5AJ3J

Structure of the small subunit of the mammalian mitoribosome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
PEITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTKLEQLPEHIRKPIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5aj3J00
4GKKJ 1HNXJ 4JI8J 4B3SJ 4X64J 4OX9J 3T1YJ 4DV2J 4DV0J 4KYZA 2VQEJ 4LFAJ 1HR0J 2UU9J 2UUCJ 4LF9J 3D3BJ 4DR5J 4JI7J 4DV5J 4LF7J 4AQYJ 4DUYJ 4DR4J 1IBLJ 4JI1J 2KVQE 4LF4J 4X65J 2MTLA 4DR7J 2MQ8A 4LFCJ 4LF6J 1XMQJ 5LMUJ 4DV6J 5AJ3J 1N36J 4KHPJ 2UUAJ 4JI5J 5LM7E 4K0KJ 3W1YC 4NEZA 3R2DJ 4JI0J 4DV1J 1N33J 4PWWA 2UXCJ 1IBKJ 2MEWA 4X66J 1XNRJ 3J7AN 4NXNJ 4RJVA 1XMOJ 4DUZJ 5LMNJ 4B3RJ 4HHUA 2VQFJ 4NXMJ 4YY3J 4JI2J 4LFBJ 1HNZJ 5FLXU 4DV7J 3R2CJ 3T1HJ 4X62J 5A2QU 4KY3A 2E5LJ 2ZM6J 4JI6J 4DR3J 5IWAJ 1N34J 5BR8J 4B3TJ 2UUBJ 4JI3J 1FJGJ 4DR1J 4JV5J 3IMQJ 4B3MJ 4JI4J 4DR6J 4JYAJ 5IT9U 4NEYA 2HHHJ 4V1Ak 2UXBJ 1I94J 3OTOJ 4YHHJ 3J80U 4DV4J 1XNQJ 3D3CJ 4LF5J 1N32J 4DV3J 2F4VJ 1HNWJ 4DR2J 2UXDJ 3J81U 2KL8A 3JAMU 1J5EJ 4GKJJ 1IBMJ 4LF8J
chains in the Genus database with same CATH superfamily
4DS5A 2F8MA 2V50A 1YJVA 4NRTA 1TL1A 1NPKA 4ETXA 2E5IA 4XIUA 3NNHA 2QTWA 3W8GA 4NLYA 4KO0B 2N7YA 1XMQJ 3D66A 1FRIA 1PCAA 4B9UA 3SSQA 1O8BA 4OIXA 2KT3A 1JB0C 5THWA 4WFXA 2GQ2A 2QA1A 3JSMB 3ZZRA 4K2XA 2CNOB 1IBKJ 1KVJA 5DQGA 4WYLA 4P2MA 2ZC4A 2RQCA 4RBTA 4OX6A 2E5HA 2P9CA 2WW8A 3H90A 4PYAA 4RNHA 3KK1B 3GB0A 5DLGA 2VG7A 2ZDPA 3TR5A 2VHGA 2F65A 1JWWA 5J2PA 1DHMA 1R89A 1FK9B 4MKAA 4DG1A 4BHQA 3GJQB 1S1UA 1QSYA 1L5UA 3K8WA 1BQNB 1C0TA 4ZIWA 4C8LA 2YWKA 1OO0B 2F63A 1XR6A 1KQSR 5GAGU 4OYWA 3GR1A 4OQJA 3SFGA 1H73A 4R8UA 1IWGA 4M1KA 3TP2A 2WVDA 3GFYA 2Y9HA 3GFXA 4GO5X 1D9DA 2V2KA 1MROA 2FJXA 4F0HA 2ALZA 4USMA 4K4SA 4NPOA 1I51B 2CJQA 4HVZA 3N6LA 3Q8SB 2PIIA 2N3OA 2RVJA 1FTCA 1S49A 3P45B 4N5SA 5T14A 2Z58B 4U6PA 1D09B 4OJ3A 1T7PA 3WZ0A 1XR7A 3MR6A 4PPDA 4HI1A 2ILYA 3HVTB 5DDRC 3MUMP 2VOPA 4LT6A 3ITHA 2DH7A 3DLGA 2PEBA 3IR6B 3JQKA 4YB6A 2YKMB 5CQGA 3ILOA 4G1IA 4ECRA 3EGWB 3KJVB 2ZITA 4TQSA 2HHUA 1FFWB 6FDRA 4YHHJ 1RTIA 5AE3A 1VQ5S 2HVHA 2Y1IA 1JXLA 2DNHA 4E0DA 1EKRA 5KFXA 1S79A 3RG6A 3RU0A 4HKQA 3C3LA 3PRBA 2M7SA 3TYTA 3BEGB 4U8YA 3PX6A 3RR8A 2XS2A 4X4NA 1FEHA 2OPPA 2QT7A 1NDCA 4F2SA 4JI3F 1UETA 4ANCA 3TWZA 4ECXA 1K1QA 2DTJA 1YITS 2CG8A 2D3ZA 2XY6A 2C28A 1RAFB 1LXJA 3GIKA 2M8HA 4ED6A 2E5JA 2DGOA 2KDOA 4U9RA 4XPEA 2XY5A 2R8KA 3OPKA 4MTPA 2UP1A 4H4KA 4CO1A 3HHKA 2JSXA 4EWTA 3DGPA 3R2CJ 1DQ9A 4CCHA 1LK7A 2K2PA 3VGSA 4J90A 4B3OB 3EVOA 2GAHC 4JI3J 4CLPA 3DHWC 1LWCB 2NPFA 1W26A 3WX8A 2MSSA 3CCZA 2V8GA 4X2BA 5KFLA 1FRHA 3HCXA 4YS2A 2FJEB 3RTVA 3CNQP 4K4VA 3QZ8A 4HACB 4W92B 3MFHA 4WCEQ 2RDDA 3MR3A 4PABA 4P74A 2GIFA 4HDHA 1RWOB 3LPEA 4BS2A 4BLGA 3IWLA 4ECYA 4I2PA 3ZFVA 1NKEA 1NHKL 4RU2A 5IQQA 1C1CB 2XEXA 4TU8A 2ZBIA 3M6WA 1UEVA 4UOCA 2FJWA 4LFAF 1RWVB 3K5OA 3TZXA 1N5TA 5K8PA 4HHJA 3AD9C 3RB4A 4DUTA 3M2UA 4RLEA 1UFKA 1FKOB 1DARA 2OO4A 2OFGX 3OBIA 3UNGC 2LDIA 2DK2A 1P9YA 4TYBA 5DS7A 4KQZA 4M95A 2ZJQQ 3LWLA 3IM9A 5MLCV 2W2NP 2RU3A 3TUZC 3TEGA 3M9MB 1N33F 1NDKA 1KLMB 4Y0FA 2VONA 4FS2A 5DGAA 5E2QA 2DNGA 3J81U 1EETA 3Q8PB 5KT4A 4NCBA 4K0KF 1NK8A 2GFFA 4LFAJ 3HT0A 4CLLA 2RUSA 2XHCA 4MMOA 1ZM3A 1EHWA 5HBMA 3TUJC 4X4PA 3UCZP 4WWSA 3FMBA 3C14A 3DOMA 4DL5A 3GR0A 2HW3A 5E3CA 3QFHA 4QIGA 1OY9A 3NG8A 5M2PA 1N33J 2FC9A 4ZOSA 1EJ7L 5I3PA 1GXTA 2IBOA 2QJ3A 4K4WA 3I5BA 3CCWA 4YN3B 3IBCB 3OFFA 3FBBA 3L7PA 4MIAA 4NLPA 3PR4A 4ZJQA 3OFGA 3HT3A 2DNZA 2UVRA 1PAUB 5H9EJ 4ID5A 3S01A 3D3CJ 1QTNB 2ZDOA 1YRTA 5C5JA 4ILMA 1KQGB 3KK3A 1X60A 1HQUB 4LSNB 3P3DA 1SC1B 4PXBA 3A3NB 3POTA 3KFWX 1NDLA 3FBFA 1RHKB 2OGUA 2XMVA 4DR3F 3MEDB 2BW2A 1S6QB 3MEEA 4EK2A 2ZNZA 3HVWA 1L3KA 1U2RA 1RBLA 3GP9A 5AXNA 3VAHA 4O0NA 1AROP 1NJIT 5HL7Q 4NEZA 3THVA 1CSJA 1S1XA 3RBEA 4URGA 2JDJA 1KOHA 2YX4A 1VIOA 2CPXA 2OPQA 3M05A 2J5AA 2QL5B 1TP7A 1NPRA 1ZM2A 2GIQA 3OTDA 2LMIA 2MQMA 1IXKA 1JX4A 4RU9A 3PW0A 1WEZA 2I8EA 4DR3J 1UWBA 2RILA 2CFXA 4PKDB 2C2OB 5DDQC 4USWA 5KFNA 3O1LA 2QC3A 1KVIA 2C2ZB 4B3RF 3MFIA 2Z56B 2E9RX 1N36F 4OHXA 2GHPA 1N56A 3O44A 1RAJA 4E2FB 3A1YG 4LR7A 1GX5A 1RTZA 3QBCA 4Q8EA 1PYOB 2E29A 3OVSA 2HFSA 3CB4A 3T6BA 3AOAA 2RQ4A 2MKHA 1FNXH 4WFZA 2KXNB 2W01A 4ZKAA 4MJKA 1L3SA 3DDIA 4NZ6A 1N48A 1T9VA 3OTEA 2EFQA 1F9FA 2DISA 1Q5VA 3GJRB 2RS2A 3IAM9 5DDPC 2R7SA 2FVRA 4J5OA 2C3MA 5G0RB 4B3RJ 1VBXA 4UOFA 3W9JA 1S9GA 1XK8A 2DGUA 1PIEA 5A8RA 2Q79A 3AQPA 1U6FA 1HNIA 1HL6A 2HSEB 1RT3A 1RISA 1SXLA 4B9LA 2UUCF 4FYWB 3NMAA 2F8EX 3R6GB 2LLZA 3HSDA 5KFRA 4KPYA 1RTHA 1PYTA 2NUHA 4I67A 1EARA 4HYKA 1RHUB 1G7CB 1SC3B 2XGQA 2HVZA 4OZ0A 1WTFA 4I0WA 4HLBA 1W2BR 3RUBL 2ZKTA 1FX2A 2AU0A 2JFKA 4IR9A 1BQMA 4KGXB 1J2VA 2JLFA 2MZRA 2ZOGA 2J6UA 3PO4A 5L9NA 2A10A 1M5KC 1OY6A 2WVCA 2V4QA 3PX0A 1TAUA 3NEKA 1NK4A 5JMNA 1K1SA 2R8IA 5L8RC 2WOMA 1SH2A 4ZPDA 4P2SA 2VKRA 4L73A 4DFMA 4LBPA 2X51A 2PA3A 5KOWA 1RT6B 1W7WA 4KPCA 4LBIA 1TL5A 1B4SA 4NA3A 3DFEA 4GKKF 3OL6A 4ZVRB 3VZIA 4DV2F 3FUYA 3BZQA 5IZHA 4LRFA 4L6V3 4LSLA 1NUEA 2VG5B 1X4EA 1HWJA 4ILRA 4Y2IA 4CNYA 1Q81T 3L3CA 3IA0A 2GJFA 1CVJA 3CEDA 3GCWP 1RLCL 5HANA 2AD9A 1HBNB 3T1HF 2BRKA 3NCPA 2ZE2B 3W61A 2MHEA 4CWBA 3PKYA 1DQAA 2HFVA 2K1RB 1F0XA 3IWXA 2AEMA 4DN9A 5DGBA 2U2FA 4J9MA 2ALYB 2MQQA 4ED3A 2LDYA 4EO6A 2BE7D 2JC0A 3W5ZA 1EP4B 1J27A 1CJUB 2WVFA 3GV5B 4UY85 3CD5A 1RT2B 3CJ4A 3KTQA 1X4BA 4D3HA 2I1RA 3S8SA 3N5FA 1C2PA 3M1VA 1FVQA 1AYEA 3T1HJ 1UVJA 1R8AA 2VF3A 4IDKA 3MEKA 2XMTA 2ILZA 3KHLA 4KKOA 2IAJB 4W4MA 1LXNA 4JI0F 2CIMA 5GADI 3ZC4A 3VF0B 2EK1A 4Q2LA 3CJ0A 2K8GA 2JNJA 3CIZA 3SQGB 3WIVA 5CABA 2I5JB 1MSWD 1YJRA 4KH0B 2D69A 4K5SA 2NZ4A 3CD0A 1QDUB 1B0VA 1FWKA 4MK7A 3EXCX 2KM8C 2UV8A 3UCUP 4B3MF 2DHXA 4UOHA 1S9EB 1WOSA 3T5KA 2RS8A 1S6PA 4DQIA 3LP0A 1YRXA 2CDQA 3NAHA 1H2TZ 1RU2A 5IC6B 2HGMA 1B0PA 1FRJA 4A4JA 1TL4A 4OX9F 4JI0J 2DNRA 3IFEA 3UD3P 4KB7A 2UVVA 2W4PA 1F5CA 3HHLC 2BANB 1XNQF 4WE1B 1Z4UA 4HHHA 2PFFB 4TNOA 3HJFA 2V63A 3PFOA 2LXFA 1C4CA 1KRPA 1HNZJ 2MZSA 3OD2A 4FYVB 1Q79A 2ADCA 3I0RA 3BGLA 4C4WA 1M5HA 2XS7A 1UZDA 3EMTA 1CS4A 1ZAXA 3A3OB 1HIYA 4Z37A 4OI0A 4B3MJ 1FXLA 3M6XA 5GAHI 2XNRA 2M70A 4ECSA 1SVDA 5KG4A 4URQU 4AL5A 5ITHA 2DY1A 4IH6A 3OT9A 4OX9J 1R8CA 4RW9A 4IRCA 5ETSA 1RWKB 2PC6A 2KJWA 1UPMB 2EKNA 3HSJA 4ZCKA 2B6AB 2ZH3A 4LVOP 3CCTA 3D6HB 2QYCA 2HZCA 2J0SD 2DR7A 1CULB 2FHJA 4DPTA 1N0UA 2IBKA 2CG4A 4Q0BA 1ICEB 2PO4A 1YZ7A 4DFKA 1UMJA 3AB4B 2MY8A 2P9EA 3NL0A 3SV3A 1R8PA 4B17A 2D3UA 2XGPA 1VQ8S 2E5LJ 1UJ6A 4N77A 3HFZB 3MAAA 3NS7B 3PRVA 3Q89A 2HMIB 1A7GE 1GXLA 4LF1A 2RH3A 3I0SA 1RT5B 1VYAA 4WU2A 4BWJA 3MR5A 4PR6A 4NXMF 2J8SA 4PG5A 3UCGA 4FYDA 3M2RA 2VQEJ 3FEXB 2WW4A 2XZTB 1S0MA 3SCIE 3PCOB 5C2GA 1RABB 2VODA 2Z0GA 1UEKA 4LF5F 3WBZA 3EZ5A 3H20A 2CJ9A 3VAGA 1RBOB 4N76A 2WVEA 1FDDA 1U25A 4CT8A 2ZOFA 6FD1A 2CPYA 3LP1B 3MM7B 3D28A 3I82A 3ZXWA 4OI1A 5HMWA 5D0EA 4UQGA 3CSKA 2DR9A 4NXMJ 4NLOA 1GTEA 3BV8A 5K20B 3PYEA 1RQ0A 1Q8BA 3I56S 1TVRA 1BWVA 3HHDA 3MM6B 2B0GA 5A2QU 1A9NB 4KHPF 3R5DA 4AE5A 3PO5A 2OJ3A 3AXMA 1JLAA 3OXFA 2VPWB 4C3KA 3MM5A 5F8NA 3ILJA 2HURA 1RWPB 4LF5J 4M94A 5F8LA 2F9DA 2D74B 3B6BA 1F9HA 3N9UC 2QFJA 2OMLA 1H3DA 1Q86T 4GVBA 4X4VA 3MPYA 4KYZA 2FJAB 2MJUA 2HVDA 3DYAA 2HIYA 1VQKS 2CNNB 1U2FA 1N5SA 2DEJA 2HIQA 1IR0A 1XMOF 2BJ9A 4L74A 1S10A 2R8JA 2L3MA 1RUSA 7FDRA 4QYRA 4CO5A 1HNWF 4KHPJ 3V4MA 2PN6A 4DQQA 5HP1B 4UTGA 5IWAF 2KTQA 3OHAA 3ISND 2QMWA 2CA9A 1B99A 1NNDA 2H9ZA 1FKPA 4DR4F 5L1KA 1MWZA 2XB2D 4ELUA 2BE2A 3ICLA 2OKQA 3OLAA 2O3DA 4DMZA 4Q5VA 3UDVA 3W5YA 1QUPA 3ULHA 1ZTWA 1R8HA 3VGTA 3KHHA 3D6FB 3A4TA 1HMVB 1Y00A 3CD7A 1M1HA 1RCXB 1HNWJ 1Q4RA 3K89A 4KE5A 3QRPA 3MM8A 4C0OC 5EGYA 3PFEA 1SJQA 3DU6A 4K4UA 2NLWA 2B9WA 3NXZA 5HI7A 3M8PB 1KDNA 5DG9A 3DRXA 2ZEJA 2ZJRQ 5A6PA 1WC6A 3IGVA 1I1GA 3DDNA 2NYIA 4DR4J 3PEJA 1T9YA 3QWPA 2DO0A 2RNEA 4CLZA 1WORA 3TVYA 4H54A 4Z2XA 3C6TA 3IS9A 2JEJA 2VDIA 1R0BG 1D9AA 2V8PA 2N3LA 1UVLA 1XEZA 1FEEA 3DRRB 2UXBF 1U02A 5B09A 5BYRA 4UY8T 4P10A 3V4IB 2XQCA 2HRYA 3Q2SC 3I87A 4J9LA 3B78A 3EPGA 4LRBA 2ZM6J 1DFDA 2XNQA 3RZAA 3VAIA 3PZPA 1DTTA 2J76E 3OTBA 3CJSA 3ET6B 1KEKA 2HKEA 3T5JA 4LVNP 4ZN3A 2L08A 4IFYB 1FNOA 2HG4A 3P49B 3IG1A 3D1HA 2H4WB 4QBUA 3DOLA 1TL3A 2P6TA 1S0VA 4QWDA 4EBCA 3CDBA 4PXCA 2V5HG 5ETNA 2AWZA 3DOKA 2VIHA 1X4AA 1EKSA 4JI4F 5IV3A 2B9YA 5EHHA 2QIFA 5U47A 3WHIA 2XS5A 3F56A 1VRUB 1EX8A 1RTJA 4QU7A 3NS5A 2HHWA 3DN9A 5D3GA 2MKKA 5HK4A 1ZBTA 3S7RA 2BJ1A 5I3QA 1ITPA 3MI7X 4DFPA 3W1YC 4EEYA 1TELA 2CXEA 4HHUA 1NDPA 2FD2A 3NKYA 5I3UA 3D0IE 1VQOS 1U1LA 5H9FJ 5KFBA 2ZBQA 3FCVA 2HZAA 4H4OB 4TY8B 2HQGA 4C97A 2ZOMA 4JI4J 2Q1LA 2DO4A 3IRXA 2OD4A 5LJ3Y 3G82A 2DNQA 2CKWA 3KUGA 5LMUF 5IT9Y 1GNKA 1L3VA 3MUVP 3JYTB 2D41A 4KBIA 1P6TA 3HMJG 4J9QA 5K8MA 2JH3A 2WZ1A 4DL2A 2RQKA 2VBYA 3PTWA 4I6WA 2CQPA 2VA3A 5CYQB 1WHVA 3RBDA 1ZM4A 3R7NB 1REVA 1X0PA 3UVJB 2MYFA 1RGVA 2UVUA 1Q7LB 3QIPA 3TAPA 3TANA 2CQ3A 4HR2A 2NXJA 2V94A 5F0WA 3WC2A 1JLEA 2GAGC 1Y0HA 2PI5A 5KFDA 1J5OB 4U67Q 1N52B 2HEKA 2XCPA 2VBXA 8ATCB 1JQGA 5CD4A 1S12A 4LF4F 4M8LA 1AZSA 1WACA 3R8YA 1VDHA 4DOZA 1T03B 3K5MA 4DF4A 1HR0F 1S0OA 4UW2A 1DJ0A 2CQDA 3HX9A 3GILA 1V3RA 1NSKL 5F8IA 1E6YB 3G87A 2GX8A 1IR2A 3KLIA 2BDPA 2EG1A 1NEEA 1PJ5A 3FRYA 4DDFA 2LFVA 1HNVA 3P4UB 2VKZG 1JLGB 3VVUA 4ID8A 3HJVA 4QCLA 2UU9J 2GIRA 1CC7A 4LIRA 1XMBA 4BCAA 2KG0A 4MFBA 3HXMA 3J7A1 4FNHA 4KC5A 4ES2A 3DKDA 4LF4J 3PM9A 1KBRA 2GV1A 3O5TB 1Q8KA 1SUQA 5GADU 4A8QA 4IFVB 3N0VA 3CJRA 4JV2A 2QSFA 3ZZZA 4L76A 1RACB 3EVMA 3T19A 1B7YB 3RW6A 3FFIB 1CJTB 1MWYA 1V3SA 2C2RA 4RKUC 2CJKA 1KD1T 3W2VB 1NBEB 2VFVA 4F26A 4USTA 3D9BA 4HEA9 4QIFA 4ZN1A 3OLBA 4PUOA 1C0UB 1GX6A 1VQ6S 4I69A 3QO9A 1N34J 3KLFB 2HNYB 4UF4A 5E5NA 2GQCA 2CVIA 2W2OP 1IJEB 1QY7A 5RUBA 2FVPA 3JSBA 1IKVB 3BKTA 5K9FA 2OFHX 2J7UA 4JB8B 2LXIA 3CJTA 2X3DA 4LF9J 3G8QA 1X7VA 6AT1B 4QPTA 1HHTP 1BD6A 5KG5A 3AT1B 1VOMA 4DN0A 1N5YB 5D8HB 1SCJB 2HNZA 1F6TA 4DV4F 5E3RA 4TLRA 3PR5B 3TA1A 5AJ3J 2F5GA 4O4GB 2ZZMA 2HHXA 3CWJA 2X1AA 2V8DA 2EPIA 3MEGA 2JWNA 5KG6A 3J7YI 1HBMA 1EQMA 2M5YA 4DV3F 2XWYA 1O5JA 1WHWA 4USKA 4WF9Q 3H25A 2EC0A 2Z57B 4DL6A 2EKYA 2W4DA 2JEGA 3BBBA 4NYPA 4IOAQ 1K9MT 1Q95G 2V4JA 1NKCA 4AQYF 3C15B 1BQXA 3H98A 4DV4J 5DM6Q 3KHGA 2WONA 1I5OB 3MTJA 3DDKA 1BC6A 1U1OA 1PGZA 4ZP7A 2ZH2A 4ZVHA 4ZHRA 2IC3B 2C3PA 4Q45A 2H1YA 1D9FA 3MF5A 2OPSB 3A3PB 2DNNA 2GS8A 5KT5A 3KLVA 3OSPA 5EWEA 3GPAA 2HHSA 3OL7A 4NWBA 3M6UA 4RNOA 3CCLS 2VG6B 3KKFA 3OHBA 3P5BP 2AP6A 1FWPA 1TKXA 2JFDA 1GMWA 3KJNB 2RUGA 2ABYA 2LQ9A 4MH8A 2HHHF 4A8SA 1RWNB 2ATCB 1FJEB 2YNGA 1JMTA 4ZVOB 2YX7A 2ZD1B 1AXQA 2VB6A 1RWWB 5CYMA 4DL4A 4I7FA 4ALZA 3MGJA 4ELVA 3BBCA 3DM2A 5C2CA 2GJ2A 3SYZA 2KZZA 2K7JA 2KT2A 4LR9A 3Q8VA 1FERA 2YKOA 3MMCA 4ECZA 5T7LA 5J2QA 7AT1B 2GMLA 2YNHA 4BC9A 3SFUA 3GZ7A 4JI8J 3IN5A 1RAIB 1RHMB 2XHWA 1TFYA 1LWEA 4MAKA 3EE3A 1BUXA 3NGKA 1SJFA 4ZMMA 4KH1B 3QAEA 3Q8YA 1CPZA 4DL7A 3QJPA 1T9XA 4FPRA 2IM3A 1TZ0A 3W9IA 4R5PA 2RF2B 3G71S 1LK5A 2AKWB 3TNVA 2HGLA 1F2HA 2CQIA 1R31A 4U7CA 2QL7B 1N88A 3QSYB 1DZ5A 1IJFB 5I4MA 1XBWA 2OTJS 1GAOA 4QU6A 3HSGA 2MKJA 4L72B 4DI6A 2EFGA 3K0JA 3PVXA 1NK6A 1ZPVA 2DIVA 2ZH6A 1RB0A 2BOPA 3KLGB 2DVIA 5DRKA 2ADBA 4Y28C 2MPUA 3MWBA 2VFTA 3UFCX 1SC6A 3TZYA 2WBRA 4C0HA 2H51B 4IG0B 2ZHOA 5ETQA 3OJSA 2V2ZA 2KYZA 3CDAA 3A8JA 3DLKB 2DRAA 5C25A 5BXIA 1D1UA 1QE1B 3QIDA 2VJVA 4YDXA 1SBRA 3NWRA 3V81B 4NLWA 1I3OB 1HI0P 2CQ1A 2KI2A 1HI8A 4A8OA 2A0FB 1WC3A 3FKBA 3C6TB 2I6WA 4DS4A 1K44A 4O0IA 2YKNA 2Z2YB 3E01A 4ZPCA 2KU7A 1Q16B 1T0TV 4N47A 2KXHA 2C22A 1MU2A 1U0HB 1X4DA 3H5XA 1U6BA 1PILA 4DLEA 1U1NA 3DRPB 4ED2A 4C8NA 2BQ3A 4DPOA 2K7KA 3A8KA 3HULA 2XMKA 2R9LA 2XZDB 4CIOA 4EMDA 3RB3A 5ADZA 2WVBA 5G4DA 1WOOA 4GO7X 5J1EB 3BM7A 3G4SS 1DY3A 4PWUA 3H5SA 3CDEA 2Q6BA 2HQCA 5FDLA 4CTAB 2KL8A 3HVAA 3BS9A 1PJ7A 1Y4ZB 4MK8A 5E3QA 3OW2R 2DEIA 3ETOA 3U27A 1ZA1B 3SI8A 1TUVA 2E5GA 2W9BB 1HLWA 3SQOP 2BKOA 4RUCA 1BY9A 3M8QA 1GTHA 4P71A 2DRDA 1Q82T 1MW7A 2YNIB 3EWGA 2EW9A 3BO2A 2RD5C 1H2VZ 4NYOA 4M5HA 2GZOA 4DV5F 4KHRA 2DBBA 2GGPB 2XMWA 2E7WA 3SDEA 4DV7J 1QJHA 4U96A 2LQBA 3IXQA 2F7VA 5E41A 4Q7AA 4ZP8A 1AT1B 1FXRA 4RW7B 3CD6S 3I4PA 2MKIA 4ZPBA 4YDDB 2G2ZA 3QAUA 4B9MA 1PC5A 3ZTOA 4LF8J 1UW9A 2Y0BB 4ZDNA 3TJ9A 3LP2B 1U26A 2DGWA 2FLOA 3MTKA 1JLBB 4UQTA 2C3YA 3M2VB 2CRLA 3J81Y 4DV5J 3CJKA 1T02A 1IBLJ 1X5PA 5D78A 5GAEI 3KK2B 1RSCA 1MN7A 1Y5NB 4ECTA 2XTJP 1ROFA 1FRKA 2B5JA 4I2QB 3RB0A 4OHVA 4QR2A 2DPJA 3UN5A 4B3TF 3PJ9A 1GMUA 4KFBB 3KLHA 4DL0C 4NMLA 3VAMA 2QEXS 2CPEA 1S9FA 1S6OA 3PRDA 2W7PA 2FZGB 1U45A 5KG0A 2AX1A 1KHWA 3NMRA 4DR2F 2PD1A 1NPPA 2DHGA 3FMWA 3M6VA 2BZ2A 2DCLA 4C9DA 4B3SF 1WSVA 3IWNC 5D0RA 4P6QA 3BQ0A 2QLBB 3E8OA 4CYUB 4N8NA 1QLNA 1GT8A 3NCQA 4G1PA 4NOHA 4M5DB 2I0XA 4LFCF 4LREA 3OL8A 5A8WA 1U09A 1WEXA 2XULA 3Q8RB 3BKFA 2VUGA 4JV0A 2GQQA 3PYFA 3CT9A 5K14B 3OTCA 1T3NA 4UOGA 3N79A 2YNFB 1PO6A 3SCLE 2R4FA 5C24B 1SKRA 5CZVA 4P2XA 4E98A 1UVKA 2CQ0A 2HNDB 2B4VA 4RW6A 1H2UX 2ZZNA 2CZ4A 4DX8H 3DMJB 4DV1J 2IJFA 4Q43A 2AIRB 2J9CA 3OUYB 2DNKA 2LQ8A 5A8KA 1VGYA 3VALA 3GIIA 2E1PA 1NSAA 1TKZB 3R7SB 3PDNA 3T41A 2FLLA 1FJGJ 2B7BB 4KV8A 1G2EA 4I1TA 1G6BA 3QMQA 3SBMA 2AW0A 3HD1A 3PIPQ 4X66F 2DHHA 3K17A 3TEHB 2RDJA 3RBXA 4NI2B 1H72C 1S1WA 3CMES 1UJ4A 3AOCA 4DL3A 4I56A 4M5IA 4PQUB 3QGIA 4TYAA 2YWHA 4G1QA 3M8ZA 2MLXA 4DQSA 2DD8S 5KG7A 3BH7B 1IKXA 2JX2A 2VFSA 3FZBA 3HM9A 1MN9A 4A8MP 5B0CA 4FN5A 3LWMA 1JLCA 3EXYA 1Y9OA 1X5SA 1HYSB 2MGZA 1F9EB 5A6WA 3OVBA 3PJXA 2XCAA 1OWXA 4X66J 3GONA 1LWFA 3TQ1A 4A8FA 5IT0A 1NSPA 2B9EA 2IIHA 2IMOA 3X3UA 1JLFB 3S1TA 4X4OA 1RT7B 3G9CA 4OI6A 2WONB 2XMMA 3DU5A 3MCNA 1YLXA 1KN6A 2BABA 1HBUA 4CLTA 5JJBA 1RDRA 1F60B 3AA9A 1SC4B 3J7YU 1Z2LA 4JI5F 1FA0A 2XWXA 3NWGA 4M63A 1RT1B 3QQCD 4MKYA 1RYRA 3O2IA 5HROA 4WXOA 3RRHA 1NH7A 4DR7J 3SMZA 1HI1A 3PYDA 3G6YA 2A2DA 3ZO7A 1N32F 1S4EA 1FF2A 3FEZA 3C16B 3UDEA 2VA2A 2VC0A 1F3FA 4QZVB 1UTAA 2C3OA 4YMEA 5LJ5Y 4ZVSB 1NZAA 2JZ5A 3FQLA 5J2MA 3HPOA 5CCLA 1GMVA 3OR2A 4I7FB 3T5LA 3MM9A 3CDUA 2F8HA 4USIA 1NH8A 2DT9A 2ZBPA 4H4MB 4LF6F 3CO9A 5D4PA 3MUTP 3D6MB 5LSRA 2JHEA 1VK3A 5F41A 3M32A 3Q24A 4QIVA 4RNFA 1X9SA 2OPRB 3EUNA 5E33A 3MZIA 3MAHA 5C42A 1T3OA 1TKTB 3TA2A 3CCES 4V1Ak 3DI6A 5B0EA 3BB5A 1N32J 1DRZA 1SL2A 3US5A 1LWEB 2PT0A 5HLFA 3MD1A 3W3SA 1R0CB 3A8IA 3N28A 5B0AA 3NAIA 4O3RA 2RT3A 3T6JA 1JLQA 3VCDA 5AXMA 2QO3A 4NLUA 4QWEA 1JJHA 2BBEA 1IWAA 2R7RA 4KGMA 2H5IB 4NLGA 2R2RA 1X9WA 5JXSA 4HH0A 4DHVA 4RW8A 1DAXA 3G6VA 2OD6A 4LF6J 3H8YA 3AD7C 2XSJA 5CA5A 2VV5A 4IRKA 1T9UA 3W2WB 1IM6A 1NXIA 2M52A 2JVRA 1K8AT 4JUZA 1N4LA 1O0PA 1NAQA 1QUVA 3U1NA 4UUWA 5LL6d 3VTIA 5FLXU 1YIJS 4DSLA 2FY1A 1IKWB 4MT1A 2YH1A 1QVGR 5B0GA 4NCGA 1E6VA 3HDSA 4DX5A 2XYGB 2Q66A 1KP6A 3PEHA 3ZNUA 5KT2A 3GYNA 3GTYX 2LQ5A 5AXLA 3L7UA 4F4KA 3I4HX 1LW2A 4AT1B 7FD1A 2NQPA 3FSIA 4ZCIA 3DLLQ 1KVKA 1RI7A 1S59A 3MECB 4IO1A 4PWDB 4JV5F 2AT1B 1VQMS 2HAFA 2F3JA 2R42A 5IQ6A 1I94F 1HPZA 2CPIA 4ES3A 1DTQB 3GU0A 4P73A 3ILLA 4AL6A 4JOUA 2A2CA 1DLOA 2MQOA 1YG0A 4QYZK 4RW4A 2PMHA 4NLSA 2ASYA 2LQJA 5KFTA 3NBPA 4S0MA 5IM0A 2RSQA 3LA0A 4DZDA 4OI3A 1IKYB 2HBYB 4LJMA 3EGZA 5I42B 2LKZA 4RX6A 3H40A 3D1OA 2VJUA 1J5EF 4TLQA 5L46A 3ONQA 4C11B 4F2RA 1P1TA 3N5BA 3CCQS 1Z1ZA 3TAMB 4P75A 3RAXA 4C8KA 1SL0A 1KQKA 2A6OA 1VK8A 4IOBA 2QFIA 4JV5J 5FDLB 1I94J 1HWLA 2MY7A 4FKXA 5KFCA 2MXYA 2C2DA 3T5HA 4WZQA 3SXLA 1VRTB 4J9PA 3IRWP 1F5AA 2D3OR 5EX0A 1YKWA 2BV3A 1N6QA 3BR8A 3PJWA 3WDOA 4DSIA 1VHIA 3NP5A 1RK8A 2OH2A 4USVA 4TU9A 1X4HA 3QLHA 4ZK7M 2X3GA 4ES1A 1D8ZA 5ETVA 3L95X 4F50A 4W98A 3HHLA 5KFWA 3DNCA 3QRQA 4DPWA 2WB4A 1P27B 3MPWA 3KXDA 1RBAA 2KFZA 4OZ5A 3DXSX 2HWTA 2EK6A 1Y3JA 4LRAA 3C6UB 2RKIB 2VICA 4XDDA 1KFDA 2EFOA 4U7UK 2MQPA 5KFIA 1VCTA 1PBUA 1NJZA 1R3NA 2KH9A 2MB0B 2DNMA 3QRRA 1SV5A 4EGLA 2MZTA 2CQCA 3I9ZA 3J80U 3BO4A 5GMKa 4CI0B 1R0AB 4F3OA 1C1BA 2K3IA 3I5CA 2YQ3A 4ECUA 3MMJA 3U02A 4K4XA 3FBEA 3KLEA 1NHVA 3TW0A 2FJVA 4F67A 2LEBA 1B70B 5MAOA 2UUBF 2ZHAA 3PG9A 1NHUA 1URNA 4QW8A 1VJQA 2MQ8A 3OR1A 5J1PA 3HVRA 3KNAA 4Y00A 3DRSA 5J2NA 1V5VA 3MMAA 3AH6A 4I6YA 5DJBA 1R8BA 1G3OA 2GCFA 4WFYA 1XJWB 4HI2A 1UA0A 3Q22A 2MEWA 2WHOA 2ROEA 1HQEA 1HW9A 4IG3A 4CLFA 5GAEU 4IOCQ 3T3FA 4KRWA 1RTDA 1RHRB 1X4GA 2G2OA 4A8KA 5KFJA 2UUBJ 1QVFR 5GMEA 2G0IA 3HO1A 4C3LA 3V6DB 5B0BA 2ROGA 1RHQB 2H4YB 4EYIB 2UXCF 5A2QY 3KJFB 3AHPA 2JEFA 2AJFE 2YKAA 3PYGA 1U2CA 3PW7A 1N54B 3GSIA 2R2TA 5M2RA 1BWEA 4GC7A 2CZVC 2IVFB 5F3ZA 1KWMA 2XSFA 1VHFA 2IRUA 3D68A 4NXNF 1QSSA 2E7VA 1BXNA 1OSCA 3MMBB 4I6AA 3BGRA 1S6UA 1CJKB 2DGXA 1PBAA 4QR0A 3ENWA 2UXCJ 4ZVFA 3ZTPA 4KGZB 4KO0A 2KG1A 2VDHA 1T95A 3FC9A 1SQGA 2HHTA 3R3TA 3IR7B 2GHVC 2BQUA 2BKPA 4FDFA 3HKWA 5BYSA 2AJ0A 3ENVA 3IMQJ 4DSJA 4ZCMA 4CLYA 4ZVEA 2E7XA 3JSMA 2UVWA 3AXKA 1YBTA 2ACMA 3U1LA 4FVMA 4NL5A 3KK1A 2ZHBA 4J9NA 3DXBA 1KR4A 2OSQA 2QLWA 3EDRB 4KGKA 1FK9A 5E3PA 1OPIA 2KVQE 5KFAA 4L3NA 1U1RA 1BQNA 1A6LA 5A76A 2M9KA 3TQEA 4WBFA 4K0KJ 2R7TA 1VBZA 3R5JB 5KAKA 2HYIB 2POKA 2GO8A 5A0YB 2JLEA 4RO0A 5K8OA 5DDOC 1T05B 1YWXA 2N82B 2KZMA 1F2GA 1JKHB 2G1HA 3QNWB 1F5BA 3L7OA 2A1BA 2FJDB 1HBUB 3SSRA 2C42A 1YJWS 3W62A 4K5RA 5DLFA 4RUBA 3HVTA 4DV6F 3OXLA 2IY5B 2IMWP 3QGGA 2CADA 1TV6B 2BX6A 4RBVA 3K5PA 4WPAA 2YKMA 2AYGA 2IDLA 2HS3A 3K58A 3KJVA 4ED5A 1WC5A 3UD5A 4JV1A 4MKBA 1S57A 4RPFA 2J9DA 4WYWA 1RT4B 4OI2A 2KXFA 3QJJA 1IN0A 1ZA2B 2NYHA 3JAMY 3NGUA 3R2DJ 4CNZA 3CC7S 4C8YA 1S1TB 1CG2A 4DQRA 4ANDA 3N01A 3VQTA 1YVFA 2F4VF 3RAMA 3N6MA 5EWFA 4CLWA 2CPDA 3PIOQ 3VAJA 1FI4A 2HHPA 4I64A 2NCKL 2DYAA 1CJVB 4WP3A 3ETMA 2X7IA 3OFHA 1YJ9S 2CQHA 4IKAA 3DLEB 3GLJA 2DITA 2JVOA 1P8GA 1LW0B 1NJYA 3M30B 1S97A 2RAQA 2DXDA 2RU9A 3VV2B 1OS5A 2ZKUA 4X4TA 1HBOB 1ZS6A 4PAAA 1S1VB 5AXKA 4ILLA 4B3OA 4L75A 3FDSA 1LWCA 4JYAF 4CP5A 2VQFF 4NLVA 3HK2A 4NX9A 1HHSA 2W9CB 4TVAB 4KHMA 4KJIA 2J6SA 2GVZB 3EZOA 1N36J 1RA6A 4ICLB 1LQ9A 1N5QA 2B51A 4OZNA 1SQFA 4O44B 5HO4A 4HACA 1C4AA 3Q83A 3PNIA 2IM2A 2DHSA 2JOQA 3G8TA 1ZAWA 1TL1B 4MYUA 2MQLA 1VQLS 2YWFA 4FBTA 1C1CA 3T1YF 5BYQA 3FCWA 4K4ZA 2MZ1A 4ZP9A 4JYAJ 3CJ3A 1AUDA 2CDRB 2ZBRA 2YY3A 5FIIA 4G65A 4RNMA 2Z4PA 2FQQB 5H9EK 4DQPA 3DCAA 3M8YA 3T9ZA 8AT1B 2QA4S 1FKOA 1PAEX 1VS3A 3EZUA 2UUCJ 3F41A 4HL9A 3GIMA 2VOOA 4W90B 3CJ2A 1HD0A 5HATA 2MTLA 2GMHA 4PQAA 3CJ5A 1KLMA 2VG7B 4YFUA 1WC4A 1WI6A 4K7QA 5J2PB 1FFSB 1U1MA 5IM0B 4ED1A 4DG1B 2E9ZA 1S1UB 2FLNA 2VFRA 1C0TB 4A8WA 4P2FA 2FLPA 4B9SA 2WAQD 1XWLA 2G1DA 4EZ6A 2OMOA 4RZRA 4R8UB 3MOZA 2ZH9A 2BMBA 2KYXA 4F4AA 1MROB 1ULRA 3LOUA 3HZGA 3ZZTA 2RDIA 1SH3A 3JQMA 3ELHA 1W2IA 3IO1A 2ZWPA 4URSA 3IM8A 3NLCA 3CF5Q 3UPFA 4GKKJ 3QT8A 1VC5A 2V9KA 4DV2J 1IM4A 2L9NA 3M8RA 1UAWA 4JI6F 3UN2A 2DH8A 5CD4H 2AJ1A 2G2YA 3ITHB 4J9VA 3DLGB 3CPWR 1FCAA 1NLKL 3FRZA 4EU0A 1HQUA 1RZMA 4LSNA 4OJGA 4C8ZA 4FYXB 2E44A 1RTIB 2UV8G 4WK3A 4QYZJ 3N4WA 3MEDA 4A8XA 2KT5A 5DQHA 1FRMA 4Q2MA 4ECWA 3ZTQA 3NNCA 2HAIA 4CH1A 4U7UD 4JI6J 2EEYA 2OPPB 1YI2S 5AT1B 2J0QD 2W24A 1R6VA 2BKNA 1NRKA 1TR0A 1YTYA 1PC4A 4PG7A 2BOAA 2KN4A 1XIQA 2EXUA 1X5TA 1X0FA 1RKJA 1H7XA 5HN0A 4ED4A 3W5XA 3RB6A 1IBCB 4Q44A 4FNIA 3QFWA 1O6XA 1URRA 2HK3A 2CJYB 2B4OA 3RJMB 4JI2F 2J0WA 4LFBF 3DGPB 3CC4S 3D1QA 2HS4A 1SQEA 5EWGA 3G86A 4Y2MA 2ZVIA 3JTPA 1UEUA 1QD1A 1HNXF 4PEOA 2DXFA 3KJQB 1LOUA 2LYVA 5DETA 3V6KA 2V68A 5D4NA 2ZC3A 3LANA 5CZXA 2HRTA 1A0OB 1YSJA 2BACA 2CNKB 1WF2A 1WF1A 2PMWA 2CPZA 3BSCA 4O4RA 2HBZB 2HLUA 4WU3A 4WKYA 5LXRA 4QIEA 4I2PB 2EBGA 2WK4A 4OFZA 1VBKA 1XNQJ 3CCVS 2ZJPQ 2D3O1 2VH7A 5DZ7A 5G0RA 2AJ2A 3PXGa 3F0NA 5J1NA 3W63A 1HNXJ 1HD1A 3D67A 4HT5A 4USHA 1H7WA 2KO1A 3B82A 2B8PA 1IBKF 1IQTA 3GG1A 3M2UB 3TA0A 4DR6F 3UE2A 4EBEA 2ZNYA 3OV7A 2SXLA 4ZPWR 2AHOB 2CWXA 1P9QC 2RRBA 1RHJB 1VQSA 1HQ2A 2JEIA 2EVZA 1U8SA 2QN6B 4YP3A 4ANEA 3B4DA 3IP0A 2H65B 3EJMA 3D6TB 2ROPA 4F0KA 3CCRS 5L38A 4V19X 2LU2A 5L39A 4DUYF 2V8VA 1SL1A 4YEAA 1GMWD 3EYZA 1EETB 2J9EA 3D7SB 4P72A 3H4DA 2AMCB 1UL3A 3BN7A 4AXIA 4C7QA 2A18A 5KFMA 4DR6J 3BJYA 5HBMB 2NPIA 2VZ9A 4EZ9A 3C14B 3DOMB 2XG8A 1SKWA 2KJVA 1RT6A 3PV8A 1LFWA 1QAJA 3FCHA 2AZ1A 1WOPA 2CJAA 1OQ3A 4DUYJ 2VG5A 2W8LA 1TKDA 4J9SA 4C98A 3ISNC 1X4CA 1HW8A 3GYGA 9ATCB 1IBMF 3AAWB 1OMSA 4OYPA 1HBNA 5IT4A 4ID5B 3RW7A 5SZTA 1UA1A 2ZE2A 1YK9A 4YHHF 3DLHA 4FBUA 5CYJA 2K1RA 2COLA 1Q0NA 2R2UA 2OI2A 3KK3B 2C2NA 4Y2CA 2GA7A 4TU7A 3CC2S 1IVZA 3POTB 3MOJB 4WJBA 4DPYA 3ZTRA 3LGNA 3MEEB 1EP4A 3E51A 4F0MA 1CJUA 1TQLA 2YTCA 1RT2A 4GRSA 5FD1A 2L41A 3K5NA 1IBMJ 1TK5A 2U1AA 4ZVPB 2RIJA 2NXCA 1S1XB 4A47A 4AL7A 1FNMA 1HKAA 1FT8A 2B8QA 5DG7A 1WF0A 1KONA 2OPQB 4CRJA 2IAJA 3I32A 4CO2A 1RWXB 3SQGA 2I5JA 2YXLA 2BW7A 2W8KA 1FVSA 4F3QA 5LSLA 4NA1A 1UWBB 5AE2A 1H98A 1LEOA 1UWAA 2AYBA 2HGNA 4DV0F 3AOBA 2CWKA 4RBUA 1XMOJ 2OEJA 3BREA 1CQNA 1U1PA 2M8DB 3FK4A 2L9DA 5IXUA 4L3KA 4PPZA 1S9EA 1KS2A 2FZKB 5KFQA 4OYAA 2DRBA 4LRCA 3HFKA 3ZZ0A 1H0HB 5IWAJ 1Q5YA 3MHYA 1WC1A 4CH7A 1S5ZA 4OLPA 2DGSA 3ZZUA 2BANA 4WE1A 3MR2A 3KUHA 3KMQA 3BBFA 3I9V9 4PCQA 1EIYB 5ETLA 1NJXA 2O01C 2UZAA 4DV0J 4M5JA 2K3KA 2HVIA 4TKTA 3D3BJ 2Q6CA 4ZVQB 2C2KB 4NRUA 4ER8A 3N6NA 1NK9A 2IHR1 1S9GB 2B43A 4NCAA 3MPVA 5A8RB 1HNIB 1VQ7S 3V5RA 1B3TA 1RT3B 3AJDA 2YWEA 1AFJA 2M88A 3T1AA 3R27A 1EAYC 3UI3A 1VQ9S 3I96A 1RTHB 4HH1A 1ZAVA 4RJVA 1RWMB 2P9GA 5LSOA 3LAMA 1NB2A 1MG7A 2R8HA 2IYIA 3KDOA 2B6AA 2GMJA 3NY0A 1BQMB 2V0NA 4YR0A 2IM0A 1L3TA 3TVZA 5L1LA 1SJ1A 1CULA 1HFEL 1H38A 3GV8B 4CT9A 5DQIA 2UXBJ 4C2MA 1TMMA 4WXWA 1NCLA 1M90T 3JAMU 2WOMB 4FF1A 1JJCB 3IGNA 2BQRA 4K59A 1I6JA 4ZLJA 2ACYA 2QLJB 2XO6A 1TTHB 2HMIA 3D4JA 2V8HA 5CAAA 5EUHA 1RT5A 5K8NA 1D0EA 3Q0AA 4ZPTR 3BN4A 1YJNS 1LWXA 5KFYA 3AY0A 4LSLB 3ZTSA 4OV6A 4AUKA 1NJWA 2GW8A 3PW4A 3LUYA 2M3DA 1ZM9A 3GG0A 2YWWA 4OZ1A 1SPBP 2G13A 4NLTA 2Z2MA 2OIHA 2JJ4D 2NREA 4YR2A 1TUGB 1JNZB 4QWBA 2GVDA 4M5MA 3UDCA 3QWUA 1ZPWX 4LBHA 4DCOB 1MMNA 3LP1A 3MM7A 2BJ8A 3CVKA 3D54A 4U8VA 3K57A 3X1LB 3TX0A 2JC1A 3H42A 2CZ9A 2IPOB 1SKUB 2GHWA 2ERRA 4F4XA 2XY7A 3MM6A 2BVZA 1WSRA 2DB1A 3W9HA 3QATA 3I6PA 1S72S 3NOCA 4ZVUB 2B9XA 3M1VB 3RGIA 5LMUJ 2HS0A 4EI2A 4IDKB 4OYZA 4R0EA 2IRXA 3QYYA 1FXDA 5D0HA 4KKOB 4J7CA 2V67A 5ETOA 4J9RA 4FXWA 4DU7A 1APSA 3JQJA 3H5UA 1H6KX 3P8BB 3AA8A 4IQMA 1FE4A 5HJYA 1CBKA 4DPXA 5HP1A 2LU1A 4UUXA 3D5MA 2H54B 2KVIA 1U1KA 3THPA 3GFZA 1RXOB 1UW4A 1FX4A 1S6PB 3LP0B 1F3VA 4OHYA 4F4ZA 2KHDA 4DF8A 5ETTA 1NK5A 3LGMA 2PEHA 2WRMA 5KFHA 1HR0J 2BRLA 2Y0SD 4M5NA 3R5CA 4NYZA 4DR1F 3OJUA 2OEKA 1WELA 3T9NA 4LRDA 4N56A 1FJCA 3I0RB 3IAS9 3D0HE 3VZHA 1HMVA 4ED7A 2L9WA 2UXDF 2HQ3A 3BH6B 4DJBA 2CUYA 4BDPA 1CS4B 2AJ4A 3G96A 2CYYA 2NXNA 4KSEB 3I31A 3OQ2A 3M8PA 1YDLA 3K5LA 3LTOA 4EO8A 2QGFB 3PX4A 2CJBA 2Q43A 2DXEA 4RW9B 2QZ8A 4BBYA 2NXEA 2H5EA 4DR1J 5H9FK 3DRRA 4CLUA 3V4IA 2O66A 2UXDJ 4USJC 3GQCA 5HJXA 3K8VA 5GAHU 4PXDA 2UUWA 2XO7A 1M1KT 1VQ4S 5GMDA 4Q0BB 1LKZA 5HVHA 1KNZA 1OIAA 1Y5IB 4NLQA 2NZCA 1KSPA 2IYGA 4OV1A 3HLUA 3DLJA 2IVYA 1XR5A 3ET6A 1FWLA 4KIAA 4AXJA 4IFYA 3MAAB 2ZZTA 4X64F 2CQGA 1PKUA 3I0SB 1Q53A 1L3UA 1NKBA 4KGVB 2VBZA 2HHQA 1K47A 2KRBA 3R7BB 1RJJA 2QMXA 3R5GA 4X4SA 3G6XA 1VRUA 3W65A 3M2RB 3H2VE 5KG2A 2JRSA 1OYDA 1QAIA 3RRKA 4NZ7A 1R27B 4BWMA 5FLXY 2XI3A 2P6SA 3TOQA 4Y6IA 4MKVA 4YB1P 3H4BA 4C8MA 2XM3A 4DV3J 1OSDA 4ZS6A 2R7UA 5FJ4A 2DCUB 2QSWA 3AFGA 1KTQA 3JS9A 1WDTA 3MPUB 4MIWA 3NS6A 5LXYA 4X64J 3TI0A 3Q2TC 2YQ1A 4X62F 4OX7A 5HMZA 1TUWA 3P6YC 2KFYA 4H4OA 3OVAA 5JUMA 3TARA 2V9WA 2I9SA 2ZVSA 4TY8A 1OJ4A 4AQYJ 1LNQA 4B9VA 2VPZB 4RUHA 2P2CB 3Q8QB 2XZWA 4CM0A 4O3QA 1TVRB 5KFGA 1JLAB 3JYTA 3MM5B 4I68A 3IBFB 4HDGA 3KYLA 4F4WA 5F8HA 4LQ9A 3JTNA 3RYLA 1OPZA 5B08A 2BA9A 4OYBA 5KG3A 5CYQA 2VD3A 3M8SA 1W25A 4ZLPA 4GVBB 3UVJA 2HZVA 2ASJA 4X62J 3UQSA 3DYAB 3BGUA 1YHQS 2ZUAA 3GWCA 2X1BA 1EB0A 1FDAA 2CPHA 3FEYB 1WKLA 3MXHP 2AYEA 2HHHJ 4ENOA 1T11A 2E1MC 1J5OA 1B64A 3L09A 3CDWA 4A48A 3FSYA 3VWSA 5HVGA 3HKZD 1EQ0A 2VU5A 5E3AA 2V69A 4RUAA 3TUPA 2AF6A 5F8JA 4OI4A 2OP5A 3QJLA 3HP6A 1T03A 5KFKA 4BC7A 2HLTA 3KOAA 2A3JA 1YBUA 1FKPB 5ETRA 2MKCA 4LQ3A 4IH5A 1E6YA 2M4MA 5KFSA 2BE2B 4NZ0A 1VC0A 5ETPA 1HNZF 5CXTA 1RAAB 3UR0A 1AFIA 1D3WA 5KFOA 2ZH5A 4K2JA 5B0FA 1JLGA 3ISZA 3GCXP 1U48A 3RRGA 4PWWA 3FJ2A 4CDIA 1S0NA 4QPXA 3WX4A 2WSEC 3PKMA 3MM8B 1FDNA 1XN9A 2N4DA 3KDNA 4IFVA 1UKUA 2Z8QA 2H3EB 1KTVA 4P52A 1RAHB 3CJQA 2VL1A 3ZNJ1 2R7WA 5KFUA 3FFIA 1CJTA 1SIWB 5DM7Q 4DEZA 2R8GA 3IS9B 2LA4A 1ELOA 1EZZB 3W2VA 1WTBA 3W7BA 1CC8A 2VC1A 3ZZOA 3H59A 4NA2A 2YH0A 2NSBA 2PMZD 3J80Y 4NLRA 3K2YA 1C0UA 1UZHA 4FP9A 3B54A 3KLFA 2HNYA 4LF2A 4WP9A 4OJHA 2C2MB 2W25A 2L48A 3EVWA 1WG4A 1FTRA 3LW5C 2QA2A 3IR5B 1IKVA 2X1FA 2Y3YA 2QG9B 4AD6A 2E5LF 5KFVA 1JNRB 2LCWA 1DTTB 2BYCA 4HTIA 2AYMA 3CUNA 3OFEA 1WKKA 2MHNA 4H4KC 2M2BA 4LF7F 2FVQA 2B56A 1N5YA 1WJ9A 3VQSA 3IG1B 3FQKA 3DOLB 1TL3B 2HVEA 3HHLD 1H74A 5F0UA 2UUAF 3DOKB 2VQEF 4O4GA 3TZZA 1SJ3P 4YR3A 2YVSA 4F04B 4J37A 1TFWA 5HAOA 4DBQA 1RTJB 4WTOB 3GIJA 5D77A 1M0SA 5D3GB 2W7OA 2ZFHA 3KUEA 2AEJA 4XDCA 2AV5A 4WK1A 2GC8A 2E1RA 2J0XA 5T41A 2DHAA 4OHWA 2DGQA 1V6HA 2FHOB 3TO8A 1FD8A 4KAIA 2F40A 4LF7J 2ATLA 1N0VC 4OX8A 4X4QA 2AGPA 3C15A 3SCJE 1AUSL 5I3UB 3PW5A 2QL9B 2QYGA 3MDFA 2UUAJ 1NB7A 1PG5B 5LM7E 2ZH7A 3NGTA 3SIPB 4YUDA 4J9KA 2IC3A 3VAFA 1U7LA 3IRXB 2B4UA 2D1CA 2OELA 2OPSA 3G82B 4C0BA 3KG0A 4HTJA 2IA0A 2Y1LB 3UD4P 1WKJA 3BGFA 3CULA 2W7AA 4RWXA 2GVDB 2AQ4A 1JJ2R 2AJQA 3EDQB 2VG6A 1GFWB 1MLAA 2NR0A 1X31C 4DU8A 1Q1KA 1VIXA 4OHZA 2MZQA 3KG1A 3W8PA 3OL9A 3VGUA 3WQPA 1REVB 2CQ4A 3QIPB 2LXUA 5SUHA 2ZD1A 1JLEB 3BDEA 2M0GB 1FRLA 2HFZA 3AQOA 1NSQA 1RWUA 1YQHA 1UFLA 2J8AA 2WSCC 3BYRA 1BLUA 2YKQA 1AZSB 3JSYA 1IUJA 5KFPA 2Z30B 2YKPA 1TMJA 1Q7YT 1NO8A 1YRUA 1QSLA 2WTFA 2MLYA 4F7VA 1RAGB 1G4CA 4XK8C 3F73A 3C19A 3KLIB 3MPDA 4IO9Q 2EFPA 2RB7A 2CJXB 1AA1B 3JXOA 1HNVB 3TX8A 3OXGA 3QT6A 4O3NA 1MWQA 1KHVA 2VPXB 1CLFA 4LIWA 3LALA 3VVTA 4DXLA 4NASA 2RF2A 5F9NA 3B8HA 4ZJOA 1YBAA 4MFBB 4B3TJ 5IFMA 2XLIA 1ZH5A 4P7VA 4ZVTB 1VBYA 1VQNS 1SUQB 4DUZF 3I55S 4DR2J 3U7JA 3SCKE 3CO0P 1WG1A 2D9OA 2IFXA 4O3OA 5K5MA 5HQLA 4B3SJ 3GJTB 4GVLA 3ZZPA 4PG6A 1GH8A 3KLGA 3CCUS 1MNEA 2EG2A 2CQ2A 4IG0A 1HARA 2Y8WA 4LFCJ 3BPSP 1WNEA 3AD8C 3DLKA 4PUOB 5CH7B 1OQ6A 3SEOA 3QO9B 1QE1A 4Y34A 2ZM6F 1FD2A 4FXDA 4TQRA 3GFHA 1M5VC 3ENAA 1LFPA 1YJ7A 4DR5F 3V81A 4DLGA 2F1FA 4DUZJ 1Y7PA 2YWGA 4X65F 1HA1A 2ZBCA 3E2EA 4UT4A 1TU0B 4OZLA 4MIBA 3R97A 2Y8YA 1U0HA 4PYDA 3VR1A 2KFNA 3DHXA 1M5OC 2HNZB 5AE1A 1OYEA 4Y2KA 3DRPA 1BHNA 1RA7A 3BPDA 2FZCB 5CHCB 1B7FA 4FYYB 3MEGB 4OJ1A 2EFVA 4DR5J 1HWKA 1KC8T 4J91A 1HBMB 3AODA 2KRRA 5J1EA 5BR8F 3EM1A 3G8SA 3V2UC 4X65J 3OTOF 5EX3A 4YQWA 3L9ZA 2HRUA 5B0DA 1IR1A 4CTAA 1KQFB 4WIQA 2BE9B 2V4JB 1JXEA 4Y65A 3NOGA 5KFEA 1HHQA 1UVMA 3CIMA 3EPIA 2NS1B 3WC0A 2PDAA 3UW1A 2V34A 4WIIA 4ZHRB 3PW2A 1Q8IA 2W9BA 3E3XA 4DCPB 5HMYA 4CH0S 4FXVA 3GV7B 4B9NA 2Q3PA 2B4PA 5BR8J 2MJNA 1D8YA 2YNIA 1KOOA 3GYXB 3OTOJ 2HPUA 2FHKA 5JVGQ 1RLDA 1U1QA 2GGPA 1TKXB 1UJ5A 2DJWA 1SB6A 4F3MA 5HMXA 1X8DA 1LV5A 4I4BA 1XERA 2W9AA 4EYHB 4TXSA 2ZUGA 4C8OA 1AW0A 2QLFB 4RW7A 4IH7A 4C48A 1U49A 2YNGB 3L4BC 2IRYA 2XMUA 5D15A 1VLYA 3LO3A 4ERDA 4OYOA 3RBZA 3C8YA 3HZEA 5CYMB 2YPYA 3TVKA 4JI5J 2DGVA 4ETZA 4ELTA 5KT7A 5LOQA 1PYSB 1K73T 3LP2A 2DGTA 4PXEA 5KOXA 3DM2B 1S4FA 4NE9C 1IQZA 1JLBA 1V9OA 3M2VA 4Z7YA 1NK0A 3MMCB 5T7LB 4M5KA 5J2QB 3TJ8A 5DO2A 4CO3A 3CXCR 1UP1A 2YNHB 2FVSA 3UO0A 3KWMA 3KK2A 4KR0B 2B3TB 1S7HA 2EFNA 4ATNA 4UZBA 3MD3A 3I5AA 4I2QA 1QM9A 2UU9F 4FF3A 4OMFG 1FFGB 4B08A 1T8EA 4KFBA 3UNYA 2O67A 2AGOA 4WZMA 3CTRA 2MKYA 4R5PB 2FB0A 3R6LB 1GXUA 3CE8A 3TUIC 4ZP6A 1S99A 2APOA 2XMAA 2AX0A 2VFUA 1M5PC 3M9NB 1V5IB 1VQPS 5KFZA 1DURA 4WFAQ 4CYUA 1KKHA 2RRNA 4QR1A 1RE1B 2I38A 3CMAS 3UR3C 3JTOA 3A12A 4M5DA 2R3VA 1FJ7A 1U8WA 4ZITA 4XAKA 2FPHX 4PG4A 4XPCA 2EC2A 2BM1A 1N34F 4GC6A 4ZJLA 1JXVA 2FUG9 2DKOB 4O3PA 2NUUG 1K0TA 4USUA 5K14A 3SZ2A 1GQEA 3FSXA 3NNAA 5C25B 4ED8A 3W64A 2YNFA 4CO0A 5C24A 3GJSB 1Q78A 3NGRA 3R5AA 4OYXA 2HNDA 5E0OA 4LF9F 3KMSA 4J9OA 1FKAF 3HHNB 2BUNA 3DMJA 2RQMA 2DNYA 3UDLA 2DR5A 4QQBA 3OUYA 5GVQA 2YKNB 3E01B 5IS2A 4XTTA 2IA6A 1U24A 5AJ3F 4E8UA 4DWIA 4IR1A 1VJWA 1ZTTA 1MU2B 2KB2A 1UVIA 4EFAC 2PFDA 4NMXA 1TKZA 4A46A 3FBCA 4PZVA 2DH9A 3LGHA 2F9JA 2KKHA 4KTQA 4ZCLA 4NI2A 2RHSB 5F8MA 1Y10A 3CGIA 2O1PA 1WC0A 4KT0C 2C1EB 5ETKA 2QE5A 5CCMA 4PQUA 2ZH8A 4X4UA 2CAJA 4JI1F 4WP8A 1KLNA 3BSOA 2MKSA 3W66A 1PJ6A 2HWHA 4AYBD 4RWWA 4YB5A 1VI7A 2EI5A 1HYSA 2R7OA 5L9XA 4QOTA 1Z2ZA 4P9SA 3H2UB 5DZ6A 3QT5A 4UZCA 2HK2A 1J5EJ 3M8QB 1SI9A 2BEFA 3R1LA 1JLFA 2ZH1A 4RL1A 4X4RA 3DGVA 1RT7A 3NCRA 2D9PA 4K4YA 4TN2A 4JI1J 3HD2A 1SJRA 2Y1JA 5HVFA 2XLKA 4NLXA 3SDEB 1DBDA 4CQ1A 3MCMA 3CW2C 2RMLA 2B7CB 2DPIA 3KHRA 1RT1A 2QRRA 1ACMB 4PRFA 3R9LA 5KT6A 1QAXA 4M5LA 3B4MA 1TL7A 1ZYQA 1JJ4A 3BDPA 2MLZA 3CMQA 4JI8F 3C16A 3TZWA 4Y3CA 3CJKB 3O3LA 4X84A 1X4FA 4FKYA 2W4CA 2V4RA 1B0TA 2AEFA 1X5OA 3EICA 1XNRF 1S77D 4QJVA 5IV4A 3C46A 2B5JB 5ETMA 4N7TA 1VRQC 4YY3F 3KG4A 1VFJA 4OL8A 4H4MA 4ZIVA 4OYIA 2C2EA 3HI9A 3KLHB 5DG8A 4WFNQ 1NZ8A 4F36A 2OPRA 1U4BA 1RYSA 1RAOA 2XMJA 3LQVA 1TKTA 4Z7CA 3OSNA 2HFOA 1U0SA 4IYQA 1R7IA 4OZ3A 2RHQB 4CLSA 2P8IA 1WI8A 1XC9A 2FHJD 1CQMA 2IJNA 3A8EA 1RADB 3M8WA 1XNRJ 3J7AN 4DFJA 4FPIA 2R7XA 3TJAA 1ZOTA 4YY3J 1YJUA 4TY9A 3G2XA 5A8WB 1NK7A 1YJTA 2G0CA 2V2VA 3QPIA 2LEPA 1TAQA 1WEYA 1NU4A 1R6YA 3PHEA 1WHYA 4MYTA 4K50A 3W2WA 4RNNA 3PY8A 1TK8A 2W1BA 2DNLA 4FZVA 3VAKA 3J7Z5 2C3UA 2E66A 1HWUA 4RW6B 2FC8A 4EBDA 1WUUA 3QGHA 4ED0A 1FRXA 2J6TA 1WWHA 1UCNA 4CLKA 2I2YA 4C6AA 3VHQA 1IKWA 5A8KB 1PSDA 5JVHQ 2YX1A 1ZZFA 4IUFA 4ZLNA 2W2PP 4Q8FA 1HWIA 3H2LA 3UN3A 2F4FA 2O5DA 3CCJS 5C7PA 2WBMA 4DPUA 4DSFA 1SKSA 2GJIA 1OY8A 3TAQA 2FYXA 3RAQA 2ZH4A 4KV8B 5E7OB 3HF5A 1JK9B 3MR7A 3TRGA 2X1GA 4FF2A 1UFWA 2H5JB 5GAGI 3G6ES 4NXNJ 2FIUA 3MECA 4QIWD 3HFVA 4PWDA 2CVEA 4OYMA 3PACA 1NMEB 1S1WB 2MZJA 4G3IA 1GEHA 1DTQA 2HWIA 1N8RT 4N8OA 3SV4A 3C66A 1QTMA 2DY9A 2W2MP 3QT7A 2WSFC 2FGOA 4G1QB 3HSZA 4NEYA 2LVWA 1S7IA 1FHTA 1IKXB 2PI4A 3GIRA 2HQDA 1IKYA 3FGVA 5I42A 4ZA1A 1JLCB 4F4YA 5B7WA 2FDNA 2R2SA 2MGZB 1T9WA 4C11A 3TAMA 4D3GA 1RAEB 4CO4A 5F3TA 1Y3KA 2HFUA 4YOEA 1LWFB 3FZ2A 2HBRB 2CPJA 2VPYB 3H5YA 2FHMA 1WD6A 3K7RA 1M1GA 4IRDA 4DV7F 5L1IA 2LP4A 1NM2A 1T9TA 2Z2ZA 3BQ2A 1UPPA 2BR0A 1VRTA 2GO9A 2QMUB 2PA8D 4CZCA 1MMLA 3V6HA 1U47A 3VGVA 1WG5A 3ILIA 1CEZA 4LF8F 3K59A 3ENQA 3BR9A 3BSAA 1GK8A 3ZZYA 4XO0A 3CCMS 5F9LA 4YB7A 1WHXA 1YGYA 2CNLB 5HROB 2KHCA 1S76D 4U95A 1FESA 2G4BA 4OZ2A 1BMQB 2R7VA 1IBLF 4B9TA 3H7HB 2XBPA 5LMNF 2K06A 3C6UA 2RKIA 4WFBQ 2OLWA 2V6AA 2VBWA 4JP8A 5J2MB 1O51A 5KG1A 5HQMA 4O23A 3OR2B 8RUCA 3C2PA 5D6GA 1RKIA 3EGNA 3MM9B 5F8GA 1T94A 3KNGA 1R0AA 4DV6J 2JLGA 2V2QA 2DNOA 3M32B 2A6MA 3LH2S 4J9UE 4OLOA 5C42B 1FDBA 4C3MA 2HQIA 2R7QA 3DI6B 3QGPA 3DRYA 3Q86A 5BJRA 4DSEA 5LMNJ 1V3ZA 5LT5A 5HLFB 3MURP 4DZ6A 4LR8A 2Z2LA 3IBWA 1JLQB 2AGQA 2OTLS 2HFNA 3BQ1A 4LSZB 1K0VA 2OEMA 2WB1D 4ITSA 1KFSA 4RW8B 2FJBB 1FO1A 3S6EA 3EX7B 1S48A 2F4VJ 2JL9A 2XSJB 3LPYA 1YX2A 2XYHB 4K4TA 3NGSA 2DR6A 1G1XA 2UUTA 1XTZA 4DV1F 2N7CA 3GMGA 3JSRA 4F25A 3V6DA 1YZ6A 3Q8UA 4WTYA 3BSNA 3CJ8A 2HBQB 1F1BB 5D0GA 3AJ1A 3W60A 2OHDA 4ZPAA 5HQ8A 4FF4A 2YQ0A 5KFFA 4G6VB 1FJGF 4NCGB 1E6VB 4IQXA 4GMKA 1R43A 4R25A 4JI7F 1BGXT 3R1HA 3AB2B 2VQFJ 1SIZA 3IC1A 1LW2B 2MMYA 3MMBA 4LMZA 3D0GE 2GNKA 2IDEA 2XC9A 1ZETA 1FE0A 4N41A 4DCJB 2QX0A 1Q8LA 1CJKA 2LEAA 5IT9U 2ASLA 3BKUA 4HT7A 2J7WA 1M5SA 1HPZB 3O8WA 4ECQA 4RR5A 3V6JA 2RRAA 1DLOB 4RW4B 1N5VA 2IM1A 5KTQA 3T1YJ 3NBPB 3UWTA 3EGVA 2FVCA 1VR6A 1AB8A 4JI7J 2OSRA 4FVCA 4M5GA 5D4OA 4B02A 2Y1RI 3QZ7A 1RCOB 1MMDA 2CQBA 3NRBA 4JBCA 4DX7A 2DR8A 3R5BA 3D2WA 3FVYA 2H48B 1VQYA 3BF4A 2FTRA 9RUBA 3CCSS 2W2QP 4PG8A 2PGCA 3HHEA 2FGCA 4ZPVR 3A13A 2WCXA 2OUGA 3M9OB 1VMBA 3NGDA 2CPFA 3J81j 2G0JA 2NSCA 2KM8B 2XI2A 1VC6A 2LA6A 1ZZNA 1N6QB 2YBVA 3ADAC 4P7TA 2MDAA 2J7KA 1SH0A 3QLHB 4DR7F 3WIUA 4QW9A 5A0YA 3J7ZT 1T05A 5HSPA 1DQ8A 1JKHA 1P1LA 5M2UA 2XYPB 2DIUA 1U6ZA 1JIHA 2HHVA 3BGOP 5D4LA 3HHLB 2G9OA 3MCOA 4F8RA 1Y11A 2EWHA 4QWAA 3P5TL 2RJZA 3PHTA 3AJ2A 3QSIA 3MCSA 2QV6A 4ZVGA 5IC4B 1S6QA 2BXJA 3F44A 3LF0A 2E1CA 4MK9A 4GKJF 2D7SA 2IVMA 3LAKA 1TV6A 3P96A 2MSTA 2AZ3A 1SV5B 2E9TA 1TL7B 3THTA 1SJ4P 2E1AA 4LUBA 4EUVA 2LECA 5L1JA 1C1BB 2VASA 3Q23A 2QA4G 2P5VA 1BE4A 2XLJA 4ECVA 1RP5A 1REGX 3KLEB 3GE9A 2YPZA 1RT4A 1VLOA 5IOLA 4KY3A 2DNPA 4AFFA 1RU1A 2RE1A 3BYPA 4F02A 4DX6A 1S1TA 3FNNA 3OR1B 2OAUA 1Y5LB 2FY8A 5EDWA 5J2NB 3DRSB 3BO3A 4GKJJ 3MMAB 2J9DE 1QAYA 4WKRA 2BJ7A 2IJRA 2EBEA 3H0PA 1CJVA 5EN1A 4CM2A 4V19J 4K8RA 3DLEA 2ZWOA 2QLXA 4ZLLA 1LW0A 1HQEB 1WDDA 4IG3B 2NXUA 1XQIA 1X9MA 5KT3A 3M30A 4R0JA 1UVNA 4A8YA 1RTDB 2HQFA 5H1SV 4QWCA 3SSSA 2MQNA 3O6QA 1HBOA 3M7VA 4DSKA 4FS1A 1S1VA 3M4XA 2N4CA 3RR7A 2BM0A 4JI2J 4LFBJ 1VISA 2BJ3A 2W9CA 2BJEA 4OZJA 1XMQF 4O3SA 2GVZA 4ICLA 3DLBA 4Y2AA 3GSDA 4O44A 4NLDA 2PE8A 2ASDA 3BGRB 2PSZA 3DC2A 3U1MA 2BJDA 3MAQA 1TK0A 3JB9k
chains in the Genus database with same CATH topology
4GKKJ 1HNXJ 4JI8J 4B3SJ 4X64J 4OX9J 3T1YJ 4DV2J 4DV0J 4KYZA 2VQEJ 4LFAJ 1HR0J 2UU9J 2UUCJ 4LF9J 3D3BJ 4DR5J 4JI7J 4DV5J 4LF7J 4AQYJ 4DUYJ 4DR4J 1IBLJ 4JI1J 2KVQE 4LF4J 4X65J 2MTLA 4DR7J 2MQ8A 4LFCJ 4LF6J 1XMQJ 5LMUJ 4DV6J 5AJ3J 1N36J 4KHPJ 2UUAJ 4JI5J 5LM7E 4K0KJ 3W1YC 4NEZA 3R2DJ 4JI0J 4DV1J 1N33J 4PWWA 2UXCJ 1IBKJ 2MEWA 4X66J 1XNRJ 3J7AN 4NXNJ 4RJVA 1XMOJ 4DUZJ 5LMNJ 4B3RJ 4HHUA 2VQFJ 4NXMJ 4YY3J 4JI2J 4LFBJ 1HNZJ 5FLXU 4DV7J 3R2CJ 3T1HJ 4X62J 5A2QU 4KY3A 2E5LJ 2ZM6J 4JI6J 4DR3J 5IWAJ 1N34J 5BR8J 4B3TJ 2UUBJ 4JI3J 1FJGJ 4DR1J 4JV5J 3IMQJ 4B3MJ 4JI4J 4DR6J 4JYAJ 5IT9U 4NEYA 2HHHJ 4V1Ak 2UXBJ 1I94J 3OTOJ 4YHHJ 3J80U 4DV4J 1XNQJ 3D3CJ 4LF5J 1N32J 4DV3J 2F4VJ 1HNWJ 4DR2J 2UXDJ 3J81U 2KL8A 3JAMU 1J5EJ 4GKJJ 1IBMJ 4LF8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK J;  1HNX J;  4JI8 J;  4B3S J;  4X64 J;  4OX9 J;  3T1Y J;  4DV2 J;  4DV0 J;  4KYZ A;  2VQE J;  4LFA J;  1HR0 J;  2UU9 J;  2UUC J;  4LF9 J;  3D3B J;  4DR5 J;  4JI7 J;  4DV5 J;  4LF7 J;  4AQY J;  4DUY J;  4DR4 J;  1IBL J;  4JI1 J;  2KVQ E;  4LF4 J;  4X65 J;  2MTL A;  4DR7 J;  2MQ8 A;  4LFC J;  4LF6 J;  1XMQ J;  5LMU J;  4DV6 J;  5AJ3 J;  1N36 J;  4KHP J;  2UUA J;  4JI5 J;  5LM7 E;  4K0K J;  3W1Y C;  4NEZ A;  3R2D J;  4JI0 J;  4DV1 J;  1N33 J;  4PWW A;  2UXC J;  1IBK J;  2MEW A;  4X66 J;  1XNR J;  3J7A N;  4NXN J;  4RJV A;  1XMO J;  4DUZ J;  5LMN J;  4B3R J;  4HHU A;  2VQF J;  4NXM J;  4YY3 J;  4JI2 J;  4LFB J;  1HNZ J;  5FLX U;  4DV7 J;  3R2C J;  3T1H J;  4X62 J;  5A2Q U;  4KY3 A;  2E5L J;  2ZM6 J;  4JI6 J;  4DR3 J;  5IWA J;  1N34 J;  5BR8 J;  4B3T J;  2UUB J;  4JI3 J;  1FJG J;  4DR1 J;  4JV5 J;  3IMQ J;  4B3M J;  4JI4 J;  4DR6 J;  4JYA J;  5IT9 U;  4NEY A;  2HHH J;  4V1A k;  2UXB J;  1I94 J;  3OTO J;  4YHH J;  3J80 U;  4DV4 J;  1XNQ J;  3D3C J;  4LF5 J;  1N32 J;  4DV3 J;  2F4V J;  1HNW J;  4DR2 J;  2UXD J;  3J81 U;  2KL8 A;  3JAM U;  1J5E J;  4GKJ J;  1IBM J;  4LF8 J; 
#chains in the Genus database with same CATH topology
 4DS5 A;  2F8M A;  2V50 A;  1YJV A;  4NRT A;  1TL1 A;  1NPK A;  4ETX A;  2E5I A;  4XIU A;  3NNH A;  2QTW A;  3W8G A;  4NLY A;  4KO0 B;  2N7Y A;  1XMQ J;  3D66 A;  1FRI A;  1PCA A;  4B9U A;  3SSQ A;  1O8B A;  4OIX A;  2KT3 A;  1JB0 C;  5THW A;  4WFX A;  2GQ2 A;  2QA1 A;  3JSM B;  3ZZR A;  4K2X A;  2CNO B;  1IBK J;  1KVJ A;  5DQG A;  4WYL A;  4P2M A;  2ZC4 A;  2RQC A;  4RBT A;  4OX6 A;  2E5H A;  2P9C A;  2WW8 A;  3H90 A;  4PYA A;  4RNH A;  3KK1 B;  3GB0 A;  5DLG A;  2VG7 A;  2ZDP A;  3TR5 A;  2VHG A;  2F65 A;  1JWW A;  5J2P A;  1DHM A;  1R89 A;  1FK9 B;  4MKA A;  4DG1 A;  4BHQ A;  3GJQ B;  1S1U A;  1QSY A;  1L5U A;  3K8W A;  1BQN B;  1C0T A;  4ZIW A;  4C8L A;  2YWK A;  1OO0 B;  2F63 A;  1XR6 A;  1KQS R;  5GAG U;  4OYW A;  3GR1 A;  4OQJ A;  3SFG A;  1H73 A;  4R8U A;  1IWG A;  4M1K A;  3TP2 A;  2WVD A;  3GFY A;  2Y9H A;  3GFX A;  4GO5 X;  1D9D A;  2V2K A;  1MRO A;  2FJX A;  4F0H A;  2ALZ A;  4USM A;  4K4S A;  4NPO A;  1I51 B;  2CJQ A;  4HVZ A;  3N6L A;  3Q8S B;  2PII A;  2N3O A;  2RVJ A;  1FTC A;  1S49 A;  3P45 B;  4N5S A;  5T14 A;  2Z58 B;  4U6P A;  1D09 B;  4OJ3 A;  1T7P A;  3WZ0 A;  1XR7 A;  3MR6 A;  4PPD A;  4HI1 A;  2ILY A;  3HVT B;  5DDR C;  3MUM P;  2VOP A;  4LT6 A;  3ITH A;  2DH7 A;  3DLG A;  2PEB A;  3IR6 B;  3JQK A;  4YB6 A;  2YKM B;  5CQG A;  3ILO A;  4G1I A;  4ECR A;  3EGW B;  3KJV B;  2ZIT A;  4TQS A;  2HHU A;  1FFW B;  6FDR A;  4YHH J;  1RTI A;  5AE3 A;  1VQ5 S;  2HVH A;  2Y1I A;  1JXL A;  2DNH A;  4E0D A;  1EKR A;  5KFX A;  1S79 A;  3RG6 A;  3RU0 A;  4HKQ A;  3C3L A;  3PRB A;  2M7S A;  3TYT A;  3BEG B;  4U8Y A;  3PX6 A;  3RR8 A;  2XS2 A;  4X4N A;  1FEH A;  2OPP A;  2QT7 A;  1NDC A;  4F2S A;  4JI3 F;  1UET A;  4ANC A;  3TWZ A;  4ECX A;  1K1Q A;  2DTJ A;  1YIT S;  2CG8 A;  2D3Z A;  2XY6 A;  2C28 A;  1RAF B;  1LXJ A;  3GIK A;  2M8H A;  4ED6 A;  2E5J A;  2DGO A;  2KDO A;  4U9R A;  4XPE A;  2XY5 A;  2R8K A;  3OPK A;  4MTP A;  2UP1 A;  4H4K A;  4CO1 A;  3HHK A;  2JSX A;  4EWT A;  3DGP A;  3R2C J;  1DQ9 A;  4CCH A;  1LK7 A;  2K2P A;  3VGS A;  4J90 A;  4B3O B;  3EVO A;  2GAH C;  4JI3 J;  4CLP A;  3DHW C;  1LWC B;  2NPF A;  1W26 A;  3WX8 A;  2MSS A;  3CCZ A;  2V8G A;  4X2B A;  5KFL A;  1FRH A;  3HCX A;  4YS2 A;  2FJE B;  3RTV A;  3CNQ P;  4K4V A;  3QZ8 A;  4HAC B;  4W92 B;  3MFH A;  4WCE Q;  2RDD A;  3MR3 A;  4PAB A;  4P74 A;  2GIF A;  4HDH A;  1RWO B;  3LPE A;  4BS2 A;  4BLG A;  3IWL A;  4ECY A;  4I2P A;  3ZFV A;  1NKE A;  1NHK L;  4RU2 A;  5IQQ A;  1C1C B;  2XEX A;  4TU8 A;  2ZBI A;  3M6W A;  1UEV A;  4UOC A;  2FJW A;  4LFA F;  1RWV B;  3K5O A;  3TZX A;  1N5T A;  5K8P A;  4HHJ A;  3AD9 C;  3RB4 A;  4DUT A;  3M2U A;  4RLE A;  1UFK A;  1FKO B;  1DAR A;  2OO4 A;  2OFG X;  3OBI A;  3UNG C;  2LDI A;  2DK2 A;  1P9Y A;  4TYB A;  5DS7 A;  4KQZ A;  4M95 A;  2ZJQ Q;  3LWL A;  3IM9 A;  5MLC V;  2W2N P;  2RU3 A;  3TUZ C;  3TEG A;  3M9M B;  1N33 F;  1NDK A;  1KLM B;  4Y0F A;  2VON A;  4FS2 A;  5DGA A;  5E2Q A;  2DNG A;  3J81 U;  1EET A;  3Q8P B;  5KT4 A;  4NCB A;  4K0K F;  1NK8 A;  2GFF A;  4LFA J;  3HT0 A;  4CLL A;  2RUS A;  2XHC A;  4MMO A;  1ZM3 A;  1EHW A;  5HBM A;  3TUJ C;  4X4P A;  3UCZ P;  4WWS A;  3FMB A;  3C14 A;  3DOM A;  4DL5 A;  3GR0 A;  2HW3 A;  5E3C A;  3QFH A;  4QIG A;  1OY9 A;  3NG8 A;  5M2P A;  1N33 J;  2FC9 A;  4ZOS A;  1EJ7 L;  5I3P A;  1GXT A;  2IBO A;  2QJ3 A;  4K4W A;  3I5B A;  3CCW A;  4YN3 B;  3IBC B;  3OFF A;  3FBB A;  3L7P A;  4MIA A;  4NLP A;  3PR4 A;  4ZJQ A;  3OFG A;  3HT3 A;  2DNZ A;  2UVR A;  1PAU B;  5H9E J;  4ID5 A;  3S01 A;  3D3C J;  1QTN B;  2ZDO A;  1YRT A;  5C5J A;  4ILM A;  1KQG B;  3KK3 A;  1X60 A;  1HQU B;  4LSN B;  3P3D A;  1SC1 B;  4PXB A;  3A3N B;  3POT A;  3KFW X;  1NDL A;  3FBF A;  1RHK B;  2OGU A;  2XMV A;  4DR3 F;  3MED B;  2BW2 A;  1S6Q B;  3MEE A;  4EK2 A;  2ZNZ A;  3HVW A;  1L3K A;  1U2R A;  1RBL A;  3GP9 A;  5AXN A;  3VAH A;  4O0N A;  1ARO P;  1NJI T;  5HL7 Q;  4NEZ A;  3THV A;  1CSJ A;  1S1X A;  3RBE A;  4URG A;  2JDJ A;  1KOH A;  2YX4 A;  1VIO A;  2CPX A;  2OPQ A;  3M05 A;  2J5A A;  2QL5 B;  1TP7 A;  1NPR A;  1ZM2 A;  2GIQ A;  3OTD A;  2LMI A;  2MQM A;  1IXK A;  1JX4 A;  4RU9 A;  3PW0 A;  1WEZ A;  2I8E A;  4DR3 J;  1UWB A;  2RIL A;  2CFX A;  4PKD B;  2C2O B;  5DDQ C;  4USW A;  5KFN A;  3O1L A;  2QC3 A;  1KVI A;  2C2Z B;  4B3R F;  3MFI A;  2Z56 B;  2E9R X;  1N36 F;  4OHX A;  2GHP A;  1N56 A;  3O44 A;  1RAJ A;  4E2F B;  3A1Y G;  4LR7 A;  1GX5 A;  1RTZ A;  3QBC A;  4Q8E A;  1PYO B;  2E29 A;  3OVS A;  2HFS A;  3CB4 A;  3T6B A;  3AOA A;  2RQ4 A;  2MKH A;  1FNX H;  4WFZ A;  2KXN B;  2W01 A;  4ZKA A;  4MJK A;  1L3S A;  3DDI A;  4NZ6 A;  1N48 A;  1T9V A;  3OTE A;  2EFQ A;  1F9F A;  2DIS A;  1Q5V A;  3GJR B;  2RS2 A;  3IAM 9;  5DDP C;  2R7S A;  2FVR A;  4J5O A;  2C3M A;  5G0R B;  4B3R J;  1VBX A;  4UOF A;  3W9J A;  1S9G A;  1XK8 A;  2DGU A;  1PIE A;  5A8R A;  2Q79 A;  3AQP A;  1U6F A;  1HNI A;  1HL6 A;  2HSE B;  1RT3 A;  1RIS A;  1SXL A;  4B9L A;  2UUC F;  4FYW B;  3NMA A;  2F8E X;  3R6G B;  2LLZ A;  3HSD A;  5KFR A;  4KPY A;  1RTH A;  1PYT A;  2NUH A;  4I67 A;  1EAR A;  4HYK A;  1RHU B;  1G7C B;  1SC3 B;  2XGQ A;  2HVZ A;  4OZ0 A;  1WTF A;  4I0W A;  4HLB A;  1W2B R;  3RUB L;  2ZKT A;  1FX2 A;  2AU0 A;  2JFK A;  4IR9 A;  1BQM A;  4KGX B;  1J2V A;  2JLF A;  2MZR A;  2ZOG A;  2J6U A;  3PO4 A;  5L9N A;  2A10 A;  1M5K C;  1OY6 A;  2WVC A;  2V4Q A;  3PX0 A;  1TAU A;  3NEK A;  1NK4 A;  5JMN A;  1K1S A;  2R8I A;  5L8R C;  2WOM A;  1SH2 A;  4ZPD A;  4P2S A;  2VKR A;  4L73 A;  4DFM A;  4LBP A;  2X51 A;  2PA3 A;  5KOW A;  1RT6 B;  1W7W A;  4KPC A;  4LBI A;  1TL5 A;  1B4S A;  4NA3 A;  3DFE A;  4GKK F;  3OL6 A;  4ZVR B;  3VZI A;  4DV2 F;  3FUY A;  3BZQ A;  5IZH A;  4LRF A;  4L6V 3;  4LSL A;  1NUE A;  2VG5 B;  1X4E A;  1HWJ A;  4ILR A;  4Y2I A;  4CNY A;  1Q81 T;  3L3C A;  3IA0 A;  2GJF A;  1CVJ A;  3CED A;  3GCW P;  1RLC L;  5HAN A;  2AD9 A;  1HBN B;  3T1H F;  2BRK A;  3NCP A;  2ZE2 B;  3W61 A;  2MHE A;  4CWB A;  3PKY A;  1DQA A;  2HFV A;  2K1R B;  1F0X A;  3IWX A;  2AEM A;  4DN9 A;  5DGB A;  2U2F A;  4J9M A;  2ALY B;  2MQQ A;  4ED3 A;  2LDY A;  4EO6 A;  2BE7 D;  2JC0 A;  3W5Z A;  1EP4 B;  1J27 A;  1CJU B;  2WVF A;  3GV5 B;  4UY8 5;  3CD5 A;  1RT2 B;  3CJ4 A;  3KTQ A;  1X4B A;  4D3H A;  2I1R A;  3S8S A;  3N5F A;  1C2P A;  3M1V A;  1FVQ A;  1AYE A;  3T1H J;  1UVJ A;  1R8A A;  2VF3 A;  4IDK A;  3MEK A;  2XMT A;  2ILZ A;  3KHL A;  4KKO A;  2IAJ B;  4W4M A;  1LXN A;  4JI0 F;  2CIM A;  5GAD I;  3ZC4 A;  3VF0 B;  2EK1 A;  4Q2L A;  3CJ0 A;  2K8G A;  2JNJ A;  3CIZ A;  3SQG B;  3WIV A;  5CAB A;  2I5J B;  1MSW D;  1YJR A;  4KH0 B;  2D69 A;  4K5S A;  2NZ4 A;  3CD0 A;  1QDU B;  1B0V A;  1FWK A;  4MK7 A;  3EXC X;  2KM8 C;  2UV8 A;  3UCU P;  4B3M F;  2DHX A;  4UOH A;  1S9E B;  1WOS A;  3T5K A;  2RS8 A;  1S6P A;  4DQI A;  3LP0 A;  1YRX A;  2CDQ A;  3NAH A;  1H2T Z;  1RU2 A;  5IC6 B;  2HGM A;  1B0P A;  1FRJ A;  4A4J A;  1TL4 A;  4OX9 F;  4JI0 J;  2DNR A;  3IFE A;  3UD3 P;  4KB7 A;  2UVV A;  2W4P A;  1F5C A;  3HHL C;  2BAN B;  1XNQ F;  4WE1 B;  1Z4U A;  4HHH A;  2PFF B;  4TNO A;  3HJF A;  2V63 A;  3PFO A;  2LXF A;  1C4C A;  1KRP A;  1HNZ J;  2MZS A;  3OD2 A;  4FYV B;  1Q79 A;  2ADC A;  3I0R A;  3BGL A;  4C4W A;  1M5H A;  2XS7 A;  1UZD A;  3EMT A;  1CS4 A;  1ZAX A;  3A3O B;  1HIY A;  4Z37 A;  4OI0 A;  4B3M J;  1FXL A;  3M6X A;  5GAH I;  2XNR A;  2M70 A;  4ECS A;  1SVD A;  5KG4 A;  4URQ U;  4AL5 A;  5ITH A;  2DY1 A;  4IH6 A;  3OT9 A;  4OX9 J;  1R8C A;  4RW9 A;  4IRC A;  5ETS A;  1RWK B;  2PC6 A;  2KJW A;  1UPM B;  2EKN A;  3HSJ A;  4ZCK A;  2B6A B;  2ZH3 A;  4LVO P;  3CCT A;  3D6H B;  2QYC A;  2HZC A;  2J0S D;  2DR7 A;  1CUL B;  2FHJ A;  4DPT A;  1N0U A;  2IBK A;  2CG4 A;  4Q0B A;  1ICE B;  2PO4 A;  1YZ7 A;  4DFK A;  1UMJ A;  3AB4 B;  2MY8 A;  2P9E A;  3NL0 A;  3SV3 A;  1R8P A;  4B17 A;  2D3U A;  2XGP A;  1VQ8 S;  2E5L J;  1UJ6 A;  4N77 A;  3HFZ B;  3MAA A;  3NS7 B;  3PRV A;  3Q89 A;  2HMI B;  1A7G E;  1GXL A;  4LF1 A;  2RH3 A;  3I0S A;  1RT5 B;  1VYA A;  4WU2 A;  4BWJ A;  3MR5 A;  4PR6 A;  4NXM F;  2J8S A;  4PG5 A;  3UCG A;  4FYD A;  3M2R A;  2VQE J;  3FEX B;  2WW4 A;  2XZT B;  1S0M A;  3SCI E;  3PCO B;  5C2G A;  1RAB B;  2VOD A;  2Z0G A;  1UEK A;  4LF5 F;  3WBZ A;  3EZ5 A;  3H20 A;  2CJ9 A;  3VAG A;  1RBO B;  4N76 A;  2WVE A;  1FDD A;  1U25 A;  4CT8 A;  2ZOF A;  6FD1 A;  2CPY A;  3LP1 B;  3MM7 B;  3D28 A;  3I82 A;  3ZXW A;  4OI1 A;  5HMW A;  5D0E A;  4UQG A;  3CSK A;  2DR9 A;  4NXM J;  4NLO A;  1GTE A;  3BV8 A;  5K20 B;  3PYE A;  1RQ0 A;  1Q8B A;  3I56 S;  1TVR A;  1BWV A;  3HHD A;  3MM6 B;  2B0G A;  5A2Q U;  1A9N B;  4KHP F;  3R5D A;  4AE5 A;  3PO5 A;  2OJ3 A;  3AXM A;  1JLA A;  3OXF A;  2VPW B;  4C3K A;  3MM5 A;  5F8N A;  3ILJ A;  2HUR A;  1RWP B;  4LF5 J;  4M94 A;  5F8L A;  2F9D A;  2D74 B;  3B6B A;  1F9H A;  3N9U C;  2QFJ A;  2OML A;  1H3D A;  1Q86 T;  4GVB A;  4X4V A;  3MPY A;  4KYZ A;  2FJA B;  2MJU A;  2HVD A;  3DYA A;  2HIY A;  1VQK S;  2CNN B;  1U2F A;  1N5S A;  2DEJ A;  2HIQ A;  1IR0 A;  1XMO F;  2BJ9 A;  4L74 A;  1S10 A;  2R8J A;  2L3M A;  1RUS A;  7FDR A;  4QYR A;  4CO5 A;  1HNW F;  4KHP J;  3V4M A;  2PN6 A;  4DQQ A;  5HP1 B;  4UTG A;  5IWA F;  2KTQ A;  3OHA A;  3ISN D;  2QMW A;  2CA9 A;  1B99 A;  1NND A;  2H9Z A;  1FKP A;  4DR4 F;  5L1K A;  1MWZ A;  2XB2 D;  4ELU A;  2BE2 A;  3ICL A;  2OKQ A;  3OLA A;  2O3D A;  4DMZ A;  4Q5V A;  3UDV A;  3W5Y A;  1QUP A;  3ULH A;  1ZTW A;  1R8H A;  3VGT A;  3KHH A;  3D6F B;  3A4T A;  1HMV B;  1Y00 A;  3CD7 A;  1M1H A;  1RCX B;  1HNW J;  1Q4R A;  3K89 A;  4KE5 A;  3QRP A;  3MM8 A;  4C0O C;  5EGY A;  3PFE A;  1SJQ A;  3DU6 A;  4K4U A;  2NLW A;  2B9W A;  3NXZ A;  5HI7 A;  3M8P B;  1KDN A;  5DG9 A;  3DRX A;  2ZEJ A;  2ZJR Q;  5A6P A;  1WC6 A;  3IGV A;  1I1G A;  3DDN A;  2NYI A;  4DR4 J;  3PEJ A;  1T9Y A;  3QWP A;  2DO0 A;  2RNE A;  4CLZ A;  1WOR A;  3TVY A;  4H54 A;  4Z2X A;  3C6T A;  3IS9 A;  2JEJ A;  2VDI A;  1R0B G;  1D9A A;  2V8P A;  2N3L A;  1UVL A;  1XEZ A;  1FEE A;  3DRR B;  2UXB F;  1U02 A;  5B09 A;  5BYR A;  4UY8 T;  4P10 A;  3V4I B;  2XQC A;  2HRY A;  3Q2S C;  3I87 A;  4J9L A;  3B78 A;  3EPG A;  4LRB A;  2ZM6 J;  1DFD A;  2XNQ A;  3RZA A;  3VAI A;  3PZP A;  1DTT A;  2J76 E;  3OTB A;  3CJS A;  3ET6 B;  1KEK A;  2HKE A;  3T5J A;  4LVN P;  4ZN3 A;  2L08 A;  4IFY B;  1FNO A;  2HG4 A;  3P49 B;  3IG1 A;  3D1H A;  2H4W B;  4QBU A;  3DOL A;  1TL3 A;  2P6T A;  1S0V A;  4QWD A;  4EBC A;  3CDB A;  4PXC A;  2V5H G;  5ETN A;  2AWZ A;  3DOK A;  2VIH A;  1X4A A;  1EKS A;  4JI4 F;  5IV3 A;  2B9Y A;  5EHH A;  2QIF A;  5U47 A;  3WHI A;  2XS5 A;  3F56 A;  1VRU B;  1EX8 A;  1RTJ A;  4QU7 A;  3NS5 A;  2HHW A;  3DN9 A;  5D3G A;  2MKK A;  5HK4 A;  1ZBT A;  3S7R A;  2BJ1 A;  5I3Q A;  1ITP A;  3MI7 X;  4DFP A;  3W1Y C;  4EEY A;  1TEL A;  2CXE A;  4HHU A;  1NDP A;  2FD2 A;  3NKY A;  5I3U A;  3D0I E;  1VQO S;  1U1L A;  5H9F J;  5KFB A;  2ZBQ A;  3FCV A;  2HZA A;  4H4O B;  4TY8 B;  2HQG A;  4C97 A;  2ZOM A;  4JI4 J;  2Q1L A;  2DO4 A;  3IRX A;  2OD4 A;  5LJ3 Y;  3G82 A;  2DNQ A;  2CKW A;  3KUG A;  5LMU F;  5IT9 Y;  1GNK A;  1L3V A;  3MUV P;  3JYT B;  2D41 A;  4KBI A;  1P6T A;  3HMJ G;  4J9Q A;  5K8M A;  2JH3 A;  2WZ1 A;  4DL2 A;  2RQK A;  2VBY A;  3PTW A;  4I6W A;  2CQP A;  2VA3 A;  5CYQ B;  1WHV A;  3RBD A;  1ZM4 A;  3R7N B;  1REV A;  1X0P A;  3UVJ B;  2MYF A;  1RGV A;  2UVU A;  1Q7L B;  3QIP A;  3TAP A;  3TAN A;  2CQ3 A;  4HR2 A;  2NXJ A;  2V94 A;  5F0W A;  3WC2 A;  1JLE A;  2GAG C;  1Y0H A;  2PI5 A;  5KFD A;  1J5O B;  4U67 Q;  1N52 B;  2HEK A;  2XCP A;  2VBX A;  8ATC B;  1JQG A;  5CD4 A;  1S12 A;  4LF4 F;  4M8L A;  1AZS A;  1WAC A;  3R8Y A;  1VDH A;  4DOZ A;  1T03 B;  3K5M A;  4DF4 A;  1HR0 F;  1S0O A;  4UW2 A;  1DJ0 A;  2CQD A;  3HX9 A;  3GIL A;  1V3R A;  1NSK L;  5F8I A;  1E6Y B;  3G87 A;  2GX8 A;  1IR2 A;  3KLI A;  2BDP A;  2EG1 A;  1NEE A;  1PJ5 A;  3FRY A;  4DDF A;  2LFV A;  1HNV A;  3P4U B;  2VKZ G;  1JLG B;  3VVU A;  4ID8 A;  3HJV A;  4QCL A;  2UU9 J;  2GIR A;  1CC7 A;  4LIR A;  1XMB A;  4BCA A;  2KG0 A;  4MFB A;  3HXM A;  3J7A 1;  4FNH A;  4KC5 A;  4ES2 A;  3DKD A;  4LF4 J;  3PM9 A;  1KBR A;  2GV1 A;  3O5T B;  1Q8K A;  1SUQ A;  5GAD U;  4A8Q A;  4IFV B;  3N0V A;  3CJR A;  4JV2 A;  2QSF A;  3ZZZ A;  4L76 A;  1RAC B;  3EVM A;  3T19 A;  1B7Y B;  3RW6 A;  3FFI B;  1CJT B;  1MWY A;  1V3S A;  2C2R A;  4RKU C;  2CJK A;  1KD1 T;  3W2V B;  1NBE B;  2VFV A;  4F26 A;  4UST A;  3D9B A;  4HEA 9;  4QIF A;  4ZN1 A;  3OLB A;  4PUO A;  1C0U B;  1GX6 A;  1VQ6 S;  4I69 A;  3QO9 A;  1N34 J;  3KLF B;  2HNY B;  4UF4 A;  5E5N A;  2GQC A;  2CVI A;  2W2O P;  1IJE B;  1QY7 A;  5RUB A;  2FVP A;  3JSB A;  1IKV B;  3BKT A;  5K9F A;  2OFH X;  2J7U A;  4JB8 B;  2LXI A;  3CJT A;  2X3D A;  4LF9 J;  3G8Q A;  1X7V A;  6AT1 B;  4QPT A;  1HHT P;  1BD6 A;  5KG5 A;  3AT1 B;  1VOM A;  4DN0 A;  1N5Y B;  5D8H B;  1SCJ B;  2HNZ A;  1F6T A;  4DV4 F;  5E3R A;  4TLR A;  3PR5 B;  3TA1 A;  5AJ3 J;  2F5G A;  4O4G B;  2ZZM A;  2HHX A;  3CWJ A;  2X1A A;  2V8D A;  2EPI A;  3MEG A;  2JWN A;  5KG6 A;  3J7Y I;  1HBM A;  1EQM A;  2M5Y A;  4DV3 F;  2XWY A;  1O5J A;  1WHW A;  4USK A;  4WF9 Q;  3H25 A;  2EC0 A;  2Z57 B;  4DL6 A;  2EKY A;  2W4D A;  2JEG A;  3BBB A;  4NYP A;  4IOA Q;  1K9M T;  1Q95 G;  2V4J A;  1NKC A;  4AQY F;  3C15 B;  1BQX A;  3H98 A;  4DV4 J;  5DM6 Q;  3KHG A;  2WON A;  1I5O B;  3MTJ A;  3DDK A;  1BC6 A;  1U1O A;  1PGZ A;  4ZP7 A;  2ZH2 A;  4ZVH A;  4ZHR A;  2IC3 B;  2C3P A;  4Q45 A;  2H1Y A;  1D9F A;  3MF5 A;  2OPS B;  3A3P B;  2DNN A;  2GS8 A;  5KT5 A;  3KLV A;  3OSP A;  5EWE A;  3GPA A;  2HHS A;  3OL7 A;  4NWB A;  3M6U A;  4RNO A;  3CCL S;  2VG6 B;  3KKF A;  3OHB A;  3P5B P;  2AP6 A;  1FWP A;  1TKX A;  2JFD A;  1GMW A;  3KJN B;  2RUG A;  2ABY A;  2LQ9 A;  4MH8 A;  2HHH F;  4A8S A;  1RWN B;  2ATC B;  1FJE B;  2YNG A;  1JMT A;  4ZVO B;  2YX7 A;  2ZD1 B;  1AXQ A;  2VB6 A;  1RWW B;  5CYM A;  4DL4 A;  4I7F A;  4ALZ A;  3MGJ A;  4ELV A;  3BBC A;  3DM2 A;  5C2C A;  2GJ2 A;  3SYZ A;  2KZZ A;  2K7J A;  2KT2 A;  4LR9 A;  3Q8V A;  1FER A;  2YKO A;  3MMC A;  4ECZ A;  5T7L A;  5J2Q A;  7AT1 B;  2GML A;  2YNH A;  4BC9 A;  3SFU A;  3GZ7 A;  4JI8 J;  3IN5 A;  1RAI B;  1RHM B;  2XHW A;  1TFY A;  1LWE A;  4MAK A;  3EE3 A;  1BUX A;  3NGK A;  1SJF A;  4ZMM A;  4KH1 B;  3QAE A;  3Q8Y A;  1CPZ A;  4DL7 A;  3QJP A;  1T9X A;  4FPR A;  2IM3 A;  1TZ0 A;  3W9I A;  4R5P A;  2RF2 B;  3G71 S;  1LK5 A;  2AKW B;  3TNV A;  2HGL A;  1F2H A;  2CQI A;  1R31 A;  4U7C A;  2QL7 B;  1N88 A;  3QSY B;  1DZ5 A;  1IJF B;  5I4M A;  1XBW A;  2OTJ S;  1GAO A;  4QU6 A;  3HSG A;  2MKJ A;  4L72 B;  4DI6 A;  2EFG A;  3K0J A;  3PVX A;  1NK6 A;  1ZPV A;  2DIV A;  2ZH6 A;  1RB0 A;  2BOP A;  3KLG B;  2DVI A;  5DRK A;  2ADB A;  4Y28 C;  2MPU A;  3MWB A;  2VFT A;  3UFC X;  1SC6 A;  3TZY A;  2WBR A;  4C0H A;  2H51 B;  4IG0 B;  2ZHO A;  5ETQ A;  3OJS A;  2V2Z A;  2KYZ A;  3CDA A;  3A8J A;  3DLK B;  2DRA A;  5C25 A;  5BXI A;  1D1U A;  1QE1 B;  3QID A;  2VJV A;  4YDX A;  1SBR A;  3NWR A;  3V81 B;  4NLW A;  1I3O B;  1HI0 P;  2CQ1 A;  2KI2 A;  1HI8 A;  4A8O A;  2A0F B;  1WC3 A;  3FKB A;  3C6T B;  2I6W A;  4DS4 A;  1K44 A;  4O0I A;  2YKN A;  2Z2Y B;  3E01 A;  4ZPC A;  2KU7 A;  1Q16 B;  1T0T V;  4N47 A;  2KXH A;  2C22 A;  1MU2 A;  1U0H B;  1X4D A;  3H5X A;  1U6B A;  1PIL A;  4DLE A;  1U1N A;  3DRP B;  4ED2 A;  4C8N A;  2BQ3 A;  4DPO A;  2K7K A;  3A8K A;  3HUL A;  2XMK A;  2R9L A;  2XZD B;  4CIO A;  4EMD A;  3RB3 A;  5ADZ A;  2WVB A;  5G4D A;  1WOO A;  4GO7 X;  5J1E B;  3BM7 A;  3G4S S;  1DY3 A;  4PWU A;  3H5S A;  3CDE A;  2Q6B A;  2HQC A;  5FDL A;  4CTA B;  2KL8 A;  3HVA A;  3BS9 A;  1PJ7 A;  1Y4Z B;  4MK8 A;  5E3Q A;  3OW2 R;  2DEI A;  3ETO A;  3U27 A;  1ZA1 B;  3SI8 A;  1TUV A;  2E5G A;  2W9B B;  1HLW A;  3SQO P;  2BKO A;  4RUC A;  1BY9 A;  3M8Q A;  1GTH A;  4P71 A;  2DRD A;  1Q82 T;  1MW7 A;  2YNI B;  3EWG A;  2EW9 A;  3BO2 A;  2RD5 C;  1H2V Z;  4NYO A;  4M5H A;  2GZO A;  4DV5 F;  4KHR A;  2DBB A;  2GGP B;  2XMW A;  2E7W A;  3SDE A;  4DV7 J;  1QJH A;  4U96 A;  2LQB A;  3IXQ A;  2F7V A;  5E41 A;  4Q7A A;  4ZP8 A;  1AT1 B;  1FXR A;  4RW7 B;  3CD6 S;  3I4P A;  2MKI A;  4ZPB A;  4YDD B;  2G2Z A;  3QAU A;  4B9M A;  1PC5 A;  3ZTO A;  4LF8 J;  1UW9 A;  2Y0B B;  4ZDN A;  3TJ9 A;  3LP2 B;  1U26 A;  2DGW A;  2FLO A;  3MTK A;  1JLB B;  4UQT A;  2C3Y A;  3M2V B;  2CRL A;  3J81 Y;  4DV5 J;  3CJK A;  1T02 A;  1IBL J;  1X5P A;  5D78 A;  5GAE I;  3KK2 B;  1RSC A;  1MN7 A;  1Y5N B;  4ECT A;  2XTJ P;  1ROF A;  1FRK A;  2B5J A;  4I2Q B;  3RB0 A;  4OHV A;  4QR2 A;  2DPJ A;  3UN5 A;  4B3T F;  3PJ9 A;  1GMU A;  4KFB B;  3KLH A;  4DL0 C;  4NML A;  3VAM A;  2QEX S;  2CPE A;  1S9F A;  1S6O A;  3PRD A;  2W7P A;  2FZG B;  1U45 A;  5KG0 A;  2AX1 A;  1KHW A;  3NMR A;  4DR2 F;  2PD1 A;  1NPP A;  2DHG A;  3FMW A;  3M6V A;  2BZ2 A;  2DCL A;  4C9D A;  4B3S F;  1WSV A;  3IWN C;  5D0R A;  4P6Q A;  3BQ0 A;  2QLB B;  3E8O A;  4CYU B;  4N8N A;  1QLN A;  1GT8 A;  3NCQ A;  4G1P A;  4NOH A;  4M5D B;  2I0X A;  4LFC F;  4LRE A;  3OL8 A;  5A8W A;  1U09 A;  1WEX A;  2XUL A;  3Q8R B;  3BKF A;  2VUG A;  4JV0 A;  2GQQ A;  3PYF A;  3CT9 A;  5K14 B;  3OTC A;  1T3N A;  4UOG A;  3N79 A;  2YNF B;  1PO6 A;  3SCL E;  2R4F A;  5C24 B;  1SKR A;  5CZV A;  4P2X A;  4E98 A;  1UVK A;  2CQ0 A;  2HND B;  2B4V A;  4RW6 A;  1H2U X;  2ZZN A;  2CZ4 A;  4DX8 H;  3DMJ B;  4DV1 J;  2IJF A;  4Q43 A;  2AIR B;  2J9C A;  3OUY B;  2DNK A;  2LQ8 A;  5A8K A;  1VGY A;  3VAL A;  3GII A;  2E1P A;  1NSA A;  1TKZ B;  3R7S B;  3PDN A;  3T41 A;  2FLL A;  1FJG J;  2B7B B;  4KV8 A;  1G2E A;  4I1T A;  1G6B A;  3QMQ A;  3SBM A;  2AW0 A;  3HD1 A;  3PIP Q;  4X66 F;  2DHH A;  3K17 A;  3TEH B;  2RDJ A;  3RBX A;  4NI2 B;  1H72 C;  1S1W A;  3CME S;  1UJ4 A;  3AOC A;  4DL3 A;  4I56 A;  4M5I A;  4PQU B;  3QGI A;  4TYA A;  2YWH A;  4G1Q A;  3M8Z A;  2MLX A;  4DQS A;  2DD8 S;  5KG7 A;  3BH7 B;  1IKX A;  2JX2 A;  2VFS A;  3FZB A;  3HM9 A;  1MN9 A;  4A8M P;  5B0C A;  4FN5 A;  3LWM A;  1JLC A;  3EXY A;  1Y9O A;  1X5S A;  1HYS B;  2MGZ A;  1F9E B;  5A6W A;  3OVB A;  3PJX A;  2XCA A;  1OWX A;  4X66 J;  3GON A;  1LWF A;  3TQ1 A;  4A8F A;  5IT0 A;  1NSP A;  2B9E A;  2IIH A;  2IMO A;  3X3U A;  1JLF B;  3S1T A;  4X4O A;  1RT7 B;  3G9C A;  4OI6 A;  2WON B;  2XMM A;  3DU5 A;  3MCN A;  1YLX A;  1KN6 A;  2BAB A;  1HBU A;  4CLT A;  5JJB A;  1RDR A;  1F60 B;  3AA9 A;  1SC4 B;  3J7Y U;  1Z2L A;  4JI5 F;  1FA0 A;  2XWX A;  3NWG A;  4M63 A;  1RT1 B;  3QQC D;  4MKY A;  1RYR A;  3O2I A;  5HRO A;  4WXO A;  3RRH A;  1NH7 A;  4DR7 J;  3SMZ A;  1HI1 A;  3PYD A;  3G6Y A;  2A2D A;  3ZO7 A;  1N32 F;  1S4E A;  1FF2 A;  3FEZ A;  3C16 B;  3UDE A;  2VA2 A;  2VC0 A;  1F3F A;  4QZV B;  1UTA A;  2C3O A;  4YME A;  5LJ5 Y;  4ZVS B;  1NZA A;  2JZ5 A;  3FQL A;  5J2M A;  3HPO A;  5CCL A;  1GMV A;  3OR2 A;  4I7F B;  3T5L A;  3MM9 A;  3CDU A;  2F8H A;  4USI A;  1NH8 A;  2DT9 A;  2ZBP A;  4H4M B;  4LF6 F;  3CO9 A;  5D4P A;  3MUT P;  3D6M B;  5LSR A;  2JHE A;  1VK3 A;  5F41 A;  3M32 A;  3Q24 A;  4QIV A;  4RNF A;  1X9S A;  2OPR B;  3EUN A;  5E33 A;  3MZI A;  3MAH A;  5C42 A;  1T3O A;  1TKT B;  3TA2 A;  3CCE S;  4V1A k;  3DI6 A;  5B0E A;  3BB5 A;  1N32 J;  1DRZ A;  1SL2 A;  3US5 A;  1LWE B;  2PT0 A;  5HLF A;  3MD1 A;  3W3S A;  1R0C B;  3A8I A;  3N28 A;  5B0A A;  3NAI A;  4O3R A;  2RT3 A;  3T6J A;  1JLQ A;  3VCD A;  5AXM A;  2QO3 A;  4NLU A;  4QWE A;  1JJH A;  2BBE A;  1IWA A;  2R7R A;  4KGM A;  2H5I B;  4NLG A;  2R2R A;  1X9W A;  5JXS A;  4HH0 A;  4DHV A;  4RW8 A;  1DAX A;  3G6V A;  2OD6 A;  4LF6 J;  3H8Y A;  3AD7 C;  2XSJ A;  5CA5 A;  2VV5 A;  4IRK A;  1T9U A;  3W2W B;  1IM6 A;  1NXI A;  2M52 A;  2JVR A;  1K8A T;  4JUZ A;  1N4L A;  1O0P A;  1NAQ A;  1QUV A;  3U1N A;  4UUW A;  5LL6 d;  3VTI A;  5FLX U;  1YIJ S;  4DSL A;  2FY1 A;  1IKW B;  4MT1 A;  2YH1 A;  1QVG R;  5B0G A;  4NCG A;  1E6V A;  3HDS A;  4DX5 A;  2XYG B;  2Q66 A;  1KP6 A;  3PEH A;  3ZNU A;  5KT2 A;  3GYN A;  3GTY X;  2LQ5 A;  5AXL A;  3L7U A;  4F4K A;  3I4H X;  1LW2 A;  4AT1 B;  7FD1 A;  2NQP A;  3FSI A;  4ZCI A;  3DLL Q;  1KVK A;  1RI7 A;  1S59 A;  3MEC B;  4IO1 A;  4PWD B;  4JV5 F;  2AT1 B;  1VQM S;  2HAF A;  2F3J A;  2R42 A;  5IQ6 A;  1I94 F;  1HPZ A;  2CPI A;  4ES3 A;  1DTQ B;  3GU0 A;  4P73 A;  3ILL A;  4AL6 A;  4JOU A;  2A2C A;  1DLO A;  2MQO A;  1YG0 A;  4QYZ K;  4RW4 A;  2PMH A;  4NLS A;  2ASY A;  2LQJ A;  5KFT A;  3NBP A;  4S0M A;  5IM0 A;  2RSQ A;  3LA0 A;  4DZD A;  4OI3 A;  1IKY B;  2HBY B;  4LJM A;  3EGZ A;  5I42 B;  2LKZ A;  4RX6 A;  3H40 A;  3D1O A;  2VJU A;  1J5E F;  4TLQ A;  5L46 A;  3ONQ A;  4C11 B;  4F2R A;  1P1T A;  3N5B A;  3CCQ S;  1Z1Z A;  3TAM B;  4P75 A;  3RAX A;  4C8K A;  1SL0 A;  1KQK A;  2A6O A;  1VK8 A;  4IOB A;  2QFI A;  4JV5 J;  5FDL B;  1I94 J;  1HWL A;  2MY7 A;  4FKX A;  5KFC A;  2MXY A;  2C2D A;  3T5H A;  4WZQ A;  3SXL A;  1VRT B;  4J9P A;  3IRW P;  1F5A A;  2D3O R;  5EX0 A;  1YKW A;  2BV3 A;  1N6Q A;  3BR8 A;  3PJW A;  3WDO A;  4DSI A;  1VHI A;  3NP5 A;  1RK8 A;  2OH2 A;  4USV A;  4TU9 A;  1X4H A;  3QLH A;  4ZK7 M;  2X3G A;  4ES1 A;  1D8Z A;  5ETV A;  3L95 X;  4F50 A;  4W98 A;  3HHL A;  5KFW A;  3DNC A;  3QRQ A;  4DPW A;  2WB4 A;  1P27 B;  3MPW A;  3KXD A;  1RBA A;  2KFZ A;  4OZ5 A;  3DXS X;  2HWT A;  2EK6 A;  1Y3J A;  4LRA A;  3C6U B;  2RKI B;  2VIC A;  4XDD A;  1KFD A;  2EFO A;  4U7U K;  2MQP A;  5KFI A;  1VCT A;  1PBU A;  1NJZ A;  1R3N A;  2KH9 A;  2MB0 B;  2DNM A;  3QRR A;  1SV5 A;  4EGL A;  2MZT A;  2CQC A;  3I9Z A;  3J80 U;  3BO4 A;  5GMK a;  4CI0 B;  1R0A B;  4F3O A;  1C1B A;  2K3I A;  3I5C A;  2YQ3 A;  4ECU A;  3MMJ A;  3U02 A;  4K4X A;  3FBE A;  3KLE A;  1NHV A;  3TW0 A;  2FJV A;  4F67 A;  2LEB A;  1B70 B;  5MAO A;  2UUB F;  2ZHA A;  3PG9 A;  1NHU A;  1URN A;  4QW8 A;  1VJQ A;  2MQ8 A;  3OR1 A;  5J1P A;  3HVR A;  3KNA A;  4Y00 A;  3DRS A;  5J2N A;  1V5V A;  3MMA A;  3AH6 A;  4I6Y A;  5DJB A;  1R8B A;  1G3O A;  2GCF A;  4WFY A;  1XJW B;  4HI2 A;  1UA0 A;  3Q22 A;  2MEW A;  2WHO A;  2ROE A;  1HQE A;  1HW9 A;  4IG3 A;  4CLF A;  5GAE U;  4IOC Q;  3T3F A;  4KRW A;  1RTD A;  1RHR B;  1X4G A;  2G2O A;  4A8K A;  5KFJ A;  2UUB J;  1QVF R;  5GME A;  2G0I A;  3HO1 A;  4C3L A;  3V6D B;  5B0B A;  2ROG A;  1RHQ B;  2H4Y B;  4EYI B;  2UXC F;  5A2Q Y;  3KJF B;  3AHP A;  2JEF A;  2AJF E;  2YKA A;  3PYG A;  1U2C A;  3PW7 A;  1N54 B;  3GSI A;  2R2T A;  5M2R A;  1BWE A;  4GC7 A;  2CZV C;  2IVF B;  5F3Z A;  1KWM A;  2XSF A;  1VHF A;  2IRU A;  3D68 A;  4NXN F;  1QSS A;  2E7V A;  1BXN A;  1OSC A;  3MMB B;  4I6A A;  3BGR A;  1S6U A;  1CJK B;  2DGX A;  1PBA A;  4QR0 A;  3ENW A;  2UXC J;  4ZVF A;  3ZTP A;  4KGZ B;  4KO0 A;  2KG1 A;  2VDH A;  1T95 A;  3FC9 A;  1SQG A;  2HHT A;  3R3T A;  3IR7 B;  2GHV C;  2BQU A;  2BKP A;  4FDF A;  3HKW A;  5BYS A;  2AJ0 A;  3ENV A;  3IMQ J;  4DSJ A;  4ZCM A;  4CLY A;  4ZVE A;  2E7X A;  3JSM A;  2UVW A;  3AXK A;  1YBT A;  2ACM A;  3U1L A;  4FVM A;  4NL5 A;  3KK1 A;  2ZHB A;  4J9N A;  3DXB A;  1KR4 A;  2OSQ A;  2QLW A;  3EDR B;  4KGK A;  1FK9 A;  5E3P A;  1OPI A;  2KVQ E;  5KFA A;  4L3N A;  1U1R A;  1BQN A;  1A6L A;  5A76 A;  2M9K A;  3TQE A;  4WBF A;  4K0K J;  2R7T A;  1VBZ A;  3R5J B;  5KAK A;  2HYI B;  2POK A;  2GO8 A;  5A0Y B;  2JLE A;  4RO0 A;  5K8O A;  5DDO C;  1T05 B;  1YWX A;  2N82 B;  2KZM A;  1F2G A;  1JKH B;  2G1H A;  3QNW B;  1F5B A;  3L7O A;  2A1B A;  2FJD B;  1HBU B;  3SSR A;  2C42 A;  1YJW S;  3W62 A;  4K5R A;  5DLF A;  4RUB A;  3HVT A;  4DV6 F;  3OXL A;  2IY5 B;  2IMW P;  3QGG A;  2CAD A;  1TV6 B;  2BX6 A;  4RBV A;  3K5P A;  4WPA A;  2YKM A;  2AYG A;  2IDL A;  2HS3 A;  3K58 A;  3KJV A;  4ED5 A;  1WC5 A;  3UD5 A;  4JV1 A;  4MKB A;  1S57 A;  4RPF A;  2J9D A;  4WYW A;  1RT4 B;  4OI2 A;  2KXF A;  3QJJ A;  1IN0 A;  1ZA2 B;  2NYH A;  3JAM Y;  3NGU A;  3R2D J;  4CNZ A;  3CC7 S;  4C8Y A;  1S1T B;  1CG2 A;  4DQR A;  4AND A;  3N01 A;  3VQT A;  1YVF A;  2F4V F;  3RAM A;  3N6M A;  5EWF A;  4CLW A;  2CPD A;  3PIO Q;  3VAJ A;  1FI4 A;  2HHP A;  4I64 A;  2NCK L;  2DYA A;  1CJV B;  4WP3 A;  3ETM A;  2X7I A;  3OFH A;  1YJ9 S;  2CQH A;  4IKA A;  3DLE B;  3GLJ A;  2DIT A;  2JVO A;  1P8G A;  1LW0 B;  1NJY A;  3M30 B;  1S97 A;  2RAQ A;  2DXD A;  2RU9 A;  3VV2 B;  1OS5 A;  2ZKU A;  4X4T A;  1HBO B;  1ZS6 A;  4PAA A;  1S1V B;  5AXK A;  4ILL A;  4B3O A;  4L75 A;  3FDS A;  1LWC A;  4JYA F;  4CP5 A;  2VQF F;  4NLV A;  3HK2 A;  4NX9 A;  1HHS A;  2W9C B;  4TVA B;  4KHM A;  4KJI A;  2J6S A;  2GVZ B;  3EZO A;  1N36 J;  1RA6 A;  4ICL B;  1LQ9 A;  1N5Q A;  2B51 A;  4OZN A;  1SQF A;  4O44 B;  5HO4 A;  4HAC A;  1C4A A;  3Q83 A;  3PNI A;  2IM2 A;  2DHS A;  2JOQ A;  3G8T A;  1ZAW A;  1TL1 B;  4MYU A;  2MQL A;  1VQL S;  2YWF A;  4FBT A;  1C1C A;  3T1Y F;  5BYQ A;  3FCW A;  4K4Z A;  2MZ1 A;  4ZP9 A;  4JYA J;  3CJ3 A;  1AUD A;  2CDR B;  2ZBR A;  2YY3 A;  5FII A;  4G65 A;  4RNM A;  2Z4P A;  2FQQ B;  5H9E K;  4DQP A;  3DCA A;  3M8Y A;  3T9Z A;  8AT1 B;  2QA4 S;  1FKO A;  1PAE X;  1VS3 A;  3EZU A;  2UUC J;  3F41 A;  4HL9 A;  3GIM A;  2VOO A;  4W90 B;  3CJ2 A;  1HD0 A;  5HAT A;  2MTL A;  2GMH A;  4PQA A;  3CJ5 A;  1KLM A;  2VG7 B;  4YFU A;  1WC4 A;  1WI6 A;  4K7Q A;  5J2P B;  1FFS B;  1U1M A;  5IM0 B;  4ED1 A;  4DG1 B;  2E9Z A;  1S1U B;  2FLN A;  2VFR A;  1C0T B;  4A8W A;  4P2F A;  2FLP A;  4B9S A;  2WAQ D;  1XWL A;  2G1D A;  4EZ6 A;  2OMO A;  4RZR A;  4R8U B;  3MOZ A;  2ZH9 A;  2BMB A;  2KYX A;  4F4A A;  1MRO B;  1ULR A;  3LOU A;  3HZG A;  3ZZT A;  2RDI A;  1SH3 A;  3JQM A;  3ELH A;  1W2I A;  3IO1 A;  2ZWP A;  4URS A;  3IM8 A;  3NLC A;  3CF5 Q;  3UPF A;  4GKK J;  3QT8 A;  1VC5 A;  2V9K A;  4DV2 J;  1IM4 A;  2L9N A;  3M8R A;  1UAW A;  4JI6 F;  3UN2 A;  2DH8 A;  5CD4 H;  2AJ1 A;  2G2Y A;  3ITH B;  4J9V A;  3DLG B;  3CPW R;  1FCA A;  1NLK L;  3FRZ A;  4EU0 A;  1HQU A;  1RZM A;  4LSN A;  4OJG A;  4C8Z A;  4FYX B;  2E44 A;  1RTI B;  2UV8 G;  4WK3 A;  4QYZ J;  3N4W A;  3MED A;  4A8X A;  2KT5 A;  5DQH A;  1FRM A;  4Q2M A;  4ECW A;  3ZTQ A;  3NNC A;  2HAI A;  4CH1 A;  4U7U D;  4JI6 J;  2EEY A;  2OPP B;  1YI2 S;  5AT1 B;  2J0Q D;  2W24 A;  1R6V A;  2BKN A;  1NRK A;  1TR0 A;  1YTY A;  1PC4 A;  4PG7 A;  2BOA A;  2KN4 A;  1XIQ A;  2EXU A;  1X5T A;  1X0F A;  1RKJ A;  1H7X A;  5HN0 A;  4ED4 A;  3W5X A;  3RB6 A;  1IBC B;  4Q44 A;  4FNI A;  3QFW A;  1O6X A;  1URR A;  2HK3 A;  2CJY B;  2B4O A;  3RJM B;  4JI2 F;  2J0W A;  4LFB F;  3DGP B;  3CC4 S;  3D1Q A;  2HS4 A;  1SQE A;  5EWG A;  3G86 A;  4Y2M A;  2ZVI A;  3JTP A;  1UEU A;  1QD1 A;  1HNX F;  4PEO A;  2DXF A;  3KJQ B;  1LOU A;  2LYV A;  5DET A;  3V6K A;  2V68 A;  5D4N A;  2ZC3 A;  3LAN A;  5CZX A;  2HRT A;  1A0O B;  1YSJ A;  2BAC A;  2CNK B;  1WF2 A;  1WF1 A;  2PMW A;  2CPZ A;  3BSC A;  4O4R A;  2HBZ B;  2HLU A;  4WU3 A;  4WKY A;  5LXR A;  4QIE A;  4I2P B;  2EBG A;  2WK4 A;  4OFZ A;  1VBK A;  1XNQ J;  3CCV S;  2ZJP Q;  2D3O 1;  2VH7 A;  5DZ7 A;  5G0R A;  2AJ2 A;  3PXG a;  3F0N A;  5J1N A;  3W63 A;  1HNX J;  1HD1 A;  3D67 A;  4HT5 A;  4USH A;  1H7W A;  2KO1 A;  3B82 A;  2B8P A;  1IBK F;  1IQT A;  3GG1 A;  3M2U B;  3TA0 A;  4DR6 F;  3UE2 A;  4EBE A;  2ZNY A;  3OV7 A;  2SXL A;  4ZPW R;  2AHO B;  2CWX A;  1P9Q C;  2RRB A;  1RHJ B;  1VQS A;  1HQ2 A;  2JEI A;  2EVZ A;  1U8S A;  2QN6 B;  4YP3 A;  4ANE A;  3B4D A;  3IP0 A;  2H65 B;  3EJM A;  3D6T B;  2ROP A;  4F0K A;  3CCR S;  5L38 A;  4V19 X;  2LU2 A;  5L39 A;  4DUY F;  2V8V A;  1SL1 A;  4YEA A;  1GMW D;  3EYZ A;  1EET B;  2J9E A;  3D7S B;  4P72 A;  3H4D A;  2AMC B;  1UL3 A;  3BN7 A;  4AXI A;  4C7Q A;  2A18 A;  5KFM A;  4DR6 J;  3BJY A;  5HBM B;  2NPI A;  2VZ9 A;  4EZ9 A;  3C14 B;  3DOM B;  2XG8 A;  1SKW A;  2KJV A;  1RT6 A;  3PV8 A;  1LFW A;  1QAJ A;  3FCH A;  2AZ1 A;  1WOP A;  2CJA A;  1OQ3 A;  4DUY J;  2VG5 A;  2W8L A;  1TKD A;  4J9S A;  4C98 A;  3ISN C;  1X4C A;  1HW8 A;  3GYG A;  9ATC B;  1IBM F;  3AAW B;  1OMS A;  4OYP A;  1HBN A;  5IT4 A;  4ID5 B;  3RW7 A;  5SZT A;  1UA1 A;  2ZE2 A;  1YK9 A;  4YHH F;  3DLH A;  4FBU A;  5CYJ A;  2K1R A;  2COL A;  1Q0N A;  2R2U A;  2OI2 A;  3KK3 B;  2C2N A;  4Y2C A;  2GA7 A;  4TU7 A;  3CC2 S;  1IVZ A;  3POT B;  3MOJ B;  4WJB A;  4DPY A;  3ZTR A;  3LGN A;  3MEE B;  1EP4 A;  3E51 A;  4F0M A;  1CJU A;  1TQL A;  2YTC A;  1RT2 A;  4GRS A;  5FD1 A;  2L41 A;  3K5N A;  1IBM J;  1TK5 A;  2U1A A;  4ZVP B;  2RIJ A;  2NXC A;  1S1X B;  4A47 A;  4AL7 A;  1FNM A;  1HKA A;  1FT8 A;  2B8Q A;  5DG7 A;  1WF0 A;  1KON A;  2OPQ B;  4CRJ A;  2IAJ A;  3I32 A;  4CO2 A;  1RWX B;  3SQG A;  2I5J A;  2YXL A;  2BW7 A;  2W8K A;  1FVS A;  4F3Q A;  5LSL A;  4NA1 A;  1UWB B;  5AE2 A;  1H98 A;  1LEO A;  1UWA A;  2AYB A;  2HGN A;  4DV0 F;  3AOB A;  2CWK A;  4RBU A;  1XMO J;  2OEJ A;  3BRE A;  1CQN A;  1U1P A;  2M8D B;  3FK4 A;  2L9D A;  5IXU A;  4L3K A;  4PPZ A;  1S9E A;  1KS2 A;  2FZK B;  5KFQ A;  4OYA A;  2DRB A;  4LRC A;  3HFK A;  3ZZ0 A;  1H0H B;  5IWA J;  1Q5Y A;  3MHY A;  1WC1 A;  4CH7 A;  1S5Z A;  4OLP A;  2DGS A;  3ZZU A;  2BAN A;  4WE1 A;  3MR2 A;  3KUH A;  3KMQ A;  3BBF A;  3I9V 9;  4PCQ A;  1EIY B;  5ETL A;  1NJX A;  2O01 C;  2UZA A;  4DV0 J;  4M5J A;  2K3K A;  2HVI A;  4TKT A;  3D3B J;  2Q6C A;  4ZVQ B;  2C2K B;  4NRU A;  4ER8 A;  3N6N A;  1NK9 A;  2IHR 1;  1S9G B;  2B43 A;  4NCA A;  3MPV A;  5A8R B;  1HNI B;  1VQ7 S;  3V5R A;  1B3T A;  1RT3 B;  3AJD A;  2YWE A;  1AFJ A;  2M88 A;  3T1A A;  3R27 A;  1EAY C;  3UI3 A;  1VQ9 S;  3I96 A;  1RTH B;  4HH1 A;  1ZAV A;  4RJV A;  1RWM B;  2P9G A;  5LSO A;  3LAM A;  1NB2 A;  1MG7 A;  2R8H A;  2IYI A;  3KDO A;  2B6A A;  2GMJ A;  3NY0 A;  1BQM B;  2V0N A;  4YR0 A;  2IM0 A;  1L3T A;  3TVZ A;  5L1L A;  1SJ1 A;  1CUL A;  1HFE L;  1H38 A;  3GV8 B;  4CT9 A;  5DQI A;  2UXB J;  4C2M A;  1TMM A;  4WXW A;  1NCL A;  1M90 T;  3JAM U;  2WOM B;  4FF1 A;  1JJC B;  3IGN A;  2BQR A;  4K59 A;  1I6J A;  4ZLJ A;  2ACY A;  2QLJ B;  2XO6 A;  1TTH B;  2HMI A;  3D4J A;  2V8H A;  5CAA A;  5EUH A;  1RT5 A;  5K8N A;  1D0E A;  3Q0A A;  4ZPT R;  3BN4 A;  1YJN S;  1LWX A;  5KFY A;  3AY0 A;  4LSL B;  3ZTS A;  4OV6 A;  4AUK A;  1NJW A;  2GW8 A;  3PW4 A;  3LUY A;  2M3D A;  1ZM9 A;  3GG0 A;  2YWW A;  4OZ1 A;  1SPB P;  2G13 A;  4NLT A;  2Z2M A;  2OIH A;  2JJ4 D;  2NRE A;  4YR2 A;  1TUG B;  1JNZ B;  4QWB A;  2GVD A;  4M5M A;  3UDC A;  3QWU A;  1ZPW X;  4LBH A;  4DCO B;  1MMN A;  3LP1 A;  3MM7 A;  2BJ8 A;  3CVK A;  3D54 A;  4U8V A;  3K57 A;  3X1L B;  3TX0 A;  2JC1 A;  3H42 A;  2CZ9 A;  2IPO B;  1SKU B;  2GHW A;  2ERR A;  4F4X A;  2XY7 A;  3MM6 A;  2BVZ A;  1WSR A;  2DB1 A;  3W9H A;  3QAT A;  3I6P A;  1S72 S;  3NOC A;  4ZVU B;  2B9X A;  3M1V B;  3RGI A;  5LMU J;  2HS0 A;  4EI2 A;  4IDK B;  4OYZ A;  4R0E A;  2IRX A;  3QYY A;  1FXD A;  5D0H A;  4KKO B;  4J7C A;  2V67 A;  5ETO A;  4J9R A;  4FXW A;  4DU7 A;  1APS A;  3JQJ A;  3H5U A;  1H6K X;  3P8B B;  3AA8 A;  4IQM A;  1FE4 A;  5HJY A;  1CBK A;  4DPX A;  5HP1 A;  2LU1 A;  4UUX A;  3D5M A;  2H54 B;  2KVI A;  1U1K A;  3THP A;  3GFZ A;  1RXO B;  1UW4 A;  1FX4 A;  1S6P B;  3LP0 B;  1F3V A;  4OHY A;  4F4Z A;  2KHD A;  4DF8 A;  5ETT A;  1NK5 A;  3LGM A;  2PEH A;  2WRM A;  5KFH A;  1HR0 J;  2BRL A;  2Y0S D;  4M5N A;  3R5C A;  4NYZ A;  4DR1 F;  3OJU A;  2OEK A;  1WEL A;  3T9N A;  4LRD A;  4N56 A;  1FJC A;  3I0R B;  3IAS 9;  3D0H E;  3VZH A;  1HMV A;  4ED7 A;  2L9W A;  2UXD F;  2HQ3 A;  3BH6 B;  4DJB A;  2CUY A;  4BDP A;  1CS4 B;  2AJ4 A;  3G96 A;  2CYY A;  2NXN A;  4KSE B;  3I31 A;  3OQ2 A;  3M8P A;  1YDL A;  3K5L A;  3LTO A;  4EO8 A;  2QGF B;  3PX4 A;  2CJB A;  2Q43 A;  2DXE A;  4RW9 B;  2QZ8 A;  4BBY A;  2NXE A;  2H5E A;  4DR1 J;  5H9F K;  3DRR A;  4CLU A;  3V4I A;  2O66 A;  2UXD J;  4USJ C;  3GQC A;  5HJX A;  3K8V A;  5GAH U;  4PXD A;  2UUW A;  2XO7 A;  1M1K T;  1VQ4 S;  5GMD A;  4Q0B B;  1LKZ A;  5HVH A;  1KNZ A;  1OIA A;  1Y5I B;  4NLQ A;  2NZC A;  1KSP A;  2IYG A;  4OV1 A;  3HLU A;  3DLJ A;  2IVY A;  1XR5 A;  3ET6 A;  1FWL A;  4KIA A;  4AXJ A;  4IFY A;  3MAA B;  2ZZT A;  4X64 F;  2CQG A;  1PKU A;  3I0S B;  1Q53 A;  1L3U A;  1NKB A;  4KGV B;  2VBZ A;  2HHQ A;  1K47 A;  2KRB A;  3R7B B;  1RJJ A;  2QMX A;  3R5G A;  4X4S A;  3G6X A;  1VRU A;  3W65 A;  3M2R B;  3H2V E;  5KG2 A;  2JRS A;  1OYD A;  1QAI A;  3RRK A;  4NZ7 A;  1R27 B;  4BWM A;  5FLX Y;  2XI3 A;  2P6S A;  3TOQ A;  4Y6I A;  4MKV A;  4YB1 P;  3H4B A;  4C8M A;  2XM3 A;  4DV3 J;  1OSD A;  4ZS6 A;  2R7U A;  5FJ4 A;  2DCU B;  2QSW A;  3AFG A;  1KTQ A;  3JS9 A;  1WDT A;  3MPU B;  4MIW A;  3NS6 A;  5LXY A;  4X64 J;  3TI0 A;  3Q2T C;  2YQ1 A;  4X62 F;  4OX7 A;  5HMZ A;  1TUW A;  3P6Y C;  2KFY A;  4H4O A;  3OVA A;  5JUM A;  3TAR A;  2V9W A;  2I9S A;  2ZVS A;  4TY8 A;  1OJ4 A;  4AQY J;  1LNQ A;  4B9V A;  2VPZ B;  4RUH A;  2P2C B;  3Q8Q B;  2XZW A;  4CM0 A;  4O3Q A;  1TVR B;  5KFG A;  1JLA B;  3JYT A;  3MM5 B;  4I68 A;  3IBF B;  4HDG A;  3KYL A;  4F4W A;  5F8H A;  4LQ9 A;  3JTN A;  3RYL A;  1OPZ A;  5B08 A;  2BA9 A;  4OYB A;  5KG3 A;  5CYQ A;  2VD3 A;  3M8S A;  1W25 A;  4ZLP A;  4GVB B;  3UVJ A;  2HZV A;  2ASJ A;  4X62 J;  3UQS A;  3DYA B;  3BGU A;  1YHQ S;  2ZUA A;  3GWC A;  2X1B A;  1EB0 A;  1FDA A;  2CPH A;  3FEY B;  1WKL A;  3MXH P;  2AYE A;  2HHH J;  4ENO A;  1T11 A;  2E1M C;  1J5O A;  1B64 A;  3L09 A;  3CDW A;  4A48 A;  3FSY A;  3VWS A;  5HVG A;  3HKZ D;  1EQ0 A;  2VU5 A;  5E3A A;  2V69 A;  4RUA A;  3TUP A;  2AF6 A;  5F8J A;  4OI4 A;  2OP5 A;  3QJL A;  3HP6 A;  1T03 A;  5KFK A;  4BC7 A;  2HLT A;  3KOA A;  2A3J A;  1YBU A;  1FKP B;  5ETR A;  2MKC A;  4LQ3 A;  4IH5 A;  1E6Y A;  2M4M A;  5KFS A;  2BE2 B;  4NZ0 A;  1VC0 A;  5ETP A;  1HNZ F;  5CXT A;  1RAA B;  3UR0 A;  1AFI A;  1D3W A;  5KFO A;  2ZH5 A;  4K2J A;  5B0F A;  1JLG A;  3ISZ A;  3GCX P;  1U48 A;  3RRG A;  4PWW A;  3FJ2 A;  4CDI A;  1S0N A;  4QPX A;  3WX4 A;  2WSE C;  3PKM A;  3MM8 B;  1FDN A;  1XN9 A;  2N4D A;  3KDN A;  4IFV A;  1UKU A;  2Z8Q A;  2H3E B;  1KTV A;  4P52 A;  1RAH B;  3CJQ A;  2VL1 A;  3ZNJ 1;  2R7W A;  5KFU A;  3FFI A;  1CJT A;  1SIW B;  5DM7 Q;  4DEZ A;  2R8G A;  3IS9 B;  2LA4 A;  1ELO A;  1EZZ B;  3W2V A;  1WTB A;  3W7B A;  1CC8 A;  2VC1 A;  3ZZO A;  3H59 A;  4NA2 A;  2YH0 A;  2NSB A;  2PMZ D;  3J80 Y;  4NLR A;  3K2Y A;  1C0U A;  1UZH A;  4FP9 A;  3B54 A;  3KLF A;  2HNY A;  4LF2 A;  4WP9 A;  4OJH A;  2C2M B;  2W25 A;  2L48 A;  3EVW A;  1WG4 A;  1FTR A;  3LW5 C;  2QA2 A;  3IR5 B;  1IKV A;  2X1F A;  2Y3Y A;  2QG9 B;  4AD6 A;  2E5L F;  5KFV A;  1JNR B;  2LCW A;  1DTT B;  2BYC A;  4HTI A;  2AYM A;  3CUN A;  3OFE A;  1WKK A;  2MHN A;  4H4K C;  2M2B A;  4LF7 F;  2FVQ A;  2B56 A;  1N5Y A;  1WJ9 A;  3VQS A;  3IG1 B;  3FQK A;  3DOL B;  1TL3 B;  2HVE A;  3HHL D;  1H74 A;  5F0U A;  2UUA F;  3DOK B;  2VQE F;  4O4G A;  3TZZ A;  1SJ3 P;  4YR3 A;  2YVS A;  4F04 B;  4J37 A;  1TFW A;  5HAO A;  4DBQ A;  1RTJ B;  4WTO B;  3GIJ A;  5D77 A;  1M0S A;  5D3G B;  2W7O A;  2ZFH A;  3KUE A;  2AEJ A;  4XDC A;  2AV5 A;  4WK1 A;  2GC8 A;  2E1R A;  2J0X A;  5T41 A;  2DHA A;  4OHW A;  2DGQ A;  1V6H A;  2FHO B;  3TO8 A;  1FD8 A;  4KAI A;  2F40 A;  4LF7 J;  2ATL A;  1N0V C;  4OX8 A;  4X4Q A;  2AGP A;  3C15 A;  3SCJ E;  1AUS L;  5I3U B;  3PW5 A;  2QL9 B;  2QYG A;  3MDF A;  2UUA J;  1NB7 A;  1PG5 B;  5LM7 E;  2ZH7 A;  3NGT A;  3SIP B;  4YUD A;  4J9K A;  2IC3 A;  3VAF A;  1U7L A;  3IRX B;  2B4U A;  2D1C A;  2OEL A;  2OPS A;  3G82 B;  4C0B A;  3KG0 A;  4HTJ A;  2IA0 A;  2Y1L B;  3UD4 P;  1WKJ A;  3BGF A;  3CUL A;  2W7A A;  4RWX A;  2GVD B;  2AQ4 A;  1JJ2 R;  2AJQ A;  3EDQ B;  2VG6 A;  1GFW B;  1MLA A;  2NR0 A;  1X31 C;  4DU8 A;  1Q1K A;  1VIX A;  4OHZ A;  2MZQ A;  3KG1 A;  3W8P A;  3OL9 A;  3VGU A;  3WQP A;  1REV B;  2CQ4 A;  3QIP B;  2LXU A;  5SUH A;  2ZD1 A;  1JLE B;  3BDE A;  2M0G B;  1FRL A;  2HFZ A;  3AQO A;  1NSQ A;  1RWU A;  1YQH A;  1UFL A;  2J8A A;  2WSC C;  3BYR A;  1BLU A;  2YKQ A;  1AZS B;  3JSY A;  1IUJ A;  5KFP A;  2Z30 B;  2YKP A;  1TMJ A;  1Q7Y T;  1NO8 A;  1YRU A;  1QSL A;  2WTF A;  2MLY A;  4F7V A;  1RAG B;  1G4C A;  4XK8 C;  3F73 A;  3C19 A;  3KLI B;  3MPD A;  4IO9 Q;  2EFP A;  2RB7 A;  2CJX B;  1AA1 B;  3JXO A;  1HNV B;  3TX8 A;  3OXG A;  3QT6 A;  4O3N A;  1MWQ A;  1KHV A;  2VPX B;  1CLF A;  4LIW A;  3LAL A;  3VVT A;  4DXL A;  4NAS A;  2RF2 A;  5F9N A;  3B8H A;  4ZJO A;  1YBA A;  4MFB B;  4B3T J;  5IFM A;  2XLI A;  1ZH5 A;  4P7V A;  4ZVT B;  1VBY A;  1VQN S;  1SUQ B;  4DUZ F;  3I55 S;  4DR2 J;  3U7J A;  3SCK E;  3CO0 P;  1WG1 A;  2D9O A;  2IFX A;  4O3O A;  5K5M A;  5HQL A;  4B3S J;  3GJT B;  4GVL A;  3ZZP A;  4PG6 A;  1GH8 A;  3KLG A;  3CCU S;  1MNE A;  2EG2 A;  2CQ2 A;  4IG0 A;  1HAR A;  2Y8W A;  4LFC J;  3BPS P;  1WNE A;  3AD8 C;  3DLK A;  4PUO B;  5CH7 B;  1OQ6 A;  3SEO A;  3QO9 B;  1QE1 A;  4Y34 A;  2ZM6 F;  1FD2 A;  4FXD A;  4TQR A;  3GFH A;  1M5V C;  3ENA A;  1LFP A;  1YJ7 A;  4DR5 F;  3V81 A;  4DLG A;  2F1F A;  4DUZ J;  1Y7P A;  2YWG A;  4X65 F;  1HA1 A;  2ZBC A;  3E2E A;  4UT4 A;  1TU0 B;  4OZL A;  4MIB A;  3R97 A;  2Y8Y A;  1U0H A;  4PYD A;  3VR1 A;  2KFN A;  3DHX A;  1M5O C;  2HNZ B;  5AE1 A;  1OYE A;  4Y2K A;  3DRP A;  1BHN A;  1RA7 A;  3BPD A;  2FZC B;  5CHC B;  1B7F A;  4FYY B;  3MEG B;  4OJ1 A;  2EFV A;  4DR5 J;  1HWK A;  1KC8 T;  4J91 A;  1HBM B;  3AOD A;  2KRR A;  5J1E A;  5BR8 F;  3EM1 A;  3G8S A;  3V2U C;  4X65 J;  3OTO F;  5EX3 A;  4YQW A;  3L9Z A;  2HRU A;  5B0D A;  1IR1 A;  4CTA A;  1KQF B;  4WIQ A;  2BE9 B;  2V4J B;  1JXE A;  4Y65 A;  3NOG A;  5KFE A;  1HHQ A;  1UVM A;  3CIM A;  3EPI A;  2NS1 B;  3WC0 A;  2PDA A;  3UW1 A;  2V34 A;  4WII A;  4ZHR B;  3PW2 A;  1Q8I A;  2W9B A;  3E3X A;  4DCP B;  5HMY A;  4CH0 S;  4FXV A;  3GV7 B;  4B9N A;  2Q3P A;  2B4P A;  5BR8 J;  2MJN A;  1D8Y A;  2YNI A;  1KOO A;  3GYX B;  3OTO J;  2HPU A;  2FHK A;  5JVG Q;  1RLD A;  1U1Q A;  2GGP A;  1TKX B;  1UJ5 A;  2DJW A;  1SB6 A;  4F3M A;  5HMX A;  1X8D A;  1LV5 A;  4I4B A;  1XER A;  2W9A A;  4EYH B;  4TXS A;  2ZUG A;  4C8O A;  1AW0 A;  2QLF B;  4RW7 A;  4IH7 A;  4C48 A;  1U49 A;  2YNG B;  3L4B C;  2IRY A;  2XMU A;  5D15 A;  1VLY A;  3LO3 A;  4ERD A;  4OYO A;  3RBZ A;  3C8Y A;  3HZE A;  5CYM B;  2YPY A;  3TVK A;  4JI5 J;  2DGV A;  4ETZ A;  4ELT A;  5KT7 A;  5LOQ A;  1PYS B;  1K73 T;  3LP2 A;  2DGT A;  4PXE A;  5KOX A;  3DM2 B;  1S4F A;  4NE9 C;  1IQZ A;  1JLB A;  1V9O A;  3M2V A;  4Z7Y A;  1NK0 A;  3MMC B;  5T7L B;  4M5K A;  5J2Q B;  3TJ8 A;  5DO2 A;  4CO3 A;  3CXC R;  1UP1 A;  2YNH B;  2FVS A;  3UO0 A;  3KWM A;  3KK2 A;  4KR0 B;  2B3T B;  1S7H A;  2EFN A;  4ATN A;  4UZB A;  3MD3 A;  3I5A A;  4I2Q A;  1QM9 A;  2UU9 F;  4FF3 A;  4OMF G;  1FFG B;  4B08 A;  1T8E A;  4KFB A;  3UNY A;  2O67 A;  2AGO A;  4WZM A;  3CTR A;  2MKY A;  4R5P B;  2FB0 A;  3R6L B;  1GXU A;  3CE8 A;  3TUI C;  4ZP6 A;  1S99 A;  2APO A;  2XMA A;  2AX0 A;  2VFU A;  1M5P C;  3M9N B;  1V5I B;  1VQP S;  5KFZ A;  1DUR A;  4WFA Q;  4CYU A;  1KKH A;  2RRN A;  4QR1 A;  1RE1 B;  2I38 A;  3CMA S;  3UR3 C;  3JTO A;  3A12 A;  4M5D A;  2R3V A;  1FJ7 A;  1U8W A;  4ZIT A;  4XAK A;  2FPH X;  4PG4 A;  4XPC A;  2EC2 A;  2BM1 A;  1N34 F;  4GC6 A;  4ZJL A;  1JXV A;  2FUG 9;  2DKO B;  4O3P A;  2NUU G;  1K0T A;  4USU A;  5K14 A;  3SZ2 A;  1GQE A;  3FSX A;  3NNA A;  5C25 B;  4ED8 A;  3W64 A;  2YNF A;  4CO0 A;  5C24 A;  3GJS B;  1Q78 A;  3NGR A;  3R5A A;  4OYX A;  2HND A;  5E0O A;  4LF9 F;  3KMS A;  4J9O A;  1FKA F;  3HHN B;  2BUN A;  3DMJ A;  2RQM A;  2DNY A;  3UDL A;  2DR5 A;  4QQB A;  3OUY A;  5GVQ A;  2YKN B;  3E01 B;  5IS2 A;  4XTT A;  2IA6 A;  1U24 A;  5AJ3 F;  4E8U A;  4DWI A;  4IR1 A;  1VJW A;  1ZTT A;  1MU2 B;  2KB2 A;  1UVI A;  4EFA C;  2PFD A;  4NMX A;  1TKZ A;  4A46 A;  3FBC A;  4PZV A;  2DH9 A;  3LGH A;  2F9J A;  2KKH A;  4KTQ A;  4ZCL A;  4NI2 A;  2RHS B;  5F8M A;  1Y10 A;  3CGI A;  2O1P A;  1WC0 A;  4KT0 C;  2C1E B;  5ETK A;  2QE5 A;  5CCM A;  4PQU A;  2ZH8 A;  4X4U A;  2CAJ A;  4JI1 F;  4WP8 A;  1KLN A;  3BSO A;  2MKS A;  3W66 A;  1PJ6 A;  2HWH A;  4AYB D;  4RWW A;  4YB5 A;  1VI7 A;  2EI5 A;  1HYS A;  2R7O A;  5L9X A;  4QOT A;  1Z2Z A;  4P9S A;  3H2U B;  5DZ6 A;  3QT5 A;  4UZC A;  2HK2 A;  1J5E J;  3M8Q B;  1SI9 A;  2BEF A;  3R1L A;  1JLF A;  2ZH1 A;  4RL1 A;  4X4R A;  3DGV A;  1RT7 A;  3NCR A;  2D9P A;  4K4Y A;  4TN2 A;  4JI1 J;  3HD2 A;  1SJR A;  2Y1J A;  5HVF A;  2XLK A;  4NLX A;  3SDE B;  1DBD A;  4CQ1 A;  3MCM A;  3CW2 C;  2RML A;  2B7C B;  2DPI A;  3KHR A;  1RT1 A;  2QRR A;  1ACM B;  4PRF A;  3R9L A;  5KT6 A;  1QAX A;  4M5L A;  3B4M A;  1TL7 A;  1ZYQ A;  1JJ4 A;  3BDP A;  2MLZ A;  3CMQ A;  4JI8 F;  3C16 A;  3TZW A;  4Y3C A;  3CJK B;  3O3L A;  4X84 A;  1X4F A;  4FKY A;  2W4C A;  2V4R A;  1B0T A;  2AEF A;  1X5O A;  3EIC A;  1XNR F;  1S77 D;  4QJV A;  5IV4 A;  3C46 A;  2B5J B;  5ETM A;  4N7T A;  1VRQ C;  4YY3 F;  3KG4 A;  1VFJ A;  4OL8 A;  4H4M A;  4ZIV A;  4OYI A;  2C2E A;  3HI9 A;  3KLH B;  5DG8 A;  4WFN Q;  1NZ8 A;  4F36 A;  2OPR A;  1U4B A;  1RYS A;  1RAO A;  2XMJ A;  3LQV A;  1TKT A;  4Z7C A;  3OSN A;  2HFO A;  1U0S A;  4IYQ A;  1R7I A;  4OZ3 A;  2RHQ B;  4CLS A;  2P8I A;  1WI8 A;  1XC9 A;  2FHJ D;  1CQM A;  2IJN A;  3A8E A;  1RAD B;  3M8W A;  1XNR J;  3J7A N;  4DFJ A;  4FPI A;  2R7X A;  3TJA A;  1ZOT A;  4YY3 J;  1YJU A;  4TY9 A;  3G2X A;  5A8W B;  1NK7 A;  1YJT A;  2G0C A;  2V2V A;  3QPI A;  2LEP A;  1TAQ A;  1WEY A;  1NU4 A;  1R6Y A;  3PHE A;  1WHY A;  4MYT A;  4K50 A;  3W2W A;  4RNN A;  3PY8 A;  1TK8 A;  2W1B A;  2DNL A;  4FZV A;  3VAK A;  3J7Z 5;  2C3U A;  2E66 A;  1HWU A;  4RW6 B;  2FC8 A;  4EBD A;  1WUU A;  3QGH A;  4ED0 A;  1FRX A;  2J6T A;  1WWH A;  1UCN A;  4CLK A;  2I2Y A;  4C6A A;  3VHQ A;  1IKW A;  5A8K B;  1PSD A;  5JVH Q;  2YX1 A;  1ZZF A;  4IUF A;  4ZLN A;  2W2P P;  4Q8F A;  1HWI A;  3H2L A;  3UN3 A;  2F4F A;  2O5D A;  3CCJ S;  5C7P A;  2WBM A;  4DPU A;  4DSF A;  1SKS A;  2GJI A;  1OY8 A;  3TAQ A;  2FYX A;  3RAQ A;  2ZH4 A;  4KV8 B;  5E7O B;  3HF5 A;  1JK9 B;  3MR7 A;  3TRG A;  2X1G A;  4FF2 A;  1UFW A;  2H5J B;  5GAG I;  3G6E S;  4NXN J;  2FIU A;  3MEC A;  4QIW D;  3HFV A;  4PWD A;  2CVE A;  4OYM A;  3PAC A;  1NME B;  1S1W B;  2MZJ A;  4G3I A;  1GEH A;  1DTQ A;  2HWI A;  1N8R T;  4N8O A;  3SV4 A;  3C66 A;  1QTM A;  2DY9 A;  2W2M P;  3QT7 A;  2WSF C;  2FGO A;  4G1Q B;  3HSZ A;  4NEY A;  2LVW A;  1S7I A;  1FHT A;  1IKX B;  2PI4 A;  3GIR A;  2HQD A;  1IKY A;  3FGV A;  5I42 A;  4ZA1 A;  1JLC B;  4F4Y A;  5B7W A;  2FDN A;  2R2S A;  2MGZ B;  1T9W A;  4C11 A;  3TAM A;  4D3G A;  1RAE B;  4CO4 A;  5F3T A;  1Y3K A;  2HFU A;  4YOE A;  1LWF B;  3FZ2 A;  2HBR B;  2CPJ A;  2VPY B;  3H5Y A;  2FHM A;  1WD6 A;  3K7R A;  1M1G A;  4IRD A;  4DV7 F;  5L1I A;  2LP4 A;  1NM2 A;  1T9T A;  2Z2Z A;  3BQ2 A;  1UPP A;  2BR0 A;  1VRT A;  2GO9 A;  2QMU B;  2PA8 D;  4CZC A;  1MML A;  3V6H A;  1U47 A;  3VGV A;  1WG5 A;  3ILI A;  1CEZ A;  4LF8 F;  3K59 A;  3ENQ A;  3BR9 A;  3BSA A;  1GK8 A;  3ZZY A;  4XO0 A;  3CCM S;  5F9L A;  4YB7 A;  1WHX A;  1YGY A;  2CNL B;  5HRO B;  2KHC A;  1S76 D;  4U95 A;  1FES A;  2G4B A;  4OZ2 A;  1BMQ B;  2R7V A;  1IBL F;  4B9T A;  3H7H B;  2XBP A;  5LMN F;  2K06 A;  3C6U A;  2RKI A;  4WFB Q;  2OLW A;  2V6A A;  2VBW A;  4JP8 A;  5J2M B;  1O51 A;  5KG1 A;  5HQM A;  4O23 A;  3OR2 B;  8RUC A;  3C2P A;  5D6G A;  1RKI A;  3EGN A;  3MM9 B;  5F8G A;  1T94 A;  3KNG A;  1R0A A;  4DV6 J;  2JLG A;  2V2Q A;  2DNO A;  3M32 B;  2A6M A;  3LH2 S;  4J9U E;  4OLO A;  5C42 B;  1FDB A;  4C3M A;  2HQI A;  2R7Q A;  3DI6 B;  3QGP A;  3DRY A;  3Q86 A;  5BJR A;  4DSE A;  5LMN J;  1V3Z A;  5LT5 A;  5HLF B;  3MUR P;  4DZ6 A;  4LR8 A;  2Z2L A;  3IBW A;  1JLQ B;  2AGQ A;  2OTL S;  2HFN A;  3BQ1 A;  4LSZ B;  1K0V A;  2OEM A;  2WB1 D;  4ITS A;  1KFS A;  4RW8 B;  2FJB B;  1FO1 A;  3S6E A;  3EX7 B;  1S48 A;  2F4V J;  2JL9 A;  2XSJ B;  3LPY A;  1YX2 A;  2XYH B;  4K4T A;  3NGS A;  2DR6 A;  1G1X A;  2UUT A;  1XTZ A;  4DV1 F;  2N7C A;  3GMG A;  3JSR A;  4F25 A;  3V6D A;  1YZ6 A;  3Q8U A;  4WTY A;  3BSN A;  3CJ8 A;  2HBQ B;  1F1B B;  5D0G A;  3AJ1 A;  3W60 A;  2OHD A;  4ZPA A;  5HQ8 A;  4FF4 A;  2YQ0 A;  5KFF A;  4G6V B;  1FJG F;  4NCG B;  1E6V B;  4IQX A;  4GMK A;  1R43 A;  4R25 A;  4JI7 F;  1BGX T;  3R1H A;  3AB2 B;  2VQF J;  1SIZ A;  3IC1 A;  1LW2 B;  2MMY A;  3MMB A;  4LMZ A;  3D0G E;  2GNK A;  2IDE A;  2XC9 A;  1ZET A;  1FE0 A;  4N41 A;  4DCJ B;  2QX0 A;  1Q8L A;  1CJK A;  2LEA A;  5IT9 U;  2ASL A;  3BKU A;  4HT7 A;  2J7W A;  1M5S A;  1HPZ B;  3O8W A;  4ECQ A;  4RR5 A;  3V6J A;  2RRA A;  1DLO B;  4RW4 B;  1N5V A;  2IM1 A;  5KTQ A;  3T1Y J;  3NBP B;  3UWT A;  3EGV A;  2FVC A;  1VR6 A;  1AB8 A;  4JI7 J;  2OSR A;  4FVC A;  4M5G A;  5D4O A;  4B02 A;  2Y1R I;  3QZ7 A;  1RCO B;  1MMD A;  2CQB A;  3NRB A;  4JBC A;  4DX7 A;  2DR8 A;  3R5B A;  3D2W A;  3FVY A;  2H48 B;  1VQY A;  3BF4 A;  2FTR A;  9RUB A;  3CCS S;  2W2Q P;  4PG8 A;  2PGC A;  3HHE A;  2FGC A;  4ZPV R;  3A13 A;  2WCX A;  2OUG A;  3M9O B;  1VMB A;  3NGD A;  2CPF A;  3J81 j;  2G0J A;  2NSC A;  2KM8 B;  2XI2 A;  1VC6 A;  2LA6 A;  1ZZN A;  1N6Q B;  2YBV A;  3ADA C;  4P7T A;  2MDA A;  2J7K A;  1SH0 A;  3QLH B;  4DR7 F;  3WIU A;  4QW9 A;  5A0Y A;  3J7Z T;  1T05 A;  5HSP A;  1DQ8 A;  1JKH A;  1P1L A;  5M2U A;  2XYP B;  2DIU A;  1U6Z A;  1JIH A;  2HHV A;  3BGO P;  5D4L A;  3HHL B;  2G9O A;  3MCO A;  4F8R A;  1Y11 A;  2EWH A;  4QWA A;  3P5T L;  2RJZ A;  3PHT A;  3AJ2 A;  3QSI A;  3MCS A;  2QV6 A;  4ZVG A;  5IC4 B;  1S6Q A;  2BXJ A;  3F44 A;  3LF0 A;  2E1C A;  4MK9 A;  4GKJ F;  2D7S A;  2IVM A;  3LAK A;  1TV6 A;  3P96 A;  2MST A;  2AZ3 A;  1SV5 B;  2E9T A;  1TL7 B;  3THT A;  1SJ4 P;  2E1A A;  4LUB A;  4EUV A;  2LEC A;  5L1J A;  1C1B B;  2VAS A;  3Q23 A;  2QA4 G;  2P5V A;  1BE4 A;  2XLJ A;  4ECV A;  1RP5 A;  1REG X;  3KLE B;  3GE9 A;  2YPZ A;  1RT4 A;  1VLO A;  5IOL A;  4KY3 A;  2DNP A;  4AFF A;  1RU1 A;  2RE1 A;  3BYP A;  4F02 A;  4DX6 A;  1S1T A;  3FNN A;  3OR1 B;  2OAU A;  1Y5L B;  2FY8 A;  5EDW A;  5J2N B;  3DRS B;  3BO3 A;  4GKJ J;  3MMA B;  2J9D E;  1QAY A;  4WKR A;  2BJ7 A;  2IJR A;  2EBE A;  3H0P A;  1CJV A;  5EN1 A;  4CM2 A;  4V19 J;  4K8R A;  3DLE A;  2ZWO A;  2QLX A;  4ZLL A;  1LW0 A;  1HQE B;  1WDD A;  4IG3 B;  2NXU A;  1XQI A;  1X9M A;  5KT3 A;  3M30 A;  4R0J A;  1UVN A;  4A8Y A;  1RTD B;  2HQF A;  5H1S V;  4QWC A;  3SSS A;  2MQN A;  3O6Q A;  1HBO A;  3M7V A;  4DSK A;  4FS1 A;  1S1V A;  3M4X A;  2N4C A;  3RR7 A;  2BM0 A;  4JI2 J;  4LFB J;  1VIS A;  2BJ3 A;  2W9C A;  2BJE A;  4OZJ A;  1XMQ F;  4O3S A;  2GVZ A;  4ICL A;  3DLB A;  4Y2A A;  3GSD A;  4O44 A;  4NLD A;  2PE8 A;  2ASD A;  3BGR B;  2PSZ A;  3DC2 A;  3U1M A;  2BJD A;  3MAQ A;  1TK0 A;  3JB9 k; 
#chains in the Genus database with same CATH homology
 4GKK J;  1HNX J;  4JI8 J;  4B3S J;  4X64 J;  4OX9 J;  3T1Y J;  4DV2 J;  4DV0 J;  4KYZ A;  2VQE J;  4LFA J;  1HR0 J;  2UU9 J;  2UUC J;  4LF9 J;  3D3B J;  4DR5 J;  4JI7 J;  4DV5 J;  4LF7 J;  4AQY J;  4DUY J;  4DR4 J;  1IBL J;  4JI1 J;  2KVQ E;  4LF4 J;  4X65 J;  2MTL A;  4DR7 J;  2MQ8 A;  4LFC J;  4LF6 J;  1XMQ J;  5LMU J;  4DV6 J;  5AJ3 J;  1N36 J;  4KHP J;  2UUA J;  4JI5 J;  5LM7 E;  4K0K J;  3W1Y C;  4NEZ A;  3R2D J;  4JI0 J;  4DV1 J;  1N33 J;  4PWW A;  2UXC J;  1IBK J;  2MEW A;  4X66 J;  1XNR J;  3J7A N;  4NXN J;  4RJV A;  1XMO J;  4DUZ J;  5LMN J;  4B3R J;  4HHU A;  2VQF J;  4NXM J;  4YY3 J;  4JI2 J;  4LFB J;  1HNZ J;  5FLX U;  4DV7 J;  3R2C J;  3T1H J;  4X62 J;  5A2Q U;  4KY3 A;  2E5L J;  2ZM6 J;  4JI6 J;  4DR3 J;  5IWA J;  1N34 J;  5BR8 J;  4B3T J;  2UUB J;  4JI3 J;  1FJG J;  4DR1 J;  4JV5 J;  3IMQ J;  4B3M J;  4JI4 J;  4DR6 J;  4JYA J;  5IT9 U;  4NEY A;  2HHH J;  4V1A k;  2UXB J;  1I94 J;  3OTO J;  4YHH J;  3J80 U;  4DV4 J;  1XNQ J;  3D3C J;  4LF5 J;  1N32 J;  4DV3 J;  2F4V J;  1HNW J;  4DR2 J;  2UXD J;  3J81 U;  2KL8 A;  3JAM U;  1J5E J;  4GKJ J;  1IBM J;  4LF8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...