1A 2HFDA 5B8BA 5INYA 1THOA 2I4AA 1K0CA 5D9WA 5A1NB 4Q5RA 1XBSA 2WB9A 1XWBA 2OE3A 4MH3A 3W8SA 2CV4A 1ERVA 3FZ9A 2HLSA 3GKKA 2LQOA 3U6VA 1TI3A 1ZYNA 3TJFA 1GSDA 3PR8A 4ZBBA 2HSYA 4WR4A 6GSXA 4WBJA 5IPHA 4ZB8A 4ML6A 4F0CA 2CAIA 1O73A 4O5QA 2X99A 1B48A 1IYIA 2JADA 3HA9A 5CP1A 2B5XA 4D73B 3GNJA 1N2AA 1LU4A 1V58A 1OE7A 3LGCA 3HVSA 5J9CA 2VCWA 2EFHA 5HFIA 3DD3A 2HNLA 4I2UA 1S3CA 1GNEA 1JZWA 2MMNA 2LSTA 1IYHA 4QL9A 4TW5A 2VD0A 2VO4A 7GSSA 3SWLA 1TK0B 2VLUA 3V1WA 4PUFC 4L8EA 3DVXA 1Z9HA 1ABAA 4IVFA 4XS1A 1DSBA 1S3DA 4MDCA 4G0KA 2PWJA 5HFKA 3IA1A 4GQCA 3FK8A 2F8AA 5FHIA 1X5DA 3RDWA 3QOUA 2LRCA 1JLWA 5ECKB 2WDUA 2LEGA 1YVLA 1BEDA 2L4CA 2DKIA 5B7CA 1M0UA 2CZ3A 3HY2A 3DIEA 1QQ2A 4MJAA 2VLVA 4ZIJA 5D96A 3DXBA 5KN2A 2HXKA 4AKGA 3F4RA 2RUFA 2VUPA 3NIVA 3F4SA 5BRTA 1GTBA 1X0RA 3QD9A 5BMUA 1DE1A 1V98A 3RBTA 2FA8A 4KX4A 1HQOA 1PN0A 5C04A 2N5AA 2AAWA 1BQ7A 5DJLA 3J7Yb 5AN1A 4IBPA 1NM3A 5JCWA 2FA4A 4GSNA 1FB6A 2FLSA 3QMXA 1T1VA 4N3ZA 14GSA 3QDNA 2OT3A 4MK3A 5F0GA 1SL0B 4BVXB 3UARA 4AKIA 1SL1B 2H72A 4OFMA 5EVOA 1F2EA 2GT5A 2NVLA 2PU9C 6GSSA 2AYTA 4TR1B 2IFQB 3GV1A 4F82A 2HT9A 1B4PA 3M9KA 5JCGA 3IV4A 5D8IA 2YZUA 1ZMAA 1XZOA 1DUGA 1SK0A 4RQRA 2VL2A 1J9BA 2HI7A 4ACSA 4MJEA 4J57E 1KNGA 2CA8A 3ZYWA 2C4JA 3E3EA 5KEJA 4MZWA 4HU7A 3IRAA 5DQSA 2V2GA 3GKXA 4AF2A 2HSMB 2OADA 2Z9SA 2CAQA 2DJ3A 1K3YA 2V6KA 3HMJG 4WR5A 5H5QA 3F6DA 4OWYA 3W6GA 2X8CA 3G7JA 4P3YB 3M8NA 4H86A 1TJDA 2RIIA 4AKXB 4NHWA 1RW1A 5ENUA 3KH9A 5AGYA 2VL9A 4Q5QA 4NMUA 2JU5A 3FY7A 5J4VA 1UC7A 5A34A 2AB6A 5A4UA 2C8UA 1PA3A 2YV7A 4V2LA 1OYJA 1YQ1A 2DBCA 2H1AA 1EP8A 3WT1A 3RHCA 3MWHA 4IHUA 1WRYA 5JWQB 4EL1A 2IMIA 3BJ5A 4N10A 4I5QA 2R6KA 4K0GA 5A1NA 1Y1UA 4F2IA 6GSWA 3VLNA 5CNWA 4KSMA 4G10A 3D22A 2K9FA 2P5RA 1WIKA 4FYUA 1YJ6A 3D4MA 2ZUPA 2IL3A 1EEMA 5IOXA 1F3AA 3CSIA 4G19A 2YCDA 5G30A 3H79A 5EL8A 19GSA 2OKAA 4OMVA 1AAZA 4FYBA 1FVKA 2DIYA 3KH7A 3O76A 4X1UA 5G1KA 3FHKA 4CHSA 3DKSA 3F63A 1XWCA 4N0ZA 3LXZA 1XWKA 3LJRA 3KMOA 4IQ1A 11GSA 3EMPA 1TU7A 1GSFA 2DJJA 2K18A 3A3TA 3CYNA 5DVBA 2ON5A 2PMTA 5GAPD 3GH9A 1QXHA 4F0BA 1THXA 1F6MC 3TKQA 2X49A 1R5PA 1OC9B 3KD0A 2E0QA 2AJQB 2GQLA 5ECOB 1XW9A 1W4VA 4Z2TA 3TOUA 4KSOA 1NHYA 2VCXA 3UVHA 2PUKC 5JWOB 2DMMA 2HZEB 2GQKA 5A5HA 2NPBA 2O8VB 1WJKA 4AKHA 2B5YA 3ERFA 3U5RE 2H0IA 4RQXA 5EY6A 3IDVA 4JR4A 4K5RA 3P2AA 1SYRA 1UVZA 2GT6A 1G6WA 1OAZA 5C00A 4L5OA 5B6NA 1SD9A 3ZVJD 4HZ4A 1O81A 3P90A 2BMXA 4RI6A 2H1GA 3GL5A 3LG6A 1F9MA 5IO0A 5DAKA 1DBYA 3MDKA 3TRPA 2VCVA 3GSSA 1ZYPA 4LMVA 5ECQB 4KAEA 2EIRA 4W66A 2F8FA 2V41A 2FWGA 4PGTA 2WFCA 1TK8B 3ZRDA 4DEJA 4MH2A 3BOAA 3ZLPA 2VL2C 2KUCA 2HSNA 4YAVA 1O85A 1PKZA 4KCEA 5AIVA 3UJ1A 3I9V2 3QR6A 4X4JA 2WJUA 4ISDA 2JZSA 1AQVA 4GWRA 1C72A 3TRXA 1ZCPA 2H1DA 5D9VA 4PX1A 2H30A 4MPFA 2GQMA 3GFKA 5DQYA 2H01A 2EFCA 3L0HA 1WMJA 2FD3A 8GSSA 20GSA 2RM5A 1XWGA 2L5LA 3K8NA 2WGRA 1FO5A 2HSMA 4F9ZA 2GTUA 3O3TA 1YF1A 4MLYA 2I3YA 4WXTA 1ZYEA 1OKDA 3TU3B 4NV5A 4POKA 2VLTA 3MSZA 5DCGA 2LJAA 3WGXA 2VL3A 4WEYA 2C0DA 2YWIA 3N9JA 1SJ6A 5D9TA 2X64A 1Y6EA 1XW6A 2H19A 2ZNMA 1XFLA 4HOJA 5DJMA 1MDKA 4KB3A 2HRKA 1XXUA 2JACA 4JE1A 1YKAA 3VI7A 3GIXA 4K9ZA 1SJZA 3IOSA 4FQUA 4HQSA 1K0OA 2PVQA 2H66A 1Y25A 1B9YC 2YPMA 5IMDA 4ZL7A 3KCMA 1CQGA 16GSA 2HRFA 3KP9A 2L4QA 2F3MA 4TOPA 4BPYA 1SKWB 3IAS2 4AI6A 2B6MA 3TJKA 3F0IA 3MIXA 3RPPA 5CRDA 1SL2B 5A4WA 5E59A 1PX6A 2XBQA 1TRSA 1GUMA 4LLRA 4MP4A 1SD8A 4GCIA 2V1MA 2DC5A 4K1FA 1AQXA 2B5EA 5CAXA 5D9XA 1TXUA 5COHA 4ECIA 4XRDA 1GTAA 2FNOA 18GSA 4YAPA 3QPMA 4KE3A 4ML1A 5ECPB 1QMVA 3ME7A 3LYPA 3VPQA 4Z7XA 1M7TA 3D21A 1EV9A 1F3BA 3H8QA 3LWAA 2GLRA 1XVQA 5IMZA 3IXRA 5L71A 1E6BA 4V2MA 5J41A 5HFGA 4AJ6A 4KDXA 3LXTA 1NHOA 4BWQA 3G7IA 5KN3A 5F05A 3C73A 3ZFLA 4G0LA 4KNDA 3QAGA 3L4NA 4YKFA 2A2RA 1GSSA 1TRVA 5CRHA 4LL4B 3M0FA 1V57A 4HEA2 2H71A 3A2VA 3NZNA 4PUAA 5KOXA 1A2MA 3CTFA 3QFBC 4MZCA 2OJLA 4L0UA 1A8LA 4NWYA 1T4YA 1X9SB 1TXXA 5DDLA 1N8JA 4OO4A 4NHZA 2IMKA 3N5OA 3HD5A 3Q74A 3DYRA 3GA4A 2RM6A 4WF4A 5D93A 1SJIA 3FZ5A 1GSYA 4DSRA 4GSTA 4G9HA 4EDYA 1F37A 2LNSA 3UIWA 2DKHA 1VRSD 1UA5A 4YQMA 3IBHA 3EU3A 1PD21 3CRUA 1FAAA 1PL1A 2YWMA 3QFAC 4OO5A 2B7JA 4YKGA 2P31A 4JZQA 2H73A 3EPTA 4X43A 3AY8A 4TR3A 4G2EA 2OBIA 1EWXA 1YF0A 1U3IA 1K3LA 2PVOC 1J08A 2X8HA 2YWOA 3APQA 5H5RA 5ECLB 1PX7A 5ID2B 3GTUA 1GTIA 3ZTLA 4PNGA 3F8UA 4HI7A 5HR1A 5AIXA 3ME8A 5A5KA 2FWEA 2GZYA 3TRQA 3CRTA 1AXDA 2MZCA 2CZ2A 1OC3A 1FG4A 2EFEA 1O8WA 3TKSA 1MD4A 4YH2A 1Z3EA 1OVNA 5LNKe 1EP7A 1GLPA 1NW2A 1TP9A 1PSQA 2EIOA 3IHGA 4DSSB 3ERWA 3CSJA 4MABA 5G2ZA 2HZFA 2HRNA 1WPIA 2G0FA 3GYKA 5F06A 4FH8A 4E68A 3I6AA 4BL7B 2KP2A 2LRTA 2A2SA 3NOFA 2I81A 1HYUA 2EC4A 2GSQA 3Q18A 3TKRA 1G0TA 1QFNA 3HJOA 4O32A 3WGDA 2GSRA 3LYKA 2L6CA 2LNTA 4G01A 4EC0A 3EVIA 2FGXA 1YDKA 3MNGA 3IPZA 2R2JA 3CWGA 4I2TA 1XVWA 4EDZA 5CO3A 4DSQA 3US3A 2REMA 4RI7A 2XC2A 1K0NA 4XIHA 2FUG2 1M2AA 3F4TA 1X5CA 4ZB6A 1R5AA 1S3AA 1TW9A 3IC4A 4QQ7A 3ZITA 2VCTA 5EPFA 4XS4A 4JR6A 2VM2A 3TKSE 4TR4A 2CVKA 3WGEA 3EINA 3W8JA 1GSEA 2DJ0A 2MBSA 5AISA 1O7UA 2VKZG 4K2DA 4HZ2A 3ZZXA 1SENA 2JZTA 2C1YA 2VOCA 3S9FA 2CVBA 1Z6MA 2OA7A 5G1LA 4TXOA 3LORA 1XPVA 4DVCA 1FVJA 2CT6A 2TIRA 3CBUA 3A5IA 2DMLA 5IOWA 5HR0A 3E9JB 3TGZA 1JZDA 2C3TA 5J47A 1HNCA 1EV4A 3LSZA 1SYXA 2DSAA 4TXVA 1X9MB 1PGTA 2K8SA 2FWFA 1PL2A 4J2FA 5J40A 2C3QA 1XIYA 3FW2A 2VIMA 3TJGA 1GULA 1SVMA 1SKSB 2JSZA 4IN0A 4NV2A 2LRNA 4MPGA 4POLA 3A5WA 2J9HA 1QGVA 4D73A 3KP8A 1CQHA 3ED3A 4EIQA 1MTCA 3Q6OA 3QAVA 1GWCA 4IGJA 3CMIA 3P8WA 1JZOA 1Q98A 1T7PB 3G9BA 1I5GA 2CVDA 4XRAA 2QA2A 1Z7PA 3BCKA 1EGOA 2A4VA 2R37A 4I97A 4EVMA 3FRCA 3KJYA 4O92A 4PQIA 4PQHA 1EOHA 2YNXA 4TN8A 1M99A 1K0AA 2HRAA 1XW5A 2KOKA 3DWVA 4O5UA 3KTLA 3TUEA 4IQAA 2R0PA 3HKRA 3KMNA 3ZL5A 1TDIA 2H1BA 5G5FA 3R3EA 2OACA 2VAFA 2H74A 4ECBA 4KH7A 4K2XA 2QGVA 4CY6A 2YANA 3IK9A 6GSYA 2H1LA 3C8EA 1XCCA 4HUAA 1ZYQB 4AGSA 1FW1A 4WETA 2YV9A 4YQVA 3F6FA 1AW9A 4TKYA 4XCSA 4PNFA 2QKEA 1K0DA 3UOMA 1URMA 1YKCA 3EURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 10GS A;  3DVW A;  4ID0 A;  3HJM A;  2LTK A;  1JHB A;  5E4W A;  22GS A;  4MA9 A;  2NDO A;  2ALB A;  4POB A;  2QC7 A;  5B8A A;  4MCU A;  2IJY A;  1YZX A;  4DSS A;  2L59 A;  1NSW A;  4BVX A;  1ZOF A;  1ERU A;  4LL1 B;  1A24 A;  1R7H A;  1WP0 A;  4IEL A;  4ILF A;  1OE8 A;  1WE0 A;  4OD7 A;  2JL4 A;  1ST9 A;  2C0G A;  4F03 A;  4TR1 A;  4LMW A;  4OFN A;  2IFQ A;  1VF3 A;  5ABR A;  4IP1 A;  2IN3 A;  2IPA A;  1BAY A;  1VF2 A;  1GL8 A;  1OKT A;  2IMF A;  2PGT A;  4JBB A;  2DIZ A;  3GST A;  1KTE A;  2YZH A;  1X9W B;  1PRX A;  2VCQ A;  4OCE A;  5CRE A;  1EEJ A;  2VCZ A;  5F07 A;  2ZCT A;  3H4K A;  4IKH A;  3UVT A;  3H93 A;  2OE0 A;  1OC8 A;  1J0F A;  3LFL A;  3O6T A;  4GLT A;  6GST A;  4WKW A;  3IC8 A;  1R4W A;  3GX0 A;  3D0Z A;  2P5Q A;  1ERW A;  2P0G A;  4E8H A;  9GSS A;  4WF5 A;  4ULX A;  5GZZ B;  2YN1 A;  4ZL8 A;  1SK1 A;  4V1A g;  2LJR A;  2PER A;  4N11 A;  3APO A;  3C71 A;  1JZR A;  3ISO A;  3C7M A;  1QUW A;  2XPE A;  1EGR A;  1BJX A;  3M3M A;  1E2Y A;  5KN0 A;  4EO3 A;  3IK7 A;  3R2Q A;  5IIZ A;  3F9U A;  2RLI A;  1TU8 A;  1XOA A;  2FY6 A;  4FO5 A;  2WCI A;  1RQM A;  4JU5 A;  3RAZ A;  2MMA A;  3F3Q A;  3ZMK A;  2QSI A;  1T3B A;  1T4Z A;  4PQ1 A;  3FR9 A;  4K6X A;  3GHA A;  1HD2 A;  3VPT A;  2BTO T;  3I43 A;  2B3S A;  4GXZ A;  4BVY B;  4K8M A;  2GZZ A;  4HS1 A;  3GKM A;  4X0X A;  2C80 A;  4KDY A;  4MZB A;  2XBI A;  4J56 E;  3ZIJ A;  2HYX A;  2DJ2 A;  5DCH A;  17GS A;  5GST A;  3BCI A;  3EMX A;  3CXG A;  3APS A;  1FOV A;  1U88 A;  1ML6 A;  1H4O A;  4E8E A;  4K0N A;  1SK2 A;  3M1G A;  2M80 A;  1G7O A;  4KF9 A;  2X8G A;  4IW9 A;  4PXO A;  1M9B A;  1EZK A;  4ZIL A;  5DAL B;  3EC3 A;  4Q5N A;  1VF4 A;  3FKF A;  3UMA A;  5IPG A;  4K7N A;  1OC9 A;  3KTB A;  3BBY A;  2H75 A;  4I8B A;  1PQN A;  1PMT A;  3GUR A;  3CTG A;  1GH2 A;  1ZL9 A;  4HU9 A;  4N0V A;  1R26 A;  3GMF A;  1GNW A;  1MDJ A;  3GRX A;  2R4V A;  3HVX A;  4Q5F A;  5IQY A;  3JCM L;  3QAW A;  4TR0 A;  2GGT A;  1W89 A;  2N5B A;  2HZE A;  4XS6 A;  4RUV A;  2MMZ A;  1MEK A;  4HDE A;  1A0R P;  4IP6 A;  2AHE A;  1GRX A;  2O89 A;  1A8Y A;  5JWR B;  1A2L A;  2C0E A;  3HHV A;  1TI1 A;  3A2W A;  2CX3 A;  2JZR A;  3TOT A;  3L78 A;  1SU9 A;  3KEB A;  5GAN D;  2B1K A;  2MMO A;  3P7X A;  1AQW A;  3BD2 A;  2H6X A;  3SBC A;  1FHE A;  5IMF A;  3RPN A;  1PN9 A;  3HVV A;  2VM1 A;  5ECH B;  3MAK A;  1Z5Y E;  5ELG A;  2IWT A;  3LQ7 A;  1BYE A;  3HDC A;  2C0F A;  3D5J A;  1H75 A;  4HJM A;  5DBQ A;  3IE3 A;  4WBR D;  1EOG A;  4JED A;  3EYT A;  2M46 A;  2DJ1 A;  1YEX A;  4N30 A;  2MBT A;  1Z7R A;  1MDI A;  3VI5 A;  1BX9 A;  1WOU A;  1GLQ A;  2L57 A;  1TK5 B;  2V6O A;  2LUS A;  3PGT A;  1ILO A;  2N5F A;  5DAK B;  4AJ7 A;  1VF1 A;  5IM9 A;  1HNA A;  3E0U A;  4GSS A;  1YEP A;  4KW6 A;  2RUE A;  4MJC A;  2K8V A;  3GL3 A;  2FHE A;  2HSN B;  4EKZ A;  2PN8 A;  1BG5 A;  4NXI A;  1U87 A;  2LS5 A;  4HJ2 A;  4AJ8 A;  1O8X A;  1K3O A;  4OFT A;  2E7P A;  4FIW A;  1B8X A;  1U3A A;  2GVP A;  2CQ9 A;  6GSV A;  2FWH A;  1TRW A;  5J5N A;  2PBJ A;  2WUL A;  4O7H A;  2XPD A;  3EU4 A;  3DML A;  1U6T A;  4L0W A;  2UZ8 A;  1DE2 A;  1B4Q A;  3UAP A;  2ON7 A;  2HE3 A;  5J4U A;  2H76 A;  4GTU A;  2CX4 A;  1T00 A;  1USB A;  1XWA A;  2OBK A;  4GF0 A;  3IR4 A;  3VWU A;  3TDG A;  4JRR A;  5CRG A;  1TKD B;  1Z6N A;  2ES7 A;  3FZ4 A;  1ACV A;  4KCA A;  1AIU A;  12GS A;  2O7K A;  3HZ8 A;  3TKP A;  3G7Y A;  4G0I A;  1GP1 A;  3D4T A;  2WZ9 A;  4QL7 A;  3ZVJ A;  4XHM A;  2HRK B;  4V2N A;  5ECM B;  2HSH A;  4TRX A;  1ON4 A;  4BVY A;  3KGK A;  2H6Z A;  3GH6 A;  5ECN B;  2I9H A;  3KM6 A;  4ZB9 A;  1TRU A;  2WS2 A;  5JCU A;  2F51 A;  1K0B A;  2WRT A;  5ECS A;  3HCZ A;  4L5L A;  1Q4J A;  4TVE A;  5GSS A;  6GSU A;  2EIQ A;  2GZP A;  1WWJ A;  3PH9 A;  4IS0 A;  4MF7 A;  2H0G A;  2DLX A;  3UL3 A;  2IME A;  2BJX A;  3UBK A;  1GUK A;  3TCO A;  1G7E A;  4V1A p;  4ZBD A;  2HQT A;  2LJK A;  3A2X A;  4EF0 A;  3C1S A;  5DAL A;  3ERG A;  5A4V A;  4OCF A;  4KDU A;  3WT2 A;  1VGL A;  4MMM A;  2TRC P;  3RHB A;  2H0H A;  1RK4 A;  1JFU A;  1M2B A;  4K7I A;  4NAX A;  1HNB A;  3VWW A;  4PUR A;  2DJK A;  1FB0 A;  1TTZ A;  2YJ7 A;  5H5S A;  3WD6 A;  1X5E A;  2GDR A;  5IMC A;  2MYG A;  2K6V A;  5ECI B;  2C3N A;  13GS A;  3EWL A;  2J23 A;  4K7O A;  3UBL A;  4MF5 A;  1K0M A;  2D2Z A;  3UEM A;  3IHQ A;  3L9S A;  2E2G A;  3DRN A;  4POM A;  4FYC A;  3DEX A;  1A23 A;  4IJI A;  1A2J A;  2O85 A;  2PPT A;  1MD3 A;  3GKN A;  5G31 A;  3TKS C;  5HR3 A;  1AC1 A;  3J7Y k;  2YOI A;  3VUR A;  4ZXG A;  5IMV A;  4EUY A;  5ID2 A;  2H70 A;  4LA1 A;  5D73 A;  4EE0 A;  1LBK A;  4EXJ A;  4USS A;  2GST A;  3FR3 A;  3GN3 A;  4CW9 A;  3EE2 A;  2L5O A;  4NPB A;  2LQQ A;  2F9S A;  2JSY A;  3KXO A;  5FT3 A;  5CYY A;  2FCH A;  2R3X A;  3IAM 2;  4O5R A;  2OE1 A;  1GUH A;  3FYG A;  1JLV A;  3LEF A;  4GRF A;  5ELA A;  3TJB A;  5LCZ A;  3TB2 A;  4ECC A;  3ZIV A;  2O87 A;  3GTU B;  1UN2 A;  1ZGN A;  2LV3 A;  2YP6 A;  2AUV A;  3GUS A;  1AUC A;  3FR6 A;  4BL7 A;  3VK9 A;  3VWX A;  2KHP A;  5HR2 A;  1I9D A;  5CRW A;  2H8L A;  4KGI A;  4PTS A;  4CDO A;  2GSS A;  3KIJ A;  1ZZY A;  2V32 A;  4I6X A;  3DGQ A;  2NBS A;  3FEU A;  2YJH A;  3L9U A;  3Q19 A;  1SKR B;  4ECJ A;  2H6Y A;  5F8B A;  3WYW A;  4GQF A;  4KUN A;  4ZBA A;  4ZL9 A;  3OR5 A;  2L6D A;  1TOF A;  5IO2 A;  4YQU A;  2R5G A;  1GSU A;  5ECR B;  4MF6 A;  3ZFB A;  3H1N A;  2NTO A;  1QK8 A;  5J3R A;  3HJP A;  5LD0 A;  3GX8 A;  3HZ4 A;  1KBN A;  2YWN A;  5IMA A;  1PKW A;  4IJ3 A;  3M9J A;  3D6I A;  5HQP A;  4MJB A;  2IMD A;  3ZML A;  5KN1 A;  2I1U A;  5FWG A;  1O6J A;  1LJR A;  4XTS A;  2KLX A;  2XHF A;  1M9A A;  1GSQ A;  3F3R A;  1KEB A;  1A0F A;  2AV4 A;  3ZRE A;  2LKU A;  3VFI A;  5J9B A;  3FZA A;  4XS4 B;  2VD1 A;  2M72 A;  4BWS A;  2GS3 A;  2G2Q A;  3I69 A;  2IIY A;  2TRX A;  1V2A A;  2E2M A;  4KA0 A;  4BA7 A;  1T8E B;  3L9V A;  3HXS A;  3CSH A;  2B7K A;  3C1R A;  3TJJ A;  1ERT A;  3PIN A;  4TXO B;  5G5E A;  1V40 A;  3HYP A;  4HQZ A;  3VWV A;  1M2D A;  1XOB A;  1G6Y A;  1YY7 A;  1V9W A;  3PPU A;  2B1L A;  1B9X C;  3KZQ A;  5B6M A;  3QCP A;  1GTU A;  2KP1 A;  2HFD A;  5B8B A;  5INY A;  1THO A;  2I4A A;  1K0C A;  5D9W A;  4Q5R A;  1XBS A;  2WB9 A;  1XWB A;  2OE3 A;  4MH3 A;  3W8S A;  2CV4 A;  1ERV A;  3FZ9 A;  2HLS A;  3GKK A;  2LQO A;  3U6V A;  1TI3 A;  3TJF A;  1GSD A;  3PR8 A;  4ZBB A;  2HSY A;  4WR4 A;  6GSX A;  4WBJ A;  5IPH A;  4ZB8 A;  4ML6 A;  4F0C A;  2CAI A;  1O73 A;  2X99 A;  1B48 A;  1IYI A;  2JAD A;  3HA9 A;  5CP1 A;  2B5X A;  4D73 B;  3GNJ A;  1N2A A;  1LU4 A;  1V58 A;  1OE7 A;  3LGC A;  3HVS A;  5J9C A;  2VCW A;  5HFI A;  3DD3 A;  2HNL A;  4I2U A;  1S3C A;  1GNE A;  1JZW A;  2MMN A;  2LST A;  1IYH A;  4QL9 A;  4TW5 A;  2VD0 A;  2VO4 A;  7GSS A;  3SWL A;  1TK0 B;  2VLU A;  3V1W A;  4PUF C;  4L8E A;  3DVX A;  1Z9H A;  1ABA A;  4IVF A;  4XS1 A;  1DSB A;  1S3D A;  4MDC A;  4G0K A;  2PWJ A;  5HFK A;  4GQC A;  3IA1 A;  3FK8 A;  2F8A A;  5FHI A;  1X5D A;  3RDW A;  3QOU A;  2LRC A;  1JLW A;  5ECK B;  2WDU A;  2LEG A;  1BED A;  2L4C A;  5B7C A;  1M0U A;  2CZ3 A;  3HY2 A;  3DIE A;  1QQ2 A;  4MJA A;  2VLV A;  4ZIJ A;  5D96 A;  3DXB A;  5KN2 A;  2HXK A;  3F4R A;  2RUF A;  2VUP A;  3NIV A;  3F4S A;  1GTB A;  1X0R A;  3QD9 A;  5BMU A;  1DE1 A;  1V98 A;  3RBT A;  2FA8 A;  4KX4 A;  1HQO A;  5C04 A;  2N5A A;  2AAW A;  1BQ7 A;  5DJL A;  3J7Y b;  5AN1 A;  4IBP A;  1NM3 A;  5JCW A;  2FA4 A;  4GSN A;  1FB6 A;  2FLS A;  3QMX A;  1T1V A;  14GS A;  3QDN A;  4MK3 A;  5F0G A;  1SL0 B;  4BVX B;  3UAR A;  1SL1 B;  2H72 A;  4OFM A;  5EVO A;  1F2E A;  2GT5 A;  2NVL A;  2PU9 C;  6GSS A;  2AYT A;  4TR1 B;  2IFQ B;  3GV1 A;  4F82 A;  2HT9 A;  1B4P A;  3M9K A;  5JCG A;  3IV4 A;  5D8I A;  2YZU A;  1ZMA A;  1XZO A;  1DUG A;  1SK0 A;  4RQR A;  2VL2 A;  1J9B A;  2HI7 A;  4ACS A;  4MJE A;  4J57 E;  1KNG A;  2CA8 A;  3ZYW A;  2C4J A;  3E3E A;  5KEJ A;  4MZW A;  4HU7 A;  3IRA A;  5DQS A;  2V2G A;  3GKX A;  4AF2 A;  2HSM B;  2OAD A;  2Z9S A;  2CAQ A;  2DJ3 A;  1K3Y A;  2V6K A;  4WR5 A;  5H5Q A;  3F6D A;  4OWY A;  3W6G A;  2X8C A;  3G7J A;  4P3Y B;  3M8N A;  4H86 A;  1TJD A;  2RII A;  4NHW A;  1RW1 A;  5ENU A;  3KH9 A;  5AGY A;  2VL9 A;  4Q5Q A;  4NMU A;  2JU5 A;  3FY7 A;  1UC7 A;  2AB6 A;  5A4U A;  2C8U A;  1PA3 A;  2YV7 A;  4V2L A;  1OYJ A;  1YQ1 A;  2DBC A;  2H1A A;  1EP8 A;  3WT1 A;  3RHC A;  3MWH A;  4IHU A;  1WRY A;  5JWQ B;  4EL1 A;  2IMI A;  3BJ5 A;  4N10 A;  4I5Q A;  2R6K A;  4K0G A;  4F2I A;  6GSW A;  3VLN A;  5CNW A;  4KSM A;  4G10 A;  3D22 A;  2K9F A;  2P5R A;  1WIK A;  4FYU A;  1YJ6 A;  3D4M A;  2ZUP A;  2IL3 A;  1EEM A;  5IOX A;  1F3A A;  3CSI A;  4G19 A;  2YCD A;  5G30 A;  3H79 A;  5EL8 A;  19GS A;  2OKA A;  4OMV A;  1AAZ A;  4FYB A;  1FVK A;  2DIY A;  3KH7 A;  3O76 A;  4X1U A;  5G1K A;  3FHK A;  4CHS A;  3DKS A;  3F63 A;  1XWC A;  4N0Z A;  3LXZ A;  1XWK A;  3LJR A;  3KMO A;  4IQ1 A;  11GS A;  3EMP A;  1TU7 A;  1GSF A;  2DJJ A;  2K18 A;  3A3T A;  3CYN A;  5DVB A;  2ON5 A;  2PMT A;  5GAP D;  3GH9 A;  1QXH A;  4F0B A;  1THX A;  1F6M C;  3TKQ A;  1R5P A;  1OC9 B;  3KD0 A;  2E0Q A;  2AJQ B;  2GQL A;  5ECO B;  1XW9 A;  1W4V A;  3TOU A;  4KSO A;  1NHY A;  2VCX A;  3UVH A;  2PUK C;  5JWO B;  2DMM A;  2HZE B;  2GQK A;  2NPB A;  2O8V B;  1WJK A;  2B5Y A;  3ERF A;  3U5R E;  2H0I A;  4RQX A;  5EY6 A;  3IDV A;  4JR4 A;  3P2A A;  1SYR A;  1UVZ A;  2GT6 A;  1G6W A;  1OAZ A;  5C00 A;  4L5O A;  5B6N A;  1SD9 A;  3ZVJ D;  4HZ4 A;  1O81 A;  3P90 A;  2BMX A;  4RI6 A;  2H1G A;  3GL5 A;  3LG6 A;  1F9M A;  5IO0 A;  5DAK A;  1DBY A;  3MDK A;  3TRP A;  2VCV A;  3GSS A;  4LMV A;  5ECQ B;  4KAE A;  2EIR A;  2F8F A;  2V41 A;  2FWG A;  4PGT A;  2WFC A;  1TK8 B;  3ZRD A;  4DEJ A;  4MH2 A;  3BOA A;  3ZLP A;  2VL2 C;  2KUC A;  4YAV A;  1O85 A;  1PKZ A;  4KCE A;  5AIV A;  3UJ1 A;  3I9V 2;  3QR6 A;  2WJU A;  4ISD A;  2JZS A;  1AQV A;  4GWR A;  1C72 A;  3TRX A;  1ZCP A;  2H1D A;  5D9V A;  4PX1 A;  2H30 A;  4MPF A;  2GQM A;  3GFK A;  5DQY A;  2H01 A;  3L0H A;  1WMJ A;  2FD3 A;  8GSS A;  20GS A;  2RM5 A;  1XWG A;  2L5L A;  3K8N A;  2WGR A;  1FO5 A;  2HSM A;  4F9Z A;  2GTU A;  3O3T A;  1YF1 A;  4MLY A;  2I3Y A;  4WXT A;  1ZYE A;  1OKD A;  4NV5 A;  4POK A;  2VLT A;  3MSZ A;  5DCG A;  2LJA A;  3WGX A;  2VL3 A;  4WEY A;  2C0D A;  2YWI A;  3N9J A;  1SJ6 A;  5D9T A;  2X64 A;  1Y6E A;  1XW6 A;  2H19 A;  2ZNM A;  1XFL A;  4HOJ A;  5DJM A;  1MDK A;  4KB3 A;  2HRK A;  1XXU A;  2JAC A;  4JE1 A;  1YKA A;  3VI7 A;  3GIX A;  4K9Z A;  1SJZ A;  3IOS A;  4FQU A;  4HQS A;  1K0O A;  2PVQ A;  2H66 A;  1Y25 A;  1B9Y C;  2YPM A;  5IMD A;  4ZL7 A;  3KCM A;  1CQG A;  16GS A;  2HRF A;  3KP9 A;  2L4Q A;  2F3M A;  4TOP A;  4BPY A;  1SKW B;  3IAS 2;  2B6M A;  3TJK A;  3F0I A;  3RPP A;  5CRD A;  1SL2 B;  5A4W A;  5E59 A;  1PX6 A;  2XBQ A;  1TRS A;  1GUM A;  4LLR A;  4MP4 A;  1SD8 A;  4GCI A;  2V1M A;  2DC5 A;  4K1F A;  1AQX A;  2B5E A;  5CAX A;  5D9X A;  5COH A;  4ECI A;  4XRD A;  1GTA A;  2FNO A;  18GS A;  4YAP A;  3QPM A;  4KE3 A;  4ML1 A;  5ECP B;  1QMV A;  3ME7 A;  3LYP A;  3VPQ A;  4Z7X A;  1M7T A;  3D21 A;  1EV9 A;  1F3B A;  3H8Q A;  3LWA A;  2GLR A;  1XVQ A;  5IMZ A;  3IXR A;  5L71 A;  1E6B A;  4V2M A;  5J41 A;  5HFG A;  4AJ6 A;  4KDX A;  3LXT A;  1NHO A;  4BWQ A;  3G7I A;  5KN3 A;  5F05 A;  3C73 A;  3ZFL A;  4G0L A;  4KND A;  3QAG A;  3L4N A;  2A2R A;  1GSS A;  1TRV A;  5CRH A;  4LL4 B;  3M0F A;  1V57 A;  4HEA 2;  2H71 A;  3A2V A;  3NZN A;  4PUA A;  1A2M A;  3CTF A;  3QFB C;  4MZC A;  2OJL A;  4L0U A;  1A8L A;  4NWY A;  1T4Y A;  1X9S B;  1TXX A;  5DDL A;  1N8J A;  4OO4 A;  4NHZ A;  2IMK A;  3N5O A;  3HD5 A;  3Q74 A;  3DYR A;  3GA4 A;  2RM6 A;  4WF4 A;  5D93 A;  1SJI A;  3FZ5 A;  1GSY A;  4DSR A;  4GST A;  4G9H A;  4EDY A;  1F37 A;  2LNS A;  3UIW A;  1VRS D;  1UA5 A;  4YQM A;  3IBH A;  3EU3 A;  1PD2 1;  3CRU A;  1FAA A;  1PL1 A;  2YWM A;  3QFA C;  4OO5 A;  2B7J A;  2P31 A;  4JZQ A;  2H73 A;  4X43 A;  3AY8 A;  4TR3 A;  4G2E A;  2OBI A;  1EWX A;  1YF0 A;  1U3I A;  1K3L A;  2PVO C;  1J08 A;  2X8H A;  2YWO A;  3APQ A;  5H5R A;  5ECL B;  1PX7 A;  5ID2 B;  3GTU A;  1GTI A;  3ZTL A;  4PNG A;  3F8U A;  4HI7 A;  5HR1 A;  5AIX A;  3ME8 A;  5A5K A;  2FWE A;  2GZY A;  3TRQ A;  3CRT A;  1AXD A;  2MZC A;  2CZ2 A;  1OC3 A;  1FG4 A;  1O8W A;  3TKS A;  1MD4 A;  4YH2 A;  1Z3E A;  1OVN A;  5LNK e;  1EP7 A;  1GLP A;  1NW2 A;  1TP9 A;  1PSQ A;  2EIO A;  4DSS B;  3ERW A;  3CSJ A;  4MAB A;  5G2Z A;  2HZF A;  2HRN A;  1WPI A;  2G0F A;  3GYK A;  5F06 A;  4FH8 A;  3I6A A;  4BL7 B;  2KP2 A;  2LRT A;  2A2S A;  3NOF A;  2I81 A;  1HYU A;  2EC4 A;  2GSQ A;  3Q18 A;  3TKR A;  1G0T A;  1QFN A;  3HJO A;  4O32 A;  3WGD A;  2GSR A;  3LYK A;  2L6C A;  2LNT A;  4EC0 A;  3EVI A;  2FGX A;  1YDK A;  3MNG A;  3IPZ A;  2R2J A;  4I2T A;  1XVW A;  4EDZ A;  5CO3 A;  4DSQ A;  3US3 A;  2REM A;  4RI7 A;  2XC2 A;  1K0N A;  4XIH A;  2FUG 2;  1M2A A;  3F4T A;  1X5C A;  4ZB6 A;  1R5A A;  1S3A A;  1TW9 A;  3IC4 A;  4QQ7 A;  3ZIT A;  2VCT A;  5EPF A;  4XS4 A;  4JR6 A;  2VM2 A;  3TKS E;  4TR4 A;  2CVK A;  3WGE A;  3EIN A;  3W8J A;  1GSE A;  2DJ0 A;  2MBS A;  5AIS A;  1O7U A;  4K2D A;  4HZ2 A;  3ZZX A;  1SEN A;  2JZT A;  2C1Y A;  2VOC A;  3S9F A;  2CVB A;  1Z6M A;  2OA7 A;  5G1L A;  4TXO A;  3LOR A;  1XPV A;  4DVC A;  1FVJ A;  2CT6 A;  2TIR A;  3CBU A;  2DML A;  5IOW A;  5HR0 A;  3E9J B;  3TGZ A;  1JZD A;  2C3T A;  1HNC A;  1EV4 A;  3LSZ A;  1SYX A;  2DSA A;  4TXV A;  1X9M B;  1PGT A;  2K8S A;  2FWF A;  1PL2 A;  4J2F A;  2C3Q A;  1XIY A;  3FW2 A;  2VIM A;  3TJG A;  1GUL A;  1SKS B;  2JSZ A;  4IN0 A;  4NV2 A;  2LRN A;  4MPG A;  4POL A;  3A5W A;  2J9H A;  1QGV A;  4D73 A;  3KP8 A;  1CQH A;  3ED3 A;  1MTC A;  3Q6O A;  3QAV A;  1GWC A;  4IGJ A;  3CMI A;  3P8W A;  1JZO A;  1Q98 A;  1T7P B;  3G9B A;  1I5G A;  2CVD A;  4XRA A;  1Z7P A;  3BCK A;  1EGO A;  2A4V A;  2R37 A;  4I97 A;  4EVM A;  3FRC A;  3KJY A;  4O92 A;  4PQI A;  4PQH A;  1EOH A;  2YNX A;  4TN8 A;  1M99 A;  1K0A A;  2HRA A;  1XW5 A;  2KOK A;  3DWV A;  3KTL A;  3TUE A;  4IQA A;  3HKR A;  3KMN A;  3ZL5 A;  1TDI A;  2H1B A;  5G5F A;  3R3E A;  2OAC A;  2VAF A;  2H74 A;  4ECB A;  4KH7 A;  2QGV A;  2YAN A;  3IK9 A;  6GSY A;  3C8E A;  1XCC A;  4HUA A;  1ZYQ B;  4AGS A;  1FW1 A;  4WET A;  2YV9 A;  4YQV A;  3F6F A;  1AW9 A;  4TKY A;  4XCS A;  4PNF A;  2QKE A;  1K0D A;  3UOM A;  1URM A;  1YKC A;  3EUR A; 
#chains in the Genus database with same CATH topology
 10GS A;  3DVW A;  4ID0 A;  3HJM A;  2LTK A;  1JHB A;  2X4A A;  5E4W A;  22GS A;  4MA9 A;  2NDO A;  2ALB A;  4POB A;  2QC7 A;  5B8A A;  4MCU A;  2IJY A;  4FXY P;  1YZX A;  4DSS A;  2L59 A;  1NSW A;  4BVX A;  1ZOF A;  2WVX B;  5KOW A;  3RFR C;  1ERU A;  4LL1 B;  1A24 A;  1R7H A;  1WP0 A;  4IEL A;  4ILF A;  1OE8 A;  1WE0 A;  4OD7 A;  2JL4 A;  1ST9 A;  2C0G A;  4F03 A;  4TR1 A;  4LMW A;  4OFN A;  2IFQ A;  1VF3 A;  5ABR A;  4IP1 A;  2IN3 A;  2IPA A;  1BAY A;  1VF2 A;  1GL8 A;  1OKT A;  4Z2R A;  2IMF A;  2PGT A;  4JBB A;  4EIP A;  2DIZ A;  3GST A;  1KTE A;  2YZH A;  1X9W B;  1PRX A;  2VCQ A;  4OCE A;  5CRE A;  1EEJ A;  2VCZ A;  3MYD A;  5F07 A;  2ZCT A;  3H4K A;  4IKH A;  3UVT A;  3H93 A;  2OE0 A;  1OC8 A;  1J0F A;  3LFL A;  3O6T A;  4GLT A;  6GST A;  4WKW A;  4GDF A;  3IC8 A;  1R4W A;  2O36 A;  3GX0 A;  3D0Z A;  2P5Q A;  1ERW A;  4MNN A;  2P0G A;  4E8H A;  9GSS A;  4WF5 A;  4ULX A;  5GZZ B;  2YN1 A;  4Z2U A;  4ZL8 A;  1SK1 A;  4V1A g;  2LJR A;  2PER A;  4N11 A;  3APO A;  3C71 A;  1JZR A;  3ISO A;  3C7M A;  1QUW A;  2XPE A;  1EGR A;  1BJX A;  3M3M A;  1E2Y A;  2UV8 G;  5KN0 A;  4EO3 A;  3IK7 A;  3R2Q A;  5IIZ A;  3F9U A;  2RLI A;  1TU8 A;  1XOA A;  2FY6 A;  4FO5 A;  2WCI A;  4QMK A;  1RQM A;  4JU5 A;  3RAZ A;  2MMA A;  2WW1 A;  3F3Q A;  3ZMK A;  2QSI A;  1T3B A;  1T4Z A;  4PQ1 A;  3FR9 A;  4K6X A;  1SVO A;  3GHA A;  1HD2 A;  3VPT A;  4CY8 A;  5A34 B;  2BTO T;  3I43 A;  2B3S A;  4GXZ A;  4BVY B;  4K8M A;  2GZZ A;  4HS1 A;  3GKM A;  4X0X A;  2C80 A;  4KDY A;  4MZB A;  2XBI A;  4J56 E;  3ZIJ A;  2HYX A;  2DJ2 A;  5DCH A;  17GS A;  5GST A;  3BCI A;  3EMX A;  3CXG A;  3APS A;  1FOV A;  3HVN A;  1U88 A;  1ML6 A;  1H4O A;  4E8E A;  4K0N A;  1SK2 A;  3M1G A;  2M80 A;  1G7O A;  4KF9 A;  2X8G A;  4IW9 A;  4PXO A;  1M9B A;  1EZK A;  4ZIL A;  5DAL B;  3EC3 A;  4Q5N A;  1VF4 A;  3FKF A;  3UMA A;  5IPG A;  4K7N A;  1OC9 A;  3KTB A;  3BBY A;  2H75 A;  4I8B A;  1PQN A;  1PMT A;  3GUR A;  3CTG A;  1GH2 A;  1ZL9 A;  4HU9 A;  4N0V A;  1R26 A;  3GMF A;  1GNW A;  1MDJ A;  3GRX A;  2R4V A;  3HVX A;  4Q5F A;  5IQY A;  3JCM L;  3QAW A;  4TR0 A;  2GGT A;  1W89 A;  2N5B A;  2HZE A;  4XS6 A;  4RUV A;  2MMZ A;  1MEK A;  4HDE A;  1A0R P;  4IP6 A;  2AHE A;  1GRX A;  2O89 A;  1A8Y A;  5JWR B;  1A2L A;  2C0E A;  3HHV A;  1TI1 A;  3A2W A;  2CX3 A;  2JZR A;  3TOT A;  3L78 A;  1SU9 A;  3KEB A;  5GAN D;  2B1K A;  2MMO A;  3P7X A;  1AQW A;  3BD2 A;  2H6X A;  3SBC A;  1FHE A;  5IMF A;  3RPN A;  1PN9 A;  3HVV A;  2VM1 A;  5ECH B;  3MAK A;  1Z5Y E;  5ELG A;  1M3I A;  2IWT A;  3LQ7 A;  1BYE A;  3HDC A;  2C0F A;  3D5J A;  1H75 A;  4HJM A;  5DBQ A;  5A5H B;  3IE3 A;  2A2P A;  4WBR D;  1EOG A;  4JED A;  3EYT A;  2M46 A;  2DJ1 A;  1YEX A;  4N30 A;  2MBT A;  1Z7R A;  1MDI A;  3VI5 A;  1BX9 A;  1WOU A;  1GLQ A;  2L57 A;  1TK5 B;  2V6O A;  2LUS A;  3PGT A;  1ILO A;  2N5F A;  5DAK B;  4AJ7 A;  1VF1 A;  5IM9 A;  1HNA A;  3E0U A;  4GSS A;  1YEP A;  4KW6 A;  2RUE A;  4MJC A;  2K8V A;  3GL3 A;  2FHE A;  2HSN B;  4EKZ A;  2PN8 A;  1BG5 A;  4NXI A;  1U87 A;  2LS5 A;  4HJ2 A;  4AJ8 A;  1O8X A;  1K3O A;  4OFT A;  2E7P A;  4FIW A;  1B8X A;  1U3A A;  2GVP A;  2CQ9 A;  6GSV A;  2FWH A;  1TRW A;  5J5N A;  2PBJ A;  2WUL A;  4O7H A;  2XPD A;  3EU4 A;  3DML A;  1U6T A;  4L0W A;  2UZ8 A;  1DE2 A;  1B4Q A;  3UAP A;  2ON7 A;  2HE3 A;  5J4U A;  2H76 A;  4GTU A;  2CX4 A;  1T00 A;  1USB A;  1XWA A;  2OBK A;  4GF0 A;  3IR4 A;  3VWU A;  4K5S A;  3TDG A;  4JRR A;  5CRG A;  1TKD B;  1Z6N A;  2ES7 A;  3FZ4 A;  1ACV A;  4KCA A;  1AIU A;  12GS A;  2O7K A;  3HZ8 A;  3TKP A;  3G7Y A;  4G0I A;  1GP1 A;  3D4T A;  2WZ9 A;  4QL7 A;  3ZVJ A;  1N25 A;  4XHM A;  2HRK B;  4V2N A;  5ECM B;  2HSH A;  4TRX A;  1SVL A;  1ON4 A;  4BVY A;  3KGK A;  2H6Z A;  3GH6 A;  5ECN B;  2I9H A;  3KM6 A;  4ZB9 A;  1TRU A;  2WS2 A;  5JCU A;  2F51 A;  1K0B A;  2WRT A;  5ECS A;  3HCZ A;  4L5L A;  1Q4J A;  4TVE A;  5GSS A;  6GSU A;  2EIQ A;  2GZP A;  1WWJ A;  3PH9 A;  2WW0 A;  4IS0 A;  4MF7 A;  2H0G A;  2DLX A;  1FOH A;  3UL3 A;  2IME A;  2BJX A;  3UBK A;  1GUK A;  3TCO A;  1G7E A;  4V1A p;  4ZBD A;  2HQT A;  2LJK A;  3A2X A;  4EF0 A;  3C1S A;  5DAL A;  3ERG A;  5A4V A;  4OCF A;  4KDU A;  3WT2 A;  1VGL A;  4MMM A;  2TRC P;  3RHB A;  2H0H A;  1RK4 A;  1JFU A;  1M2B A;  4K7I A;  4NAX A;  1HNB A;  3VWW A;  4PUR A;  2DJK A;  1FB0 A;  1TTZ A;  2YJ7 A;  5H5S A;  3WD6 A;  1X5E A;  1S4B P;  2GDR A;  5J4Y A;  5IMC A;  2MYG A;  2K6V A;  5ECI B;  2C3N A;  13GS A;  4ICY A;  3EWL A;  2J23 A;  4K7O A;  3UBL A;  4MF5 A;  1K0M A;  2D2Z A;  3UEM A;  3IHQ A;  3L9S A;  2E2G A;  3LW9 A;  3DRN A;  4POM A;  4FYC A;  3DEX A;  1A23 A;  4IJI A;  1A2J A;  2O85 A;  2PPT A;  1MD3 A;  3GKN A;  5G31 A;  3TKS C;  5HR3 A;  1AC1 A;  3J7Y k;  2YOI A;  1BF5 A;  3VUR A;  4ZXG A;  5IMV A;  4EUY A;  5ID2 A;  2EFD A;  2H70 A;  4LA1 A;  5D73 A;  4EE0 A;  1LBK A;  4EXJ A;  4USS A;  2GST A;  3FR3 A;  3GN3 A;  4CW9 A;  3EE2 A;  2L5O A;  4NPB A;  2LQQ A;  2F9S A;  2JSY A;  3KXO A;  5FT3 A;  5CYY A;  2FCH A;  2R3X A;  3IAM 2;  4O5R A;  2OE1 A;  1GUH A;  3FYG A;  1JLV A;  3LEF A;  4ZB7 A;  4GRF A;  5ELA A;  3TJB A;  5LCZ A;  3TB2 A;  4ECC A;  3ZIV A;  2O87 A;  3GTU B;  1UN2 A;  1ZGN A;  2LV3 A;  2YP6 A;  2AUV A;  3GUS A;  1AUC A;  5BMU B;  3FR6 A;  4BL7 A;  3VK9 A;  3VWX A;  2QA1 A;  2KHP A;  5HR2 A;  3FMW A;  1I9D A;  5CRW A;  2H8L A;  4KGI A;  3RGB C;  4PTS A;  4CDO A;  2GSS A;  3KIJ A;  1ZZY A;  2V32 A;  4I6X A;  2O5V A;  3DGQ A;  2NBS A;  3FEU A;  2YJH A;  4A5P A;  3L9U A;  3Q19 A;  2A4H A;  1SKR B;  4ECJ A;  2H6Y A;  5F8B A;  3WYW A;  4GQF A;  4KUN A;  4ZBA A;  4ZL9 A;  3OR5 A;  2L6D A;  1TOF A;  2WW3 A;  5IO2 A;  4YQU A;  2R5G A;  1GSU A;  5ECR B;  4MF6 A;  3ZFB A;  3H1N A;  2NTO A;  1QK8 A;  5J3R A;  3HJP A;  5LD0 A;  3GX8 A;  3HZ4 A;  1KBN A;  2YWN A;  5IMA A;  1PKW A;  4IJ3 A;  3M9J A;  3D6I A;  5HQP A;  2R0G A;  4MJB A;  2IMD A;  3ZML A;  1BG1 A;  5KN1 A;  2I1U A;  5FWG A;  1O6J A;  1LJR A;  2R0C A;  4XTS A;  2KLX A;  2XHF A;  2WVY A;  1M9A A;  1GSQ A;  3F3R A;  1KEB A;  1A0F A;  2AV4 A;  3ZRE A;  2LKU A;  3VFI A;  5J9B A;  3FZA A;  4XS4 B;  2VD1 A;  2M72 A;  4BWS A;  2GS3 A;  2G2Q A;  3I69 A;  2IIY A;  2TRX A;  1V2A A;  2E2M A;  4KA0 A;  4BA7 A;  1T8E B;  3L9V A;  3HXS A;  3CSH A;  2B7K A;  3C1R A;  3TJJ A;  1ERT A;  3PIN A;  4TXO B;  5G5E A;  1V40 A;  3HYP A;  4HQZ A;  3VWV A;  1M2D A;  1XOB A;  1G6Y A;  1YY7 A;  1S3R A;  3PPU A;  1V9W A;  2B1L A;  1B9X C;  3KZQ A;  5B6M A;  3QCP A;  1GTU A;  2KP1 A;  2HFD A;  5B8B A;  5INY A;  1THO A;  2I4A A;  1K0C A;  5D9W A;  5A1N B;  4Q5R A;  1XBS A;  2WB9 A;  1XWB A;  2OE3 A;  4MH3 A;  3W8S A;  2CV4 A;  1ERV A;  3FZ9 A;  2HLS A;  3GKK A;  2LQO A;  3U6V A;  1TI3 A;  1ZYN A;  3TJF A;  1GSD A;  3PR8 A;  4ZBB A;  2HSY A;  4WR4 A;  6GSX A;  4WBJ A;  5IPH A;  4ZB8 A;  4ML6 A;  4F0C A;  2CAI A;  1O73 A;  4O5Q A;  2X99 A;  1B48 A;  1IYI A;  2JAD A;  3HA9 A;  5CP1 A;  2B5X A;  4D73 B;  3GNJ A;  1N2A A;  1LU4 A;  1V58 A;  1OE7 A;  3LGC A;  3HVS A;  5J9C A;  2VCW A;  2EFH A;  5HFI A;  3DD3 A;  2HNL A;  4I2U A;  1S3C A;  1GNE A;  1JZW A;  2MMN A;  2LST A;  1IYH A;  4QL9 A;  4TW5 A;  2VD0 A;  2VO4 A;  7GSS A;  3SWL A;  1TK0 B;  2VLU A;  3V1W A;  4PUF C;  4L8E A;  3DVX A;  1Z9H A;  1ABA A;  4IVF A;  4XS1 A;  1DSB A;  1S3D A;  4MDC A;  4G0K A;  2PWJ A;  5HFK A;  3IA1 A;  4GQC A;  3FK8 A;  2F8A A;  5FHI A;  1X5D A;  3RDW A;  3QOU A;  2LRC A;  1JLW A;  5ECK B;  2WDU A;  2LEG A;  1YVL A;  1BED A;  2L4C A;  2DKI A;  5B7C A;  1M0U A;  2CZ3 A;  3HY2 A;  3DIE A;  1QQ2 A;  4MJA A;  2VLV A;  4ZIJ A;  5D96 A;  3DXB A;  5KN2 A;  2HXK A;  2WVX A;  4AKG A;  3F4R A;  2RUF A;  2VUP A;  3NIV A;  3F4S A;  5BRT A;  1GTB A;  1X0R A;  3QD9 A;  5BMU A;  1DE1 A;  1V98 A;  3RBT A;  2FA8 A;  4KX4 A;  1HQO A;  1PN0 A;  5C04 A;  2N5A A;  2AAW A;  1BQ7 A;  5DJL A;  3J7Y b;  5AN1 A;  4IBP A;  1NM3 A;  5JCW A;  2FA4 A;  4GSN A;  1FB6 A;  2FLS A;  3QMX A;  1T1V A;  4N3Z A;  14GS A;  3QDN A;  2OT3 A;  4MK3 A;  5F0G A;  1SL0 B;  4BVX B;  3UAR A;  4AKI A;  1SL1 B;  2H72 A;  4OFM A;  5EVO A;  1F2E A;  2GT5 A;  2NVL A;  2PU9 C;  6GSS A;  2AYT A;  4TR1 B;  2IFQ B;  3GV1 A;  4F82 A;  2HT9 A;  1B4P A;  3M9K A;  5JCG A;  3IV4 A;  5D8I A;  2YZU A;  1ZMA A;  1XZO A;  1DUG A;  1SK0 A;  4RQR A;  2VL2 A;  1J9B A;  2HI7 A;  4ACS A;  4MJE A;  4J57 E;  1KNG A;  2CA8 A;  3ZYW A;  2C4J A;  3E3E A;  5KEJ A;  4MZW A;  4HU7 A;  3IRA A;  5DQS A;  2V2G A;  3GKX A;  4AF2 A;  2HSM B;  1PFO A;  2OAD A;  2Z9S A;  2CAQ A;  2DJ3 A;  1K3Y A;  2V6K A;  3HMJ G;  4WR5 A;  5H5Q A;  3F6D A;  4OWY A;  3W6G A;  2X8C A;  3G7J A;  4P3Y B;  3M8N A;  4H86 A;  1TJD A;  2RII A;  4AKX B;  4PI2 C;  4NHW A;  1RW1 A;  5ENU A;  3KH9 A;  5AGY A;  2VL9 A;  4Q5Q A;  4NMU A;  2JU5 A;  3FY7 A;  5J4V A;  1UC7 A;  5A34 A;  2AB6 A;  5A4U A;  2C8U A;  1PA3 A;  2YV7 A;  4V2L A;  1OYJ A;  1YQ1 A;  2DBC A;  2H1A A;  1EP8 A;  3WT1 A;  3RHC A;  3MWH A;  4IHU A;  1WRY A;  5JWQ B;  4EL1 A;  2IMI A;  3BJ5 A;  4N10 A;  4I5Q A;  2R6K A;  4K0G A;  5A1N A;  1Y1U A;  4F2I A;  6GSW A;  3VLN A;  5CNW A;  4KSM A;  4G10 A;  3D22 A;  2K9F A;  2P5R A;  1WIK A;  4FYU A;  1YJ6 A;  3D4M A;  2ZUP A;  2IL3 A;  1EEM A;  5IOX A;  1F3A A;  3CSI A;  4G19 A;  2YCD A;  5G30 A;  3H79 A;  5EL8 A;  19GS A;  2OKA A;  4OMV A;  1AAZ A;  4FYB A;  1FVK A;  2DIY A;  3KH7 A;  3O76 A;  4X1U A;  5G1K A;  3FHK A;  4CHS A;  3DKS A;  3F63 A;  1XWC A;  4N0Z A;  3LXZ A;  1XWK A;  3LJR A;  3KMO A;  4IQ1 A;  11GS A;  3EMP A;  1TU7 A;  1GSF A;  2DJJ A;  2K18 A;  3A3T A;  3CYN A;  5DVB A;  2ON5 A;  2PMT A;  5GAP D;  3GH9 A;  1QXH A;  4F0B A;  1I1I P;  1THX A;  1F6M C;  3TKQ A;  2X49 A;  1R5P A;  1OC9 B;  3KD0 A;  2E0Q A;  2AJQ B;  2GQL A;  5ECO B;  1XW9 A;  1W4V A;  3CQF A;  2WVZ A;  4Z2T A;  3TOU A;  4KSO A;  1NHY A;  2VCX A;  3UVH A;  2PUK C;  5JWO B;  2DMM A;  2HZE B;  2GQK A;  5A5H A;  2NPB A;  2O8V B;  1WJK A;  4AKH A;  2B5Y A;  3ERF A;  3U5R E;  1YEW C;  2H0I A;  4RQX A;  5EY6 A;  3IDV A;  4JR4 A;  4K5R A;  3P2A A;  1SYR A;  1UVZ A;  2GT6 A;  1G6W A;  1OAZ A;  5C00 A;  4L5O A;  5B6N A;  1SD9 A;  3ZVJ D;  4HZ4 A;  1O81 A;  3P90 A;  2BMX A;  4RI6 A;  2H1G A;  3GL5 A;  3LG6 A;  1F9M A;  5IO0 A;  5DAK A;  1DBY A;  3MDK A;  3TRP A;  2VCV A;  3GSS A;  1ZYP A;  4LMV A;  5ECQ B;  4KAE A;  2EIR A;  4W66 A;  2F8F A;  2V41 A;  2FWG A;  4PGT A;  2WFC A;  1TK8 B;  3ZRD A;  4DEJ A;  4MH2 A;  3BOA A;  3ZLP A;  2VL2 C;  2KUC A;  2HSN A;  4YAV A;  1O85 A;  1PKZ A;  4KCE A;  5AIV A;  3UJ1 A;  3I9V 2;  3QR6 A;  4X4J A;  2WJU A;  4ISD A;  2JZS A;  1AQV A;  4GWR A;  1C72 A;  3TRX A;  1ZCP A;  2H1D A;  5D9V A;  4PX1 A;  2H30 A;  4MPF A;  2GQM A;  3GFK A;  2WW2 A;  5DQY A;  2H01 A;  2EFC A;  3L0H A;  1WMJ A;  2FD3 A;  8GSS A;  20GS A;  2RM5 A;  1XWG A;  2L5L A;  3K8N A;  2WGR A;  1FO5 A;  2HSM A;  4F9Z A;  2GTU A;  3O3T A;  1YF1 A;  4MLY A;  2I3Y A;  4WXT A;  1ZYE A;  1OKD A;  3TU3 B;  4NV5 A;  4POK A;  2VLT A;  3MSZ A;  5DCG A;  2LJA A;  3WGX A;  2VL3 A;  4WEY A;  2C0D A;  2YWI A;  3N9J A;  1SJ6 A;  5D9T A;  2X64 A;  1Y6E A;  1XW6 A;  2H19 A;  2ZNM A;  1XFL A;  4HOJ A;  5DJM A;  1MDK A;  4KB3 A;  2HRK A;  1XXU A;  2JAC A;  4JE1 A;  1YKA A;  3VI7 A;  3GIX A;  4K9Z A;  1SJZ A;  3IOS A;  4FQU A;  4HQS A;  1K0O A;  2PVQ A;  2H66 A;  1Y25 A;  1B9Y C;  2YPM A;  5IMD A;  4ZL7 A;  3KCM A;  4HSC X;  1CQG A;  16GS A;  2HRF A;  3KP9 A;  2L4Q A;  2F3M A;  4TOP A;  4BPY A;  4PHZ C;  1SKW B;  3IAS 2;  4AI6 A;  2B6M A;  3TJK A;  3F0I A;  3MIX A;  3RPP A;  5CRD A;  1SL2 B;  5A4W A;  5E59 A;  1PX6 A;  2XBQ A;  1TRS A;  1GUM A;  4LLR A;  4MP4 A;  1SD8 A;  4GCI A;  2V1M A;  2DC5 A;  1M3J A;  4K1F A;  1AQX A;  2B5E A;  5CAX A;  5D9X A;  1TXU A;  5COH A;  4ECI A;  4XRD A;  1GTA A;  2FNO A;  18GS A;  4YAP A;  3QPM A;  4KE3 A;  4ML1 A;  5ECP B;  1QMV A;  3ME7 A;  3LYP A;  3VPQ A;  4Z7X A;  1M7T A;  3D21 A;  1EV9 A;  1F3B A;  3H8Q A;  3LWA A;  2GLR A;  1XVQ A;  5IMZ A;  3IXR A;  5L71 A;  1E6B A;  4V2M A;  5J41 A;  5HFG A;  4AJ6 A;  4KDX A;  3LXT A;  1NHO A;  4BWQ A;  3G7I A;  5KN3 A;  5F05 A;  3C73 A;  3ZFL A;  4G0L A;  4KND A;  3QAG A;  3L4N A;  4YKF A;  2A2R A;  1GSS A;  1TRV A;  5CRH A;  4LL4 B;  3M0F A;  1V57 A;  4HEA 2;  2H71 A;  3A2V A;  3CHX C;  3NZN A;  4PUA A;  5KOX A;  1A2M A;  3CTF A;  3QFB C;  4MZC A;  2OJL A;  4L0U A;  1A8L A;  4NWY A;  1T4Y A;  1X9S B;  1TXX A;  5DDL A;  1N8J A;  4OO4 A;  4NHZ A;  2IMK A;  3N5O A;  3HD5 A;  3Q74 A;  3DYR A;  3GA4 A;  2RM6 A;  4WF4 A;  5D93 A;  1SJI A;  3FZ5 A;  1GSY A;  4DSR A;  4GST A;  4G9H A;  4EDY A;  1F37 A;  2LNS A;  3UIW A;  2DKH A;  1VRS D;  1UA5 A;  4YQM A;  3IBH A;  3EU3 A;  1PD2 1;  3CRU A;  1FAA A;  1PL1 A;  2YWM A;  3QFA C;  4OO5 A;  2B7J A;  4YKG A;  2P31 A;  4JZQ A;  2H73 A;  3EPT A;  4X43 A;  3AY8 A;  4TR3 A;  4G2E A;  2OBI A;  1EWX A;  1YF0 A;  1U3I A;  1K3L A;  2PVO C;  1J08 A;  2X8H A;  2YWO A;  3APQ A;  5H5R A;  5ECL B;  1PX7 A;  5ID2 B;  3GTU A;  1GTI A;  3ZTL A;  4PNG A;  3F8U A;  4HI7 A;  5HR1 A;  4BIK A;  5AIX A;  3ME8 A;  5A5K A;  4PI0 C;  2FWE A;  2GZY A;  3TRQ A;  3CRT A;  1AXD A;  2MZC A;  2CZ2 A;  1OC3 A;  1FG4 A;  2EFE A;  1O8W A;  3TKS A;  1MD4 A;  4YH2 A;  1Z3E A;  1OVN A;  5LNK e;  1EP7 A;  1GLP A;  1NW2 A;  1TP9 A;  1PSQ A;  2EIO A;  3IHG A;  4DSS B;  3ERW A;  3CSJ A;  4MAB A;  5G2Z A;  2HZF A;  1XG8 A;  2HRN A;  1WPI A;  2G0F A;  3GYK A;  5F06 A;  4FH8 A;  4E68 A;  3I6A A;  4BL7 B;  2KP2 A;  2LRT A;  2A2S A;  3NOF A;  2I81 A;  1HYU A;  2EC4 A;  2GSQ A;  3Q18 A;  3TKR A;  1G0T A;  1QFN A;  3HJO A;  4O32 A;  3WGD A;  2GSR A;  3LYK A;  2L6C A;  2LNT A;  4G01 A;  4EC0 A;  3EVI A;  2FGX A;  1YDK A;  3MNG A;  3IPZ A;  2R2J A;  3CWG A;  4I2T A;  1XVW A;  4EDZ A;  5CO3 A;  4DSQ A;  3US3 A;  2REM A;  4RI7 A;  2XC2 A;  1K0N A;  4XIH A;  2FUG 2;  1M2A A;  3F4T A;  1X5C A;  4ZB6 A;  1R5A A;  1S3A A;  1TW9 A;  3IC4 A;  4QQ7 A;  3ZIT A;  2VCT A;  5EPF A;  4XS4 A;  2WZS A;  4JR6 A;  2VM2 A;  3TKS E;  4TR4 A;  2CVK A;  3WGE A;  3EIN A;  3W8J A;  1GSE A;  2DJ0 A;  2MBS A;  5AIS A;  1O7U A;  2VKZ G;  4K2D A;  4HZ2 A;  3ZZX A;  1SEN A;  2JZT A;  2C1Y A;  2VOC A;  3S9F A;  2CVB A;  1Z6M A;  2OA7 A;  5G1L A;  4TXO A;  3LOR A;  1XPV A;  4DVC A;  1FVJ A;  2CT6 A;  2TIR A;  3CBU A;  3A5I A;  2DML A;  5IOW A;  5HR0 A;  3E9J B;  3TGZ A;  1JZD A;  2C3T A;  5J47 A;  1HNC A;  1EV4 A;  3LSZ A;  1SYX A;  2DSA A;  4TXV A;  1X9M B;  1PGT A;  2K8S A;  2FWF A;  2O3E A;  1PL2 A;  4J2F A;  5J40 A;  2C3Q A;  1XIY A;  3FW2 A;  2VIM A;  3TJG A;  1GUL A;  1SVM A;  1SKS B;  2JSZ A;  4IN0 A;  4NV2 A;  2LRN A;  4MPG A;  4POL A;  3A5W A;  2J9H A;  1QGV A;  4D73 A;  3KP8 A;  1CQH A;  3ED3 A;  4EIQ A;  1MTC A;  3Q6O A;  3QAV A;  1GWC A;  4IGJ A;  3CMI A;  3P8W A;  1JZO A;  1Q98 A;  1T7P B;  3G9B A;  1I5G A;  2CVD A;  4XRA A;  2QA2 A;  1Z7P A;  3BCK A;  1EGO A;  2A4V A;  2R37 A;  4I97 A;  4EVM A;  3FRC A;  3KJY A;  4O92 A;  4PQI A;  4PQH A;  1EOH A;  2YNX A;  4TN8 A;  1M99 A;  1K0A A;  2HRA A;  1XW5 A;  2KOK A;  3DWV A;  4O5U A;  3KTL A;  3TUE A;  4IQA A;  2R0P A;  3HKR A;  3KMN A;  3ZL5 A;  1TDI A;  2H1B A;  5G5F A;  3R3E A;  2OAC A;  2VAF A;  2H74 A;  4ECB A;  4KH7 A;  4K2X A;  2QGV A;  4CY6 A;  2YAN A;  3IK9 A;  6GSY A;  2H1L A;  3C8E A;  1XCC A;  4HUA A;  1ZYQ B;  4AGS A;  1FW1 A;  4WET A;  2YV9 A;  4YQV A;  3F6F A;  1AW9 A;  4TKY A;  4XCS A;  4PNF A;  2QKE A;  1K0D A;  3UOM A;  1URM A;  1YKC A;  3EUR A; 
#chains in the Genus database with same CATH homology
 10GS A;  3DVW A;  4ID0 A;  3HJM A;  2LTK A;  1JHB A;  2X4A A;  5E4W A;  22GS A;  4MA9 A;  2NDO A;  2ALB A;  4POB A;  2QC7 A;  5B8A A;  4MCU A;  2IJY A;  1YZX A;  4DSS A;  2L59 A;  1NSW A;  4BVX A;  1ZOF A;  5KOW A;  1ERU A;  4LL1 B;  1A24 A;  1R7H A;  1WP0 A;  4IEL A;  4ILF A;  1OE8 A;  1WE0 A;  4OD7 A;  2JL4 A;  1ST9 A;  2C0G A;  4F03 A;  4TR1 A;  4LMW A;  4OFN A;  2IFQ A;  1VF3 A;  5ABR A;  4IP1 A;  2IN3 A;  2IPA A;  1BAY A;  1VF2 A;  1GL8 A;  1OKT A;  4Z2R A;  2IMF A;  2PGT A;  4JBB A;  4EIP A;  2DIZ A;  3GST A;  1KTE A;  2YZH A;  1X9W B;  1PRX A;  2VCQ A;  4OCE A;  5CRE A;  1EEJ A;  2VCZ A;  3MYD A;  5F07 A;  2ZCT A;  3H4K A;  4IKH A;  3UVT A;  3H93 A;  2OE0 A;  1OC8 A;  1J0F A;  3LFL A;  3O6T A;  4GLT A;  6GST A;  4WKW A;  4GDF A;  3IC8 A;  1R4W A;  3GX0 A;  3D0Z A;  2P5Q A;  1ERW A;  4MNN A;  2P0G A;  4E8H A;  9GSS A;  4WF5 A;  4ULX A;  5GZZ B;  2YN1 A;  4Z2U A;  4ZL8 A;  1SK1 A;  4V1A g;  2LJR A;  2PER A;  4N11 A;  3APO A;  3C71 A;  1JZR A;  3ISO A;  3C7M A;  1QUW A;  2XPE A;  1EGR A;  1BJX A;  3M3M A;  1E2Y A;  2UV8 G;  5KN0 A;  4EO3 A;  3IK7 A;  3R2Q A;  5IIZ A;  3F9U A;  2RLI A;  1TU8 A;  1XOA A;  2FY6 A;  4FO5 A;  2WCI A;  4QMK A;  1RQM A;  4JU5 A;  3RAZ A;  2MMA A;  3F3Q A;  3ZMK A;  2QSI A;  1T3B A;  1T4Z A;  4PQ1 A;  3FR9 A;  4K6X A;  1SVO A;  3GHA A;  1HD2 A;  3VPT A;  4CY8 A;  5A34 B;  2BTO T;  3I43 A;  2B3S A;  4GXZ A;  4BVY B;  4K8M A;  2GZZ A;  4HS1 A;  3GKM A;  4X0X A;  2C80 A;  4KDY A;  4MZB A;  2XBI A;  4J56 E;  3ZIJ A;  2HYX A;  2DJ2 A;  5DCH A;  17GS A;  5GST A;  3BCI A;  3EMX A;  3CXG A;  3APS A;  1FOV A;  1U88 A;  1ML6 A;  1H4O A;  4E8E A;  4K0N A;  1SK2 A;  3M1G A;  2M80 A;  1G7O A;  4KF9 A;  2X8G A;  4IW9 A;  4PXO A;  1M9B A;  1EZK A;  4ZIL A;  5DAL B;  3EC3 A;  4Q5N A;  1VF4 A;  3FKF A;  3UMA A;  5IPG A;  4K7N A;  1OC9 A;  3KTB A;  3BBY A;  2H75 A;  4I8B A;  1PQN A;  1PMT A;  3GUR A;  3CTG A;  1GH2 A;  1ZL9 A;  4HU9 A;  4N0V A;  1R26 A;  3GMF A;  1GNW A;  1MDJ A;  3GRX A;  2R4V A;  3HVX A;  4Q5F A;  5IQY A;  3JCM L;  3QAW A;  4TR0 A;  2GGT A;  1W89 A;  2N5B A;  2HZE A;  4XS6 A;  4RUV A;  2MMZ A;  1MEK A;  4HDE A;  1A0R P;  4IP6 A;  2AHE A;  1GRX A;  2O89 A;  1A8Y A;  5JWR B;  1A2L A;  2C0E A;  3HHV A;  1TI1 A;  3A2W A;  2CX3 A;  2JZR A;  3TOT A;  3L78 A;  1SU9 A;  3KEB A;  5GAN D;  2B1K A;  2MMO A;  3P7X A;  1AQW A;  3BD2 A;  2H6X A;  3SBC A;  1FHE A;  5IMF A;  3RPN A;  1PN9 A;  3HVV A;  2VM1 A;  5ECH B;  3MAK A;  1Z5Y E;  5ELG A;  2IWT A;  3LQ7 A;  1BYE A;  3HDC A;  2C0F A;  3D5J A;  1H75 A;  4HJM A;  5DBQ A;  5A5H B;  3IE3 A;  2A2P A;  4WBR D;  1EOG A;  4JED A;  3EYT A;  2M46 A;  2DJ1 A;  1YEX A;  4N30 A;  2MBT A;  1Z7R A;  1MDI A;  3VI5 A;  1BX9 A;  1WOU A;  1GLQ A;  2L57 A;  1TK5 B;  2V6O A;  2LUS A;  3PGT A;  1ILO A;  2N5F A;  5DAK B;  4AJ7 A;  1VF1 A;  5IM9 A;  1HNA A;  3E0U A;  4GSS A;  1YEP A;  4KW6 A;  2RUE A;  4MJC A;  2K8V A;  3GL3 A;  2FHE A;  2HSN B;  4EKZ A;  2PN8 A;  1BG5 A;  4NXI A;  1U87 A;  2LS5 A;  4HJ2 A;  4AJ8 A;  1O8X A;  1K3O A;  4OFT A;  2E7P A;  4FIW A;  1B8X A;  1U3A A;  2GVP A;  2CQ9 A;  6GSV A;  2FWH A;  1TRW A;  5J5N A;  2PBJ A;  2WUL A;  4O7H A;  2XPD A;  3EU4 A;  3DML A;  1U6T A;  4L0W A;  2UZ8 A;  1DE2 A;  1B4Q A;  3UAP A;  2ON7 A;  2HE3 A;  5J4U A;  2H76 A;  4GTU A;  2CX4 A;  1T00 A;  1USB A;  1XWA A;  2OBK A;  4GF0 A;  3IR4 A;  3VWU A;  4K5S A;  3TDG A;  4JRR A;  5CRG A;  1TKD B;  1Z6N A;  2ES7 A;  3FZ4 A;  1ACV A;  4KCA A;  1AIU A;  12GS A;  2O7K A;  3HZ8 A;  3TKP A;  3G7Y A;  4G0I A;  1GP1 A;  3D4T A;  2WZ9 A;  4QL7 A;  3ZVJ A;  1N25 A;  4XHM A;  2HRK B;  4V2N A;  5ECM B;  2HSH A;  4TRX A;  1SVL A;  1ON4 A;  4BVY A;  3KGK A;  2H6Z A;  3GH6 A;  5ECN B;  2I9H A;  3KM6 A;  4ZB9 A;  1TRU A;  2WS2 A;  5JCU A;  2F51 A;  1K0B A;  2WRT A;  5ECS A;  3HCZ A;  4L5L A;  1Q4J A;  4TVE A;  5GSS A;  6GSU A;  2EIQ A;  2GZP A;  1WWJ A;  3PH9 A;  4IS0 A;  4MF7 A;  2H0G A;  2DLX A;  1FOH A;  3UL3 A;  2IME A;  2BJX A;  3UBK A;  1GUK A;  3TCO A;  1G7E A;  4V1A p;  4ZBD A;  2HQT A;  2LJK A;  3A2X A;  4EF0 A;  3C1S A;  5DAL A;  3ERG A;  5A4V A;  4OCF A;  4KDU A;  3WT2 A;  1VGL A;  4MMM A;  2TRC P;  3RHB A;  2H0H A;  1RK4 A;  1JFU A;  1M2B A;  4K7I A;  4NAX A;  1HNB A;  3VWW A;  4PUR A;  2DJK A;  1FB0 A;  1TTZ A;  2YJ7 A;  5H5S A;  3WD6 A;  1X5E A;  2GDR A;  5J4Y A;  5IMC A;  2MYG A;  2K6V A;  5ECI B;  2C3N A;  13GS A;  4ICY A;  3EWL A;  2J23 A;  4K7O A;  3UBL A;  4MF5 A;  1K0M A;  2D2Z A;  3UEM A;  3IHQ A;  3L9S A;  2E2G A;  3LW9 A;  3DRN A;  4POM A;  4FYC A;  3DEX A;  1A23 A;  4IJI A;  1A2J A;  2O85 A;  2PPT A;  1MD3 A;  3GKN A;  5G31 A;  3TKS C;  5HR3 A;  1AC1 A;  3J7Y k;  2YOI A;  1BF5 A;  3VUR A;  4ZXG A;  5IMV A;  4EUY A;  5ID2 A;  2EFD A;  2H70 A;  4LA1 A;  5D73 A;  4EE0 A;  1LBK A;  4EXJ A;  4USS A;  2GST A;  3FR3 A;  3GN3 A;  4CW9 A;  3EE2 A;  2L5O A;  4NPB A;  2LQQ A;  2F9S A;  2JSY A;  3KXO A;  5FT3 A;  5CYY A;  2FCH A;  2R3X A;  3IAM 2;  4O5R A;  2OE1 A;  1GUH A;  3FYG A;  1JLV A;  3LEF A;  4ZB7 A;  4GRF A;  5ELA A;  3TJB A;  5LCZ A;  3TB2 A;  4ECC A;  3ZIV A;  2O87 A;  3GTU B;  1UN2 A;  1ZGN A;  2LV3 A;  2YP6 A;  2AUV A;  3GUS A;  1AUC A;  5BMU B;  3FR6 A;  4BL7 A;  3VK9 A;  3VWX A;  2QA1 A;  2KHP A;  5HR2 A;  3FMW A;  1I9D A;  5CRW A;  2H8L A;  4KGI A;  4PTS A;  4CDO A;  2GSS A;  3KIJ A;  1ZZY A;  2V32 A;  4I6X A;  2O5V A;  3DGQ A;  2NBS A;  3FEU A;  2YJH A;  4A5P A;  3L9U A;  3Q19 A;  2A4H A;  1SKR B;  4ECJ A;  2H6Y A;  5F8B A;  3WYW A;  4GQF A;  4KUN A;  4ZBA A;  4ZL9 A;  3OR5 A;  2L6D A;  1TOF A;  5IO2 A;  4YQU A;  2R5G A;  1GSU A;  5ECR B;  4MF6 A;  3ZFB A;  3H1N A;  2NTO A;  1QK8 A;  5J3R A;  3HJP A;  5LD0 A;  3GX8 A;  3HZ4 A;  1KBN A;  2YWN A;  5IMA A;  1PKW A;  4IJ3 A;  3M9J A;  3D6I A;  5HQP A;  2R0G A;  4MJB A;  2IMD A;  3ZML A;  1BG1 A;  5KN1 A;  2I1U A;  5FWG A;  1O6J A;  1LJR A;  2R0C A;  4XTS A;  2KLX A;  2XHF A;  1M9A A;  1GSQ A;  3F3R A;  1KEB A;  1A0F A;  2AV4 A;  3ZRE A;  2LKU A;  3VFI A;  5J9B A;  3FZA A;  4XS4 B;  2VD1 A;  2M72 A;  4BWS A;  2GS3 A;  2G2Q A;  3I69 A;  2IIY A;  2TRX A;  1V2A A;  2E2M A;  4KA0 A;  4BA7 A;  1T8E B;  3L9V A;  3HXS A;  3CSH A;  2B7K A;  3C1R A;  3TJJ A;  1ERT A;  3PIN A;  4TXO B;  5G5E A;  1V40 A;  3HYP A;  4HQZ A;  3VWV A;  1M2D A;  1XOB A;  1G6Y A;  1YY7 A;  1V9W A;  3PPU A;  2B1L A;  1B9X C;  3KZQ A;  5B6M A;  3QCP A;  1GTU A;  2KP1 A;  2HFD A;  5B8B A;  5INY A;  1THO A;  2I4A A;  1K0C A;  5D9W A;  5A1N B;  4Q5R A;  1XBS A;  2WB9 A;  1XWB A;  2OE3 A;  4MH3 A;  3W8S A;  2CV4 A;  1ERV A;  3FZ9 A;  2HLS A;  3GKK A;  2LQO A;  3U6V A;  1TI3 A;  1ZYN A;  3TJF A;  1GSD A;  3PR8 A;  4ZBB A;  2HSY A;  4WR4 A;  6GSX A;  4WBJ A;  5IPH A;  4ZB8 A;  4ML6 A;  4F0C A;  2CAI A;  1O73 A;  4O5Q A;  2X99 A;  1B48 A;  1IYI A;  2JAD A;  3HA9 A;  5CP1 A;  2B5X A;  4D73 B;  3GNJ A;  1N2A A;  1LU4 A;  1V58 A;  1OE7 A;  3LGC A;  3HVS A;  5J9C A;  2VCW A;  2EFH A;  5HFI A;  3DD3 A;  2HNL A;  4I2U A;  1S3C A;  1GNE A;  1JZW A;  2MMN A;  2LST A;  1IYH A;  4QL9 A;  4TW5 A;  2VD0 A;  2VO4 A;  7GSS A;  3SWL A;  1TK0 B;  2VLU A;  3V1W A;  4PUF C;  4L8E A;  3DVX A;  1Z9H A;  1ABA A;  4IVF A;  4XS1 A;  1DSB A;  1S3D A;  4MDC A;  4G0K A;  2PWJ A;  5HFK A;  3IA1 A;  4GQC A;  3FK8 A;  2F8A A;  5FHI A;  1X5D A;  3RDW A;  3QOU A;  2LRC A;  1JLW A;  5ECK B;  2WDU A;  2LEG A;  1YVL A;  1BED A;  2L4C A;  2DKI A;  5B7C A;  1M0U A;  2CZ3 A;  3HY2 A;  3DIE A;  1QQ2 A;  4MJA A;  2VLV A;  4ZIJ A;  5D96 A;  3DXB A;  5KN2 A;  2HXK A;  4AKG A;  3F4R A;  2RUF A;  2VUP A;  3NIV A;  3F4S A;  5BRT A;  1GTB A;  1X0R A;  3QD9 A;  5BMU A;  1DE1 A;  1V98 A;  3RBT A;  2FA8 A;  4KX4 A;  1HQO A;  1PN0 A;  5C04 A;  2N5A A;  2AAW A;  1BQ7 A;  5DJL A;  3J7Y b;  5AN1 A;  4IBP A;  1NM3 A;  5JCW A;  2FA4 A;  4GSN A;  1FB6 A;  2FLS A;  3QMX A;  1T1V A;  4N3Z A;  14GS A;  3QDN A;  2OT3 A;  4MK3 A;  5F0G A;  1SL0 B;  4BVX B;  3UAR A;  4AKI A;  1SL1 B;  2H72 A;  4OFM A;  5EVO A;  1F2E A;  2GT5 A;  2NVL A;  2PU9 C;  6GSS A;  2AYT A;  4TR1 B;  2IFQ B;  3GV1 A;  4F82 A;  2HT9 A;  1B4P A;  3M9K A;  5JCG A;  3IV4 A;  5D8I A;  2YZU A;  1ZMA A;  1XZO A;  1DUG A;  1SK0 A;  4RQR A;  2VL2 A;  1J9B A;  2HI7 A;  4ACS A;  4MJE A;  4J57 E;  1KNG A;  2CA8 A;  3ZYW A;  2C4J A;  3E3E A;  5KEJ A;  4MZW A;  4HU7 A;  3IRA A;  5DQS A;  2V2G A;  3GKX A;  4AF2 A;  2HSM B;  2OAD A;  2Z9S A;  2CAQ A;  2DJ3 A;  1K3Y A;  2V6K A;  3HMJ G;  4WR5 A;  5H5Q A;  3F6D A;  4OWY A;  3W6G A;  2X8C A;  3G7J A;  4P3Y B;  3M8N A;  4H86 A;  1TJD A;  2RII A;  4AKX B;  4NHW A;  1RW1 A;  5ENU A;  3KH9 A;  5AGY A;  2VL9 A;  4Q5Q A;  4NMU A;  2JU5 A;  3FY7 A;  5J4V A;  1UC7 A;  5A34 A;  2AB6 A;  5A4U A;  2C8U A;  1PA3 A;  2YV7 A;  4V2L A;  1OYJ A;  1YQ1 A;  2DBC A;  2H1A A;  1EP8 A;  3WT1 A;  3RHC A;  3MWH A;  4IHU A;  1WRY A;  5JWQ B;  4EL1 A;  2IMI A;  3BJ5 A;  4N10 A;  4I5Q A;  2R6K A;  4K0G A;  5A1N A;  1Y1U A;  4F2I A;  6GSW A;  3VLN A;  5CNW A;  4KSM A;  4G10 A;  3D22 A;  2K9F A;  2P5R A;  1WIK A;  4FYU A;  1YJ6 A;  3D4M A;  2ZUP A;  2IL3 A;  1EEM A;  5IOX A;  1F3A A;  3CSI A;  4G19 A;  2YCD A;  5G30 A;  3H79 A;  5EL8 A;  19GS A;  2OKA A;  4OMV A;  1AAZ A;  4FYB A;  1FVK A;  2DIY A;  3KH7 A;  3O76 A;  4X1U A;  5G1K A;  3FHK A;  4CHS A;  3DKS A;  3F63 A;  1XWC A;  4N0Z A;  3LXZ A;  1XWK A;  3LJR A;  3KMO A;  4IQ1 A;  11GS A;  3EMP A;  1TU7 A;  1GSF A;  2DJJ A;  2K18 A;  3A3T A;  3CYN A;  5DVB A;  2ON5 A;  2PMT A;  5GAP D;  3GH9 A;  1QXH A;  4F0B A;  1THX A;  1F6M C;  3TKQ A;  2X49 A;  1R5P A;  1OC9 B;  3KD0 A;  2E0Q A;  2AJQ B;  2GQL A;  5ECO B;  1XW9 A;  1W4V A;  4Z2T A;  3TOU A;  4KSO A;  1NHY A;  2VCX A;  3UVH A;  2PUK C;  5JWO B;  2DMM A;  2HZE B;  2GQK A;  5A5H A;  2NPB A;  2O8V B;  1WJK A;  4AKH A;  2B5Y A;  3ERF A;  3U5R E;  2H0I A;  4RQX A;  5EY6 A;  3IDV A;  4JR4 A;  4K5R A;  3P2A A;  1SYR A;  1UVZ A;  2GT6 A;  1G6W A;  1OAZ A;  5C00 A;  4L5O A;  5B6N A;  1SD9 A;  3ZVJ D;  4HZ4 A;  1O81 A;  3P90 A;  2BMX A;  4RI6 A;  2H1G A;  3GL5 A;  3LG6 A;  1F9M A;  5IO0 A;  5DAK A;  1DBY A;  3MDK A;  3TRP A;  2VCV A;  3GSS A;  1ZYP A;  4LMV A;  5ECQ B;  4KAE A;  2EIR A;  4W66 A;  2F8F A;  2V41 A;  2FWG A;  4PGT A;  2WFC A;  1TK8 B;  3ZRD A;  4DEJ A;  4MH2 A;  3BOA A;  3ZLP A;  2VL2 C;  2KUC A;  2HSN A;  4YAV A;  1O85 A;  1PKZ A;  4KCE A;  5AIV A;  3UJ1 A;  3I9V 2;  3QR6 A;  4X4J A;  2WJU A;  4ISD A;  2JZS A;  1AQV A;  4GWR A;  1C72 A;  3TRX A;  1ZCP A;  2H1D A;  5D9V A;  4PX1 A;  2H30 A;  4MPF A;  2GQM A;  3GFK A;  5DQY A;  2H01 A;  2EFC A;  3L0H A;  1WMJ A;  2FD3 A;  8GSS A;  20GS A;  2RM5 A;  1XWG A;  2L5L A;  3K8N A;  2WGR A;  1FO5 A;  2HSM A;  4F9Z A;  2GTU A;  3O3T A;  1YF1 A;  4MLY A;  2I3Y A;  4WXT A;  1ZYE A;  1OKD A;  3TU3 B;  4NV5 A;  4POK A;  2VLT A;  3MSZ A;  5DCG A;  2LJA A;  3WGX A;  2VL3 A;  4WEY A;  2C0D A;  2YWI A;  3N9J A;  1SJ6 A;  5D9T A;  2X64 A;  1Y6E A;  1XW6 A;  2H19 A;  2ZNM A;  1XFL A;  4HOJ A;  5DJM A;  1MDK A;  4KB3 A;  2HRK A;  1XXU A;  2JAC A;  4JE1 A;  1YKA A;  3VI7 A;  3GIX A;  4K9Z A;  1SJZ A;  3IOS A;  4FQU A;  4HQS A;  1K0O A;  2PVQ A;  2H66 A;  1Y25 A;  1B9Y C;  2YPM A;  5IMD A;  4ZL7 A;  3KCM A;  1CQG A;  16GS A;  2HRF A;  3KP9 A;  2L4Q A;  2F3M A;  4TOP A;  4BPY A;  1SKW B;  3IAS 2;  4AI6 A;  2B6M A;  3TJK A;  3F0I A;  3MIX A;  3RPP A;  5CRD A;  1SL2 B;  5A4W A;  5E59 A;  1PX6 A;  2XBQ A;  1TRS A;  1GUM A;  4LLR A;  4MP4 A;  1SD8 A;  4GCI A;  2V1M A;  2DC5 A;  4K1F A;  1AQX A;  2B5E A;  5CAX A;  5D9X A;  1TXU A;  5COH A;  4ECI A;  4XRD A;  1GTA A;  2FNO A;  18GS A;  4YAP A;  3QPM A;  4KE3 A;  4ML1 A;  5ECP B;  1QMV A;  3ME7 A;  3LYP A;  3VPQ A;  4Z7X A;  1M7T A;  3D21 A;  1EV9 A;  1F3B A;  3H8Q A;  3LWA A;  2GLR A;  1XVQ A;  5IMZ A;  3IXR A;  5L71 A;  1E6B A;  4V2M A;  5J41 A;  5HFG A;  4AJ6 A;  4KDX A;  3LXT A;  1NHO A;  4BWQ A;  3G7I A;  5KN3 A;  5F05 A;  3C73 A;  3ZFL A;  4G0L A;  4KND A;  3QAG A;  3L4N A;  4YKF A;  2A2R A;  1GSS A;  1TRV A;  5CRH A;  4LL4 B;  3M0F A;  1V57 A;  4HEA 2;  2H71 A;  3A2V A;  3NZN A;  4PUA A;  5KOX A;  1A2M A;  3CTF A;  3QFB C;  4MZC A;  2OJL A;  4L0U A;  1A8L A;  4NWY A;  1T4Y A;  1X9S B;  1TXX A;  5DDL A;  1N8J A;  4OO4 A;  4NHZ A;  2IMK A;  3N5O A;  3HD5 A;  3Q74 A;  3DYR A;  3GA4 A;  2RM6 A;  4WF4 A;  5D93 A;  1SJI A;  3FZ5 A;  1GSY A;  4DSR A;  4GST A;  4G9H A;  4EDY A;  1F37 A;  2LNS A;  3UIW A;  2DKH A;  1VRS D;  1UA5 A;  4YQM A;  3IBH A;  3EU3 A;  1PD2 1;  3CRU A;  1FAA A;  1PL1 A;  2YWM A;  3QFA C;  4OO5 A;  2B7J A;  4YKG A;  2P31 A;  4JZQ A;  2H73 A;  3EPT A;  4X43 A;  3AY8 A;  4TR3 A;  4G2E A;  2OBI A;  1EWX A;  1YF0 A;  1U3I A;  1K3L A;  2PVO C;  1J08 A;  2X8H A;  2YWO A;  3APQ A;  5H5R A;  5ECL B;  1PX7 A;  5ID2 B;  3GTU A;  1GTI A;  3ZTL A;  4PNG A;  3F8U A;  4HI7 A;  5HR1 A;  5AIX A;  3ME8 A;  5A5K A;  2FWE A;  2GZY A;  3TRQ A;  3CRT A;  1AXD A;  2MZC A;  2CZ2 A;  1OC3 A;  1FG4 A;  2EFE A;  1O8W A;  3TKS A;  1MD4 A;  4YH2 A;  1Z3E A;  1OVN A;  5LNK e;  1EP7 A;  1GLP A;  1NW2 A;  1TP9 A;  1PSQ A;  2EIO A;  3IHG A;  4DSS B;  3ERW A;  3CSJ A;  4MAB A;  5G2Z A;  2HZF A;  2HRN A;  1WPI A;  2G0F A;  3GYK A;  5F06 A;  4FH8 A;  4E68 A;  3I6A A;  4BL7 B;  2KP2 A;  2LRT A;  2A2S A;  3NOF A;  2I81 A;  1HYU A;  2EC4 A;  2GSQ A;  3Q18 A;  3TKR A;  1G0T A;  1QFN A;  3HJO A;  4O32 A;  3WGD A;  2GSR A;  3LYK A;  2L6C A;  2LNT A;  4G01 A;  4EC0 A;  3EVI A;  2FGX A;  1YDK A;  3MNG A;  3IPZ A;  2R2J A;  3CWG A;  4I2T A;  1XVW A;  4EDZ A;  5CO3 A;  4DSQ A;  3US3 A;  2REM A;  4RI7 A;  2XC2 A;  1K0N A;  4XIH A;  2FUG 2;  1M2A A;  3F4T A;  1X5C A;  4ZB6 A;  1R5A A;  1S3A A;  1TW9 A;  3IC4 A;  4QQ7 A;  3ZIT A;  2VCT A;  5EPF A;  4XS4 A;  4JR6 A;  2VM2 A;  3TKS E;  4TR4 A;  2CVK A;  3WGE A;  3EIN A;  3W8J A;  1GSE A;  2DJ0 A;  2MBS A;  5AIS A;  1O7U A;  2VKZ G;  4K2D A;  4HZ2 A;  3ZZX A;  1SEN A;  2JZT A;  2C1Y A;  2VOC A;  3S9F A;  2CVB A;  1Z6M A;  2OA7 A;  5G1L A;  4TXO A;  3LOR A;  1XPV A;  4DVC A;  1FVJ A;  2CT6 A;  2TIR A;  3CBU A;  3A5I A;  2DML A;  5IOW A;  5HR0 A;  3E9J B;  3TGZ A;  1JZD A;  2C3T A;  5J47 A;  1HNC A;  1EV4 A;  3LSZ A;  1SYX A;  2DSA A;  4TXV A;  1X9M B;  1PGT A;  2K8S A;  2FWF A;  1PL2 A;  4J2F A;  5J40 A;  2C3Q A;  1XIY A;  3FW2 A;  2VIM A;  3TJG A;  1GUL A;  1SVM A;  1SKS B;  2JSZ A;  4IN0 A;  4NV2 A;  2LRN A;  4MPG A;  4POL A;  3A5W A;  2J9H A;  1QGV A;  4D73 A;  3KP8 A;  1CQH A;  3ED3 A;  4EIQ A;  1MTC A;  3Q6O A;  3QAV A;  1GWC A;  4IGJ A;  3CMI A;  3P8W A;  1JZO A;  1Q98 A;  1T7P B;  3G9B A;  1I5G A;  2CVD A;  4XRA A;  2QA2 A;  1Z7P A;  3BCK A;  1EGO A;  2A4V A;  2R37 A;  4I97 A;  4EVM A;  3FRC A;  3KJY A;  4O92 A;  4PQI A;  4PQH A;  1EOH A;  2YNX A;  4TN8 A;  1M99 A;  1K0A A;  2HRA A;  1XW5 A;  2KOK A;  3DWV A;  4O5U A;  3KTL A;  3TUE A;  4IQA A;  2R0P A;  3HKR A;  3KMN A;  3ZL5 A;  1TDI A;  2H1B A;  5G5F A;  3R3E A;  2OAC A;  2VAF A;  2H74 A;  4ECB A;  4KH7 A;  4K2X A;  2QGV A;  4CY6 A;  2YAN A;  3IK9 A;  6GSY A;  2H1L A;  3C8E A;  1XCC A;  4HUA A;  1ZYQ B;  4AGS A;  1FW1 A;  4WET A;  2YV9 A;  4YQV A;  3F6F A;  1AW9 A;  4TKY A;  4XCS A;  4PNF A;  2QKE A;  1K0D A;  3UOM A;  1URM A;  1YKC A;  3EUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...