5AJ3J

Structure of the small subunit of the mammalian mitoribosome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
PEITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTKLEQLPEHIRKPIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5aj3J00
4LF9J 4NXMJ 5AJ3J 4B3MJ 4RJVA 2MTLA 5LMNJ 4DV7J 4NEYA 3T1YJ 1XNQJ 4K0KJ 5A2QU 4OX9J 5FLXU 4NEZA 3R2DJ 4DR4J 4NXNJ 1N36J 4X62J 3T1HJ 3J7AN 2ZM6J 1N32J 1XMQJ 4LF4J 1J5EJ 4DV3J 1IBLJ 2VQFJ 2E5LJ 3R2CJ 1HNXJ 3D3BJ 4JI3J 2UU9J 2UXCJ 5LMUJ 4LF6J 1IBMJ 2KL8A 4DV1J 4DR2J 4B3RJ 4GKJJ 4LF5J 4DR7J 1XMOJ 2KVQE 1XNRJ 1HNWJ 5IWAJ 4KY3A 4GKKJ 2MEWA 2UUAJ 4DUZJ 4HHUA 4DR1J 4DV4J 3J80U 1IBKJ 4KHPJ 1HNZJ 4JI6J 4DR3J 4B3SJ 4JI4J 4X65J 2UXBJ 3D3CJ 2VQEJ 2F4VJ 1N33J 4DV0J 4DR6J 1HR0J 1I94J 4AQYJ 4X64J 2UXDJ 4KYZA 4V1Ak 4JI2J 4JI0J 4LFAJ 2UUCJ 3IMQJ 4DV2J 5LM7E 3J81U 4DR5J 4YY3J 4DUYJ 3OTOJ 5BR8J 4B3TJ 2HHHJ 4JV5J 1N34J 4JI5J 4X66J 2UUBJ 4JI1J 4JI8J 4DV5J 4JYAJ 4LF8J 2MQ8A 3W1YC 5IT9U 4LF7J 4LFCJ 4JI7J 4DV6J 4PWWA 1FJGJ 4LFBJ 4YHHJ 3JAMU
chains in the Genus database with same CATH superfamily
2AEFA 4CYUB 2OO4A 3RRGA 2UVWA 5DQHA 4DV4F 3KLFA 3IO1A 1HQEB 2HNYB 2JVRA 1CLFA 3QRRA 3Q2TC 4NYZA 4Y2AA 2RQKA 4RWWA 3KXDA 4DV3J 5J2MA 1XQIA 1DBDA 2DYAA 1IM4A 2CPFA 3Q8UA 4Y65A 1NSAA 2VUGA 1MROA 3WC2A 2PMWA 3Q8VA 1RTJA 4LF8F 3DOLB 3QFHA 4M5MA 2NUUG 2QFIA 4DV4J 3MM9A 2ZH9A 1BHNA 5C5JA 2HHVA 1C2PA 4IYQA 4CM0A 3W66A 2RU3A 1UKUA 4J9UE 4HR2A 4RW8A 1OY6A 3EGNA 3WQPA 1CC8A 4LF8J 4QYZK 3W61A 4G1PA 4ALZA 4RW7A 3SQGB 3DRRA 1F0XA 3K2YA 4OYIA 4W92B 4DI6A 1RWMB 3M32A 1CVJA 2BANB 1YI2S 3B78A 3C66A 1RWWB 4CDIA 4P7TA 4BBYA 5DGBA 4JI6F 2NYIA 4B3SF 2C28A 4IG3A 4YP3A 2KI2A 4LBHA 1PAEX 4IOAQ 2V9WA 3QGHA 2J76E 1F1BB 1SVDA 4O3PA 3M2UB 2ROPA 4DV2F 1LWEA 4WBFA 4JI1F 3C14A 3MUMP 2K3IA 1M5PC 4JI6J 4B3SJ 1REVB 5KFOA 4RUHA 1X5PA 3KHRA 2PN6A 5G4DA 2U1AA 4O3NA 1JKHA 4I69A 3MAAA 5F8IA 2IJRA 4V1Ak 1U1MA 2ZNYA 4WK1A 2OGUA 4ZOSA 1DFDA 1V5VA 4DV2J 3JQKA 3Q8RB 3KK3A 3KLGA 1HPZB 2XM3A 4P71A 2CIMA 2I5JA 4JI1J 1RE1B 5F8HA 4QR1A 5J2PB 4Z7CA 2HRYA 1IR2A 2YY3A 1I1GA 2E1AA 3CCSS 4DR1F 2V8GA 4YFUA 4ZJLA 5LXRA 3HZGA 4EI2A 2UV8A 2XZWA 3TRGA 2MSSA 2AT1B 1T05A 4H54A 2LDIA 1YRUA 3CB4A 1CJUA 4BS2A 1TL4A 1RZMA 3P3DA 1DTQA 3RUBL 4F3QA 4ZKAA 2GHVC 2PD1A 3HVAA 4DR1J 3QT8A 4L6V3 2M52A 2DH7A 2H65B 1HWLA 4ZPWR 1J5EF 5CD4A 1B0PA 3CUNA 5KG6A 2DNKA 3QGGA 1S1XB 4L74A 1TAQA 4O4GB 2CJQA 3C6UB 3E01A 3M2RA 1BWEA 4CLWA 2CA9A 2IRYA 4TU9A 2BZ2A 3PY8A 2Z0GA 1HI1A 3AY0A 4O3SA 3NGTA 4OX7A 3NS7B 2KU7A 2CNKB 1C0TA 1HFEL 4PQUA 1F2GA 2YXLA 3GYXB 1OWXA 1C4AA 3AAWB 5THWA 3BM7A 1D8YA 1PJ5A 3OL9A 5F8NA 5A8RA 1FWKA 2BJ7A 3CC4S 1HR0F 2DT9A 4JP8A 4ED6A 3NNCA 2YKMA 1FKPB 2GIFA 1TUWA 4I6WA 4MIAA 1YX2A 1M5SA 3D3BJ 2V6AA 4IH5A 3RBEA 5E3AA 5SZTA 1U0HB 1YJVA 5AE3A 3PNIA 3I4PA 2X7IA 2DRBA 1Q95G 4QPXA 1IM6A 1YDLA 2HS3A 1Z2LA 3ZTRA 2JC0A 1HR0J 3UPFA 1GXUA 4OZ5A 1X5TA 1IKXA 3UI3A 3V4IA 1N5YB 3GU0A 3KLIA 1Y5IB 2BE2B 1B7YB 1FKOA 2AW0A 1OQ6A 3FSXA 2OEMA 3UQSA 3OXGA 4X62F 4BLGA 3SCJE 4ZLJA 2G2ZA 4C3KA 1VIXA 2WHOA 2QZ8A 2ZH5A 2AV5A 2OPPA 3FRYA 2FLNA 4UQTA 4B9MA 1PAUB 4CO5A 3BYRA 3VAIA 1VMBA 3UR3C 4GVLA 3J7YI 2FVCA 2WW8A 3EPGA 5L9XA 3GQCA 3MEDA 4P9SA 4X62J 2UXBF 1AT1B 2Z2ZA 1NHUA 2ZHOA 3EXCX 1ZM3A 3FUYA 2GJFA 1ZM4A 4WFZA 3N6LA 3BF4A 4R8UA 2LEPA 1QAXA 4PWDA 1RT1B 2MQQA 3CCZA 2UXBJ 2DXFA 1WKKA 4F4AA 4EBDA 2Q1LA 3U7JA 2MQLA 4X4QA 5IFMA 1RA7A 3IMQJ 3ITHB 2VU5A 3EVMA 4C8YA 4TU8A 3OL6A 1RTHB 5EWFA 1HD1A 3MM7A 2W2QP 3V4MA 4B9LA 2HWHA 2ZJRQ 2K2PA 2ATLA 5KFTA 1Q7YT 2IJNA 3R1HA 3KNAA 1DLOB 5AXNA 1G4CA 1TKZA 1EIYB 2KYZA 3GG0A 3GIKA 1U48A 1LOUA 2JL9A 1TV6A 2A6OA 2HVEA 3HT3A 4PKDB 3B8HA 3ETMA 4RNOA 1RT6A 3MOJB 3MAQA 1X4FA 1LWCB 4ES3A 3MTKA 1RWOB 2M8DB 1H2TZ 2XG8A 4KGMA 2V5HG 2N4CA 2A18A 3W2VB 2U2FA 5JJBA 3OW2R 4J9QA 3D9BA 3I55S 1GMWA 2ZOMA 3TI0A 4YB6A 1WSVA 2JFKA 1LWFA 1JXVA 3KLFB 3D1OA 2R3VA 3TX8A 4Q8EA 3POTB 3AB2B 5J2MB 2JC1A 1T9YA 1MROB 2LVWA 2VC1A 2E9RX 1F60B 1RTJB 3ZO7A 3ENQA 2FD2A 4IRKA 3MM9B 4MIWA 3RJMB 1VBZA 2JEIA 4HHHA 4DZ6A 4RW8B 2V67A 2G0JA 4B3MF 4HYKA 2QLBB 2HZCA 2CPHA 3W9HA 5CZVA 1RWPB 3D0HE 3BDEA 2CPYA 4ZIWA 1HL6A 2YWEA 4LREA 2AJQA 3RBXA 4OZ0A 4OHXA 2MQMA 2LQJA 2LQ9A 3M32B 1FTRA 2B6AA 3NP5A 3LWLA 4QIGA 2MZRA 4Y2CA 3AD9C 3SMZA 3SXLA 2J6SA 2XQCA 4IG3B 2MKIA 2LXIA 1WC6A 3EXYA 5IT9U 4UY85 1OIAA 4F02A 4AFFA 3BBFA 3GV8B 1MWQA 4Q5VA 2PGCA 4FF3A 1T9WA 3DRYA 4W4MA 1LWEB 2GVZA 1FRLA 2RU9A 2V68A 2ZBQA 3C14B 4USWA 3LUYA 4Y6IA 5HBMB 4DUZF 1RTIA 1U2RA 1MSWD 4ECUA 5HI7A 3J81j 2WVCA 3CJ2A 1JKHB 3MAAB 5EWGA 1N6QB 1V3ZA 1SC3B 5T7LA 3DI6B 4OYAA 4CCHA 2EXUA 2P9CA 5HQ8A 3KK3B 3KLGB 1EKSA 2I5JB 2E1RA 3NCQA 4L72B 3LGHA 4JI8F 4K0KF 2W01A 3A8JA 2YX7A 4RZRA 4DUZJ 5HLFA 1NJZA 2H48B 3A8EA 1A6LA 3KLHA 2XS2A 4IO1A 2B4VA 4FBUA 4LUBA 1DTTA 2X1AA 2I38A 4OHVA 2G9OA 3M6WA 1ZH5A 2FZGB 1S4EA 4GO5X 4ZP7A 3MMCB 2MHEA 1XNQF 4NASA 3OLBA 2POKA 3TQ1A 4JI8J 2YKAA 4PXBA 2JZ5A 3DRPB 3UVJA 1T05B 1JJHA 4YN3B 1WELA 4ZPTR 5HJYA 3TUPA 3M9MB 1RAJA 1CJUB 1Q1KA 1NB7A 2HURA 3AD8C 3GIJA 2R7RA 1DTQB 2UXDF 4C3MA 4KFBA 2OMLA 2B7CB 3C6TA 5IWAF 2Q66A 1XNQJ 3H5YA 1PYSB 2C1EB 5KFQA 4UOFA 2O3DA 5MAOA 2VDIA 4CO4A 1BE4A 3R3TA 1R8HA 5F3TA 4DV0F 4K5RA 4OJ3A 1IBMJ 4WTOB 1FRXA 3E01B 2HHHF 2MLZA 4CIOA 3GE9A 5SUHA 4OI1A 5IWAJ 2VF3A 3UDVA 4IOCQ 4B9TA 1WC1A 3KOAA 4DN9A 3Q8YA 5HMWA 1C0TB 4DV0J 4ZVTB 3Q24A 1O51A 3GIIA 2FHJD 4ECZA 4PQUB 3BB5A 2KT5A 2R7TA 3A13A 1RKJA 1S99A 2PMHA 5DLGA 2GFFA 2HHHJ 1K8AT 2DTJA 5A8RB 4ECQA 4JUZA 3SCIE 2YKMB 3PKMA 5DRKA 4XAKA 5ETRA 2DNZA 2HQDA 4C0BA 5T14A 2BW2A 2CQIA 3PKYA 4OHWA 1VC6A 4OYXA 2BJ9A 1RAHB 3TVZA 4D3GA 4O3RA 2ZBPA 4EZ9A 1WHXA 3QRQA 2UV8G 2FJWA 4ZCKA 1IKXB 3NCRA 3V4IB 4J5OA 3KLIB 2CPEA 1PBAA 4N8NA 3MPVA 1B64A 1DQ9A 1FKOB 3QT5A 2DH9A 2ZD1B 1RACB 2RE1A 2FHKA 5BR8F 4OZ3A 4KHMA 2DR7A 4QZVB 5I3UA 2OPPB 3NBPA 1AFIA 4F4WA 2MZQA 1U09A 1ZTWA 3JQJA 3KJFB 2AYGA 4IQMA 3V6KA 4KYZA 2DHSA 5AT1B 2Z8QA 1WKJA 1T9UA 3AODA 5C2GA 2KRBA 1PYTA 2D74B 1UCNA 2DNLA 5BR8J 1PO6A 2LXUA 1J27A 1WG1A 2GHPA 2KYXA 1T8EA 2RILA 4ZVQB 3UWTA 1VJWA 3HXMA 2HWTA 4DSJA 1FJGJ 4HHJA 3MI7X 4R8UB 2XSFA 1NDCA 4PWDB 1PILA 1NMEB 1KN6A 5B0EA 3BQ2A 3D28A 3UCGA 5IT9Y 3A3NB 2RVJA 4ZPCA 5E5NA 4FP9A 3H2VE 1BLUA 2W2OP 1URNA 3DLGA 4M5NA 2AX0A 1JK9B 4NLQA 2DISA 2FGOA 1J5OA 2QLXA 3MPUB 5M2UA 3GJQB 3M8SA 1QTNB 1X5OA 2COLA 3MF5A 1XNRJ 2B56A 3MM7B 4PG7A 3US5A 2FY1A 1RT3A 2WSCC 3R9LA 3EMTA 1FEHA 2CXEA 2IRXA 1S9EA 5EGYA 5L8RC 4KRWA 3W60A 2Y1IA 3FMBA 1SUQA 1UVMA 3NGUA 2W4DA 1TKZB 5I3PA 1QLNA 1KDNA 3DXBA 1FDNA 3W64A 1TV6B 2Z56B 4DX8H 1X4BA 3ADAC 1UA1A 5L1LA 3A1YG 4NA1A 2ZZTA 1RT6B 2PEBA 1I51B 2WZ1A 2F3JA 3A12A 4NLXA 3IS9B 1M1HA 4BDPA 1FJ7A 2DO0A 4MK8A 1MG7A 1O6XA 2VFRA 4O4RA 2N3OA 3IBCB 4C3LA 4X4RA 4EU0A 2ASYA 2E9TA 4JI4F 3D66A 2XB2D 5B0FA 2F8EX 4ZCLA 1HIYA 4M5HA 1AXQA 2YQ1A 2UUCF 2LLZA 5D0EA 1ZS6A 5J1NA 3JYTB 4LR9A 3Q0AA 5DZ6A 3MM8A 5GMDA 4U96A 3SV4A 1Q79A 3EUNA 1YQHA 2XMWA 3PCOB 4JI4J 1BUXA 4LFBF 1Q8BA 2VBWA 5B0AA 3DLLQ 3DYAA 2VASA 1UTAA 1DQ8A 2UUCJ 5KFEA 2ALYB 3E8OA 1JLGA 1R0BG 2QIFA 3CMAS 3CCJS 2FLOA 5KFPA 1VRQC 3MXHP 5DDPC 3NWRA 2KT3A 3UR0A 1TL3A 4NCAA 4LFBJ 3QWPA 2G1HA 4HH1A 5IC4B 2HBQB 3P8BB 2HVZA 2DGXA 5KFUA 3B54A 2B51A 1WDDA 3R2DJ 2GA7A 1YJ7A 1KLNA 4U7CA 3N9UC 2AJ4A 5L9NA 1UFLA 4TY8A 2AGOA 2B6AB 2JVOA 1YJUA 3HHLA 3TJ8A 2E29A 4KO0A 4ES2A 1HNIA 1DARA 1SV5A 2ILZA 2IDEA 3ZFVA 1X31C 1U4BA 1UW9A 2RD5C 1XWLA 4K2JA 2QL7B 2W1BA 1FXLA 2J8SA 5E41A 2GVZB 4IFYA 4L3KA 3CDAA 3NAHA 1YKWA 4K4VA 3VV2B 2AF6A 4Y28C 1RTIB 3KDNA 3GTYX 2BA9A 3NGRA 4YB1P 2MQ8A 3TARA 4RR5A 5T7LB 1IQZA 4N77A 4N47A 1L3VA 1VRTA 2LQ8A 4DR6F 5KT2A 1S7IA 2C2OB 1NSKL 2W9CA 2I8EA 4EO6A 4DWIA 3H59A 2ZVIA 2DY9A 4F67A 1FVSA 3S8SA 5HLFB 3KLHB 5CAAA 1DTTB 2BKNA 1DURA 1XEZA 4FVMA 3GSDA 2VH7A 1S9GA 3BS9A 5CYQA 4MKYA 2BQRA 1UZDA 4P75A 5LMNF 2WVFA 1PIEA 3CMQA 5BYRA 3UVJB 2B9YA 3IXQA 1MMDA 4H4KA 2DGWA 4P2SA 4ZCMA 4YB5A 5B0DA 2CPZA 1YSJA 4KFBB 2K7KA 3C6TB 4GRSA 3GIMA 4FNIA 2HYIB 4RUBA 3AJ2A 1S4FA 2ROGA 3A4TA 1EETA 2GAHC 2P6TA 4WXWA 2IM1A 4U8VA 2ZJQQ 2RDIA 4HTIA 2C2MB 1KLMB 1AROP 2C3UA 2HZAA 3WBZA 1REGX 5DM6Q 4GKKF 2X3GA 4OYPA 1APSA 1S1TA 4KHPF 1TVRA 2DJWA 1Y3JA 2EFNA 3PW5A 1RAGB 2GJIA 2LDYA 2UXCJ 3RBZA 2F1FA 3I0RB 2W7OA 4UTGA 2BW7A 3NRBA 5C25A 2Y9HA 3J7A1 2HWIA 4XPCA 1Q78A 4Q2MA 4GKKJ 1YJWS 3IR7B 1XR7A 1QJHA 4KHPJ 4N56A 4QIFA 1G3OA 1U45A 3LGNA 2QA4S 2JEGA 3LP2A 2J8AA 2XGQA 2R8JA 4LF6F 2DCUB 2R9LA 3VAJA 2R8KA 4LVOP 3OHBA 2JEJA 2ZVSA 4ECTA 4LF4F 1NUEA 3C2PA 3RW6A 1FNOA 1L5UA 4S0MA 2M88A 4RBTA 1KTVA 5HSPA 2HIQA 2VFUA 2M4MA 5I3UB 1AUDA 3NBPB 4EEYA 1WG5A 3WX8A 4QWEA 3B4MA 5KFWA 3L4BC 3PO4A 2QA4G 2D41A 4LF4J 2XS7A 1HHSA 4RX6A 5HVHA 2XULA 4OZNA 3CJQA 3BGUA 1FKAF 2B8QA 2CJYB 1N88A 3BGRA 4USVA 3BSCA 3T3FA 4F2RA 2V4JA 2QLWA 3RRKA 1RT2A 4QW9A 3J80U 3WC0A 4XK8C 1R7IA 4K4WA 3K8VA 2Y8YA 4HDHA 1RWKB 3DRXA 2GQ2A 1NHKL 2G1DA 1QAJA 3L9ZA 1RAAB 2VB6A 3IRXA 4RU9A 1J5OB 1RWXB 2RMLA 1VRUA 2BDPA 1KOOA 4XDCA 4DOZA 4GC7A 1XIQA 4J90A 1SH3A 3R7BB 4U9RA 4A8MP 1RT3B 2UVRA 1KQKA 4ZMMA 2AJ0A 3KLEA 4OZ2A 1SUQB 4DEZA 2WVEA 3R97A 3UDCA 3VVUA 4TY9A 5JXSA 2KT2A 3O8WA 3RAXA 3ZTQA 2XMTA 2R7QA 2HVHA 4NLOA 2H5JB 1M90T 2RF2B 3BO4A 1HD0A 2E7VA 3V6JA 5ADZA 4KV8A 1MU2A 1WORA 2EFQA 1VQSA 1HWKA 2ZZMA 4YR3A 2JJ4D 1MNEA 2RB7A 2GGPA 1FD8A 4P7VA 2C2DA 2KM8B 3DGPB 4DL5A 1HW9A 1Q0NA 4NYPA 3Q2SC 2DNRA 2Q43A 4X2BA 1W7WA 1HWIA 4EYHB 3CTRA 2DEJA 2VKRA 1K1QA 1KSPA 5AJ3J 3LF0A 5H1SV 2IPOB 2OD4A 5EX0A 1SKRA 3IBFB 1ZBTA 3MM8B 5C24A 2FUG9 2MKSA 1LWXA 3DYAB 4OQJA 3KFWX 2WVDA 4YEAA 4L75A 1S49A 2CNOB 1VIOA 4FF2A 3QYYA 2MYFA 1CJTA 2MZTA 5E7OB 1JJ2R 3TWZA 3HX9A 3BV8A 3EX7B 3HSDA 3ENAA 2VKZG 3K57A 1QUPA 2OFHX 2RH3A 4X84A 2VJUA 2E5JA 3IAS9 2MLXA 2QTWA 3EZOA 3NGKA 2PFFB 3J81Y 2X3DA 1QDUB 4UQGA 3UO0A 2OI2A 3MR5A 4TY8B 3G82B 1O8BA 3HHLB 3HK2A 2P9GA 4DLGA 2AX1A 2AEMA 4ILMA 3JAMU 1VLYA 5KFFA 3X1LB 4KO0B 5H9EK 1HNIB 1SV5B 3G96A 3EWGA 3H25A 5J1EA 5HL7Q 4GO7X 4LIRA 4MAKA 4URQU 3VALA 3JTOA 4IFYB 4UOHA 4EO8A 2HFVA 4DSKA 4OMFG 2ASLA 2VICA 3H7HB 1V5IB 1S72S 1FDAA 2BACA 4DX7A 3I0SA 1GXTA 1N4LA 1NM2A 3R5AA 2HHPA 2HGLA 5KFJA 1VQ5S 2CG8A 1VRTB 4M5DA 4CZCA 3IBWA 1S1WA 3DFEA 4K4XA 4LSZB 4OJHA 2HMIA 3LP1A 5F0UA 1NK5A 2UU9F 4OHZA 3EGZA 3TEGA 3DU6A 1DHMA 3NMAA 3EGVA 4FPRA 1S6UA 1TP7A 3S01A 5E33A 4WCEQ 4L73A 1P1TA 1S9GB 1HBUA 5CYQB 4NI2A 1B0VA 1SKSA 2VG7A 1IR1A 3FZ2A 4FVCA 2CRLA 4RW4B 4DFJA 1S0OA 2W7AA 4ZP8A 1NEEA 1GAOA 1GX6A 2HNZA 1VS3A 3OLAA 3TUZC 2R7OA 2B9EA 4WE1A 2JOQA 2L3MA 2VIHA 2VZ9A 4K59A 3UDEA 3IM9A 3TANA 2XMUA 2HZVA 4HEA9 3I82A 3G71S 2QEXS 5K8MA 1RGVA 1EETB 4HTJA 5CZXA 3NS6A 1HLWA 1G6BA 4DSIA 1NH8A 4DSLA 3A3PB 4ILRA 4NYOA 2NSBA 4F2SA 3Q86A 3PRVA 2F8HA 1WEZA 3MEEA 3FMWA 5CCLA 2DR8A 2G0IA 1TVRB 1UP1A 1RAOA 2Z30B 4NOHA 2LA6A 2X1BA 4NLVA 3QSIA 4C97A 4K4TA 2BQUA 5C25B 2H4YB 3PRBA 1MW7A 1YGYA 3H0PA 1MMLA 3NWGA 4HI2A 4OJGA 5HROB 1EZZB 3HHLD 2VV5A 3JSYA 2ZNZA 3FCVA 1RTDB 1D9DA 2LQBA 4PPDA 1VHIA 2CQDA 1RLCL 4ZLLA 1C4CA 4B08A 2AEJA 4E2FB 5K8NA 1PJ7A 4F4YA 4TU7A 2ZBIA 1DJ0A 1RU2A 4CLYA 4QJVA 4JV0A 4M5GA 4G3IA 1CG2A 4DPWA 1FVQA 4Q43A 1S77D 4ES1A 1RHMB 2OH2A 1S12A 1HA1A 3LWMA 3CD7A 3IGVA 3F56A 3ZZTA 2ZUGA 3W9IA 3FKBA 2MKCA 1ZZFA 3CEDA 2D9PA 3P6YC 3BKUA 5DDOC 2ZH2A 5DG8A 1TAUA 3PDNA 3NAIA 2HQCA 2QN6B 1U6BA 3ILOA 2ZH1A 1XTZA 4NX9A 2XZDB 3BGRB 5GAHU 3W63A 1WTFA 2IDLA 2V4JB 5LL6d 4F0MA 1RT2B 1NJXA 4IDKA 2H5IB 1S10A 5E0OA 2WB1D 3QO9A 3PYDA 3VGUA 3RG6A 1FX2A 1P9YA 1WOSA 3OTOF 1UVLA 4FF1A 2XYHB 2H5EA 3HJVA 2FDNA 4DQRA 3RB3A 4C11A 1WHWA 1X4CA 3IRXB 5GAGU 5A76A 1VRUB 3MCOA 3NNHA 1UL3A 3O5TB 4DL7A 3NY0A 2KN4A 3TX0A 4MJKA 2C2NA 3R1LA 2QJ3A 1TU0B 1W2BR 3OTOJ 4B9SA 4ZVUB 1EAYC 1HYSA 2CWKA 3KLEB 1RQ0A 2VPYB 2ZKTA 1VQYA 3PZPA 1Q5VA 2Y0BB 4P2MA 1GEHA 3DM2A 3ZXWA 1FE0A 3AOAA 4WFAQ 5IT4A 4DMZA 2HIYA 3BQ1A 3E51A 2AU0A 3IN5A 3OR2A 2JRSA 4KV8B 4DPUA 1MU2B 4USMA 1HNVA 2WSEC 4ZPDA 4LF7F 5E3PA 4Q45A 3LO3A 3PIOQ 1RU1A 2GGPB 2OD6A 3SSQA 4FXWA 4L3NA 1U8WA 1U2FA 2VL1A 3R6LB 1UAWA 4U67Q 4KIAA 3HD1A 4EWTA 4DX6A 3M2VB 4NLGA 4KB7A 1TL7A 4PYDA 3Q23A 5C24B 3B6BA 3ZC4A 3GJTB 2Y0SD 2ALZA 1KHWA 1XN9A 4OX6A 2HW3A 4CTAA 2DRDA 1Q53A 3IRWP 3ZTSA 2HQGA 2CQPA 1ELOA 2HFSA 4F4ZA 3GLJA 1CJTB 2HAIA 1DAXA 1F5BA 2PE8A 3HFZB 1Y7PA 3KNGA 1NRKA 2K1RA 4ZLNA 4FYWB 1N5SA 1WSRA 2W8KA 4ZCIA 1ULRA 2OP5A 5IV3A 4KJIA 3H42A 3EVOA 4OLPA 2YNHA 1NK9A 2GQCA 4HKQA 1U1OA 2CQCA 2VFSA 2QA2A 2X51A 1PBUA 2PI5A 4LRDA 2UUAJ 1MN9A 5LSRA 2GMJA 5FDLA 3FBEA 5KFBA 3MMBA 1QE1A 1FESA 4P10A 1RWVB 2YQ3A 4UW2A 3HHEA 4RNFA 4IO9Q 3SQOP 3FQKA 1JQGA 4DUTA 3JTPA 2PO4A 5J1EB 2BABA 2W4CA 1UWAA 2EBEA 4XPEA 1HNWF 3H90A 4ED4A 6FD1A 1YHQS 2Z57B 2C3MA 3BR8A 2YTCA 1NAQA 4ELUA 3HJFA 4J9SA 1B70B 1T95A 2M3DA 3I0SB 3UD5A 2ZC4A 2FHMA 2MJUA 3FRZA 3KWMA 3IG1A 4FN5A 3R6GB 1S1WB 2ZBCA 3FZBA 2LEBA 3H40A 5D6GA 4M8LA 2HMIB 1OQ3A 3LP1B 3R7NB 3M6UA 2V2ZA 4Q7AA 1SIZA 1NPRA 2CQ2A 3I87A 3PX4A 4PXDA 3RGIA 3OVAA 4KC5A 3THTA 2N4DA 1LFPA 4JB8B 2IAJA 1HWJA 3ISZA 3VF0B 1HBUB 2K06A 2CQBA 5KG0A 2BV3A 1RA6A 1OYDA 4P2XA 4NI2B 1U02A 2VG7B 2MZ1A 4LF9F 2VQFF 3EDRB 4PG6A 3F73A 2DGQA 7FD1A 2V4QA 1RCXB 2HFZA 1FDBA 2DRAA 2H4WB 4AL7A 3ZTPA 2BJ3A 4RLEA 1Q16B 2HNZB 1L3KA 1S6PA 2C2EA 4LVNP 1UPPA 3K7RA 4WE1B 2XLJA 4DG1A 3WIUA 3KHLA 4LF9J 2YNIB 4Q44A 2XBPA 2EVZA 4UT4A 1NKBA 2PI4A 5GVQA 1KFSA 4FYVB 2VHGA 4HI1A 5FLXU 1WHYA 5A2QY 2H54B 1ZA1B 5KFZA 3F41A 1RBAA 4PAAA 2DHXA 3CCLS 1SC6A 2RKIA 3MPDA 2DGTA 3D1QA 1ACMB 5MLCV 2HG4A 1RAFB 2BUNA 2WOMA 2RQMA 3PFEA 1B7FA 4LT6A 3MEEB 2EFVA 2CFXA 2AYEA 2FVSA 2YQ0A 1FRJA 3GYGA 4DQSA 4WU3A 4N76A 5KT4A 4DV5F 4FYDA 2AWZA 2UP1A 1VDHA 2C2ZB 1SL2A 1Y0HA 4HHUA 2F5GA 3IC1A 3AJDA 4CWBA 3CC7S 4G1IA 2DVIA 5DETA 4TLQA 2XO6A 2RQ4A 5JVHQ 3O6QA 4ECRA 3SBMA 1OY8A 3LALA 2A2DA 4OX9F 3HT0A 2D7SA 4ECYA 1OYEA 3RW7A 1A9NB 3QNWB 4DV5J 3CJRA 1R31A 1WC5A 1SI9A 1VC0A 3QGIA 2JHEA 3R5JB 4PWWA 3TW0A 4QCLA 4DBQA 1UPMB 2UUWA 3I6PA 4F7VA 3G2XA 2FC8A 3THPA 3C16B 4DR7F 2R7XA 3CJKA 2CZ9A 4OX9J 5B0CA 3J7Z5 1S79A 4TLRA 3RB6A 4ETXA 3FSIA 7FDRA 4R0EA 3JSRA 2XMAA 3PV8A 1TKTA 1FRKA 4CT9A 3RAQA 3T5JA 2ZBRA 2HHUA 4DV1J 4DR7J 1UW4A 1EB0A 4WKYA 3CDBA 3PW0A 4KSEB 1KBRA 1QD1A 4DQQA 3CDEA 2CZVC 3VWSA 4MKAA 3KK2A 1VC5A 5DJBA 4EGLA 4G6VB 5KTQA 2M8HA 3K59A 3M8QA 1R43A 2HBRB 5I42A 3CCUS 2PEHA 4IDKB 2HFNA 1WF1A 2GZOA 4O3QA 3DNCA 4OYMA 1JLAA 3CJSA 5CYMA 2B4PA 1U2CA 3PJ9A 3KLVA 4HH0A 1YRTA 3QO9B 4ED1A 1YJNS 1U1RA 2DR6A 3BO3A 2V94A 1U47A 1NK0A 2CWXA 2IVYA 1BMQB 4C11B 3DGVA 2IY5B 1RKIA 3Q22A 4CO2A 4C4WA 3UNYA 3ZZRA 1NBEB 1NSPA 2VOPA 3T6BA 4FS1A 2IBOA 5A0YA 4A8KA 1SJRA 3DDNA 4W98A 4AE5A 4DXLA 1HYSB 1JXLA 2V63A 2Z2LA 1WNEA 1SL0A 3CF5Q 4I67A 1NU4A 1O0PA 3GCWP 3DM2B 3SDEA 4ANCA 4B02A 4C0OC 2BRLA 5ETNA 3K8WA 2EKNA 3OL8A 1A7GE 1UEVA 1ZZNA 4FNHA 3FBCA 1N36F 5KG1A 2NR0A 1HNVB 4MTPA 5D78A 3KHHA 5KG3A 3OL7A 1LW2A 3TO8A 4HLBA 4IRCA 3VTIA 3G6ES 3PYEA 1PGZA 1GT8A 2B5JA 4KGKA 2AD9A 1TFYA 3BH7B 3SI8A 4PYAA 1TZ0A 1N36J 2BXJA 1HNZF 2IYGA 4CLSA 4C48A 4PQAA 1TL7B 4M1KA 1HBNB 5D4LA 1KEKA 4C8OA 3AXMA 5CHCB 4OZJA 1BD6A 3OPKA 5FLXY 4AL6A 1WJ9A 4CTAB 1AUSL 3MD3A 2A3JA 3PVXA 2VDHA 2HVDA 4ZHRA 1NDLA 3RBDA 3OTCA 1HNZJ 2IA6A 4YOEA 3H4DA 2XSJB 4DSEA 1C0UA 1SB6A 2E66A 3OVBA 1R89A 3K89A 2H1YA 3PJWA 2K1RB 4RBVA 3CW2C 5F9NA 4LMZA 1CBKA 3FK4A 3V6HA 2IC3A 2HGMA 2AJ1A 3E2EA 2KFNA 4JV1A 1QY7A 2YNHB 4I2QB 4QPTA 3KDOA 1RWUA 3NXZA 1FTCA 2YH1A 3BH6B 2RRBA 5KT3A 2F65A 2HRUA 1BXNA 2JLEA 5G0RA 5FDLB 2R4FA 2R2TA 3MMBB 4KE5A 1JLFA 4CP5A 3H5XA 2J9CA 2PT0A 4M5IA 1HNXJ 4OLOA 1FJEB 4YDDB 3G87A 1IKYA 2QA1A 4DR5F 2KB2A 2V8PA 3CVKA 1G7CB 3FEXB 4A8OA 1M5HA 2DNQA 2DR5A 4N8OA 3N01A 3WHIA 3L7OA 2O66A 4LFCF 1XJWB 2KJVA 4TXSA 4DFMA 4K4YA 1NB2A 1YIJS 4PABA 2QL5B 1UZHA 2I1RA 3IG1B 4DR5J 2OPRA 3KJNB 4HVZA 4I68A 4Q2LA 1NO8A 4ID5A 3OBIA 4EBCA 3ZTOA 1RISA 2RRNA 4QR2A 3ET6A 2MHNA 4YS2A 4ED0A 2FVPA 2GIRA 1XMQF 2EBGA 4LFCJ 2DY1A 2XNQA 3OFGA 3HKWA 2GW8A 3O2IA 3PYGA 3TOQA 2DKOB 3N5FA 4DV7J 2WONA 2IAJB 1GTEA 3VGVA 4CO3A 4NPOA 4V19X 1FRMA 4X65F 3DN9A 5FJ4A 3TNVA 1I94F 4X4UA 2OKQA 2XNRA 1XMQJ 3G6VA 1H98A 4ZPVR 4LRCA 2EI5A 4OHYA 1O5JA 3LP0B 2KL8A 2OUGA 3IWLA 1RHJB 2CUYA 2Z2YB 2HLUA 2NREA 5GADI 1S6PB 5D4PA 4M5JA 4OI2A 1KC8T 5L38A 1B4SA 3GR1A 1Z2ZA 4X65J 4DG1B 4PEOA 4YHHF 1I94J 3C8YA 5IQQA 2DO4A 3VAMA 1JLCB 1ICEB 3H5UA 1GMVA 2VA2A 4EBEA 2ZM6F 3I32A 2ZDOA 4ZVRB 2WOMB 1IBLF 3VQSA 2QL9B 4DLEA 3CGIA 1I6JA 2ZE2A 2JFDA 3FC9A 3GV5B 4YHHJ 2FHOB 3AT1B 3DRSB 3GFXA 1LK5A 2RUSA 3CO9A 4RU2A 4A48A 3DDKA 2PIIA 2XY5A 1Q4RA 3MOZA 1R8PA 1TELA 2ZM6J 2BKPA 4K8RA 2HHSA 1IBLJ 3SEOA 3W5YA 3EVWA 2F9DA 4ZVFA 2JWNA 2BJEA 1S57A 3LAKA 3PX6A 4K7QA 2FVRA 1X5SA 2KFZA 4LIWA 3G6XA 3LAMA 3D68A 2IVMA 1VK8A 4YB7A 3T6JA 1RXOB 1C1CA 2ADCA 3CJKB 3SFUA 2PMZD 4KGXB 3ICLA 4DX5A 1KFDA 3SSRA 4IG0A 9RUBA 1RHUB 2CJ9A 1IN0A 4CLKA 4ECVA 3C15A 4C6AA 3DOMA 5J2NA 4ED8A 4QWBA 1TKTB 2LP4A 4BWJA 4PG4A 3N28A 3AOBA 5GMEA 3HCXA 4H4MA 3J7YU 4RNMA 2V50A 2LU2A 2KG1A 3ILLA 2R8HA 2OAUA 2IM2A 4ED2A 2LEAA 3H2UB 1WI8A 1W2IA 3DOLA 3M7VA 1VBYA 1IJFB 5KG4A 1RAIB 3KK2B 1TMMA 3JTNA 1S7HA 1R6YA 3M8QB 4I6AA 5I42B 1UVNA 5GAEI 3T5LA 4LSNA 2GIQA 3BN7A 1JLAB 5CYMB 1VYAA 1KP6A 2CVIA 1U24A 2MY8A 3BGOP 1T0TV 1TFWA 3M9NB 2UVVA 3SQGA 1VQNS 4NLWA 2KHDA 1TL5A 3P5BP 3G6YA 3NCPA 3JSMA 4FYYB 1QTMA 5EHHA 3N6MA 1H2UX 4C7QA 3TQEA 1D3WA 3M8RA 2NPIA 3W8PA 2KRRA 3MFIA 1PCAA 3MCNA 2CPXA 5A0YB 1KONA 2DK2A 3SZ2A 5DS7A 5LMUF 4NLDA 4F50A 3M2UA 3VAKA 1FO1A 3KUEA 2JDJA 3T1YJ 2WSFC 2YWHA 3KMSA 4LRAA 2YNGA 1FA0A 3HKZD 3SDEB 4KAIA 1IKWA 4J9PA 4RW7B 1AYEA 3DRRB 5A8WA 3GONA 3QAUA 1F6TA 5LMUJ 3UN3A 5B7WA 2XYGB 5KG7A 1K44A 2R2RA 3NGSA 3ILJA 1VQOS 1UETA 1UJ6A 3IWNC 4KQZA 2M2BA 1S97A 3T19A 2MMYA 2XEXA 4RPFA 3OXFA 5J2PA 2F4VJ 2EK1A 2CJXB 4WFNQ 2Y1RI 1NJIT 3N4WA 1EQMA 5KFRA 2V4RA 1X7VA 2RHSB 2X1GA 2AGPA 4DUYJ 1ZM2A 3UCUP 1N32F 3PM9A 4ZITA 4O3OA 2CDRB 2HBZB 3AD7C 3RAMA 5H9EJ 4RO0A 4RWXA 2K3KA 4ZHRB 4J9VA 3ULHA 1VBKA 3MWBA 1RUSA 3OHAA 3CO0P 3HI9A 1RT5A 4DL6A 1C0UB 2KG0A 3T1HJ 4QU6A 1N32J 1S1UA 1X4AA 1SH0A 4KBIA 1VQ7S 1OSCA 1N56A 5CYJA 2NXEA 4USJC 3TA2A 4I2PA 4Y2IA 3CMES 2IC3B 1TQLA 2LA4A 2YKPA 4UF4A 1KVJA 4WK3A 1RI7A 2CG4A 1B99A 1YITS 3CULA 1M5OC 4ILLA 2IM0A 4TYBA 1PKUA 3MEGA 4QIEA 4ZVSB 2KZZA 3GP9A 1KTQA 4F4KA 1U1PA 3AJ1A 1IBMF 1G1XA 1QVGR 4NXNF 2MQOA 2EKYA 3EJMA 1JLFB 1F3FA 2XYPB 2FGCA 4URSA 1YLXA 2E5IA 2VJVA 4LBPA 3TAMA 2CDQA 4QW8A 2QLFB 1IKYB 2E7XA 4NCGA 5F9LA 2VC0A 2HK3A 3GFHA 4OV6A 3M2RB 2L9WA 4NXNJ 1Q8KA 4KR0B 1RHRB 4ZS6A 3GMGA 2JH3A 2GMLA 2QC3A 3R2CJ 1N5YA 3AFGA 3BPSP 2OPRB 4USUA 2BKOA 3R5GA 2NCKL 4ID5B 3ET6B 3LQVA 1JNZB 4ZP6A 2RSQA 1SJFA 4YQWA 1Y4ZB 4OIXA 3UD4P 2F7VA 2MZJA 3D1HA 3F44A 4WIIA 3ELHA 2ZH7A 2WONB 1Y3KA 5K14A 4QWAA 5L39A 2GQQA 4B3TJ 2MY7A 5D77A 2MPUA 4N5SA 2MKKA 1RCOB 1H0HB 3HZEA 4EYIB 4WFXA 2HFUA 3TJAA 2RAQA 1E6VA 3PFOA 3MDFA 3ILIA 4CI0B 3DLKA 3OTBA 3GZ7A 4DR3F 5EN1A 3PHTA 1ZPVA 3EYZA 3S1TA 1SKWA 2J0QD 3MR6A 2RHQB 2KZMA 5DGAA 2CNNB 4J9RA 2LECA 4YMEA 1FJGF 3PYFA 1IQTA 2DNGA 5KFDA 5U47A 4W90B 4P74A 1VQPS 1D9FA 2AGQA 1FXRA 3MEDB 4DF4A 1TK0A 3QGPA 2HAFA 2IBKA 1K73T 4DR3J 3CWJA 2PA3A 3PEHA 4WYLA 5F8JA 1ZAXA 4E0DA 1I5OB 4CT8A 3HHLC 4PXEA 3CE8A 1TTHB 2ZUAA 2XS5A 4I1TA 4NZ0A 2ZKUA 1DLOA 1WUUA 3EE3A 1XNRF 1WEXA 1Z1ZA 3Q8PB 3I9ZA 2HKEA 1UVIA 3BN4A 4CH1A 1IKVA 4DS5A 2BEFA 4B9VA 1X4HA 4UZBA 1HBOA 4WYWA 2YPYA 4I4BA 1XR6A 3ENVA 3D54A 2J7WA 2DGVA 3HHKA 3PIPQ 3T41A 2VG5A 3CDUA 2XTJP 3KUHA 4OYWA 4ANDA 5KFIA 1C1CB 2E44A 2CPDA 2DPIA 4HT7A 3LA0A 3B4DA 5JMNA 5L1IA 4A47A 4IG0B 4MKVA 4KPCA 4Q8FA 2CQ3A 3C15B 3DOMB 5JUMA 5J2NB 1WWHA 1Q81T 1NCLA 2B4UA 3POTA 1AZSA 1X4GA 3V6DA 2XY7A 4H4MB 4K4ZA 3PACA 3GCXP 4Y2KA 4DPYA 3UN2A 2MZSA 5CD4H 2XHWA 4H4KC 2VODA 4LJMA 1GTHA 2HVIA 3Q89A 5DLFA 3DCAA 2MDAA 1F9HA 4LSNB 1F3VA 3D6FB 2FHJA 1TR0A 3HSZA 1LWFB 5HANA 1QM9A 4ECXA 1Q5YA 1T94A 2A2CA 5IS2A 3G9CA 3EICA 3D6HB 2XMJA 2CJKA 4OFZA 4TNOA 2B43A 2BOAA 2GS8A 3JSMB 4Y00A 3W3SA 3HPOA 1UWBA 2J9DE 2V2QA 3LPYA 2D69A 4X4NA 5KFHA 1M5KC 4YR0A 2AP6A 3DC2A 2XI3A 1RHQB 5BYQA 2ZHAA 5HAOA 1S1VA 4DPXA 2V8VA 4I64A 3CPWR 5DDQC 3QZ8A 1LKZA 2ZDPA 4CNZA 1GMUA 4LR8A 2WCXA 4AXJA 3BJYA 3N0VA 1PC4A 2DNMA 2YNGB 5HBMA 4NMXA 2MXYA 1IKWB 2W8LA 4ZJOA 1F9FA 5HVFA 3EM1A 5A8WB 1N6QA 1AB8A 3DI6A 2MQNA 2NLWA 1P27B 1CEZA 2P5VA 1P9QC 5RUBA 3S6EA 1U25A 3HVTA 3DXSX 4CLLA 1PJ6A 2BYCA 2C3PA 2GC8A 2YPZA 2B4OA 2AQ4A 3M8ZA 1ZPWX 1U1NA 1GNKA 1XBWA 3MMCA 3NKYA 1DQAA 2G13A 4UOGA 4ITSA 3SCLE 4U6PA 5ETSA 3BKTA 5DG9A 3OSPA 3DRPA 5IC6B 4WFYA 3J7ZT 3PEJA 3CD0A 4M5LA 4EMDA 1YBAA 3ZZ0A 2DD8S 1R8BA 5LM7E 1VQLS 4F36A 1F2HA 1RT5B 3MGJA 2DBBA 1AFJA 4ICLA 1EARA 4OL8A 1S1UB 2EFGA 1JXEA 4KGVB 5F41A 1KVIA 2QMUB 4I2PB 2W9BA 3CCTA 3G8TA 4J7CA 2RUGA 2ERRA 4XIUA 4NEYA 2DNHA 4TQSA 1OJ4A 4ED3A 2APOA 4MYUA 5C7PA 4V19J 1EKRA 1ZAWA 3MEGB 4DFKA 5D0GA 1GMWD 3H20A 1TK5A 4WU2A 1J5EJ 3ISND 3MECA 2FJXA 3BEGB 3CJ5A 1QSYA 1NDPA 1YJTA 5BJRA 1S48A 3ZNUA 1CQMA 2KTQA 5GMKa 4WF9Q 2MLYA 1EJ7L 2GV1A 2LQ5A 1ZM9A 5EWEA 2DIUA 3TAMB 3AA8A 1WF2A 4NCGB 4NXMF 3HVRA 5IXUA 2J0WA 1V6HA 1SJ1A 4FKXA 4TN2A 2UXCF 5KT6A 3R5CA 3KJVA 1XMBA 2HNDA 4Z2XA 4KKOA 2OFGX 3HSJA 5ITHA 5KT5A 3RB4A 2N3LA 2HSEB 2QMXA 4I7FA 3DLHA 2EEYA 2YWFA 4FF4A 5D3GA 2VG6A 4K50A 1G2EA 4NXMJ 4GVBA 1VR6A 3V81A 2ZD1A 4RJVA 3IP0A 2AJ2A 5KFXA 2ZJPQ 5E3QA 2GCFA 3NOGA 4A4JA 2ZITA 3I9V9 2YX1A 4IKAA 2YBVA 3PRDA 1R0AA 3FJ2A 2CVEA 2KFYA 3M8WA 3PR4A 3LOUA 1R8AA 4BWMA 2HQ3A 3QIDA 1T3OA 1K0TA 1CJVA 3CJTA 4Q0BA 2VFVA 2BE9B 3R5DA 1U7LA 5K14B 2VA3A 2FJVA 2MSTA 1WACA 4C8KA 8RUCA 4X66F 3LH2S 1WOPA 4MH8A 3SCKE 3NS5A 4WKRA 2R7WA 2FPHX 2C2RA 2EWHA 3TYTA 3CCMS 3SIPB 4E98A 3MM5A 5HMXA 1E6VB 1DY3A 3K5LA 1X9MA 1NLKL 2BJ1A 5ETTA 3P49B 3RR7A 4XO0A 1JJCB 3DLKB 3NG8A 3NLCA 2IM3A 2C22A 3CDWA 4X66J 1WC3A 4AL5A 3FBBA 4CLZA 2PSZA 2D1CA 3TVYA 3D6MB 1FFWB 3I5CA 4ZIVA 2ZH6A 4LF5F 3AA9A 5KOXA 2I6WA 3EZUA 4FKYA 3R5BA 2QFJA 4G1QA 2K8GA 4CO0A 3MPWA 5AE1A 2CZ4A 2XI2A 2DXEA 4MKBA 5D4NA 4ZVGA 2QO3A 4AXIA 4J9KA 1D09B 4A8WA 4LF5J 5I3QA 3QQCD 3HHDA 1MMNA 2Q6CA 1TKDA 2PC6A 4YUDA 1IKVB 3HM9A 2BM0A 5IZHA 2AKWB 1HBOB 3DLGB 1RDRA 2MGZA 3IS9A 1FDDA 3T9ZA 3QLHA 2XHCA 3W2WA 1BQNA 2VG5B 5M2RA 2LCWA 1H7XA 2VD3A 4ZPBA 2IFXA 3O3LA 1NZAA 1OY9A 4K4UA 1YRXA 5KFKA 2V8HA 1S9EB 4MK7A 3BBCA 3Q8SB 1XMOF 1NJYA 3JYTA 1PG5B 3NOCA 1SC1B 4CH7A 1S0MA 1AZSB 5HN0A 2CQ1A 1IJEB 1GQEA 3M6XA 3VZIA 3V6DB 1N33F 1WG4A 2QV6A 2Q79A 1NSQA 2W2PP 2H9ZA 2M9KA 5AJ3F 1F9EB 3KG0A 3TZWA 1XMOJ 2BM1A 3FEYB 4DFPA 4KY3A 4NA3A 4CM2A 4PG5A 2EC2A 2DXDA 2XWYA 4RUCA 1N33J 5AXKA 3QWUA 2R7VA 5D0RA 5D0HA 1ZYQA 2HHXA 3W5ZA 3BSNA 1S6QA 3OT9A 3DMJA 4TYAA 3V2UC 4B9UA 3R7SB 1VI7A 4QR0A 3M8PA 2SXLA 2O01C 1S6OA 3TZXA 2H51B 3TA0A 2DNOA 2NSCA 3BO2A 5IQ6A 1UWBB 2KXHA 2FTRA 2FY8A 4J9NA 4B3MJ 1SJ3P 2CQHA 4XDDA 3CJ3A 1JLGB 1K1SA 2P2CB 3M05A 1S1VB 1UVKA 3PO5A 4OYOA 4U7UD 1TL3B 5DDRC 1YBUA 3CIZA 1CQNA 4DS4A 2JLFA 3W7BA 1RTZA 2BVZA 2OPSA 4ZVOB 4RW6A 1A0OB 4ELTA 3UE2A 4HDGA 4DV6F 5C2CA 5EX3A 3GSIA 3N6NA 2NQPA 2R42A 4DCOB 4C2MA 2DEIA 2XGPA 3HVTB 3VVTA 4RL1A 5EDWA 2NXJA 2CJAA 3RB0A 1T3NA 2FQQB 1PSDA 3K58A 1RLDA 4ZK7M 1JWWA 3NL0A 4H4OA 4DV6J 5J1PA 3HSGA 2PA8D 4LQ3A 2KXNB 2IA0A 1Y5LB 3TVKA 1VHFA 3KJQB 3MUTP 1RYSA 1K0VA 3DHWC 4K0KJ 2HHWA 2MKHA 1R6VA 5LXYA 2VQEF 1D9AA 1QAIA 4DQIA 3OTEA 2OSRA 3H4BA 3L3CA 2UZAA 4JI0F 2ASJA 4R5PA 1AW0A 2W9CB 4PXCA 2ASDA 1YBTA 3G86A 4ICLB 3F0NA 2HLTA 2MKYA 3J80Y 1BQMA 1S0NA 4OX8A 2VQEJ 3LW5C 5T41A 2W9BB 1SCJB 2E5GA 4NMLA 1KLMA 1T9VA 2UXDJ 4JI0J 1RWNB 3W5XA 3WZ0A 2EPIA 4EUVA 2BRKA 2V2VA 2XMVA 4X4SA 3GILA 5F3ZA 2OIHA 3MECB 1VQMS 2E5LF 3MMAA 3K0JA 5J2QA 3U1NA 3NNAA 2OTJS 2GAGC 3ZZYA 1EX8A 5IT0A 3I0RA 2D3UA 2M7SA 1S76D 1PC5A 8AT1B 4KH0B 4X4OA 2V2KA 1WTBA 2CQ0A 1FNMA 5C42A 1OS5A 2RT3A 4AYBD 4DCPB 1HWUA 1I3OB 1NHVA 2E5LJ 4PWUA 1NDKA 1JX4A 1ZOTA 3KJVB 2WBRA 4OYZA 3GFYA 2HNDB 5E2QA 4F25A 4YY3F 4R25A 1NPKA 4KKOB 5HK4A 2VBZA 1KKHA 3KMQA 2XCAA 1H38A 3KHGA 4I7FB 2VBYA 1S1TB 4LRBA 1U1KA 5D3GB 1SXLA 2VG6B 2IHR1 3T5KA 3L09A 4GVBB 4LQ9A 3V81B 1N5TA 1FI4A 1LFWA 4PZVA 2NS1B 4ED5A 1S0VA 4YY3J 2UUTA 1R0AB 3IR6B 5H9FJ 1B0TA 2X1FA 2GX8A 4PRFA 1WI6A 2C3OA 1CJVB 1HHQA 1RT7A 4Q0BB 1WOOA 3FCHA 4B3RF 5HP1A 3K5NA 3LP2B 2Z2MA 3PJXA 3MCSA 3MR7A 4UY8T 1FD2A 1FFGB 2FLLA 3I96A 2YKQA 5ETLA 3NEKA 3MM5B 2A6MA 1U1LA 4ZJQA 1Y5NB 4FPIA 4ED7A 2ACYA 2I9SA 5BXIA 1QAYA 2I0XA 3UN5A 4B3RJ 1YJRA 3TZYA 2DCLA 4FBTA 3T9NA 3SV3A 3B82A 2YX4A 2GJ2A 2O5DA 2XWXA 3AQPA 5ETOA 1WEYA 4G1QB 3QFWA 1WC4A 2GO9A 2AZ3A 2P8IA 4WJBA 5AE2A 1N5VA 4NLTA 3OR1A 2F9JA 4MMOA 3NGDA 1S9FA 3M4XA 5A8KA 2RIJA 3VAFA 2WK4A 5IM0A 3JAMY 4DR2F 4WP8A 4M5KA 2DNNA 3L7PA 3QIPA 1SQEA 1T9XA 2RF2A 2LXFA 3Q83A 4HT5A 1NPPA 3IWXA 2MGZB 4OZ1A 4C8ZA 1XERA 3QLHB 4DL0C 1H7WA 5K9FA 3E3XA 3W2WB 1KQSR 1UFWA 1BQNB 1KOHA 4AT1B 1RBOB 4WWSA 2P6SA 4DR2J 3DGPA 1N34F 1TL1A 1N0VC 3AXKA 4JOUA 1CULA 5LT5A 3UNGC 2M70A 2BR0A 3HHNB 3BSAA 3WX4A 3TUJC 4G65A 2EFOA 3MR3A 2R7SA 1F5CA 2OEKA 4ZDNA 2N7YA 2R8IA 2FZCB 3MZIA 5HATA 1LQ9A 4WTYA 1QSLA 2O67A 1VGYA 1TUVA 1UEKA 2WW4A 3BZQA 5DM7Q 1KNZA 2OTLS 3KTQA 2R7UA 1N34J 4AUKA 2XCPA 5FIIA 4DF8A 2OEJA 1S59A 3W62A 1LXNA 4WIQA 2FB0A 3MUVP 4IQXA 1Q8IA 1HMVA 1PYOB 5LJ5Y 4ID8A 3FDSA 4I0WA 3VAHA 2Y8WA 1T03A 4ZP9A 8ATCB 1JLBA 5CCMA 4Y3CA 1KQFB 2O1PA 2EFPA 4N7TA 2OLWA 2CYYA 4IOBA 4WXOA 2W7PA 4CH0S 1SJ4P 3ZZUA 1S6QB 3DMJB 5KFAA 3P45B 2MJNA 1EP4A 3CJ4A 1V3RA 4X4PA 5CA5A 4JI5F 3M8PB 2GHWA 1RADB 1FHTA 1U26A 1KQGB 3JQMA 4ZVPB 4P52A 5B08A 3G82A 1Q8LA 4IUFA 2RDJA 2HBYB 2A0FB 4IRDA 1D8ZA 2LU1A 1HQUA 1H2VZ 3OTDA 2DNYA 2HHQA 2RRAA 2L9NA 4F0HA 4JI5J 2D3ZA 2UUAF 4IR1A 2BJ8A 4EZ6A 2BBEA 5EUHA 3BGFA 2MB0B 2HFOA 2ZOFA 4CLUA 2I2YA 1SH2A 1GX5A 4M63A 4Z37A 1NNDA 2OPSB 1JLQA 3P96A 1MLAA 4RW6B 5ETQA 1IBKF 3PG9A 1MWZA 1UA0A 3K5PA 2VBXA 5KG5A 3UD3P 5D8HB 2NXNA 3VHQA 2V8DA 2DHGA 2Z58B 1U0SA 2C2KB 2Y1JA 3ONQA 2A10A 4ANEA 4OYBA 3G4SS 3BBBA 3T1AA 2WVBA 2QT7A 2ZWPA 2KVQE 4FDFA 2FJAB 2PDAA 1URRA 1BQXA 1IBKJ 1H6KX 4H4OB 3FVYA 5LOQA 4IR9A 4DR6J 3W65A 3CC2S 1VK3A 3M1VA 4DL2A 2BE7D 5B0BA 2J6UA 4RW4A 2QLJB 2DIVA 2YWKA 3M30A 1F5AA 1FFSB 2XY6A 3H8YA 3QT7A 1VLOA 3DU5A 1OSDA 4LRFA 4M5DB 4NCBA 1BY9A 5KFCA 4YDXA 4R5PB 1HQ2A 3HULA 3JB9k 1IXKA 5LMNJ 1N48A 3BQ0A 3QMQA 1NK6A 5KAKA 2J0SD 1FRHA 2DHHA 3D7SB 3IAM9 1ZETA 1RHKB 4C8NA 1BQMB 4J9OA 2IVFB 3MEKA 4J9MA 4X64F 1CC7A 3CSKA 4M94A 3JXOA 3CD6S 3VGSA 4TQRA 3RZAA 3GIRA 4MT1A 3QJJA 3FBFA 2KXFA 1JLEA 1UMJA 4DPOA 1RT4A 1L3SA 2NUHA 2E1CA 2XMKA 4DU7A 2G0CA 3MMAB 1KR4A 2BQ3A 5J2QB 1RSCA 2GVDA 1HI0P 4DN0A 3UDLA 2AYMA 5HQMA 3DLEA 4PUOA 3EPIA 4X64J 3CJ8A 1GK8A 1TMJA 2YKOA 1W26A 1CSJA 3AHPA 3KUGA 2B3TB 4ATNA 2CJBA 3J81U 2W2NP 5HROA 2RS2A 5C42B 4IFVA 1RTDA 3GFZA 4C9DA 1Q82T 1LXJA 2AZ1A 3SYZA 3BDPA 1RJJA 3A3OB 2BX6A 2ZH3A 2NXCA 4F26A 1HW8A 4A8YA 1IR0A 3OQ2A 2R2UA 2E7WA 4NE9C 1X4DA 3WIVA 3MMJA 1OPZA 3BR9A 3MURP 1H72C 1H73A 3X3UA 3J7AN 2IJFA 4QIVA 4EFAC 4E8UA 4WP9A 2ZH8A 2IYIA 2KO1A 4LF6J 3C46A 4CNYA 2YVSA 2DGSA 2VONA 1ZAVA 4JYAF 1Q86T 2OHDA 1RT7B 4RKUC 3VCDA 1WDTA 1E6YA 4ERDA 2W9AA 5HP1B 2IIHA 4QQBA 1X0PA 1OMSA 4DV1F 1HARA 2HS4A 3DHXA 4Y2MA 4K2XA 3D5MA 3CCES 3G8QA 1JB0C 2YNFA 4JYAJ 4F4XA 1KD1T 3GYNA 4O0IA 4QIWD 4ENOA 1IUJA 1CJKA 4KH1B 3FNNA 3TAPA 2B7BB 1V9OA 4BHQA 2DHAA 4MFBA 2XO7A 3JS9A 2KJWA 5HMYA 2BMBA 1CS4A 5KOWA 1VQKS 4TKTA 3OXLA 3ZZZA 1HKAA 5LSOA 4TVAB 2F63A 5HMZA 5B0GA 3BPDA 4NRTA 3HFVA 3ZZOA 1QUVA 5ETKA 1YTYA 3QT6A 1P1LA 3O1LA 2FJBB 1ZA2B 3OR1B 2FZKB 3ZNJ1 4NLPA 5A8KB 5IM0B 1BC6A 3OJUA 4NZ7A 5F8GA 4B3OA 2GO8A 1JMTA 3CJ0A 3QIPB 4FS2A 1KVKA 3JSBA 3FQLA 2CQGA 1FK9A 4GMKA 3SSSA 3G8SA 2EK6A 4P72A 3THVA 2D3O1 4Y0FA 4FXDA 1EQ0A 1FX4A 2RNEA 3D6TB 3N5BA 4XTTA 3MPYA 5M2PA 1BGXT 1TKXA 1FE4A 1VOMA 1YWXA 3D4JA 4GKJF 2AJFE 1U49A 1TL1B 4BCAA 1HI8A 3DDIA 1CULB 2ZWOA 4C8MA 2FJDB 4BC7A 2Y3YA 4LBIA 2B9XA 2ATCB 4QYZJ 1SQGA 3M2VA 1X9WA 2L48A 4ECWA 4JI2F 3I5BA 3GPAA 2YKNA 1NJWA 4GKJJ 2BOPA 1HBMA 4DDFA 1FWPA 2ABYA 2KVIA 2KH9A 3OR2B 4NL5A 3I4HX 4U95A 4ZVHA 4FYXB 1HMVB 4P2FA 3HF5A 4DCJB 2NPFA 3HP6A 4A8FA 5HJXA 1EHWA 1FEEA 4P73A 1SIWB 4UZCA 3CCRS 4JI2J 4MYTA 5K8PA 1T03B 3M9OB 2F8MA 2QE5A 1JLBB 1FWLA 1IWGA 2Y1LB 4J9LA 2ZEJA 5CQGA 3FFIA 5DO2A 4WZQA 2XLIA 4HACA 2Q6BA 3CD5A 3Q8QB 5KFLA 1BWVA 7AT1B 2HGNA 1EP4B 2BJDA 2OPQA 2HEKA 3CCWA 4NRUA 2E1PA 3UW1A 2H3EB 1N5QA 5FD1A 1HQUB 5L1KA 1VFJA 2FC9A 1T11A 2V34A 4LFAF 4UUWA 4CLPA 4WFBQ 4B9NA 3BKFA 3K17A 2L9DA 4PG8A 3BSOA 3M6VA 4PPZA 3EGWB 5KFVA 5F8MA 3QSYB 2HPUA 3HMJG 1WF0A 3MAHA 1LW0A 2FLPA 2ZC3A 4DZDA 1WD6A 2R2SA 1Y00A 1HNXF 3OSNA 1AA1B 4LFAJ 3L95X 4RUAA 1JLQB 4LSLA 3D0GE 1FT8A 5LJ3Y 2G2OA 4J37A 1C1BA 3O44A 1K9MT 5IOLA 3W1YC 3T5HA 1P8GA 2FJEB 3MR2A 1QE1B 4JI3F 5CH7B 5CXTA 1VQ4S 1NXIA 3FGVA 3VR1A 1R8CA 3IFEA 3VGTA 3IGNA 2CPIA 3ENWA 2C3YA 1YZ6A 3OFEA 3R8YA 4F3MA 2LFVA 3DOKA 4LF2A 4C0HA 4M95A 1K47A 3M1VB 1LK7A 3FSYA 1VJQA 1FNXH 1QSSA 4JI3J 2UU9J 3GG1A 1IVZA 2ADBA 5KT7A 3M30B 4DV7F 2J6TA 4ZN1A 3HD2A 3TA1A 2QYCA 1N0UA 3N79A 3QPIA 1FF2A 4ZVEA 2G2YA 4O23A 3AH6A 1N52B 3QJPA 4NLYA 3UCZP 2D9OA 1NK8A 2M0GB 2YNIA 2DR9A 4OI4A 3P5TL 3BGLA 4YR2A 1R27B 5L1JA 3ISNC 3P4UB 2J9DA 3PX0A 2ROEA 1FRIA 2EG1A 4X4TA 4Z7YA 2XLKA 3RR8A 2ACMA 4CQ1A 1JLEB 2VPZB 5GAHI 1RT4B 3IM8A 4USKA 5KFNA 3HLUA 3D2WA 3H98A 2XZTB 2XC9A 3HO1A 2GVDB 3DLEB 4F8RA 4PUOB 1NKEA 4USIA 1D1UA 5DG7A 3VQTA 4K4SA 1RBLA 5K20B 4IFVB 5ETVA 4O44A 3K5OA 3MM6A 2IMOA 1RB0A 4LR7A 1M0SA 3MTJA 4RW9A 1QVFR 3OUYA 5H9FK 2CPJA 2RKIB 5AXLA 5GAGI 2K7JA 4DPTA 4JI7F 4KTQA 5KFSA 3C16A 2VPWB 1JIHA 1YK9A 1DRZA 2AIRB 3KK1A 2Z4PA 3HDSA 5IV4A 1X8DA 2V9KA 4ZA1A 3LPEA 5I4MA 3U1LA 1WC0A 2HQIA 4JI7J 4B17A 2HK2A 2DITA 1MWYA 5ETPA 3ZZPA 1GH8A 3IA0A 4X4VA 1GFWB 1T7PA 3A8KA 2C42A 5BYSA 2EC0A 1E6YB 3RU0A 2J7KA 2W24A 2DPJA 4P6QA 4DL3A 1VISA 1KWMA 1Y11A 1FXDA 3SFGA 5A6PA 4F3OA 3GJRB 2J5AA 4CYUA 1KS2A 4QBUA 5GADU 2RS8A 2DGOA 4WPAA 2HHTA 2YNFB 3OVSA 2MEWA 5KFYA 4LF1A 1RYRA 4GC6A 2B8PA 4RNHA 1CJKB 3MCMA 1HQEA 2HNYA 2CKWA 1V3SA 2ZHBA 2DNPA 2MKJA 4PCQA 3D0IE 4MFBB 4KGZB 1CS4B 1FJCA 3WDOA 3PR5B 4ER8A 2ZOGA 3A8IA 3DLBA 3CCQS 5D4OA 1M5VC 2VOOA 4OZLA 3TAQA 3VAGA 4ELVA 4JV2A 4QWDA 9ATCB 3UFCX 4KT0C 4MIBA 2CAJA 2ZH4A 1SJQA 1SL1A 3TP2A 1U8SA 1N8RT 2B9WA 5A2QU 1Y9OA 4NEZA 2NZ4A 3CNQP 3K5MA 1N54B 2ZFHA 1UVJA 1VCTA 4J91A 5HO4A 4B3OB 4MK9A 1H74A 2V69A 4OI0A 4KHRA 4RBUA 3AB4B 4OI6A 2E1MC 1FK9B 3EZ5A 3T1YF 4UUXA 1X9SA 4USHA 4KPYA 2BANA 4NLSA 4DJBA 1X0FA 4NZ6A 3W9JA 1TKXB 2GNKA 2OELA 3TZZA 2XMMA 1OO0B 1GXLA 1SBRA 2DH8A 4IH6A 4JBCA 2N82B 1TUGB 1U1QA 3DKDA 4A8QA 1VQ8S 1R3NA 3TR5A 1D0EA 1HHTP 1UJ4A 2KKHA 2Q3PA 4LF7J 1YVFA 2F4VF 5CABA 1LEOA 2YKNB 1HBNA 1REVA 3S7RA 3OV7A 1X4EA 1KHVA 3QZ7A 1HBMB 2MTLA 3GWCA 4ZN3A 2LYVA 4NWBA 4DUYF 3TUIC 2V0NA 2JX2A 4QYRA 1HPZA 1FERA 5B09A 3LGMA 2XSJA 1IWAA 4DHVA 2NYHA 1LW2B 4ZLPA 4AQYF 1ROFA 4IH7A 3RRHA 5D15A 4BC9A 2EW9A 1UFKA 4HL9A 5GAEU 2F4FA 2YWGA 4F04B 2L08A 4CRJA 1LV5A 5A6WA 3HVWA 2B5JB 5L46A 3FFIB 2QYGA 2UUBF 1P6TA 4CLTA 3CT9A 4O0NA 4HACB 3CXCR 1SPBP 1NZ8A 4FXVA 3T1HF 4OJ1A 3BYPA 4I2QA 3H5SA 1Z4UA 4AQYJ 5DQGA 2OPQB 2J9EA 3MHYA 3EDQB 2WRMA 4DQPA 4RNNA 4A46A 4QWCA 4C8LA 2QX0A 2UUBJ 4I56A 5KFGA 3FEZA 2WTFA 4DSFA 2ILYA 3PW2A 2WB4A 1NH7A 4A8SA 2CADA 2GMHA 5K8OA 2QRRA 1S1XA 2OJ3A 4O4GA 2HRTA 3MFHA 3LANA 3C6UA 2CNLB 1LW0B 1YJ9S 1X60A 4WP3A 3U27A 3KYLA 1Y10A 2E5HA 4PR6A 2HQFA 4NLUA 4URGA 5KG2A 2WAQD 2FVQA 2YH0A 4LSLB 4WZMA 4AD6A 3L7UA 3C19A 2FYXA 4DU8A 1HNWJ 2A1BA 5G0RB 2AHOB 1C1BB 3QBCA 2W4PA 3MD1A 1SKUB 1R0CB 2QGFB 3I31A 1M1KT 2NXUA 1FCAA 1YZ7A 1SC4B 1M1GA 1YG0A 2LMIA 2J7UA 2KHCA 3OFFA 4QOTA 3GV7B 1FKPA 3OJSA 3TJ9A 1S5ZA 3NMRA 3QATA 2QSWA 3U02A 2G4BA 3QJLA 5K5MA 2HS0A 1U0HA 2J0XA 2YWWA 1W25A 3D67A 5HQLA 3DOKB 3LTOA 2E9ZA 4USTA 3BREA 3PHEA 2M5YA 3C3LA 4N41A 3RTVA 3PW7A 4DL4A 3GR0A 1JNRB 1RK8A 4ECSA 1VQ9S 3KG4A 3LP0A 2R8GA 5DZ7A 2QSFA 2IMWP 1SQFA 1XK8A 1B3TA 2BE2A 4OI3A 4B3TF 1VQ6S 4FZVA 4A8XA 2QMWA 3OFHA 5LSLA 2KM8C 5HVGA 3I56S 3VZHA 2WBMA 4L76A 2VQFJ 3V5RA 1NK4A 2AMCB 3PTWA 1U6ZA 1JLCA 4R0JA 5E3CA 4OV1A 3ETOA 2MQPA 3AQOA 1T02A 2P9EA 2PFDA 1RAEB 3QAEA 2VFTA 2W25A 3IR5B 1ZTTA 3GB0A 1UEUA 1XC9A 2AYBA 1WHVA 3D3CJ 3KKFA 2JEFA 2RQCA 2QG9B 4U7UK 2F40A 2OMOA 3HFKA 2DGUA 3DRSA 1KRPA 2OSQA 3W8GA 4DR4F 1RP5A 5KFMA 4UOCA 3FCWA 1RT1A 3PW4A 1JJ4A 1DZ5A 1L3TA 4I6YA 1TK8A 3RYLA 5AXMA 3M8YA 4NLRA 3PXGa 4O44B 3MM6B 5E3RA 3GJSB 3CCVS 4RW9B 1MN7A 1ITPA 3OUYB 5ETMA 3ITHA 4DR4J 2FIUA 1NK7A 1LNQA 1H3DA 3I5AA 1WKLA 4ETZA 4C98A 1RTHA 5F8LA 2JNJA 5DQIA 2D3OR 1IBCB 2ZE2B 6AT1B 2RJZA 4EK2A 3KK1B 2W2MP 3U1MA 4ZPAA 1OPIA 1Q7LB 4JV5F 1RABB 3QRPA 4Y34A 2LKZA 5F0WA 1J2VA 1UJ5A 1XR5A 1T9TA 4D3HA 2B0GA 1CPZA 3OD2A 2CQ4A 2IRUA 1VBXA 4U8YA 2KDOA 2L41A 6FDRA 4CLFA 4NA2A 3KG1A 4F0KA 2RDDA 2DB1A 3TEHB 2NZCA 3H2LA 3R27A 2UVUA 3CIMA 1LWCA 1L3UA 2EG2A 4JV5J 3DLJA 2VPXB 2N7CA 1U6FA 5JVGQ 3AOCA 3W2VA 1NKCA 4DV3F 4CO1A 2JLGA 2JSXA 4K5SA 2ZZNA 4QU7A
chains in the Genus database with same CATH topology
4LF9J 4NXMJ 5AJ3J 4B3MJ 4RJVA 2MTLA 5LMNJ 4DV7J 4NEYA 3T1YJ 1XNQJ 4K0KJ 5A2QU 4OX9J 5FLXU 4NEZA 3R2DJ 4DR4J 4NXNJ 1N36J 4X62J 3T1HJ 3J7AN 2ZM6J 1N32J 1XMQJ 4LF4J 1J5EJ 4DV3J 1IBLJ 2VQFJ 2E5LJ 3R2CJ 1HNXJ 3D3BJ 4JI3J 2UU9J 2UXCJ 5LMUJ 4LF6J 1IBMJ 2KL8A 4DV1J 4DR2J 4B3RJ 4GKJJ 4LF5J 4DR7J 1XMOJ 2KVQE 1XNRJ 1HNWJ 5IWAJ 4KY3A 4GKKJ 2MEWA 2UUAJ 4DUZJ 4HHUA 4DR1J 4DV4J 3J80U 1IBKJ 4KHPJ 1HNZJ 4JI6J 4DR3J 4B3SJ 4JI4J 4X65J 2UXBJ 3D3CJ 2VQEJ 2F4VJ 1N33J 4DV0J 4DR6J 1HR0J 1I94J 4AQYJ 4X64J 2UXDJ 4KYZA 4V1Ak 4JI2J 4JI0J 4LFAJ 2UUCJ 3IMQJ 4DV2J 5LM7E 3J81U 4DR5J 4YY3J 4DUYJ 3OTOJ 5BR8J 4B3TJ 2HHHJ 4JV5J 1N34J 4JI5J 4X66J 2UUBJ 4JI1J 4JI8J 4DV5J 4JYAJ 4LF8J 2MQ8A 3W1YC 5IT9U 4LF7J 4LFCJ 4JI7J 4DV6J 4PWWA 1FJGJ 4LFBJ 4YHHJ 3JAMU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 J;  4NXM J;  5AJ3 J;  4B3M J;  4RJV A;  2MTL A;  5LMN J;  4DV7 J;  4NEY A;  3T1Y J;  1XNQ J;  4K0K J;  5A2Q U;  4OX9 J;  5FLX U;  4NEZ A;  3R2D J;  4DR4 J;  4NXN J;  1N36 J;  4X62 J;  3T1H J;  3J7A N;  2ZM6 J;  1N32 J;  1XMQ J;  4LF4 J;  1J5E J;  4DV3 J;  1IBL J;  2VQF J;  2E5L J;  3R2C J;  1HNX J;  3D3B J;  4JI3 J;  2UU9 J;  2UXC J;  5LMU J;  4LF6 J;  1IBM J;  2KL8 A;  4DV1 J;  4DR2 J;  4B3R J;  4GKJ J;  4LF5 J;  4DR7 J;  1XMO J;  2KVQ E;  1XNR J;  1HNW J;  5IWA J;  4KY3 A;  4GKK J;  2MEW A;  2UUA J;  4DUZ J;  4HHU A;  4DR1 J;  4DV4 J;  3J80 U;  1IBK J;  4KHP J;  1HNZ J;  4JI6 J;  4DR3 J;  4B3S J;  4JI4 J;  4X65 J;  2UXB J;  3D3C J;  2VQE J;  2F4V J;  1N33 J;  4DV0 J;  4DR6 J;  1HR0 J;  1I94 J;  4AQY J;  4X64 J;  2UXD J;  4KYZ A;  4V1A k;  4JI2 J;  4JI0 J;  4LFA J;  2UUC J;  3IMQ J;  4DV2 J;  5LM7 E;  3J81 U;  4DR5 J;  4YY3 J;  4DUY J;  3OTO J;  5BR8 J;  4B3T J;  2HHH J;  4JV5 J;  1N34 J;  4JI5 J;  4X66 J;  2UUB J;  4JI1 J;  4JI8 J;  4DV5 J;  4JYA J;  4LF8 J;  2MQ8 A;  3W1Y C;  5IT9 U;  4LF7 J;  4LFC J;  4JI7 J;  4DV6 J;  4PWW A;  1FJG J;  4LFB J;  4YHH J;  3JAM U; 
#chains in the Genus database with same CATH topology
 2AEF A;  4CYU B;  2OO4 A;  3RRG A;  2UVW A;  5DQH A;  4DV4 F;  3KLF A;  3IO1 A;  1HQE B;  2HNY B;  2JVR A;  1CLF A;  3QRR A;  3Q2T C;  4NYZ A;  4Y2A A;  2RQK A;  4RWW A;  3KXD A;  4DV3 J;  5J2M A;  1XQI A;  1DBD A;  2DYA A;  1IM4 A;  2CPF A;  3Q8U A;  4Y65 A;  1NSA A;  2VUG A;  1MRO A;  3WC2 A;  2PMW A;  3Q8V A;  1RTJ A;  4LF8 F;  3DOL B;  3QFH A;  4M5M A;  2NUU G;  2QFI A;  4DV4 J;  3MM9 A;  2ZH9 A;  1BHN A;  5C5J A;  2HHV A;  1C2P A;  4IYQ A;  4CM0 A;  3W66 A;  2RU3 A;  1UKU A;  4J9U E;  4HR2 A;  4RW8 A;  1OY6 A;  3EGN A;  3WQP A;  1CC8 A;  4LF8 J;  4QYZ K;  3W61 A;  4G1P A;  4ALZ A;  4RW7 A;  3SQG B;  3DRR A;  1F0X A;  3K2Y A;  4OYI A;  4W92 B;  4DI6 A;  1RWM B;  3M32 A;  1CVJ A;  2BAN B;  1YI2 S;  3B78 A;  3C66 A;  1RWW B;  4CDI A;  4P7T A;  4BBY A;  5DGB A;  4JI6 F;  2NYI A;  4B3S F;  2C28 A;  4IG3 A;  4YP3 A;  2KI2 A;  4LBH A;  1PAE X;  4IOA Q;  2V9W A;  3QGH A;  2J76 E;  1F1B B;  1SVD A;  4O3P A;  3M2U B;  2ROP A;  4DV2 F;  1LWE A;  4WBF A;  4JI1 F;  3C14 A;  3MUM P;  2K3I A;  1M5P C;  4JI6 J;  4B3S J;  1REV B;  5KFO A;  4RUH A;  1X5P A;  3KHR A;  2PN6 A;  5G4D A;  2U1A A;  4O3N A;  1JKH A;  4I69 A;  3MAA A;  5F8I A;  2IJR A;  4V1A k;  1U1M A;  2ZNY A;  4WK1 A;  2OGU A;  4ZOS A;  1DFD A;  1V5V A;  4DV2 J;  3JQK A;  3Q8R B;  3KK3 A;  3KLG A;  1HPZ B;  2XM3 A;  4P71 A;  2CIM A;  2I5J A;  4JI1 J;  1RE1 B;  5F8H A;  4QR1 A;  5J2P B;  4Z7C A;  2HRY A;  1IR2 A;  2YY3 A;  1I1G A;  2E1A A;  3CCS S;  4DR1 F;  2V8G A;  4YFU A;  4ZJL A;  5LXR A;  3HZG A;  4EI2 A;  2UV8 A;  2XZW A;  3TRG A;  2MSS A;  2AT1 B;  1T05 A;  4H54 A;  2LDI A;  1YRU A;  3CB4 A;  1CJU A;  4BS2 A;  1TL4 A;  1RZM A;  3P3D A;  1DTQ A;  3RUB L;  4F3Q A;  4ZKA A;  2GHV C;  2PD1 A;  3HVA A;  4DR1 J;  3QT8 A;  4L6V 3;  2M52 A;  2DH7 A;  2H65 B;  1HWL A;  4ZPW R;  1J5E F;  5CD4 A;  1B0P A;  3CUN A;  5KG6 A;  2DNK A;  3QGG A;  1S1X B;  4L74 A;  1TAQ A;  4O4G B;  2CJQ A;  3C6U B;  3E01 A;  3M2R A;  1BWE A;  4CLW A;  2CA9 A;  2IRY A;  4TU9 A;  2BZ2 A;  3PY8 A;  2Z0G A;  1HI1 A;  3AY0 A;  4O3S A;  3NGT A;  4OX7 A;  3NS7 B;  2KU7 A;  2CNK B;  1C0T A;  1HFE L;  4PQU A;  1F2G A;  2YXL A;  3GYX B;  1OWX A;  1C4A A;  3AAW B;  5THW A;  3BM7 A;  1D8Y A;  1PJ5 A;  3OL9 A;  5F8N A;  5A8R A;  1FWK A;  2BJ7 A;  3CC4 S;  1HR0 F;  2DT9 A;  4JP8 A;  4ED6 A;  3NNC A;  2YKM A;  1FKP B;  2GIF A;  1TUW A;  4I6W A;  4MIA A;  1YX2 A;  1M5S A;  3D3B J;  2V6A A;  4IH5 A;  3RBE A;  5E3A A;  5SZT A;  1U0H B;  1YJV A;  5AE3 A;  3PNI A;  3I4P A;  2X7I A;  2DRB A;  1Q95 G;  4QPX A;  1IM6 A;  1YDL A;  2HS3 A;  1Z2L A;  3ZTR A;  2JC0 A;  1HR0 J;  3UPF A;  1GXU A;  4OZ5 A;  1X5T A;  1IKX A;  3UI3 A;  3V4I A;  1N5Y B;  3GU0 A;  3KLI A;  1Y5I B;  2BE2 B;  1B7Y B;  1FKO A;  2AW0 A;  1OQ6 A;  3FSX A;  2OEM A;  3UQS A;  3OXG A;  4X62 F;  4BLG A;  3SCJ E;  4ZLJ A;  2G2Z A;  4C3K A;  1VIX A;  2WHO A;  2QZ8 A;  2ZH5 A;  2AV5 A;  2OPP A;  3FRY A;  2FLN A;  4UQT A;  4B9M A;  1PAU B;  4CO5 A;  3BYR A;  3VAI A;  1VMB A;  3UR3 C;  4GVL A;  3J7Y I;  2FVC A;  2WW8 A;  3EPG A;  5L9X A;  3GQC A;  3MED A;  4P9S A;  4X62 J;  2UXB F;  1AT1 B;  2Z2Z A;  1NHU A;  2ZHO A;  3EXC X;  1ZM3 A;  3FUY A;  2GJF A;  1ZM4 A;  4WFZ A;  3N6L A;  3BF4 A;  4R8U A;  2LEP A;  1QAX A;  4PWD A;  1RT1 B;  2MQQ A;  3CCZ A;  2UXB J;  2DXF A;  1WKK A;  4F4A A;  4EBD A;  2Q1L A;  3U7J A;  2MQL A;  4X4Q A;  5IFM A;  1RA7 A;  3IMQ J;  3ITH B;  2VU5 A;  3EVM A;  4C8Y A;  4TU8 A;  3OL6 A;  1RTH B;  5EWF A;  1HD1 A;  3MM7 A;  2W2Q P;  3V4M A;  4B9L A;  2HWH A;  2ZJR Q;  2K2P A;  2ATL A;  5KFT A;  1Q7Y T;  2IJN A;  3R1H A;  3KNA A;  1DLO B;  5AXN A;  1G4C A;  1TKZ A;  1EIY B;  2KYZ A;  3GG0 A;  3GIK A;  1U48 A;  1LOU A;  2JL9 A;  1TV6 A;  2A6O A;  2HVE A;  3HT3 A;  4PKD B;  3B8H A;  3ETM A;  4RNO A;  1RT6 A;  3MOJ B;  3MAQ A;  1X4F A;  1LWC B;  4ES3 A;  3MTK A;  1RWO B;  2M8D B;  1H2T Z;  2XG8 A;  4KGM A;  2V5H G;  2N4C A;  2A18 A;  3W2V B;  2U2F A;  5JJB A;  3OW2 R;  4J9Q A;  3D9B A;  3I55 S;  1GMW A;  2ZOM A;  3TI0 A;  4YB6 A;  1WSV A;  2JFK A;  1LWF A;  1JXV A;  3KLF B;  3D1O A;  2R3V A;  3TX8 A;  4Q8E A;  3POT B;  3AB2 B;  5J2M B;  2JC1 A;  1T9Y A;  1MRO B;  2LVW A;  2VC1 A;  2E9R X;  1F60 B;  1RTJ B;  3ZO7 A;  3ENQ A;  2FD2 A;  4IRK A;  3MM9 B;  4MIW A;  3RJM B;  1VBZ A;  2JEI A;  4HHH A;  4DZ6 A;  4RW8 B;  2V67 A;  2G0J A;  4B3M F;  4HYK A;  2QLB B;  2HZC A;  2CPH A;  3W9H A;  5CZV A;  1RWP B;  3D0H E;  3BDE A;  2CPY A;  4ZIW A;  1HL6 A;  2YWE A;  4LRE A;  2AJQ A;  3RBX A;  4OZ0 A;  4OHX A;  2MQM A;  2LQJ A;  2LQ9 A;  3M32 B;  1FTR A;  2B6A A;  3NP5 A;  3LWL A;  4QIG A;  2MZR A;  4Y2C A;  3AD9 C;  3SMZ A;  3SXL A;  2J6S A;  2XQC A;  4IG3 B;  2MKI A;  2LXI A;  1WC6 A;  3EXY A;  5IT9 U;  4UY8 5;  1OIA A;  4F02 A;  4AFF A;  3BBF A;  3GV8 B;  1MWQ A;  4Q5V A;  2PGC A;  4FF3 A;  1T9W A;  3DRY A;  4W4M A;  1LWE B;  2GVZ A;  1FRL A;  2RU9 A;  2V68 A;  2ZBQ A;  3C14 B;  4USW A;  3LUY A;  4Y6I A;  5HBM B;  4DUZ F;  1RTI A;  1U2R A;  1MSW D;  4ECU A;  5HI7 A;  3J81 j;  2WVC A;  3CJ2 A;  1JKH B;  3MAA B;  5EWG A;  1N6Q B;  1V3Z A;  1SC3 B;  5T7L A;  3DI6 B;  4OYA A;  4CCH A;  2EXU A;  2P9C A;  5HQ8 A;  3KK3 B;  3KLG B;  1EKS A;  2I5J B;  2E1R A;  3NCQ A;  4L72 B;  3LGH A;  4JI8 F;  4K0K F;  2W01 A;  3A8J A;  2YX7 A;  4RZR A;  4DUZ J;  5HLF A;  1NJZ A;  2H48 B;  3A8E A;  1A6L A;  3KLH A;  2XS2 A;  4IO1 A;  2B4V A;  4FBU A;  4LUB A;  1DTT A;  2X1A A;  2I38 A;  4OHV A;  2G9O A;  3M6W A;  1ZH5 A;  2FZG B;  1S4E A;  4GO5 X;  4ZP7 A;  3MMC B;  2MHE A;  1XNQ F;  4NAS A;  3OLB A;  2POK A;  3TQ1 A;  4JI8 J;  2YKA A;  4PXB A;  2JZ5 A;  3DRP B;  3UVJ A;  1T05 B;  1JJH A;  4YN3 B;  1WEL A;  4ZPT R;  5HJY A;  3TUP A;  3M9M B;  1RAJ A;  1CJU B;  1Q1K A;  1NB7 A;  2HUR A;  3AD8 C;  3GIJ A;  2R7R A;  1DTQ B;  2UXD F;  4C3M A;  4KFB A;  2OML A;  2B7C B;  3C6T A;  5IWA F;  2Q66 A;  1XNQ J;  3H5Y A;  1PYS B;  2C1E B;  5KFQ A;  4UOF A;  2O3D A;  5MAO A;  2VDI A;  4CO4 A;  1BE4 A;  3R3T A;  1R8H A;  5F3T A;  4DV0 F;  4K5R A;  4OJ3 A;  1IBM J;  4WTO B;  1FRX A;  3E01 B;  2HHH F;  2MLZ A;  4CIO A;  3GE9 A;  5SUH A;  4OI1 A;  5IWA J;  2VF3 A;  3UDV A;  4IOC Q;  4B9T A;  1WC1 A;  3KOA A;  4DN9 A;  3Q8Y A;  5HMW A;  1C0T B;  4DV0 J;  4ZVT B;  3Q24 A;  1O51 A;  3GII A;  2FHJ D;  4ECZ A;  4PQU B;  3BB5 A;  2KT5 A;  2R7T A;  3A13 A;  1RKJ A;  1S99 A;  2PMH A;  5DLG A;  2GFF A;  2HHH J;  1K8A T;  2DTJ A;  5A8R B;  4ECQ A;  4JUZ A;  3SCI E;  2YKM B;  3PKM A;  5DRK A;  4XAK A;  5ETR A;  2DNZ A;  2HQD A;  4C0B A;  5T14 A;  2BW2 A;  2CQI A;  3PKY A;  4OHW A;  1VC6 A;  4OYX A;  2BJ9 A;  1RAH B;  3TVZ A;  4D3G A;  4O3R A;  2ZBP A;  4EZ9 A;  1WHX A;  3QRQ A;  2UV8 G;  2FJW A;  4ZCK A;  1IKX B;  3NCR A;  3V4I B;  4J5O A;  3KLI B;  2CPE A;  1PBA A;  4N8N A;  3MPV A;  1B64 A;  1DQ9 A;  1FKO B;  3QT5 A;  2DH9 A;  2ZD1 B;  1RAC B;  2RE1 A;  2FHK A;  5BR8 F;  4OZ3 A;  4KHM A;  2DR7 A;  4QZV B;  5I3U A;  2OPP B;  3NBP A;  1AFI A;  4F4W A;  2MZQ A;  1U09 A;  1ZTW A;  3JQJ A;  3KJF B;  2AYG A;  4IQM A;  3V6K A;  4KYZ A;  2DHS A;  5AT1 B;  2Z8Q A;  1WKJ A;  1T9U A;  3AOD A;  5C2G A;  2KRB A;  1PYT A;  2D74 B;  1UCN A;  2DNL A;  5BR8 J;  1PO6 A;  2LXU A;  1J27 A;  1WG1 A;  2GHP A;  2KYX A;  1T8E A;  2RIL A;  4ZVQ B;  3UWT A;  1VJW A;  3HXM A;  2HWT A;  4DSJ A;  1FJG J;  4HHJ A;  3MI7 X;  4R8U B;  2XSF A;  1NDC A;  4PWD B;  1PIL A;  1NME B;  1KN6 A;  5B0E A;  3BQ2 A;  3D28 A;  3UCG A;  5IT9 Y;  3A3N B;  2RVJ A;  4ZPC A;  5E5N A;  4FP9 A;  3H2V E;  1BLU A;  2W2O P;  1URN A;  3DLG A;  4M5N A;  2AX0 A;  1JK9 B;  4NLQ A;  2DIS A;  2FGO A;  1J5O A;  2QLX A;  3MPU B;  5M2U A;  3GJQ B;  3M8S A;  1QTN B;  1X5O A;  2COL A;  3MF5 A;  1XNR J;  2B56 A;  3MM7 B;  4PG7 A;  3US5 A;  2FY1 A;  1RT3 A;  2WSC C;  3R9L A;  3EMT A;  1FEH A;  2CXE A;  2IRX A;  1S9E A;  5EGY A;  5L8R C;  4KRW A;  3W60 A;  2Y1I A;  3FMB A;  1SUQ A;  1UVM A;  3NGU A;  2W4D A;  1TKZ B;  5I3P A;  1QLN A;  1KDN A;  3DXB A;  1FDN A;  3W64 A;  1TV6 B;  2Z56 B;  4DX8 H;  1X4B A;  3ADA C;  1UA1 A;  5L1L A;  3A1Y G;  4NA1 A;  2ZZT A;  1RT6 B;  2PEB A;  1I51 B;  2WZ1 A;  2F3J A;  3A12 A;  4NLX A;  3IS9 B;  1M1H A;  4BDP A;  1FJ7 A;  2DO0 A;  4MK8 A;  1MG7 A;  1O6X A;  2VFR A;  4O4R A;  2N3O A;  3IBC B;  4C3L A;  4X4R A;  4EU0 A;  2ASY A;  2E9T A;  4JI4 F;  3D66 A;  2XB2 D;  5B0F A;  2F8E X;  4ZCL A;  1HIY A;  4M5H A;  1AXQ A;  2YQ1 A;  2UUC F;  2LLZ A;  5D0E A;  1ZS6 A;  5J1N A;  3JYT B;  4LR9 A;  3Q0A A;  5DZ6 A;  3MM8 A;  5GMD A;  4U96 A;  3SV4 A;  1Q79 A;  3EUN A;  1YQH A;  2XMW A;  3PCO B;  4JI4 J;  1BUX A;  4LFB F;  1Q8B A;  2VBW A;  5B0A A;  3DLL Q;  3DYA A;  2VAS A;  1UTA A;  1DQ8 A;  2UUC J;  5KFE A;  2ALY B;  3E8O A;  1JLG A;  1R0B G;  2QIF A;  3CMA S;  3CCJ S;  2FLO A;  5KFP A;  1VRQ C;  3MXH P;  5DDP C;  3NWR A;  2KT3 A;  3UR0 A;  1TL3 A;  4NCA A;  4LFB J;  3QWP A;  2G1H A;  4HH1 A;  5IC4 B;  2HBQ B;  3P8B B;  2HVZ A;  2DGX A;  5KFU A;  3B54 A;  2B51 A;  1WDD A;  3R2D J;  2GA7 A;  1YJ7 A;  1KLN A;  4U7C A;  3N9U C;  2AJ4 A;  5L9N A;  1UFL A;  4TY8 A;  2AGO A;  2B6A B;  2JVO A;  1YJU A;  3HHL A;  3TJ8 A;  2E29 A;  4KO0 A;  4ES2 A;  1HNI A;  1DAR A;  1SV5 A;  2ILZ A;  2IDE A;  3ZFV A;  1X31 C;  1U4B A;  1UW9 A;  2RD5 C;  1XWL A;  4K2J A;  2QL7 B;  2W1B A;  1FXL A;  2J8S A;  5E41 A;  2GVZ B;  4IFY A;  4L3K A;  3CDA A;  3NAH A;  1YKW A;  4K4V A;  3VV2 B;  2AF6 A;  4Y28 C;  1RTI B;  3KDN A;  3GTY X;  2BA9 A;  3NGR A;  4YB1 P;  2MQ8 A;  3TAR A;  4RR5 A;  5T7L B;  1IQZ A;  4N77 A;  4N47 A;  1L3V A;  1VRT A;  2LQ8 A;  4DR6 F;  5KT2 A;  1S7I A;  2C2O B;  1NSK L;  2W9C A;  2I8E A;  4EO6 A;  4DWI A;  3H59 A;  2ZVI A;  2DY9 A;  4F67 A;  1FVS A;  3S8S A;  5HLF B;  3KLH B;  5CAA A;  1DTT B;  2BKN A;  1DUR A;  1XEZ A;  4FVM A;  3GSD A;  2VH7 A;  1S9G A;  3BS9 A;  5CYQ A;  4MKY A;  2BQR A;  1UZD A;  4P75 A;  5LMN F;  2WVF A;  1PIE A;  3CMQ A;  5BYR A;  3UVJ B;  2B9Y A;  3IXQ A;  1MMD A;  4H4K A;  2DGW A;  4P2S A;  4ZCM A;  4YB5 A;  5B0D A;  2CPZ A;  1YSJ A;  4KFB B;  2K7K A;  3C6T B;  4GRS A;  3GIM A;  4FNI A;  2HYI B;  4RUB A;  3AJ2 A;  1S4F A;  2ROG A;  3A4T A;  1EET A;  2GAH C;  2P6T A;  4WXW A;  2IM1 A;  4U8V A;  2ZJQ Q;  2RDI A;  4HTI A;  2C2M B;  1KLM B;  1ARO P;  2C3U A;  2HZA A;  3WBZ A;  1REG X;  5DM6 Q;  4GKK F;  2X3G A;  4OYP A;  1APS A;  1S1T A;  4KHP F;  1TVR A;  2DJW A;  1Y3J A;  2EFN A;  3PW5 A;  1RAG B;  2GJI A;  2LDY A;  2UXC J;  3RBZ A;  2F1F A;  3I0R B;  2W7O A;  4UTG A;  2BW7 A;  3NRB A;  5C25 A;  2Y9H A;  3J7A 1;  2HWI A;  4XPC A;  1Q78 A;  4Q2M A;  4GKK J;  1YJW S;  3IR7 B;  1XR7 A;  1QJH A;  4KHP J;  4N56 A;  4QIF A;  1G3O A;  1U45 A;  3LGN A;  2QA4 S;  2JEG A;  3LP2 A;  2J8A A;  2XGQ A;  2R8J A;  4LF6 F;  2DCU B;  2R9L A;  3VAJ A;  2R8K A;  4LVO P;  3OHB A;  2JEJ A;  2ZVS A;  4ECT A;  4LF4 F;  1NUE A;  3C2P A;  3RW6 A;  1FNO A;  1L5U A;  4S0M A;  2M88 A;  4RBT A;  1KTV A;  5HSP A;  2HIQ A;  2VFU A;  2M4M A;  5I3U B;  1AUD A;  3NBP B;  4EEY A;  1WG5 A;  3WX8 A;  4QWE A;  3B4M A;  5KFW A;  3L4B C;  3PO4 A;  2QA4 G;  2D41 A;  4LF4 J;  2XS7 A;  1HHS A;  4RX6 A;  5HVH A;  2XUL A;  4OZN A;  3CJQ A;  3BGU A;  1FKA F;  2B8Q A;  2CJY B;  1N88 A;  3BGR A;  4USV A;  3BSC A;  3T3F A;  4F2R A;  2V4J A;  2QLW A;  3RRK A;  1RT2 A;  4QW9 A;  3J80 U;  3WC0 A;  4XK8 C;  1R7I A;  4K4W A;  3K8V A;  2Y8Y A;  4HDH A;  1RWK B;  3DRX A;  2GQ2 A;  1NHK L;  2G1D A;  1QAJ A;  3L9Z A;  1RAA B;  2VB6 A;  3IRX A;  4RU9 A;  1J5O B;  1RWX B;  2RML A;  1VRU A;  2BDP A;  1KOO A;  4XDC A;  4DOZ A;  4GC7 A;  1XIQ A;  4J90 A;  1SH3 A;  3R7B B;  4U9R A;  4A8M P;  1RT3 B;  2UVR A;  1KQK A;  4ZMM A;  2AJ0 A;  3KLE A;  4OZ2 A;  1SUQ B;  4DEZ A;  2WVE A;  3R97 A;  3UDC A;  3VVU A;  4TY9 A;  5JXS A;  2KT2 A;  3O8W A;  3RAX A;  3ZTQ A;  2XMT A;  2R7Q A;  2HVH A;  4NLO A;  2H5J B;  1M90 T;  2RF2 B;  3BO4 A;  1HD0 A;  2E7V A;  3V6J A;  5ADZ A;  4KV8 A;  1MU2 A;  1WOR A;  2EFQ A;  1VQS A;  1HWK A;  2ZZM A;  4YR3 A;  2JJ4 D;  1MNE A;  2RB7 A;  2GGP A;  1FD8 A;  4P7V A;  2C2D A;  2KM8 B;  3DGP B;  4DL5 A;  1HW9 A;  1Q0N A;  4NYP A;  3Q2S C;  2DNR A;  2Q43 A;  4X2B A;  1W7W A;  1HWI A;  4EYH B;  3CTR A;  2DEJ A;  2VKR A;  1K1Q A;  1KSP A;  5AJ3 J;  3LF0 A;  5H1S V;  2IPO B;  2OD4 A;  5EX0 A;  1SKR A;  3IBF B;  1ZBT A;  3MM8 B;  5C24 A;  2FUG 9;  2MKS A;  1LWX A;  3DYA B;  4OQJ A;  3KFW X;  2WVD A;  4YEA A;  4L75 A;  1S49 A;  2CNO B;  1VIO A;  4FF2 A;  3QYY A;  2MYF A;  1CJT A;  2MZT A;  5E7O B;  1JJ2 R;  3TWZ A;  3HX9 A;  3BV8 A;  3EX7 B;  3HSD A;  3ENA A;  2VKZ G;  3K57 A;  1QUP A;  2OFH X;  2RH3 A;  4X84 A;  2VJU A;  2E5J A;  3IAS 9;  2MLX A;  2QTW A;  3EZO A;  3NGK A;  2PFF B;  3J81 Y;  2X3D A;  1QDU B;  4UQG A;  3UO0 A;  2OI2 A;  3MR5 A;  4TY8 B;  3G82 B;  1O8B A;  3HHL B;  3HK2 A;  2P9G A;  4DLG A;  2AX1 A;  2AEM A;  4ILM A;  3JAM U;  1VLY A;  5KFF A;  3X1L B;  4KO0 B;  5H9E K;  1HNI B;  1SV5 B;  3G96 A;  3EWG A;  3H25 A;  5J1E A;  5HL7 Q;  4GO7 X;  4LIR A;  4MAK A;  4URQ U;  3VAL A;  3JTO A;  4IFY B;  4UOH A;  4EO8 A;  2HFV A;  4DSK A;  4OMF G;  2ASL A;  2VIC A;  3H7H B;  1V5I B;  1S72 S;  1FDA A;  2BAC A;  4DX7 A;  3I0S A;  1GXT A;  1N4L A;  1NM2 A;  3R5A A;  2HHP A;  2HGL A;  5KFJ A;  1VQ5 S;  2CG8 A;  1VRT B;  4M5D A;  4CZC A;  3IBW A;  1S1W A;  3DFE A;  4K4X A;  4LSZ B;  4OJH A;  2HMI A;  3LP1 A;  5F0U A;  1NK5 A;  2UU9 F;  4OHZ A;  3EGZ A;  3TEG A;  3DU6 A;  1DHM A;  3NMA A;  3EGV A;  4FPR A;  1S6U A;  1TP7 A;  3S01 A;  5E33 A;  4WCE Q;  4L73 A;  1P1T A;  1S9G B;  1HBU A;  5CYQ B;  4NI2 A;  1B0V A;  1SKS A;  2VG7 A;  1IR1 A;  3FZ2 A;  4FVC A;  2CRL A;  4RW4 B;  4DFJ A;  1S0O A;  2W7A A;  4ZP8 A;  1NEE A;  1GAO A;  1GX6 A;  2HNZ A;  1VS3 A;  3OLA A;  3TUZ C;  2R7O A;  2B9E A;  4WE1 A;  2JOQ A;  2L3M A;  2VIH A;  2VZ9 A;  4K59 A;  3UDE A;  3IM9 A;  3TAN A;  2XMU A;  2HZV A;  4HEA 9;  3I82 A;  3G71 S;  2QEX S;  5K8M A;  1RGV A;  1EET B;  4HTJ A;  5CZX A;  3NS6 A;  1HLW A;  1G6B A;  4DSI A;  1NH8 A;  4DSL A;  3A3P B;  4ILR A;  4NYO A;  2NSB A;  4F2S A;  3Q86 A;  3PRV A;  2F8H A;  1WEZ A;  3MEE A;  3FMW A;  5CCL A;  2DR8 A;  2G0I A;  1TVR B;  1UP1 A;  1RAO A;  2Z30 B;  4NOH A;  2LA6 A;  2X1B A;  4NLV A;  3QSI A;  4C97 A;  4K4T A;  2BQU A;  5C25 B;  2H4Y B;  3PRB A;  1MW7 A;  1YGY A;  3H0P A;  1MML A;  3NWG A;  4HI2 A;  4OJG A;  5HRO B;  1EZZ B;  3HHL D;  2VV5 A;  3JSY A;  2ZNZ A;  3FCV A;  1RTD B;  1D9D A;  2LQB A;  4PPD A;  1VHI A;  2CQD A;  1RLC L;  4ZLL A;  1C4C A;  4B08 A;  2AEJ A;  4E2F B;  5K8N A;  1PJ7 A;  4F4Y A;  4TU7 A;  2ZBI A;  1DJ0 A;  1RU2 A;  4CLY A;  4QJV A;  4JV0 A;  4M5G A;  4G3I A;  1CG2 A;  4DPW A;  1FVQ A;  4Q43 A;  1S77 D;  4ES1 A;  1RHM B;  2OH2 A;  1S12 A;  1HA1 A;  3LWM A;  3CD7 A;  3IGV A;  3F56 A;  3ZZT A;  2ZUG A;  3W9I A;  3FKB A;  2MKC A;  1ZZF A;  3CED A;  2D9P A;  3P6Y C;  3BKU A;  5DDO C;  2ZH2 A;  5DG8 A;  1TAU A;  3PDN A;  3NAI A;  2HQC A;  2QN6 B;  1U6B A;  3ILO A;  2ZH1 A;  1XTZ A;  4NX9 A;  2XZD B;  3BGR B;  5GAH U;  3W63 A;  1WTF A;  2IDL A;  2V4J B;  5LL6 d;  4F0M A;  1RT2 B;  1NJX A;  4IDK A;  2H5I B;  1S10 A;  5E0O A;  2WB1 D;  3QO9 A;  3PYD A;  3VGU A;  3RG6 A;  1FX2 A;  1P9Y A;  1WOS A;  3OTO F;  1UVL A;  4FF1 A;  2XYH B;  2H5E A;  3HJV A;  2FDN A;  4DQR A;  3RB3 A;  4C11 A;  1WHW A;  1X4C A;  3IRX B;  5GAG U;  5A76 A;  1VRU B;  3MCO A;  3NNH A;  1UL3 A;  3O5T B;  4DL7 A;  3NY0 A;  2KN4 A;  3TX0 A;  4MJK A;  2C2N A;  3R1L A;  2QJ3 A;  1TU0 B;  1W2B R;  3OTO J;  4B9S A;  4ZVU B;  1EAY C;  1HYS A;  2CWK A;  3KLE B;  1RQ0 A;  2VPY B;  2ZKT A;  1VQY A;  3PZP A;  1Q5V A;  2Y0B B;  4P2M A;  1GEH A;  3DM2 A;  3ZXW A;  1FE0 A;  3AOA A;  4WFA Q;  5IT4 A;  4DMZ A;  2HIY A;  3BQ1 A;  3E51 A;  2AU0 A;  3IN5 A;  3OR2 A;  2JRS A;  4KV8 B;  4DPU A;  1MU2 B;  4USM A;  1HNV A;  2WSE C;  4ZPD A;  4LF7 F;  5E3P A;  4Q45 A;  3LO3 A;  3PIO Q;  1RU1 A;  2GGP B;  2OD6 A;  3SSQ A;  4FXW A;  4L3N A;  1U8W A;  1U2F A;  2VL1 A;  3R6L B;  1UAW A;  4U67 Q;  4KIA A;  3HD1 A;  4EWT A;  4DX6 A;  3M2V B;  4NLG A;  4KB7 A;  1TL7 A;  4PYD A;  3Q23 A;  5C24 B;  3B6B A;  3ZC4 A;  3GJT B;  2Y0S D;  2ALZ A;  1KHW A;  1XN9 A;  4OX6 A;  2HW3 A;  4CTA A;  2DRD A;  1Q53 A;  3IRW P;  3ZTS A;  2HQG A;  2CQP A;  1ELO A;  2HFS A;  4F4Z A;  3GLJ A;  1CJT B;  2HAI A;  1DAX A;  1F5B A;  2PE8 A;  3HFZ B;  1Y7P A;  3KNG A;  1NRK A;  2K1R A;  4ZLN A;  4FYW B;  1N5S A;  1WSR A;  2W8K A;  4ZCI A;  1ULR A;  2OP5 A;  5IV3 A;  4KJI A;  3H42 A;  3EVO A;  4OLP A;  2YNH A;  1NK9 A;  2GQC A;  4HKQ A;  1U1O A;  2CQC A;  2VFS A;  2QA2 A;  2X51 A;  1PBU A;  2PI5 A;  4LRD A;  2UUA J;  1MN9 A;  5LSR A;  2GMJ A;  5FDL A;  3FBE A;  5KFB A;  3MMB A;  1QE1 A;  1FES A;  4P10 A;  1RWV B;  2YQ3 A;  4UW2 A;  3HHE A;  4RNF A;  4IO9 Q;  3SQO P;  3FQK A;  1JQG A;  4DUT A;  3JTP A;  2PO4 A;  5J1E B;  2BAB A;  2W4C A;  1UWA A;  2EBE A;  4XPE A;  1HNW F;  3H90 A;  4ED4 A;  6FD1 A;  1YHQ S;  2Z57 B;  2C3M A;  3BR8 A;  2YTC A;  1NAQ A;  4ELU A;  3HJF A;  4J9S A;  1B70 B;  1T95 A;  2M3D A;  3I0S B;  3UD5 A;  2ZC4 A;  2FHM A;  2MJU A;  3FRZ A;  3KWM A;  3IG1 A;  4FN5 A;  3R6G B;  1S1W B;  2ZBC A;  3FZB A;  2LEB A;  3H40 A;  5D6G A;  4M8L A;  2HMI B;  1OQ3 A;  3LP1 B;  3R7N B;  3M6U A;  2V2Z A;  4Q7A A;  1SIZ A;  1NPR A;  2CQ2 A;  3I87 A;  3PX4 A;  4PXD A;  3RGI A;  3OVA A;  4KC5 A;  3THT A;  2N4D A;  1LFP A;  4JB8 B;  2IAJ A;  1HWJ A;  3ISZ A;  3VF0 B;  1HBU B;  2K06 A;  2CQB A;  5KG0 A;  2BV3 A;  1RA6 A;  1OYD A;  4P2X A;  4NI2 B;  1U02 A;  2VG7 B;  2MZ1 A;  4LF9 F;  2VQF F;  3EDR B;  4PG6 A;  3F73 A;  2DGQ A;  7FD1 A;  2V4Q A;  1RCX B;  2HFZ A;  1FDB A;  2DRA A;  2H4W B;  4AL7 A;  3ZTP A;  2BJ3 A;  4RLE A;  1Q16 B;  2HNZ B;  1L3K A;  1S6P A;  2C2E A;  4LVN P;  1UPP A;  3K7R A;  4WE1 B;  2XLJ A;  4DG1 A;  3WIU A;  3KHL A;  4LF9 J;  2YNI B;  4Q44 A;  2XBP A;  2EVZ A;  4UT4 A;  1NKB A;  2PI4 A;  5GVQ A;  1KFS A;  4FYV B;  2VHG A;  4HI1 A;  5FLX U;  1WHY A;  5A2Q Y;  2H54 B;  1ZA1 B;  5KFZ A;  3F41 A;  1RBA A;  4PAA A;  2DHX A;  3CCL S;  1SC6 A;  2RKI A;  3MPD A;  2DGT A;  3D1Q A;  1ACM B;  5MLC V;  2HG4 A;  1RAF B;  2BUN A;  2WOM A;  2RQM A;  3PFE A;  1B7F A;  4LT6 A;  3MEE B;  2EFV A;  2CFX A;  2AYE A;  2FVS A;  2YQ0 A;  1FRJ A;  3GYG A;  4DQS A;  4WU3 A;  4N76 A;  5KT4 A;  4DV5 F;  4FYD A;  2AWZ A;  2UP1 A;  1VDH A;  2C2Z B;  1SL2 A;  1Y0H A;  4HHU A;  2F5G A;  3IC1 A;  3AJD A;  4CWB A;  3CC7 S;  4G1I A;  2DVI A;  5DET A;  4TLQ A;  2XO6 A;  2RQ4 A;  5JVH Q;  3O6Q A;  4ECR A;  3SBM A;  1OY8 A;  3LAL A;  2A2D A;  4OX9 F;  3HT0 A;  2D7S A;  4ECY A;  1OYE A;  3RW7 A;  1A9N B;  3QNW B;  4DV5 J;  3CJR A;  1R31 A;  1WC5 A;  1SI9 A;  1VC0 A;  3QGI A;  2JHE A;  3R5J B;  4PWW A;  3TW0 A;  4QCL A;  4DBQ A;  1UPM B;  2UUW A;  3I6P A;  4F7V A;  3G2X A;  2FC8 A;  3THP A;  3C16 B;  4DR7 F;  2R7X A;  3CJK A;  2CZ9 A;  4OX9 J;  5B0C A;  3J7Z 5;  1S79 A;  4TLR A;  3RB6 A;  4ETX A;  3FSI A;  7FDR A;  4R0E A;  3JSR A;  2XMA A;  3PV8 A;  1TKT A;  1FRK A;  4CT9 A;  3RAQ A;  3T5J A;  2ZBR A;  2HHU A;  4DV1 J;  4DR7 J;  1UW4 A;  1EB0 A;  4WKY A;  3CDB A;  3PW0 A;  4KSE B;  1KBR A;  1QD1 A;  4DQQ A;  3CDE A;  2CZV C;  3VWS A;  4MKA A;  3KK2 A;  1VC5 A;  5DJB A;  4EGL A;  4G6V B;  5KTQ A;  2M8H A;  3K59 A;  3M8Q A;  1R43 A;  2HBR B;  5I42 A;  3CCU S;  2PEH A;  4IDK B;  2HFN A;  1WF1 A;  2GZO A;  4O3Q A;  3DNC A;  4OYM A;  1JLA A;  3CJS A;  5CYM A;  2B4P A;  1U2C A;  3PJ9 A;  3KLV A;  4HH0 A;  1YRT A;  3QO9 B;  4ED1 A;  1YJN S;  1U1R A;  2DR6 A;  3BO3 A;  2V94 A;  1U47 A;  1NK0 A;  2CWX A;  2IVY A;  1BMQ B;  4C11 B;  3DGV A;  2IY5 B;  1RKI A;  3Q22 A;  4CO2 A;  4C4W A;  3UNY A;  3ZZR A;  1NBE B;  1NSP A;  2VOP A;  3T6B A;  4FS1 A;  2IBO A;  5A0Y A;  4A8K A;  1SJR A;  3DDN A;  4W98 A;  4AE5 A;  4DXL A;  1HYS B;  1JXL A;  2V63 A;  2Z2L A;  1WNE A;  1SL0 A;  3CF5 Q;  4I67 A;  1NU4 A;  1O0P A;  3GCW P;  3DM2 B;  3SDE A;  4ANC A;  4B02 A;  4C0O C;  2BRL A;  5ETN A;  3K8W A;  2EKN A;  3OL8 A;  1A7G E;  1UEV A;  1ZZN A;  4FNH A;  3FBC A;  1N36 F;  5KG1 A;  2NR0 A;  1HNV B;  4MTP A;  5D78 A;  3KHH A;  5KG3 A;  3OL7 A;  1LW2 A;  3TO8 A;  4HLB A;  4IRC A;  3VTI A;  3G6E S;  3PYE A;  1PGZ A;  1GT8 A;  2B5J A;  4KGK A;  2AD9 A;  1TFY A;  3BH7 B;  3SI8 A;  4PYA A;  1TZ0 A;  1N36 J;  2BXJ A;  1HNZ F;  2IYG A;  4CLS A;  4C48 A;  4PQA A;  1TL7 B;  4M1K A;  1HBN B;  5D4L A;  1KEK A;  4C8O A;  3AXM A;  5CHC B;  4OZJ A;  1BD6 A;  3OPK A;  5FLX Y;  4AL6 A;  1WJ9 A;  4CTA B;  1AUS L;  3MD3 A;  2A3J A;  3PVX A;  2VDH A;  2HVD A;  4ZHR A;  1NDL A;  3RBD A;  3OTC A;  1HNZ J;  2IA6 A;  4YOE A;  3H4D A;  2XSJ B;  4DSE A;  1C0U A;  1SB6 A;  2E66 A;  3OVB A;  1R89 A;  3K89 A;  2H1Y A;  3PJW A;  2K1R B;  4RBV A;  3CW2 C;  5F9N A;  4LMZ A;  1CBK A;  3FK4 A;  3V6H A;  2IC3 A;  2HGM A;  2AJ1 A;  3E2E A;  2KFN A;  4JV1 A;  1QY7 A;  2YNH B;  4I2Q B;  4QPT A;  3KDO A;  1RWU A;  3NXZ A;  1FTC A;  2YH1 A;  3BH6 B;  2RRB A;  5KT3 A;  2F65 A;  2HRU A;  1BXN A;  2JLE A;  5G0R A;  5FDL B;  2R4F A;  2R2T A;  3MMB B;  4KE5 A;  1JLF A;  4CP5 A;  3H5X A;  2J9C A;  2PT0 A;  4M5I A;  1HNX J;  4OLO A;  1FJE B;  4YDD B;  3G87 A;  1IKY A;  2QA1 A;  4DR5 F;  2KB2 A;  2V8P A;  3CVK A;  1G7C B;  3FEX B;  4A8O A;  1M5H A;  2DNQ A;  2DR5 A;  4N8O A;  3N01 A;  3WHI A;  3L7O A;  2O66 A;  4LFC F;  1XJW B;  2KJV A;  4TXS A;  4DFM A;  4K4Y A;  1NB2 A;  1YIJ S;  4PAB A;  2QL5 B;  1UZH A;  2I1R A;  3IG1 B;  4DR5 J;  2OPR A;  3KJN B;  4HVZ A;  4I68 A;  4Q2L A;  1NO8 A;  4ID5 A;  3OBI A;  4EBC A;  3ZTO A;  1RIS A;  2RRN A;  4QR2 A;  3ET6 A;  2MHN A;  4YS2 A;  4ED0 A;  2FVP A;  2GIR A;  1XMQ F;  2EBG A;  4LFC J;  2DY1 A;  2XNQ A;  3OFG A;  3HKW A;  2GW8 A;  3O2I A;  3PYG A;  3TOQ A;  2DKO B;  3N5F A;  4DV7 J;  2WON A;  2IAJ B;  1GTE A;  3VGV A;  4CO3 A;  4NPO A;  4V19 X;  1FRM A;  4X65 F;  3DN9 A;  5FJ4 A;  3TNV A;  1I94 F;  4X4U A;  2OKQ A;  2XNR A;  1XMQ J;  3G6V A;  1H98 A;  4ZPV R;  4LRC A;  2EI5 A;  4OHY A;  1O5J A;  3LP0 B;  2KL8 A;  2OUG A;  3IWL A;  1RHJ B;  2CUY A;  2Z2Y B;  2HLU A;  2NRE A;  5GAD I;  1S6P B;  5D4P A;  4M5J A;  4OI2 A;  1KC8 T;  5L38 A;  1B4S A;  3GR1 A;  1Z2Z A;  4X65 J;  4DG1 B;  4PEO A;  4YHH F;  1I94 J;  3C8Y A;  5IQQ A;  2DO4 A;  3VAM A;  1JLC B;  1ICE B;  3H5U A;  1GMV A;  2VA2 A;  4EBE A;  2ZM6 F;  3I32 A;  2ZDO A;  4ZVR B;  2WOM B;  1IBL F;  3VQS A;  2QL9 B;  4DLE A;  3CGI A;  1I6J A;  2ZE2 A;  2JFD A;  3FC9 A;  3GV5 B;  4YHH J;  2FHO B;  3AT1 B;  3DRS B;  3GFX A;  1LK5 A;  2RUS A;  3CO9 A;  4RU2 A;  4A48 A;  3DDK A;  2PII A;  2XY5 A;  1Q4R A;  3MOZ A;  1R8P A;  1TEL A;  2ZM6 J;  2BKP A;  4K8R A;  2HHS A;  1IBL J;  3SEO A;  3W5Y A;  3EVW A;  2F9D A;  4ZVF A;  2JWN A;  2BJE A;  1S57 A;  3LAK A;  3PX6 A;  4K7Q A;  2FVR A;  1X5S A;  2KFZ A;  4LIW A;  3G6X A;  3LAM A;  3D68 A;  2IVM A;  1VK8 A;  4YB7 A;  3T6J A;  1RXO B;  1C1C A;  2ADC A;  3CJK B;  3SFU A;  2PMZ D;  4KGX B;  3ICL A;  4DX5 A;  1KFD A;  3SSR A;  4IG0 A;  9RUB A;  1RHU B;  2CJ9 A;  1IN0 A;  4CLK A;  4ECV A;  3C15 A;  4C6A A;  3DOM A;  5J2N A;  4ED8 A;  4QWB A;  1TKT B;  2LP4 A;  4BWJ A;  4PG4 A;  3N28 A;  3AOB A;  5GME A;  3HCX A;  4H4M A;  3J7Y U;  4RNM A;  2V50 A;  2LU2 A;  2KG1 A;  3ILL A;  2R8H A;  2OAU A;  2IM2 A;  4ED2 A;  2LEA A;  3H2U B;  1WI8 A;  1W2I A;  3DOL A;  3M7V A;  1VBY A;  1IJF B;  5KG4 A;  1RAI B;  3KK2 B;  1TMM A;  3JTN A;  1S7H A;  1R6Y A;  3M8Q B;  4I6A A;  5I42 B;  1UVN A;  5GAE I;  3T5L A;  4LSN A;  2GIQ A;  3BN7 A;  1JLA B;  5CYM B;  1VYA A;  1KP6 A;  2CVI A;  1U24 A;  2MY8 A;  3BGO P;  1T0T V;  1TFW A;  3M9N B;  2UVV A;  3SQG A;  1VQN S;  4NLW A;  2KHD A;  1TL5 A;  3P5B P;  3G6Y A;  3NCP A;  3JSM A;  4FYY B;  1QTM A;  5EHH A;  3N6M A;  1H2U X;  4C7Q A;  3TQE A;  1D3W A;  3M8R A;  2NPI A;  3W8P A;  2KRR A;  3MFI A;  1PCA A;  3MCN A;  2CPX A;  5A0Y B;  1KON A;  2DK2 A;  3SZ2 A;  5DS7 A;  5LMU F;  4NLD A;  4F50 A;  3M2U A;  3VAK A;  1FO1 A;  3KUE A;  2JDJ A;  3T1Y J;  2WSF C;  2YWH A;  3KMS A;  4LRA A;  2YNG A;  1FA0 A;  3HKZ D;  3SDE B;  4KAI A;  1IKW A;  4J9P A;  4RW7 B;  1AYE A;  3DRR B;  5A8W A;  3GON A;  3QAU A;  1F6T A;  5LMU J;  3UN3 A;  5B7W A;  2XYG B;  5KG7 A;  1K44 A;  2R2R A;  3NGS A;  3ILJ A;  1VQO S;  1UET A;  1UJ6 A;  3IWN C;  4KQZ A;  2M2B A;  1S97 A;  3T19 A;  2MMY A;  2XEX A;  4RPF A;  3OXF A;  5J2P A;  2F4V J;  2EK1 A;  2CJX B;  4WFN Q;  2Y1R I;  1NJI T;  3N4W A;  1EQM A;  5KFR A;  2V4R A;  1X7V A;  2RHS B;  2X1G A;  2AGP A;  4DUY J;  1ZM2 A;  3UCU P;  1N32 F;  3PM9 A;  4ZIT A;  4O3O A;  2CDR B;  2HBZ B;  3AD7 C;  3RAM A;  5H9E J;  4RO0 A;  4RWX A;  2K3K A;  4ZHR B;  4J9V A;  3ULH A;  1VBK A;  3MWB A;  1RUS A;  3OHA A;  3CO0 P;  3HI9 A;  1RT5 A;  4DL6 A;  1C0U B;  2KG0 A;  3T1H J;  4QU6 A;  1N32 J;  1S1U A;  1X4A A;  1SH0 A;  4KBI A;  1VQ7 S;  1OSC A;  1N56 A;  5CYJ A;  2NXE A;  4USJ C;  3TA2 A;  4I2P A;  4Y2I A;  3CME S;  2IC3 B;  1TQL A;  2LA4 A;  2YKP A;  4UF4 A;  1KVJ A;  4WK3 A;  1RI7 A;  2CG4 A;  1B99 A;  1YIT S;  3CUL A;  1M5O C;  4ILL A;  2IM0 A;  4TYB A;  1PKU A;  3MEG A;  4QIE A;  4ZVS B;  2KZZ A;  3GP9 A;  1KTQ A;  4F4K A;  1U1P A;  3AJ1 A;  1IBM F;  1G1X A;  1QVG R;  4NXN F;  2MQO A;  2EKY A;  3EJM A;  1JLF B;  1F3F A;  2XYP B;  2FGC A;  4URS A;  1YLX A;  2E5I A;  2VJV A;  4LBP A;  3TAM A;  2CDQ A;  4QW8 A;  2QLF B;  1IKY B;  2E7X A;  4NCG A;  5F9L A;  2VC0 A;  2HK3 A;  3GFH A;  4OV6 A;  3M2R B;  2L9W A;  4NXN J;  1Q8K A;  4KR0 B;  1RHR B;  4ZS6 A;  3GMG A;  2JH3 A;  2GML A;  2QC3 A;  3R2C J;  1N5Y A;  3AFG A;  3BPS P;  2OPR B;  4USU A;  2BKO A;  3R5G A;  2NCK L;  4ID5 B;  3ET6 B;  3LQV A;  1JNZ B;  4ZP6 A;  2RSQ A;  1SJF A;  4YQW A;  1Y4Z B;  4OIX A;  3UD4 P;  2F7V A;  2MZJ A;  3D1H A;  3F44 A;  4WII A;  3ELH A;  2ZH7 A;  2WON B;  1Y3K A;  5K14 A;  4QWA A;  5L39 A;  2GQQ A;  4B3T J;  2MY7 A;  5D77 A;  2MPU A;  4N5S A;  2MKK A;  1RCO B;  1H0H B;  3HZE A;  4EYI B;  4WFX A;  2HFU A;  3TJA A;  2RAQ A;  1E6V A;  3PFO A;  3MDF A;  3ILI A;  4CI0 B;  3DLK A;  3OTB A;  3GZ7 A;  4DR3 F;  5EN1 A;  3PHT A;  1ZPV A;  3EYZ A;  3S1T A;  1SKW A;  2J0Q D;  3MR6 A;  2RHQ B;  2KZM A;  5DGA A;  2CNN B;  4J9R A;  2LEC A;  4YME A;  1FJG F;  3PYF A;  1IQT A;  2DNG A;  5KFD A;  5U47 A;  4W90 B;  4P74 A;  1VQP S;  1D9F A;  2AGQ A;  1FXR A;  3MED B;  4DF4 A;  1TK0 A;  3QGP A;  2HAF A;  2IBK A;  1K73 T;  4DR3 J;  3CWJ A;  2PA3 A;  3PEH A;  4WYL A;  5F8J A;  1ZAX A;  4E0D A;  1I5O B;  4CT8 A;  3HHL C;  4PXE A;  3CE8 A;  1TTH B;  2ZUA A;  2XS5 A;  4I1T A;  4NZ0 A;  2ZKU A;  1DLO A;  1WUU A;  3EE3 A;  1XNR F;  1WEX A;  1Z1Z A;  3Q8P B;  3I9Z A;  2HKE A;  1UVI A;  3BN4 A;  4CH1 A;  1IKV A;  4DS5 A;  2BEF A;  4B9V A;  1X4H A;  4UZB A;  1HBO A;  4WYW A;  2YPY A;  4I4B A;  1XR6 A;  3ENV A;  3D54 A;  2J7W A;  2DGV A;  3HHK A;  3PIP Q;  3T41 A;  2VG5 A;  3CDU A;  2XTJ P;  3KUH A;  4OYW A;  4AND A;  5KFI A;  1C1C B;  2E44 A;  2CPD A;  2DPI A;  4HT7 A;  3LA0 A;  3B4D A;  5JMN A;  5L1I A;  4A47 A;  4IG0 B;  4MKV A;  4KPC A;  4Q8F A;  2CQ3 A;  3C15 B;  3DOM B;  5JUM A;  5J2N B;  1WWH A;  1Q81 T;  1NCL A;  2B4U A;  3POT A;  1AZS A;  1X4G A;  3V6D A;  2XY7 A;  4H4M B;  4K4Z A;  3PAC A;  3GCX P;  4Y2K A;  4DPY A;  3UN2 A;  2MZS A;  5CD4 H;  2XHW A;  4H4K C;  2VOD A;  4LJM A;  1GTH A;  2HVI A;  3Q89 A;  5DLF A;  3DCA A;  2MDA A;  1F9H A;  4LSN B;  1F3V A;  3D6F B;  2FHJ A;  1TR0 A;  3HSZ A;  1LWF B;  5HAN A;  1QM9 A;  4ECX A;  1Q5Y A;  1T94 A;  2A2C A;  5IS2 A;  3G9C A;  3EIC A;  3D6H B;  2XMJ A;  2CJK A;  4OFZ A;  4TNO A;  2B43 A;  2BOA A;  2GS8 A;  3JSM B;  4Y00 A;  3W3S A;  3HPO A;  1UWB A;  2J9D E;  2V2Q A;  3LPY A;  2D69 A;  4X4N A;  5KFH A;  1M5K C;  4YR0 A;  2AP6 A;  3DC2 A;  2XI3 A;  1RHQ B;  5BYQ A;  2ZHA A;  5HAO A;  1S1V A;  4DPX A;  2V8V A;  4I64 A;  3CPW R;  5DDQ C;  3QZ8 A;  1LKZ A;  2ZDP A;  4CNZ A;  1GMU A;  4LR8 A;  2WCX A;  4AXJ A;  3BJY A;  3N0V A;  1PC4 A;  2DNM A;  2YNG B;  5HBM A;  4NMX A;  2MXY A;  1IKW B;  2W8L A;  4ZJO A;  1F9F A;  5HVF A;  3EM1 A;  5A8W B;  1N6Q A;  1AB8 A;  3DI6 A;  2MQN A;  2NLW A;  1P27 B;  1CEZ A;  2P5V A;  1P9Q C;  5RUB A;  3S6E A;  1U25 A;  3HVT A;  3DXS X;  4CLL A;  1PJ6 A;  2BYC A;  2C3P A;  2GC8 A;  2YPZ A;  2B4O A;  2AQ4 A;  3M8Z A;  1ZPW X;  1U1N A;  1GNK A;  1XBW A;  3MMC A;  3NKY A;  1DQA A;  2G13 A;  4UOG A;  4ITS A;  3SCL E;  4U6P A;  5ETS A;  3BKT A;  5DG9 A;  3OSP A;  3DRP A;  5IC6 B;  4WFY A;  3J7Z T;  3PEJ A;  3CD0 A;  4M5L A;  4EMD A;  1YBA A;  3ZZ0 A;  2DD8 S;  1R8B A;  5LM7 E;  1VQL S;  4F36 A;  1F2H A;  1RT5 B;  3MGJ A;  2DBB A;  1AFJ A;  4ICL A;  1EAR A;  4OL8 A;  1S1U B;  2EFG A;  1JXE A;  4KGV B;  5F41 A;  1KVI A;  2QMU B;  4I2P B;  2W9B A;  3CCT A;  3G8T A;  4J7C A;  2RUG A;  2ERR A;  4XIU A;  4NEY A;  2DNH A;  4TQS A;  1OJ4 A;  4ED3 A;  2APO A;  4MYU A;  5C7P A;  4V19 J;  1EKR A;  1ZAW A;  3MEG B;  4DFK A;  5D0G A;  1GMW D;  3H20 A;  1TK5 A;  4WU2 A;  1J5E J;  3ISN D;  3MEC A;  2FJX A;  3BEG B;  3CJ5 A;  1QSY A;  1NDP A;  1YJT A;  5BJR A;  1S48 A;  3ZNU A;  1CQM A;  2KTQ A;  5GMK a;  4WF9 Q;  2MLY A;  1EJ7 L;  2GV1 A;  2LQ5 A;  1ZM9 A;  5EWE A;  2DIU A;  3TAM B;  3AA8 A;  1WF2 A;  4NCG B;  4NXM F;  3HVR A;  5IXU A;  2J0W A;  1V6H A;  1SJ1 A;  4FKX A;  4TN2 A;  2UXC F;  5KT6 A;  3R5C A;  3KJV A;  1XMB A;  2HND A;  4Z2X A;  4KKO A;  2OFG X;  3HSJ A;  5ITH A;  5KT5 A;  3RB4 A;  2N3L A;  2HSE B;  2QMX A;  4I7F A;  3DLH A;  2EEY A;  2YWF A;  4FF4 A;  5D3G A;  2VG6 A;  4K50 A;  1G2E A;  4NXM J;  4GVB A;  1VR6 A;  3V81 A;  2ZD1 A;  4RJV A;  3IP0 A;  2AJ2 A;  5KFX A;  2ZJP Q;  5E3Q A;  2GCF A;  3NOG A;  4A4J A;  2ZIT A;  3I9V 9;  2YX1 A;  4IKA A;  2YBV A;  3PRD A;  1R0A A;  3FJ2 A;  2CVE A;  2KFY A;  3M8W A;  3PR4 A;  3LOU A;  1R8A A;  4BWM A;  2HQ3 A;  3QID A;  1T3O A;  1K0T A;  1CJV A;  3CJT A;  4Q0B A;  2VFV A;  2BE9 B;  3R5D A;  1U7L A;  5K14 B;  2VA3 A;  2FJV A;  2MST A;  1WAC A;  4C8K A;  8RUC A;  4X66 F;  3LH2 S;  1WOP A;  4MH8 A;  3SCK E;  3NS5 A;  4WKR A;  2R7W A;  2FPH X;  2C2R A;  2EWH A;  3TYT A;  3CCM S;  3SIP B;  4E98 A;  3MM5 A;  5HMX A;  1E6V B;  1DY3 A;  3K5L A;  1X9M A;  1NLK L;  2BJ1 A;  5ETT A;  3P49 B;  3RR7 A;  4XO0 A;  1JJC B;  3DLK B;  3NG8 A;  3NLC A;  2IM3 A;  2C22 A;  3CDW A;  4X66 J;  1WC3 A;  4AL5 A;  3FBB A;  4CLZ A;  2PSZ A;  2D1C A;  3TVY A;  3D6M B;  1FFW B;  3I5C A;  4ZIV A;  2ZH6 A;  4LF5 F;  3AA9 A;  5KOX A;  2I6W A;  3EZU A;  4FKY A;  3R5B A;  2QFJ A;  4G1Q A;  2K8G A;  4CO0 A;  3MPW A;  5AE1 A;  2CZ4 A;  2XI2 A;  2DXE A;  4MKB A;  5D4N A;  4ZVG A;  2QO3 A;  4AXI A;  4J9K A;  1D09 B;  4A8W A;  4LF5 J;  5I3Q A;  3QQC D;  3HHD A;  1MMN A;  2Q6C A;  1TKD A;  2PC6 A;  4YUD A;  1IKV B;  3HM9 A;  2BM0 A;  5IZH A;  2AKW B;  1HBO B;  3DLG B;  1RDR A;  2MGZ A;  3IS9 A;  1FDD A;  3T9Z A;  3QLH A;  2XHC A;  3W2W A;  1BQN A;  2VG5 B;  5M2R A;  2LCW A;  1H7X A;  2VD3 A;  4ZPB A;  2IFX A;  3O3L A;  1NZA A;  1OY9 A;  4K4U A;  1YRX A;  5KFK A;  2V8H A;  1S9E B;  4MK7 A;  3BBC A;  3Q8S B;  1XMO F;  1NJY A;  3JYT A;  1PG5 B;  3NOC A;  1SC1 B;  4CH7 A;  1S0M A;  1AZS B;  5HN0 A;  2CQ1 A;  1IJE B;  1GQE A;  3M6X A;  3VZI A;  3V6D B;  1N33 F;  1WG4 A;  2QV6 A;  2Q79 A;  1NSQ A;  2W2P P;  2H9Z A;  2M9K A;  5AJ3 F;  1F9E B;  3KG0 A;  3TZW A;  1XMO J;  2BM1 A;  3FEY B;  4DFP A;  4KY3 A;  4NA3 A;  4CM2 A;  4PG5 A;  2EC2 A;  2DXD A;  2XWY A;  4RUC A;  1N33 J;  5AXK A;  3QWU A;  2R7V A;  5D0R A;  5D0H A;  1ZYQ A;  2HHX A;  3W5Z A;  3BSN A;  1S6Q A;  3OT9 A;  3DMJ A;  4TYA A;  3V2U C;  4B9U A;  3R7S B;  1VI7 A;  4QR0 A;  3M8P A;  2SXL A;  2O01 C;  1S6O A;  3TZX A;  2H51 B;  3TA0 A;  2DNO A;  2NSC A;  3BO2 A;  5IQ6 A;  1UWB B;  2KXH A;  2FTR A;  2FY8 A;  4J9N A;  4B3M J;  1SJ3 P;  2CQH A;  4XDD A;  3CJ3 A;  1JLG B;  1K1S A;  2P2C B;  3M05 A;  1S1V B;  1UVK A;  3PO5 A;  4OYO A;  4U7U D;  1TL3 B;  5DDR C;  1YBU A;  3CIZ A;  1CQN A;  4DS4 A;  2JLF A;  3W7B A;  1RTZ A;  2BVZ A;  2OPS A;  4ZVO B;  4RW6 A;  1A0O B;  4ELT A;  3UE2 A;  4HDG A;  4DV6 F;  5C2C A;  5EX3 A;  3GSI A;  3N6N A;  2NQP A;  2R42 A;  4DCO B;  4C2M A;  2DEI A;  2XGP A;  3HVT B;  3VVT A;  4RL1 A;  5EDW A;  2NXJ A;  2CJA A;  3RB0 A;  1T3N A;  2FQQ B;  1PSD A;  3K58 A;  1RLD A;  4ZK7 M;  1JWW A;  3NL0 A;  4H4O A;  4DV6 J;  5J1P A;  3HSG A;  2PA8 D;  4LQ3 A;  2KXN B;  2IA0 A;  1Y5L B;  3TVK A;  1VHF A;  3KJQ B;  3MUT P;  1RYS A;  1K0V A;  3DHW C;  4K0K J;  2HHW A;  2MKH A;  1R6V A;  5LXY A;  2VQE F;  1D9A A;  1QAI A;  4DQI A;  3OTE A;  2OSR A;  3H4B A;  3L3C A;  2UZA A;  4JI0 F;  2ASJ A;  4R5P A;  1AW0 A;  2W9C B;  4PXC A;  2ASD A;  1YBT A;  3G86 A;  4ICL B;  3F0N A;  2HLT A;  2MKY A;  3J80 Y;  1BQM A;  1S0N A;  4OX8 A;  2VQE J;  3LW5 C;  5T41 A;  2W9B B;  1SCJ B;  2E5G A;  4NML A;  1KLM A;  1T9V A;  2UXD J;  4JI0 J;  1RWN B;  3W5X A;  3WZ0 A;  2EPI A;  4EUV A;  2BRK A;  2V2V A;  2XMV A;  4X4S A;  3GIL A;  5F3Z A;  2OIH A;  3MEC B;  1VQM S;  2E5L F;  3MMA A;  3K0J A;  5J2Q A;  3U1N A;  3NNA A;  2OTJ S;  2GAG C;  3ZZY A;  1EX8 A;  5IT0 A;  3I0R A;  2D3U A;  2M7S A;  1S76 D;  1PC5 A;  8AT1 B;  4KH0 B;  4X4O A;  2V2K A;  1WTB A;  2CQ0 A;  1FNM A;  5C42 A;  1OS5 A;  2RT3 A;  4AYB D;  4DCP B;  1HWU A;  1I3O B;  1NHV A;  2E5L J;  4PWU A;  1NDK A;  1JX4 A;  1ZOT A;  3KJV B;  2WBR A;  4OYZ A;  3GFY A;  2HND B;  5E2Q A;  4F25 A;  4YY3 F;  4R25 A;  1NPK A;  4KKO B;  5HK4 A;  2VBZ A;  1KKH A;  3KMQ A;  2XCA A;  1H38 A;  3KHG A;  4I7F B;  2VBY A;  1S1T B;  4LRB A;  1U1K A;  5D3G B;  1SXL A;  2VG6 B;  2IHR 1;  3T5K A;  3L09 A;  4GVB B;  4LQ9 A;  3V81 B;  1N5T A;  1FI4 A;  1LFW A;  4PZV A;  2NS1 B;  4ED5 A;  1S0V A;  4YY3 J;  2UUT A;  1R0A B;  3IR6 B;  5H9F J;  1B0T A;  2X1F A;  2GX8 A;  4PRF A;  1WI6 A;  2C3O A;  1CJV B;  1HHQ A;  1RT7 A;  4Q0B B;  1WOO A;  3FCH A;  4B3R F;  5HP1 A;  3K5N A;  3LP2 B;  2Z2M A;  3PJX A;  3MCS A;  3MR7 A;  4UY8 T;  1FD2 A;  1FFG B;  2FLL A;  3I96 A;  2YKQ A;  5ETL A;  3NEK A;  3MM5 B;  2A6M A;  1U1L A;  4ZJQ A;  1Y5N B;  4FPI A;  4ED7 A;  2ACY A;  2I9S A;  5BXI A;  1QAY A;  2I0X A;  3UN5 A;  4B3R J;  1YJR A;  3TZY A;  2DCL A;  4FBT A;  3T9N A;  3SV3 A;  3B82 A;  2YX4 A;  2GJ2 A;  2O5D A;  2XWX A;  3AQP A;  5ETO A;  1WEY A;  4G1Q B;  3QFW A;  1WC4 A;  2GO9 A;  2AZ3 A;  2P8I A;  4WJB A;  5AE2 A;  1N5V A;  4NLT A;  3OR1 A;  2F9J A;  4MMO A;  3NGD A;  1S9F A;  3M4X A;  5A8K A;  2RIJ A;  3VAF A;  2WK4 A;  5IM0 A;  3JAM Y;  4DR2 F;  4WP8 A;  4M5K A;  2DNN A;  3L7P A;  3QIP A;  1SQE A;  1T9X A;  2RF2 A;  2LXF A;  3Q83 A;  4HT5 A;  1NPP A;  3IWX A;  2MGZ B;  4OZ1 A;  4C8Z A;  1XER A;  3QLH B;  4DL0 C;  1H7W A;  5K9F A;  3E3X A;  3W2W B;  1KQS R;  1UFW A;  1BQN B;  1KOH A;  4AT1 B;  1RBO B;  4WWS A;  2P6S A;  4DR2 J;  3DGP A;  1N34 F;  1TL1 A;  1N0V C;  3AXK A;  4JOU A;  1CUL A;  5LT5 A;  3UNG C;  2M70 A;  2BR0 A;  3HHN B;  3BSA A;  3WX4 A;  3TUJ C;  4G65 A;  2EFO A;  3MR3 A;  2R7S A;  1F5C A;  2OEK A;  4ZDN A;  2N7Y A;  2R8I A;  2FZC B;  3MZI A;  5HAT A;  1LQ9 A;  4WTY A;  1QSL A;  2O67 A;  1VGY A;  1TUV A;  1UEK A;  2WW4 A;  3BZQ A;  5DM7 Q;  1KNZ A;  2OTL S;  3KTQ A;  2R7U A;  1N34 J;  4AUK A;  2XCP A;  5FII A;  4DF8 A;  2OEJ A;  1S59 A;  3W62 A;  1LXN A;  4WIQ A;  2FB0 A;  3MUV P;  4IQX A;  1Q8I A;  1HMV A;  1PYO B;  5LJ5 Y;  4ID8 A;  3FDS A;  4I0W A;  3VAH A;  2Y8W A;  1T03 A;  4ZP9 A;  8ATC B;  1JLB A;  5CCM A;  4Y3C A;  1KQF B;  2O1P A;  2EFP A;  4N7T A;  2OLW A;  2CYY A;  4IOB A;  4WXO A;  2W7P A;  4CH0 S;  1SJ4 P;  3ZZU A;  1S6Q B;  3DMJ B;  5KFA A;  3P45 B;  2MJN A;  1EP4 A;  3CJ4 A;  1V3R A;  4X4P A;  5CA5 A;  4JI5 F;  3M8P B;  2GHW A;  1RAD B;  1FHT A;  1U26 A;  1KQG B;  3JQM A;  4ZVP B;  4P52 A;  5B08 A;  3G82 A;  1Q8L A;  4IUF A;  2RDJ A;  2HBY B;  2A0F B;  4IRD A;  1D8Z A;  2LU1 A;  1HQU A;  1H2V Z;  3OTD A;  2DNY A;  2HHQ A;  2RRA A;  2L9N A;  4F0H A;  4JI5 J;  2D3Z A;  2UUA F;  4IR1 A;  2BJ8 A;  4EZ6 A;  2BBE A;  5EUH A;  3BGF A;  2MB0 B;  2HFO A;  2ZOF A;  4CLU A;  2I2Y A;  1SH2 A;  1GX5 A;  4M63 A;  4Z37 A;  1NND A;  2OPS B;  1JLQ A;  3P96 A;  1MLA A;  4RW6 B;  5ETQ A;  1IBK F;  3PG9 A;  1MWZ A;  1UA0 A;  3K5P A;  2VBX A;  5KG5 A;  3UD3 P;  5D8H B;  2NXN A;  3VHQ A;  2V8D A;  2DHG A;  2Z58 B;  1U0S A;  2C2K B;  2Y1J A;  3ONQ A;  2A10 A;  4ANE A;  4OYB A;  3G4S S;  3BBB A;  3T1A A;  2WVB A;  2QT7 A;  2ZWP A;  2KVQ E;  4FDF A;  2FJA B;  2PDA A;  1URR A;  1BQX A;  1IBK J;  1H6K X;  4H4O B;  3FVY A;  5LOQ A;  4IR9 A;  4DR6 J;  3W65 A;  3CC2 S;  1VK3 A;  3M1V A;  4DL2 A;  2BE7 D;  5B0B A;  2J6U A;  4RW4 A;  2QLJ B;  2DIV A;  2YWK A;  3M30 A;  1F5A A;  1FFS B;  2XY6 A;  3H8Y A;  3QT7 A;  1VLO A;  3DU5 A;  1OSD A;  4LRF A;  4M5D B;  4NCB A;  1BY9 A;  5KFC A;  4YDX A;  4R5P B;  1HQ2 A;  3HUL A;  3JB9 k;  1IXK A;  5LMN J;  1N48 A;  3BQ0 A;  3QMQ A;  1NK6 A;  5KAK A;  2J0S D;  1FRH A;  2DHH A;  3D7S B;  3IAM 9;  1ZET A;  1RHK B;  4C8N A;  1BQM B;  4J9O A;  2IVF B;  3MEK A;  4J9M A;  4X64 F;  1CC7 A;  3CSK A;  4M94 A;  3JXO A;  3CD6 S;  3VGS A;  4TQR A;  3RZA A;  3GIR A;  4MT1 A;  3QJJ A;  3FBF A;  2KXF A;  1JLE A;  1UMJ A;  4DPO A;  1RT4 A;  1L3S A;  2NUH A;  2E1C A;  2XMK A;  4DU7 A;  2G0C A;  3MMA B;  1KR4 A;  2BQ3 A;  5J2Q B;  1RSC A;  2GVD A;  1HI0 P;  4DN0 A;  3UDL A;  2AYM A;  5HQM A;  3DLE A;  4PUO A;  3EPI A;  4X64 J;  3CJ8 A;  1GK8 A;  1TMJ A;  2YKO A;  1W26 A;  1CSJ A;  3AHP A;  3KUG A;  2B3T B;  4ATN A;  2CJB A;  3J81 U;  2W2N P;  5HRO A;  2RS2 A;  5C42 B;  4IFV A;  1RTD A;  3GFZ A;  4C9D A;  1Q82 T;  1LXJ A;  2AZ1 A;  3SYZ A;  3BDP A;  1RJJ A;  3A3O B;  2BX6 A;  2ZH3 A;  2NXC A;  4F26 A;  1HW8 A;  4A8Y A;  1IR0 A;  3OQ2 A;  2R2U A;  2E7W A;  4NE9 C;  1X4D A;  3WIV A;  3MMJ A;  1OPZ A;  3BR9 A;  3MUR P;  1H72 C;  1H73 A;  3X3U A;  3J7A N;  2IJF A;  4QIV A;  4EFA C;  4E8U A;  4WP9 A;  2ZH8 A;  2IYI A;  2KO1 A;  4LF6 J;  3C46 A;  4CNY A;  2YVS A;  2DGS A;  2VON A;  1ZAV A;  4JYA F;  1Q86 T;  2OHD A;  1RT7 B;  4RKU C;  3VCD A;  1WDT A;  1E6Y A;  4ERD A;  2W9A A;  5HP1 B;  2IIH A;  4QQB A;  1X0P A;  1OMS A;  4DV1 F;  1HAR A;  2HS4 A;  3DHX A;  4Y2M A;  4K2X A;  3D5M A;  3CCE S;  3G8Q A;  1JB0 C;  2YNF A;  4JYA J;  4F4X A;  1KD1 T;  3GYN A;  4O0I A;  4QIW D;  4ENO A;  1IUJ A;  1CJK A;  4KH1 B;  3FNN A;  3TAP A;  2B7B B;  1V9O A;  4BHQ A;  2DHA A;  4MFB A;  2XO7 A;  3JS9 A;  2KJW A;  5HMY A;  2BMB A;  1CS4 A;  5KOW A;  1VQK S;  4TKT A;  3OXL A;  3ZZZ A;  1HKA A;  5LSO A;  4TVA B;  2F63 A;  5HMZ A;  5B0G A;  3BPD A;  4NRT A;  3HFV A;  3ZZO A;  1QUV A;  5ETK A;  1YTY A;  3QT6 A;  1P1L A;  3O1L A;  2FJB B;  1ZA2 B;  3OR1 B;  2FZK B;  3ZNJ 1;  4NLP A;  5A8K B;  5IM0 B;  1BC6 A;  3OJU A;  4NZ7 A;  5F8G A;  4B3O A;  2GO8 A;  1JMT A;  3CJ0 A;  3QIP B;  4FS2 A;  1KVK A;  3JSB A;  3FQL A;  2CQG A;  1FK9 A;  4GMK A;  3SSS A;  3G8S A;  2EK6 A;  4P72 A;  3THV A;  2D3O 1;  4Y0F A;  4FXD A;  1EQ0 A;  1FX4 A;  2RNE A;  3D6T B;  3N5B A;  4XTT A;  3MPY A;  5M2P A;  1BGX T;  1TKX A;  1FE4 A;  1VOM A;  1YWX A;  3D4J A;  4GKJ F;  2AJF E;  1U49 A;  1TL1 B;  4BCA A;  1HI8 A;  3DDI A;  1CUL B;  2ZWO A;  4C8M A;  2FJD B;  4BC7 A;  2Y3Y A;  4LBI A;  2B9X A;  2ATC B;  4QYZ J;  1SQG A;  3M2V A;  1X9W A;  2L48 A;  4ECW A;  4JI2 F;  3I5B A;  3GPA A;  2YKN A;  1NJW A;  4GKJ J;  2BOP A;  1HBM A;  4DDF A;  1FWP A;  2ABY A;  2KVI A;  2KH9 A;  3OR2 B;  4NL5 A;  3I4H X;  4U95 A;  4ZVH A;  4FYX B;  1HMV B;  4P2F A;  3HF5 A;  4DCJ B;  2NPF A;  3HP6 A;  4A8F A;  5HJX A;  1EHW A;  1FEE A;  4P73 A;  1SIW B;  4UZC A;  3CCR S;  4JI2 J;  4MYT A;  5K8P A;  1T03 B;  3M9O B;  2F8M A;  2QE5 A;  1JLB B;  1FWL A;  1IWG A;  2Y1L B;  4J9L A;  2ZEJ A;  5CQG A;  3FFI A;  5DO2 A;  4WZQ A;  2XLI A;  4HAC A;  2Q6B A;  3CD5 A;  3Q8Q B;  5KFL A;  1BWV A;  7AT1 B;  2HGN A;  1EP4 B;  2BJD A;  2OPQ A;  2HEK A;  3CCW A;  4NRU A;  2E1P A;  3UW1 A;  2H3E B;  1N5Q A;  5FD1 A;  1HQU B;  5L1K A;  1VFJ A;  2FC9 A;  1T11 A;  2V34 A;  4LFA F;  4UUW A;  4CLP A;  4WFB Q;  4B9N A;  3BKF A;  3K17 A;  2L9D A;  4PG8 A;  3BSO A;  3M6V A;  4PPZ A;  3EGW B;  5KFV A;  5F8M A;  3QSY B;  2HPU A;  3HMJ G;  1WF0 A;  3MAH A;  1LW0 A;  2FLP A;  2ZC3 A;  4DZD A;  1WD6 A;  2R2S A;  1Y00 A;  1HNX F;  3OSN A;  1AA1 B;  4LFA J;  3L95 X;  4RUA A;  1JLQ B;  4LSL A;  3D0G E;  1FT8 A;  5LJ3 Y;  2G2O A;  4J37 A;  1C1B A;  3O44 A;  1K9M T;  5IOL A;  3W1Y C;  3T5H A;  1P8G A;  2FJE B;  3MR2 A;  1QE1 B;  4JI3 F;  5CH7 B;  5CXT A;  1VQ4 S;  1NXI A;  3FGV A;  3VR1 A;  1R8C A;  3IFE A;  3VGT A;  3IGN A;  2CPI A;  3ENW A;  2C3Y A;  1YZ6 A;  3OFE A;  3R8Y A;  4F3M A;  2LFV A;  3DOK A;  4LF2 A;  4C0H A;  4M95 A;  1K47 A;  3M1V B;  1LK7 A;  3FSY A;  1VJQ A;  1FNX H;  1QSS A;  4JI3 J;  2UU9 J;  3GG1 A;  1IVZ A;  2ADB A;  5KT7 A;  3M30 B;  4DV7 F;  2J6T A;  4ZN1 A;  3HD2 A;  3TA1 A;  2QYC A;  1N0U A;  3N79 A;  3QPI A;  1FF2 A;  4ZVE A;  2G2Y A;  4O23 A;  3AH6 A;  1N52 B;  3QJP A;  4NLY A;  3UCZ P;  2D9O A;  1NK8 A;  2M0G B;  2YNI A;  2DR9 A;  4OI4 A;  3P5T L;  3BGL A;  4YR2 A;  1R27 B;  5L1J A;  3ISN C;  3P4U B;  2J9D A;  3PX0 A;  2ROE A;  1FRI A;  2EG1 A;  4X4T A;  4Z7Y A;  2XLK A;  3RR8 A;  2ACM A;  4CQ1 A;  1JLE B;  2VPZ B;  5GAH I;  1RT4 B;  3IM8 A;  4USK A;  5KFN A;  3HLU A;  3D2W A;  3H98 A;  2XZT B;  2XC9 A;  3HO1 A;  2GVD B;  3DLE B;  4F8R A;  4PUO B;  1NKE A;  4USI A;  1D1U A;  5DG7 A;  3VQT A;  4K4S A;  1RBL A;  5K20 B;  4IFV B;  5ETV A;  4O44 A;  3K5O A;  3MM6 A;  2IMO A;  1RB0 A;  4LR7 A;  1M0S A;  3MTJ A;  4RW9 A;  1QVF R;  3OUY A;  5H9F K;  2CPJ A;  2RKI B;  5AXL A;  5GAG I;  2K7J A;  4DPT A;  4JI7 F;  4KTQ A;  5KFS A;  3C16 A;  2VPW B;  1JIH A;  1YK9 A;  1DRZ A;  2AIR B;  3KK1 A;  2Z4P A;  3HDS A;  5IV4 A;  1X8D A;  2V9K A;  4ZA1 A;  3LPE A;  5I4M A;  3U1L A;  1WC0 A;  2HQI A;  4JI7 J;  4B17 A;  2HK2 A;  2DIT A;  1MWY A;  5ETP A;  3ZZP A;  1GH8 A;  3IA0 A;  4X4V A;  1GFW B;  1T7P A;  3A8K A;  2C42 A;  5BYS A;  2EC0 A;  1E6Y B;  3RU0 A;  2J7K A;  2W24 A;  2DPJ A;  4P6Q A;  4DL3 A;  1VIS A;  1KWM A;  1Y11 A;  1FXD A;  3SFG A;  5A6P A;  4F3O A;  3GJR B;  2J5A A;  4CYU A;  1KS2 A;  4QBU A;  5GAD U;  2RS8 A;  2DGO A;  4WPA A;  2HHT A;  2YNF B;  3OVS A;  2MEW A;  5KFY A;  4LF1 A;  1RYR A;  4GC6 A;  2B8P A;  4RNH A;  1CJK B;  3MCM A;  1HQE A;  2HNY A;  2CKW A;  1V3S A;  2ZHB A;  2DNP A;  2MKJ A;  4PCQ A;  3D0I E;  4MFB B;  4KGZ B;  1CS4 B;  1FJC A;  3WDO A;  3PR5 B;  4ER8 A;  2ZOG A;  3A8I A;  3DLB A;  3CCQ S;  5D4O A;  1M5V C;  2VOO A;  4OZL A;  3TAQ A;  3VAG A;  4ELV A;  4JV2 A;  4QWD A;  9ATC B;  3UFC X;  4KT0 C;  4MIB A;  2CAJ A;  2ZH4 A;  1SJQ A;  1SL1 A;  3TP2 A;  1U8S A;  1N8R T;  2B9W A;  5A2Q U;  1Y9O A;  4NEZ A;  2NZ4 A;  3CNQ P;  3K5M A;  1N54 B;  2ZFH A;  1UVJ A;  1VCT A;  4J91 A;  5HO4 A;  4B3O B;  4MK9 A;  1H74 A;  2V69 A;  4OI0 A;  4KHR A;  4RBU A;  3AB4 B;  4OI6 A;  2E1M C;  1FK9 B;  3EZ5 A;  3T1Y F;  4UUX A;  1X9S A;  4USH A;  4KPY A;  2BAN A;  4NLS A;  4DJB A;  1X0F A;  4NZ6 A;  3W9J A;  1TKX B;  2GNK A;  2OEL A;  3TZZ A;  2XMM A;  1OO0 B;  1GXL A;  1SBR A;  2DH8 A;  4IH6 A;  4JBC A;  2N82 B;  1TUG B;  1U1Q A;  3DKD A;  4A8Q A;  1VQ8 S;  1R3N A;  3TR5 A;  1D0E A;  1HHT P;  1UJ4 A;  2KKH A;  2Q3P A;  4LF7 J;  1YVF A;  2F4V F;  5CAB A;  1LEO A;  2YKN B;  1HBN A;  1REV A;  3S7R A;  3OV7 A;  1X4E A;  1KHV A;  3QZ7 A;  1HBM B;  2MTL A;  3GWC A;  4ZN3 A;  2LYV A;  4NWB A;  4DUY F;  3TUI C;  2V0N A;  2JX2 A;  4QYR A;  1HPZ A;  1FER A;  5B09 A;  3LGM A;  2XSJ A;  1IWA A;  4DHV A;  2NYH A;  1LW2 B;  4ZLP A;  4AQY F;  1ROF A;  4IH7 A;  3RRH A;  5D15 A;  4BC9 A;  2EW9 A;  1UFK A;  4HL9 A;  5GAE U;  2F4F A;  2YWG A;  4F04 B;  2L08 A;  4CRJ A;  1LV5 A;  5A6W A;  3HVW A;  2B5J B;  5L46 A;  3FFI B;  2QYG A;  2UUB F;  1P6T A;  4CLT A;  3CT9 A;  4O0N A;  4HAC B;  3CXC R;  1SPB P;  1NZ8 A;  4FXV A;  3T1H F;  4OJ1 A;  3BYP A;  4I2Q A;  3H5S A;  1Z4U A;  4AQY J;  5DQG A;  2OPQ B;  2J9E A;  3MHY A;  3EDQ B;  2WRM A;  4DQP A;  4RNN A;  4A46 A;  4QWC A;  4C8L A;  2QX0 A;  2UUB J;  4I56 A;  5KFG A;  3FEZ A;  2WTF A;  4DSF A;  2ILY A;  3PW2 A;  2WB4 A;  1NH7 A;  4A8S A;  2CAD A;  2GMH A;  5K8O A;  2QRR A;  1S1X A;  2OJ3 A;  4O4G A;  2HRT A;  3MFH A;  3LAN A;  3C6U A;  2CNL B;  1LW0 B;  1YJ9 S;  1X60 A;  4WP3 A;  3U27 A;  3KYL A;  1Y10 A;  2E5H A;  4PR6 A;  2HQF A;  4NLU A;  4URG A;  5KG2 A;  2WAQ D;  2FVQ A;  2YH0 A;  4LSL B;  4WZM A;  4AD6 A;  3L7U A;  3C19 A;  2FYX A;  4DU8 A;  1HNW J;  2A1B A;  5G0R B;  2AHO B;  1C1B B;  3QBC A;  2W4P A;  3MD1 A;  1SKU B;  1R0C B;  2QGF B;  3I31 A;  1M1K T;  2NXU A;  1FCA A;  1YZ7 A;  1SC4 B;  1M1G A;  1YG0 A;  2LMI A;  2J7U A;  2KHC A;  3OFF A;  4QOT A;  3GV7 B;  1FKP A;  3OJS A;  3TJ9 A;  1S5Z A;  3NMR A;  3QAT A;  2QSW A;  3U02 A;  2G4B A;  3QJL A;  5K5M A;  2HS0 A;  1U0H A;  2J0X A;  2YWW A;  1W25 A;  3D67 A;  5HQL A;  3DOK B;  3LTO A;  2E9Z A;  4UST A;  3BRE A;  3PHE A;  2M5Y A;  3C3L A;  4N41 A;  3RTV A;  3PW7 A;  4DL4 A;  3GR0 A;  1JNR B;  1RK8 A;  4ECS A;  1VQ9 S;  3KG4 A;  3LP0 A;  2R8G A;  5DZ7 A;  2QSF A;  2IMW P;  1SQF A;  1XK8 A;  1B3T A;  2BE2 A;  4OI3 A;  4B3T F;  1VQ6 S;  4FZV A;  4A8X A;  2QMW A;  3OFH A;  5LSL A;  2KM8 C;  5HVG A;  3I56 S;  3VZH A;  2WBM A;  4L76 A;  2VQF J;  3V5R A;  1NK4 A;  2AMC B;  3PTW A;  1U6Z A;  1JLC A;  4R0J A;  5E3C A;  4OV1 A;  3ETO A;  2MQP A;  3AQO A;  1T02 A;  2P9E A;  2PFD A;  1RAE B;  3QAE A;  2VFT A;  2W25 A;  3IR5 B;  1ZTT A;  3GB0 A;  1UEU A;  1XC9 A;  2AYB A;  1WHV A;  3D3C J;  3KKF A;  2JEF A;  2RQC A;  2QG9 B;  4U7U K;  2F40 A;  2OMO A;  3HFK A;  2DGU A;  3DRS A;  1KRP A;  2OSQ A;  3W8G A;  4DR4 F;  1RP5 A;  5KFM A;  4UOC A;  3FCW A;  1RT1 A;  3PW4 A;  1JJ4 A;  1DZ5 A;  1L3T A;  4I6Y A;  1TK8 A;  3RYL A;  5AXM A;  3M8Y A;  4NLR A;  3PXG a;  4O44 B;  3MM6 B;  5E3R A;  3GJS B;  3CCV S;  4RW9 B;  1MN7 A;  1ITP A;  3OUY B;  5ETM A;  3ITH A;  4DR4 J;  2FIU A;  1NK7 A;  1LNQ A;  1H3D A;  3I5A A;  1WKL A;  4ETZ A;  4C98 A;  1RTH A;  5F8L A;  2JNJ A;  5DQI A;  2D3O R;  1IBC B;  2ZE2 B;  6AT1 B;  2RJZ A;  4EK2 A;  3KK1 B;  2W2M P;  3U1M A;  4ZPA A;  1OPI A;  1Q7L B;  4JV5 F;  1RAB B;  3QRP A;  4Y34 A;  2LKZ A;  5F0W A;  1J2V A;  1UJ5 A;  1XR5 A;  1T9T A;  4D3H A;  2B0G A;  1CPZ A;  3OD2 A;  2CQ4 A;  2IRU A;  1VBX A;  4U8Y A;  2KDO A;  2L41 A;  6FDR A;  4CLF A;  4NA2 A;  3KG1 A;  4F0K A;  2RDD A;  2DB1 A;  3TEH B;  2NZC A;  3H2L A;  3R27 A;  2UVU A;  3CIM A;  1LWC A;  1L3U A;  2EG2 A;  4JV5 J;  3DLJ A;  2VPX B;  2N7C A;  1U6F A;  5JVG Q;  3AOC A;  3W2V A;  1NKC A;  4DV3 F;  4CO1 A;  2JLG A;  2JSX A;  4K5S A;  2ZZN A;  4QU7 A; 
#chains in the Genus database with same CATH homology
 4LF9 J;  4NXM J;  5AJ3 J;  4B3M J;  4RJV A;  2MTL A;  5LMN J;  4DV7 J;  4NEY A;  3T1Y J;  1XNQ J;  4K0K J;  5A2Q U;  4OX9 J;  5FLX U;  4NEZ A;  3R2D J;  4DR4 J;  4NXN J;  1N36 J;  4X62 J;  3T1H J;  3J7A N;  2ZM6 J;  1N32 J;  1XMQ J;  4LF4 J;  1J5E J;  4DV3 J;  1IBL J;  2VQF J;  2E5L J;  3R2C J;  1HNX J;  3D3B J;  4JI3 J;  2UU9 J;  2UXC J;  5LMU J;  4LF6 J;  1IBM J;  2KL8 A;  4DV1 J;  4DR2 J;  4B3R J;  4GKJ J;  4LF5 J;  4DR7 J;  1XMO J;  2KVQ E;  1XNR J;  1HNW J;  5IWA J;  4KY3 A;  4GKK J;  2MEW A;  2UUA J;  4DUZ J;  4HHU A;  4DR1 J;  4DV4 J;  3J80 U;  1IBK J;  4KHP J;  1HNZ J;  4JI6 J;  4DR3 J;  4B3S J;  4JI4 J;  4X65 J;  2UXB J;  3D3C J;  2VQE J;  2F4V J;  1N33 J;  4DV0 J;  4DR6 J;  1HR0 J;  1I94 J;  4AQY J;  4X64 J;  2UXD J;  4KYZ A;  4V1A k;  4JI2 J;  4JI0 J;  4LFA J;  2UUC J;  3IMQ J;  4DV2 J;  5LM7 E;  3J81 U;  4DR5 J;  4YY3 J;  4DUY J;  3OTO J;  5BR8 J;  4B3T J;  2HHH J;  4JV5 J;  1N34 J;  4JI5 J;  4X66 J;  2UUB J;  4JI1 J;  4JI8 J;  4DV5 J;  4JYA J;  4LF8 J;  2MQ8 A;  3W1Y C;  5IT9 U;  4LF7 J;  4LFC J;  4JI7 J;  4DV6 J;  4PWW A;  1FJG J;  4LFB J;  4YHH J;  3JAM U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...