5AJ3L

Structure of the small subunit of the mammalian mitoribosome
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
ATLNQMHRLGPPKHPPGKMGPTAGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHSLQEHHVVLVQGGRTQDLPGVKLTVVRGKYDCGHVQKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL 12S RRNA
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5aj3L00
1VQNA 3GD7A 2H5XA 4YCWA 4DR3L 1PH2A 2UU9L 4IJHA 4X62L 2PI2A 4HJAA 5LMNQ 3U58A 2BA0A 2JJQA 1N9WA 2ZJPA 4DUZL 1VQ5A 4LUVA 5IYDH 2N78A 1G6PA 4RG1A 1A8VA 5C3EH 2K5VA 1WI5A 4X65Q 4IJLA 3DLLA 2ID0A 5H1SE 2ATWA 5JEAG 2PMZE 2GN5A 1SE8A 3OTOL 3CCRA 2R6GA 1DGSA 2VNUD 1HNWL 3NBHB 5C3EG 3E0EA 2RF4A 1HNZL 1A62A 3L7ZC 4DV6L 2MO0A 3CMEA 3GTJH 4HJ5A 1I6HH 2FXQA 3GTKH 1Q8KA 2OWOA 3HOYH 2F4VL 2B29A 4POGA 1MJCA 4R4TA 4GKJL 3CXCA 2LSSA 4PG3A 2ZJRA 1KAWA 2R7DA 2C35B 1L2FA 1VCIA 5IYBH 1HZBA 1N8RC 3RZOH 2QA4A 3RLFA 3PUXA 2KHJA 2E8GA 3CCLA 4LF9Q 1Q12A 1QUQA 4JI2Q 1N33Q 3BJUA 1JJCB 2Z6KA 3AFPA 3ULPA 4NXNQ 2R7ZH 1XMQQ 1IBMQ 4L5TA 1BKBA 5IYDG 1TWFH 4LFCL 4GN5A 2JA9A 2NZHA 3PUZA 3HOXG 3STBD 1PH3A 4LF5Q 2HHHL 4OX9Q 4P71A 1C9OA 1Y14B 1XNQL 5FLMH 4JI7L 4PZ8A 4QL5A 2HIXA 3HOZG 3OW2A 3RLOA 2YTVA 1YI2A 3VDYA 4OWWB 2AKWB 3STBC 1CKNA 1Q86C 1FJGQ 3CPWA 1NMFA 4KHPQ 4JI8Q 4EX5A 1CSPA 1YZ6A 2VQEL 1MJEA 1HNWQ 3H0GH 4AQYQ 4MZ9A 3K81C 3CC7A 4DV4L 2ZM6L 4B3SL 2AMCB 3ULJA 4DV2L 4BY1G 1I94Q 1J6QA 4LUZA 4XTCS 4GKJQ 3I2ZA 2E2JH 2KCTA 4C3IH 1VQ6A 3G48A 2UXBL 5C0XI 4DR5L 3E9HA 4PZ6A 2MQHA 5C4XH 2ES2A 4HJ9A 1X55A 3CC2A 1S40A 4JI0Q 5M5YH 1VS0A 2IY5B 1QZHA 3S24A 3AFQA 1IBLQ 5LMUQ 3FP9A 3D0FA 3M4PA 1HH2P 3CMAA 1UWVA 3KF8B 3F2CA 2I0QA 4JI2L 2JK8A 4NXNL 2JA6G 3S17H 1IBML 2ZTDA 1MIUA 1P8LA 2MFIA 1N32L 3KLWA 1HJPA 1Y1VG 5AJ3Q 4A3MG 2EXDA 1YHQA 1RL2A 1X6OA 4JBWA 4QIWE 4DR2Q 3HOZH 3OTOQ 2JA6H 2HHHQ 4R4IA 4IFDJ 3M9BA 2E2IH 1OXTA 4KI0A 1PYSB 1YEZA 4H02A 3I4NG 2JA8G 3GTOH 4XIGS 3H3VI 2CKZB 2PI2E 3PSIA 4LF4Q 3HOUH 1L1OC 3J7ZC 1K3RA 1T9HA 4QGUA 1VQOA 1YJWA 1VQMA 2VQEQ 3JAMc 2LXJA 3ICEA 1QUQB 4KLKA 4YWMA 2AHOB 4GN4B 4R4QA 1P16A 1VQJA 1VQDA 1PH9A 3L2PA 2K14A 2Z6KC 4LFBQ 4A3BG 1FGUA 2K4KA 1PFSA 4APVA 2QEXA 1XPRA 4A3CH 3MXNB 4A3IG 3KDFA 1K83H 3CAMA 4HJ8A 4A3CG 1WYDA 4JI1L 1VQPA 4IFDI 4TVAB 4A3BH 5FJ8H 4NB3A 1KL9A 1UE6A 1YHBA 2IT1A 2K5NA 4BBSG 1R9TH 1Y1VH 3UE1A 3J80c 1HR0L 2UUAL 1D8LA 1QZGA 3AEVA 4OONA 1EOVA 4JI7Q 4RMFA 1FVIA 3CW2C 3KYHC 4YHHL 1D7QA 4JYAQ 1OXUA 4DUYL 4DR1L 4KHPL 2OQ0A 2R92G 1K9MC 4AQYL 2N49A 1ASZA 2HIVA 5C0XJ 1N34L 1PYBA 2F3IA 4DNIA 1PH1A 3KFUA 1XNRQ 4R4OA 3B6YA 3F2BA 1I94L 1PV4A 1Y1WH 1UE1A 2JQOA 4C2MH 1I3QH 2CWAA 4DUZQ 3HOVH 3EN2A 4GLVB 1OXXK 3HKSA 4DR7L 1BBUA 4IFDG 2NVTH 4B3TQ 1ASYA 3CCVA 2B63H 1IBKL 1XPOA 4DR4L 4X64L 4Y52H 2VL6A 5C4JH 1EWIA 2KHIA 1XPUA 2N3SA 2PQAB 5IYCG 1NE3A 1X3GA 3GTGH 3S15H 1LTLA 2NN6I 4DK3C 1HNZQ 1NMGA 4GKKL 2I5HA 4DR2L 2DUDA 1E3PA 4L5RC 1UE5A 1EIFA 2JA8H 1TXYA 1XMOL 2WB1G 1NY4A 2OTJA 4OWXB 1BVSA 1EIYB 4NXML 1JE5A 3G71A 4A3FG 2R93G 1IZ6A 4LF8Q 2D62A 3M7NA 4BY7H 2K5HA 4LF9L 4BA2I 4Y7NH 4DV5Q 3I4MH 2D0OA 1Q7YC 3HOWG 5M3MG 1V1QA 2EQSA 3UE0A 4DV3L 2Z0SA 4P72A 1VQ7A 2Q2TA 2UUBQ 1NTGA 4GOPC 3T1YQ 4BY7G 4DV7Q 4LF7Q 2I5LX 4LFCQ 2Q2IA 3CCUA 3A0JA 1N36Q 4BXXH 2Y0SE 1VQGA 1JT8A 2NN6G 1XNQQ 1EQRA 2WFWA 3GO5A 4JOIC 4DAMA 2ZTCA 3U4ZA 2R7ZG 4JCVE 3PO3H 1EUJA 1CUKA 3F2DA 2UXDL 1C0AA 1PVOA 2WB1E 2OCEA 4DV0Q 1FJGL 2MO1A 4QY7A 1VQ9A 3F1ZA 5JJKA 1CKMA 3W5OA 1S3OA 1VQ8A 2ZM6Q 4DV2Q 1C7YA 4GKKQ 1Z47A 4A3FH 3S14H 3K0XA 3NENA 4MNOA 5M5WH 1KXLA 4ALPA 1J5EL 1SLJA 1JB7A 4NXMQ 4IPHA 4BBRH 3HOXH 5M3FG 3U4VA 2ALYB 3CQZH 2OTLA 1NBWA 4UY8C 1XNRL 4A93H 4X62Q 5GADC 3T1HL 5FLXc 3S16H 3HKZG 2VUMG 4DV5L 4DR7Q 3GDEA 2VY3A 1WFQA 4DV3Q 2AWOA 2CWPA 4B3TL 4B3MQ 2VUMH 1E22A 1N32Q 4X65L 3KOJA 2B63G 2ZJQA 5IWAQ 2GVBA 3I4OA 1FL0A 1VQHA 3AQQA 1PH4A 3M3YH 4JG2A 2BA1A 1KD1C 4FDBA 3S2HH 4NPSA 3CD6A 3GTLH 3RN5A 4GLXA 2UXDQ 1Q81C 4PMWA 4YWLA 1PH6A 3CCSA 2WAQE 3BZKA 3UDIA 3HOYG 3UDFA 3J81c 2K50A 1VQIA 3CCQA 1HZCA 3TEHB 4R4CA 4A75A 1U5KA 3CPFA 2JA5H 2R92H 3HKZE 4K0KQ 2B3GA 5EAYA 4A3JG 3EIVA 1OTCA 1GD7A 3PF4A 4LFBL 4BBRG 5M3FH 4IO9A 2HT1A 2E2HH 3PO3G 3CP0A 4LFAQ 4JI1Q 3MEFA 1YJNA 3A5UA 1X9NA 3ERSX 3A74A 2R7FA 3PGZA 4DPGA 5LMNL 2ASBA 1HR0Q 3RN2A 5HGQA 4KHZA 1LYLA 1OXSC 2OQKA 2RCNA 2WAQG 4B3ML 2IX0A 1X54A 4A3KH 3KF6B 1VQEA 2VQFQ 3HFZB 1W3SA 3PIPA 2PQAA 1TWAH 2HQLA 3TREA 5IWAL 1QVCA 2IHFA 4YY3L 2JA5G 5C44G 1K73C 1UE7A 5GROA 4DV4Q 4B3SQ 3M4OH 4JI6Q 3UDXA 2YTXA 2E5LL 4BXXG 5IE8A 1G51A 2N8NA 3A5ZB 3UDGA 4IPCA 4C3HH 3HOVG 3PUWA 3M85A 4AH6A 2JA7G 1K0RA 2JE6I 5IP7G 3HOWH 1KRTA 1O7IA 4DK6C 3K80C 3E9IA 4POFA 4X64Q 3GTMH 4DR6L 5HY6A 1GVPA 3ER0A 5JJIA 1XMQL 4L5SA 1X3FA 4PZ7A 1B7YB 4HJ7A 3S2DH 4YCUA 1HR0W 5DLQE 3J81j 4JC0A 4IPDA 5BR8Q 1JJ2A 4LF6L 2UUCL 3Q8DA 1XMOQ 5K36G 3RLNA 2PNHA 3M4QA 1U0LA 4MTNA 3J81i 5IYCH 3HOUG 4WJ3M 2VQFL 4LWCA 4HIOA 4HIMA 4LF4L 5C44H 2L15A 2JEAI 3G6EA 3PUVA 4X66Q 3LGJA 3H15A 2EIFA 3WWVA 4P73A 4HIDA 1E24A 4TQUS 4GOPB 2XTIA 5M3MH 1VQ4A 4JBKA 4YY3Q 5LMNW 4DV7L 4JI5L 1VQAA 1Q82C 1IXRA 4GOPA 1Y1WG 1N36L 3J7A5 5J3BA 4DAYB 3PO2H 1PH7A 3NEMA 4A3DH 1A63A 4A3IH 2UXBQ 5IP9G 4DR5Q 1S72A 1L1OA 4A4IA 1EYGA 2Q2UA 4JI0L 4LNQA 5E7NA 3BZCA 1M1KC 4GLAC 3FKIH 5LMUL 1X65A 5C0XG 2UUAQ 3CC4A 1Q46A 1PH8A 3S1MH 4JBJA 3TS2A 4O2DA 1G291 1YVCA 4IPGA 1KQSA 4UP9A 4A3MH 1PH5A 1VQBA 1YIJA 4JYAL 2KBNA 3I56A 4IOCA 1K8GA 4A3LG 3PF5A 2NZOA 4JI3Q 3H0GG 4JV5L 5M5XH 2GVAA 3S1QH 4R1JA 3AYHB 3W1BA 1SR3A 2MNAA 3D31A 3I55A 1J5EQ 2KENA 4DV6Q 4A3DG 1PA6A 1WOCA 1HZ9A 3CCEA 4JI6L 1SRUA 4A3LH 3KDFB 1H95A 4L5QA 2E5LQ 2BH8A 5IP7H 5C4XG 4QQBX 3T1HQ 4GNXC 1JMCA 3I7FA 2F52A 4A76A 1I50H 1L0WA 3KJPA 4A3JH 5GQOA 1IBKQ 1LUZA 4DR4Q 1VQKA 3S1NH 1B8AA 4OO1I 1GO3E 1JJGA 4LW1A 5ELNA 3F8TA 3SGIA 3PV0A 1SFOH 3CF5A 3GTPH 1CKOA 1WCMG 4A3GG 1XTDA 1YHAA 4J15A 5BR8L 4UPAA 4BBSH 4A3KG 5FJ8G 2UUCQ 4LF6Q 4O0AA 1OXVA 1XJVA 1KRSA 5FLMG 1WCMH 3OYYA 4UP8A 3L0OA 3KJOA 2RHSB 1SROA 3RR5A 5JEAJ 1Z9FA 5IT9c 2CCZA 1B70B 1BBWA 3FHWA 3S1RH 1Q1EA 1VQFA 1IYJB 2Y0SG 4DR6Q 3TS0A 1X56A 4LFAL 1TWHH 2ZTEA 1E1TA 3T1YL 1VQLA 2V1CC 2QGQA 4LF7L 4OO1G 3FKIG 5ELOA 4JI4L 3H3VH 1L1OB 3CCMA 4YCVA 1MKHA 5GAHC 4DR3Q 1K8AC 3PIOA 4WJ4A 2UU9Q 3TRZA 4B3RQ 1V9PA 1E7ZA 3PUYA 4LUOA 3TQYA 1E1OA 3PO2G 1CKNB 2DGYA 1IL2A 2LXKA 1SMXA 4DV0L 4C3JH 4P75A 1IBLL 4OXPA 2D0PA 2I5MX 2UXCQ 3RNUA 4P74A 2AWNA 1YITA 2CQOA 1GKHA 1VQCA 2Q2HA 2YTYA 3K8AA 4DKAC 5AJ3L 4DV1L 2R93H 3EBEA 2RHQB 1EFWA 2F4VQ 1I5FA 2VS1A 4JI3L 2YU9H 1W2BA 4JV5Q 3ULLA 4GNXA 3I4NH 5IP9H 1HNXL 2YV5A 3CCJA 4AIMA 1YBYA 2VW9A 4GNXB 2NVXH 4LF8L 1Q1BA 2A1AA 1KC8C 2BH2A 4BY1H 4JOIA 4IOAA 3NELA 3W1GA 1TWCH 4YWKA 1QVGA 3I4MG 1AH9A 1TWGH 1A0IA 1KHIA 2CFMA 3IRBA 1AE2A 2UUBL 1YJ9A 2YYZA 1CSQA 3K7AH 3RZDH 2A8VA 3PCOB 4AYBG 4JI4Q 3K7UC 4LF5L 4OX9L 4B3RL 1HZAA 1LM0A 4X6AH 1RIPA 2WP8J 2A19A 2K52A 4A3EH 4OWTB 3U50C 2XGTA 3BU2A 3JC66 4A3EG 3KF6A 4X66L 3DM3A 4QJFA 4A3GH 1M90C 1EQQA 1GM5A 4JI8L 1YNXA 1V43A 1WJJA 2IHEA 3G4SA 4JBMA 2KCMA 5GAGC 4ME3A 1NJIC 2NVQH 2UXCL 1PHJA 2JEBI 4GS3A 4JI5Q 2VZAA 3JAMi 4K0KL 1AE3A 4UP7A 4YHHQ 3ZJYC 3J80i 4DV1Q 4A93G 1SN8A 4DUYQ 4DR1Q 5JJLA 1X3EA 5GAEC 4EQ5A 5IYBG 1N33L 4AYBE 2JA7H 1QVFA 1KIXA 4BA1I 4GN3B 4HIKA 5IY0A 1N34Q 1HNXQ 2NVYH 2IX1A 1UEBA 2K75A 3GTQH
chains in the Genus database with same CATH superfamily
3GV3A 4YCWA 1PFMA 4TRDA 3U58A 1PH2A 3NUCA 2JJQA 1N9WA 5CV8A 1VQ5A 3NWTA 4RG1A 3DLLA 5JEAG 2PMZE 2GN5A 3I3CA 2F0PA 1SE4A 3CCRA 3NHHA 1STEA 2E74C 2Z6BA 4KKUA 2F4IA 1Y69U 1HNWL 3E0EA 1ZXTA 1OO9B 2A74C 5AFWA 4DV6L 1CHQD 1HFGA 2L5TA 3R3OA 4POGA 4GKJL 4PG3A 4O1NA 3R8BA 2ZJRA 4F88A 2R7DA 2C35B 2QA4A 4OO1H 2EDGA 2XRSD 4DK1A 3PUXA 2KHJA 1N33Q 1STGA 3BJUA 1JJCB 3ULPA 3SK5A 5IIFA 1F77A 2R7ZH 3J81L 1EIGA 1GUOA 2OEOA 1TWFH 4MHEA 4KHVA 4K6DA 1PH3A 3PUZA 1Q90A 3MXNA 3STBD 4P71A 2HIXA 1WTVA 3HOZG 4OWWB 1NMFA 4DK0A 1YZ6A 2K1BA 1QJOA 4AQYQ 4MZ9A 2CW0C 5FLXL 4DV4L 3H91A 3R2IA 2NB0A 2M00A 5I2XA 3G48A 1D1IA 2UXBL 5C0XI 5C4XH 2MQHA 4JI0Q 4K5XA 4HJ9A 1VS0A 2F0SA 2XRQD 2Q8IB 1IBLQ 5LMUQ 3M4PA 3F2CA 3A8IE 2G5DA 4JI2L 4F87A 4G7ZC 1V8QA 4KJOA 1X6OA 4JBWA 2F0TA 2Q8TA 3URYA 1ET9A 1OXTA 5COYA 1PYSB 4XIGS 1F9PA 4QGUA 2K5DA 1GUNA 4QMGA 3QIAA 4KLKA 1D5XC 2AHOB 4GN4B 4R4QA 1P16A 3EA6A 4IUPA 4RH6A 2K14A 4A3BG 5C44B 1A2TA 4APVA 4CJ0B 4HJ8A 3CAMA 3GTKB 3HOYB 3DEPA 4A3BH 4C2MB 5HGTA 2PNRC 4NB3A 1MHWC 4KN7C 1S5BD 5KEEA 2F3VA 1SMYC 1D8LA 4JI7Q 1FVIA 3MXUA 3CW2C 4C3JB 3AB9A 4DR1L 1WTXA 2R92G 1K0SA 5CV9A 1CI3M 2N49A 3NSWA 1ASZA 3NQTA 5C0XJ 3S1MB 3KFUA 1ILPA 2OT2A 2EOTA 4H7BA 1PV4A 3DUZA 3P20A 2CWAA 1ZYRC 2B2YC 1OXXK 5G3LF 1IBKL 4DR4L 4Y52H 3GTLB 3IKJA 2F0FA 1EWIA 1ZYRD 1XPUA 2N3SA 4HMIA 1F9RA 1EIHA 3K7AB 4OL7A 1EU3A 4DK3C 5T1IA 5EGTA 2RQXA 4DAVA 1UE5A 1EIFA 1XMOL 5EPLA 1PRTD 4OWXB 5NUCA 4CHTB 3G71A 3W2DA 2QKIC 1AW7A 2K5HA 4LF9L 3I4MH 5CYUA 1V1QA 4DV3L 3T1YQ 4OGQC 2O2LD 2Q2IA 3LWEA 3CCUA 4A3KB 1N36Q 1JT8A 1VQGA 1LO5D 2NN6G 3MA2B 1EQRA 2WFWA 4DAMA 1LACA 3GTOB 2R7ZG 3OOCA 1EUJA 1CUKA 3MTSA 3VYSA 4OIKA 2RSOA 1SDFA 2MO1A 5A35A 2EXZA 3NQIA 4DXGA 3K5LA 1VQ9A 2QEJC 5CGKA 1XTCD 3S14H 4CKCA 2DNEA 1SLJA 1A3TA 4BBRH 1XNRL 3U4VA 2ALYB 3MFYA 4WFN3 3S16H 5EKLA 1WFQA 1HUMA 2XIWA 4X65L 1B50A 1YNJC 3ITPA 2D9UA 2B63G 5FO9B 1C48A 3WDNA 2EY5A 1EFID 3M3YH 1I4RA 2BA1A 4FDBA 2A68D 4M8AA 3GTLH 5E3FA 5JAVA 4IUNA 4PMWA 4YWLA 2WAQE 4DF7A 3UDFA 3CCQA 1SNOA 1VQIA 1B3AA 4R4CA 1H9SA 4A75A 2ZXPA 1MD2D 3HGBA 4TSSA 3OSOA 5DAUA 4IO9A 5CV4A 1G2SA 5CV6A 1X9NA 3A74A 3SXHA 5C6AA 2FINB 2F3WA 2ASBA 3RN2A 2WAQG 4B3ML 1ZKOA 3K58A 5DM63 1VQEA 4XQNA 1W3SA 3Q22A 2ZT9C 5F2DA 1EOTA 4F8MA 3TREA 4RGMA 2MJ8A 4OEMB 1QVCA 2IHFA 3PQIA 1UE7A 4DV4Q 2EY2A 4BXXG 5IE8A 3A5ZB 4IPCA 4LK1C 4WJWA 3S15B 1BQQT 1SXTA 3HOWH 1J9OA 4X64Q 3EJIA 3QWNA 3GQBA 4FXKC 1F2ZA 2KEDA 4FF3A 4KKSA 4K2LA 4HJ7A 3SR1A 1HR0W 3J7AV 1EYCA 4DA2A 1K8MA 4I7AA 4MTNA 3NTHA 4WJ3M 2VQFL 3MAQA 4HIOA 1G6ZA 4X66Q 1Y8NB 5C4ZA 2F0JA 4GOPB 1EY5A 5ISRA 2NWGA 1Y1WG 3J7A5 5E1FA 3FPPA 4DAYB 3SEBA 2JA5B 1A6XA 3PO2H 1WTOA 1PH7A 4A3DH 2L55A 2L0CA 1JC7A 1BCPC 1O7ZA 2JA8B 1L1OA 4A4IA 1EYGA 2Q2UA 1S5CD 1YNND 1MGSA 3HOVB 1HCZA 3O13A 4A3FB 5K5PA 1LABA 5IOCA 1M8AA 1KQSA 1DXMA 4QUCA 4A3MH 1PTOH 1YIJA 2RDFA 1K8GA 3I56A 4JYAL 3S1QH 4R1JA 3S16B 3D31A 4A3DG 1O7LA 1HZ9A 2JP1A 5IP7H 4DXFA 4QQBX 3I7FA 1WVLA 2E75C 2QDBA 2LKVA 3BS1A 2SOBA 1IBKQ 1AZPA 4DR4Q 3S1NH 4OO1I 1GO3E 1NAPA 4LW1A 3F8TA 1LTAD 2EYJA 3TZUA 1CKOA 1WCMG 1XTDA 1YHAA 4QF4A 1VF7A 1EY7A 2SNMA 5FJ8G 2UUCQ 3IAYA 1KRSA 5I9OA 3OYYA 1GUWA 1SROA 1RTOA 5IT9c 5BN5A 5CORA 1B70B 3S1RH 4HCSA 3C1EA 3X3MA 1VQFA 4C3HG 3TS0A 4LFAL 1I4QA 2KOLA 2QGQA 4LF7L 3NXWA 4YCVA 1MKHA 5GAHC 1WD0A 1V9PA 1S4ZA 4IUUA 2R93B 1CK1A 3EQLC 4DV0L 3GTJB 4C3JH 1I6HB 3TSSA 3K59A 1RJTA 1I3QB 2CQOA 4DKAC 2Q2HA 2YTYA 2QCPX 4HSPA 5AJ3L 4DV1L 3EBEA 4CDDC 1EFWA 2F4VQ 1I5FA 2VS1A 2YU9H 2F0EA 4AIMA 1YBYA 2WACA 2NVXH 2IJ0A 2BH2A 1Q1BA 2A1AA 4BY1H 5FO8B 3JAME 3W1GA 3SK4A 3VR2A 3PMFA 1B1ZA 1A0IA 3IRBA 5HURA 3K7AH 1KABA 4HTHA 2I46A 3K7UC 3HS0C 4LF5L 4B3RL 4ZLTF 3HG9A 4Y7NB 3N6RA 2C5CA 5JJZA 5L37A 3V96A 3R93A 1CQVA 3KF6A 4X66L 4QJFA 1STBA 2PZUA 4JI8L 1WJJA 3G4SA 4I7ZC 2UXCL 2ZXOA 1PHJA 2JEBI 4GS3A 4AYBB 1AE3A 1UAPA 1CT1D 4UP7A 3J80i 4DUYQ 5JJLA 1JICA 4EQ5A 2ENBA 4AYBE 4RHSA 4BA1I 5IY0A 4BBSB 3H94A 1CA5A 2K75A 3PIP3 4A3EB 3S1RB 2CVRA 4X62L 4DUZL 2ZJPA 4X3TA 3AU7A 4LUVA 2N78A 4IUVA 4C1NI 1WI5A 4IJLA 4XXEA 1SE8A 3OTOL 4TKOB 1DGSA 4EQPA 5IGDA 1TY2A 2VNUD 1BXTA 4DGZA 1E2ZA 2RF4A 1KAAA 1HNZL 4IUQA 1PRTF 3NPPA 4NW2A 1Q8KA 2HUGA 1TY0A 4ZAIA 4FF1A 3TDQA 1L2FA 1VCIA 5IYBH 3RZOH 1N8RC 2F0VA 2G9HD 3RLFA 4LAAA 2Z4HA 4IURA 2PW7A 5I9PA 1XMQQ 4GN5A 1T5EA 2NZHA 2HDLA 1C9OA 4QL5A 4C1NK 2WKDA 3OW2A 3RLOA 2JXMB 1CKNA 3D4DA 3CPWA 2M2LA 4KY7A 1CSPA 4EX5A 3GV6A 1HNWQ 3CC7A 4B3SL 3SK6A 1HA6A 1QNKA 4BWGB 4ABNA 4BY1G 1JORA 2B2TC 2WIIB 3M4YA 1BCPD 4GKJQ 1DONA 2KCTA 1UEAB 3OIPA 4DR5L 3TP5A 3Q0AA 1KDCA 5M5YH 2B2WC 4NKLA 3TBIB 1QZHA 5M5WB 3FP9A 3VYUA 1HH2P 1UWVA 2L4NA 4NXNL 3S17H 4UHVA 1LT6D 5ELDA 1N32L 1HJPA 1AZQA 5AJ3Q 2EXDA 1RL2A 3OTOQ 4EGVA 1EEFD 3EFXD 4KI0A 4H02A 2PI2E 3PSIA 3EROA 1M4VA 1L1OC 3J7ZC 1YJWA 1VQOA 3HOZB 2QW7A 3C46A 2FMCA 1JOQA 1SYDA 4C3JG 1VQDA 4LFBQ 1XX8A 4FXGC 2HCIA 1FGUA 2K4KA 1PFSA 1XPRA 2QEXA 4A3IG 1ENAA 1K83H 4A3CG 4JI1L 1VQPA 4N9PA 2K5NA 4G7HC 2PW5A 1HR0L 1LTGD 3AEVA 3ONAB 4RHRA 4YHHL 2I07B 1D7QA 3RZDB 1OXUA 3NK9A 1EQTA 3HP3A 4A3IB 5IGGA 1EYDA 3B6YA 4FVMA 1UE1A 2JQOA 4C2MH 4DUZQ 2VB2X 3EN2A 3HKSA 1H9RA 1QWYA 2B63H 2K03A 4G57A 2BDNA 2KHIA 2PPBC 1DOLA 4NDXA 3BVMA 3FEWX 2NN6I 1HNZQ 4GKKL 4DR2L 2PO4A 4L5RC 1ENCA 2JA8H 1UUPA 5D14A 1F9QA 5FLXE 1EIYB 4U673 1VF5C 1IZ6A 2NUCA 2D62A 3VR3A 4CKBA 5IGFA 4DV5Q 1FR3A 2EQSA 4P72A 2UUBQ 4GOPC 2F1MA 4BY7G 4N8FA 5JPMC 3A0JA 4XT1B 4KY6A 4DU9A 2NVQB 2XWJB 2KCCA 1FNVA 1XNQQ 4Q0FA 3U4ZA 2KCNA 3H6MA 1D1KA 5CMDA 3J80E 4FXDA 3TZDA 3W5OA 1S3OA 3I4MB 1V1PA 2FMMA 4HAEA 2ZM6Q 1HFNA 4FYDA 1Z47A 3I4LA 5M5WH 4MNOA 2NZ1D 1KTKA 2DY8A 1WTQA 4G4KA 1EY8A 4NXMQ 3F2UA 3KBXA 5M3FG 2F0QA 2K28A 4X62Q 5GADC 3VYRA 2VUMG 4DFAA 2CH4W 3FMCA 2VUMH 1N32Q 1HA5A 3KOJA 2MUYA 5IWAQ 1FL0A 1VQHA 2C9OA 4JG2A 3TMEA 4XQQA 3CCSA 1RF2D 3UDIA 2R7ZB 1NSNS 2RKSA 5A2QL 2K50A 2L9HA 3CPFA 2R92H 3NP8A 4L6TB 1DCZA 1OTCA 3PF4A 2NTTA 4LFBL 5M3FH 1MSGA 2E2HH 3PO3G 4QCLA 2IPKD 4JI1Q 1YJNA 3A5UA 2HQEA 1GUSA 2SEBD 4FP5D 4DPGA 3HOUB 1HR0Q 1LYLA 3Q24A 3DEOA 3PIPA 1MI2A 4A3JB 4YY3L 3K5MA 5C44G 1K73C 5GROA 1I50B 2VB3X 4IN3A 2E5LL 3GTQB 2NTSA 3UDGA 1PRTC 4C3HH 1WTRA 3PUWA 1K0RA 5IP7G 1KRTA 1O7IA 4DK6C 3E9IA 5FKAC 1QNUA 1EZ6A 3OPOA 1B9NA 1STNA 1X3FA 4PZ7A 1KLUD 1B9MA 4YCUA 5CV7A 3K57A 4IPDA 4LF6L 2HCCA 2MP1A 3M4QA 3QR8A 2KQ3A 1B3QA 4LWCA 4HIMA 5C44H 2L15A 2JEAI 3FRPB 2BE5D 3PUVA 5I2YA 3LGJA 3WWVA 4HIDA 4TQUS 4JBKA 5LMNW 1VQAA 1Q82C 4XYOA 1ICFB 3D4RA 4KMUC 1NUCA 1A63A 2E2DC 3MWYW 3EVQA 5IP9G 2UXBQ 1QILA 4JI0L 1QB5D 5E7NA 4GLAC 2A6HD 5LMUL 1X65A 5C0XG 3TS2A 1PH8A 4JBJA 2AQ1B 3T56B 1G291 1YVCA 3S9WA 3OHXC 4IPGA 4DNRB 2M9VA 1PZID 4MTKA 4UP9A 4X3KA 1VQBA 3PF5A 2NZOA 4JV5L 3H0GG 2N55A 5C3WA 1SFOB 3GTPB 4KJNA 2MNAA 3I55A 2A68C 1J5EQ 1PA6A 1JCKB 4JI6L 4HN7A 1X3QA 1U4RA 2E5LQ 2VXWA 1CQFA 1G91A 1RCVD 4IUTA 4JVZA 1I50H 1CZGA 4GZYC 4ME5A 3P1HA 2HDMA 1B8AA 1PZJD 3D4WA 2KECA 1CM9A 5TSSA 3CF5A 4A3GG 5JPNC 4L8JA 5BR8L 2B2TA 4LF6Q 4O0AA 1GHJA 5FLMG 3H3VC 3P7JA 3L0OA 2X69A 2TSSA 4X3UA 5IGEA 3MFGA 3VR6A 5JEAJ 1SAPA 1D6EC 2CCZA 1AEXA 5J39A 1Q1EA 1IYJB 2Y0SG 4DR6Q 2E76C 1X56A 2EYFA 4QB4A 3FKIG 4JI4L 1ET6A 1RHPA 3OMGA 4WJ4A 4DR3Q 1K8AC 3PIOA 3TRZA 4B3RQ 4LUOA 1R4PB 2F03A 1TS5A 2B8GA 1VMPA 2DN8A 2DGYA 2E2JB 3IFTA 1LTBD 2A6EC 5IODA 2X6GA 4ZUJA 1YITA 2F0HA 1EY6A 3K8AA 4QUFA 2DJGC 5C3XA 4GNXA 4NP5A 2BCOA 2YV5A 3CCJA 1R9TB 1KC8C 2Z8LA 2BDOA 1LTID 4IOAA 1QOHA 4YWKA 1D5MC 1BNZA 1KHIA 3N52A 3PCOB 1EYAA 4AYBG 1DM0B 3VA5A 3DWQA 4OX9L 4CJ2C 3TP6A 1AN8A 1RIPA 4DAYA 5K36H 4A3EH 1PDQA 4A3EG 1M90C 1EQQA 1BR9A 1STAA 1GM5A 2IHEA 4JBMA 4ME3A 2BOSA 1NCVA 1SYBA 5CV5A 1H9KA 1W6JA 3ZJYC 4DV1Q 4A93G 1SN8A 1PTOD 5IYBG 3QG1A 1QE6A 3JAML 4KK7A 1KIXA 1QVFA 2F0LA 4GN3B 2IX1A 1EQVA 5HGQA 1VQNA 3GD7A 4DR3L 5LHY1 3U9OA 3T13A 4X65Q 2ID0A 3KBGA 5H1SE 2ATWA 1KNAA 2H4OA 4KD3A 3ZYYX 4A93B 2R6GA 3NBHB 3L7ZC 2MO0A 4HJ5A 2FXQA 1AFPA 3GTKH 2OWOA 3HOYH 2NVYB 2K01A 1SE3A 4IZ8A 1L0YB 2B2VC 2EYMA 3BDOA 2MHVA 3T53B 3CCLA 2E8GA 1JB3A 4LF9Q 1PRTB 1Q12A 1L0XB 2Z6KA 3AFPA 4NXNQ 3CHBD 1BKBA 4FO2A 2JA9A 4OX9Q 3HOXG 1BO0A 1TS4A 4M1UB 3SVMA 1Y14B 4EVOA 5FLMH 4JI7L 4RWSC 1I4GA 2YTVA 1YI2A 3BYTB 3VDYA 5KGUA 2AKWB 1XWEA 3STBC 4KHPQ 3GP7A 1MJEA 4J6HA 3PO3B 1V1OA 3H0GH 3K81C 2E2HB 2AMCB 4LUZA 4LMQD 1IYUA 3IL8A 3I2ZA 3ND9A 3V05A 4C3IH 2E2JH 4PZ6A 1HQMC 1X55A 3CC2A 1S40A 4K8JA 3AFQA 3BDCA 3KF8B 2I0QA 2JK8A 3SDZA 1DYQA 5CBAE 2WINB 1IBML 2MFIA 1Y1VG 4OHJA 4K8IA 1TU2B 1C8CA 5KNCA 3HOZH 4J8QA 2HHHQ 4R4IA 2E2IH 1YEZA 3I4NG 4XT3B 4NMZA 3D3RA 3GTOH 2CKZB 3HOUH 1K3RA 1T9HA 3M3YB 2VQEQ 3JAMc 2LXJA 4QIWB 1LTRD 1QUQB 5KNDA 4YWMA 2XN9C 2KA7A 1VMCA 1Z6HA 1PH9A 3L2PA 1Y1VB 5FK9C 3KDFA 1WYDA 3I8ZA 4R9WA 4TVAB 3DM1A 5FJ8H 1KL9A 1UE6A 1YHBA 4N9TA 3WOFA 1GXDC 4CGYB 3KLRA 1QZGA 1EOVA 2RCFA 3LWUA 5KYIA 3DXJC 3KYHC 1I4HA 5JVG3 2EJGC 4JYAQ 3GTGB 4KHPL 5KNBA 3D6WA 1NR2A 1CTMA 1K9MC 4AQYL 2H1EA 2HIVA 1PYBA 5KYLA 5T1GA 2EZVA 1XNRQ 4R4OA 4KTAA 2BE5C 4KV6A 1Y1WH 1I3QH 2WB1B 4LJZC 4GLVB 4DR7L 1BBUA 4IFDG 2NVTH 4B3TQ 5BN3A 1XPOA 4X64L 2VL6A 5FOBB 3H0GB 3S15H 2PQAB 3TP8A 1X3GA 1C4QA 1LTLA 5JOBA 2K5QA 5D3DA 4H13C 4BY7B 1IKLA 2I5HA 4K5WA 5EQ0A 1E3PA 4CKEA 1TXYA 4K14A 2WB1G 2OTJA 4B9WA 1BCPB 1BVSA 2FFKB 4NXML 1JE5A 5DM73 3M7NA 4BA2I 4Y7NH 5EBCA 3A7AB 5M3MG 2Q2TA 1JWUD 2Z0SA 3A55A 1TQOA 1NTGA 1HTLD 4LF7Q 2I5LX 2Y0SE 1R4QB 4P2CB 3PO3H 3BYYB 1C0AA 2UXDL 3KF8A 2WB1E 2OCEA 4DV0Q 5JEAH 1CZWA 1PTOF 2EJMA 4QY7A 1PFBA 2EYPA 4I65A 2HD3A 5EPJA 1H9MA 3F1ZA 2D2CC 2VUMB 1CKMA 5JJKA 2KVMA 1ILQA 3FKIB 4GKKQ 4A3FH 3L3OC 1JB7A 2RDGA 4IPHA 3HOXH 1D5ZC 1NBWA 1SNPA 4XYQA 3T1HL 3HKZG 1CHPD 4DV5L 4DR7Q 3J81E 2PQEA 2AWOA 2CWPA 4B3TL 4CBVA 4ZKCB 2A69C 3AQQA 1PH4A 3J80L 3SHLA 1LT3D 1XXGA 2K05A 4NPSA 3RN5A 1Q81C 4YIJA 1PH6A 3HOYG 2OF1A 1HZCA 2JA5H 1U5KA 3TN2A 1JQYD 4WORA 3G7LA 3HKZE 4K0KQ 4DAPA 1O7YA 5EAYA 1KXLA 4A3JG 1GD7A 4BBRG 1K28A 3CP0A 1YNNC 1FNUA 2LMCB 4LFAQ 2IWHA 3NBHA 1Y8OB 2KHSA 1PXUA 5LMNL 4KHZA 5M3FB 2OQKA 3HEJA 2J4XA 2IX0A 1X54A 4A3KH 4ID6A 3M7GA 1S5DD 2PQAA 3BVGA 3MEHA 3V2TA 4DN4M 1TWAH 2HQLA 1UNSA 4C3HB 5IWAL 5IGBA 5M5YB 1KDBA 2EPBA 3UDXA 2D5DA 1GUTA 1A15A 2B2VA 1SEBD 2N8NA 2WKCA 2PYKA 3K0YA 3M85A 4AH6A 2ICEC 4CJ1B 4POFA 3GTMH 2RSNA 4F7XA 1EY9A 1B4OA 2F0NA 1XMQL 1ML0D 5G3LD 1B7YB 4BY1B 1TWCB 3VR5A 2UUCL 3Q8DA 1XMOQ 5K36G 3RLNA 2IX3A 4N8X1 3R2TA 3HOUG 3S2DB 4RKLA 1IL8A 1HRJA 3G6EA 3A8KE 3H15A 1DJRD 1K83B 4P73A 2F0DA 4YY3Q 4JI5L 4GOPA 1N36L 5J3BA 2F0OA 1H9JA 1STHA 1S5FD 3NEMA 3OWFA 4A3IH 4DR5Q 1LT4D 2EY1A 3CKIB 4LNQA 1M1KC 4ILWA 3OMCA 3FKIH 2FHTA 5M5XB 3S14B 2EYHA 1Q46A 3HRZC 1PYWD 1PH5A 4PMBA 2KBNA 2NVXB 4IOCA 2QILA 4JI3Q 4A3LG 3QOJA 2GVAA 4RKBA 2B63B 3CU7A 3L9AX 2KENA 3IFDA 4RCOA 4A3LH 1SRUA 3KDFB 2PCFB 2BH8A 5JVH3 2EYLA 4ZYSA 3T1HQ 5EPKA 4GNXC 1JMCA 1TVXA 2F52A 1HQRD 4RA8A 2X6LA 1L0WA 5IT9L 3KJPA 1LUZA 1RDPD 1VQKA 2L1BA 3MZ5A 1RD9D 1JJGA 1SNMA 5C5LA 3HOWB 5ELNA 3SGIA 3PV0A 1SFOH 3GTPH 2RBMA 1RTNA 4UPAA 4BBSH 1B53A 1OXVA 1XJVA 3C1FA 5CC4A 3Q23A 1WCMH 2CH4A 2F0MA 4CDCC 1LLRD 1Q3LA 2DY7A 4PV1C 3RR5A 1Z9FA 1SNDA 1BBWA 3FHWA 1O78A 2F0IA 2ZTEA 3T1YL 2O5JC 2V1CC 5C3EB 1SYEA 4OO1G 3H3VH 3CCMA 5IT9E 2UU9Q 3UI2A 1E7ZA 3I73A 3PUYA 4KN4C 3TQYA 1DD2A 3ERQA 1IW7D 3NWSA 5E4WC 3DWPA 1IYVA 1IL2A 3RZOB 1SMXA 4ZRZA 2XWBB 4P75A 2AQ3B 2CHBD 4OXPA 2D0PA 2I5MX 4ZKBB 1FGBD 4P74A 2AWNA 2CW0D 3CQZB 5C0XH 1BBXC 1BF4A 1B2TA 4JI3L 5EKIA 1W2BA 2TMPA 2K04A 2IW3A 3S2HB 5IP9H 1HNXL 1LT5D 2VW9A 1JE4A 4DNTB 4LF8L 2RDHA 2J7ZA 3NELA 1TWCH 2F0GA 2B2UA 5D65A 4HMJA 3I4MG 2MPMA 2CFMA 1QG7A 2UUBL 2YYZA 1CSQA 4B9XA 2CQAA 4JI4Q 4EQOA 1LTTD 1PLFA 2Q8RE 2IL8A 2PZWA 3DWAA 1II3A 1LM0A 4OIJA 1KLGD 2WP8J 1T5XD 2GA4B 1TR5A 2K7VA 2P5ZX 3U50C 3BU2A 4A3GH 4S3SA 3DM3A 3SK8A 5C4HA 2NBFA 1YNXA 1V43A 2KCMA 5EKKA 5GAGC 1F2YA 1ESRA 4JI5Q 1JWSD 3JAMi 4K0KL 4YHHQ 2PMZB 1QCBD 1X3EA 5GAEC 1N33L 1U4PA 1WTWA 2B2UC 4JK1C 1N34Q 2NVYH 3P75A 2RVLA 1UEBA 3GTQH 4RFBA 2H5XA 2UU9L 2B2YA 4IJHA 2PI2A 4HJAA 5LMNQ 5IYDH 2BA0A 1H95A 4C56C 1G6PA 1A8VA 3MXGA 5C3EH 3M4OB 2JA7B 2K5VA 4CDEC 2J0TD 2ZXRA 2R61A 1U4MA 5I6YA 1F2LA 5I4DA 5C3EG 1TS3A 4ODGA 1A62A 2F0WA 1SNCA 3CMEA 2ICIA 3GTJH 1I6HH 1EZ8A 3LNNA 2F4VL 2B29A 1MJCA 4R4TA 3RMHA 4EQNA 3CXCA 3HOXB 2LSSA 4XDXA 1KAWA 2WAQB 1HZBA 2EE1A 3DHQA 1IKMA 2QF7A 1SJED 3A8JE 1QUQA 4JI2Q 5ELBA 2EY6A 1IBMQ 4L5TA 1WD1A 2N88A 5IYDG 4LFCL 2YU9B 4C3IB 4LF5Q 5D3IB 2HHHL 3X3NA 1VDZA 2Z1CA 1NR4A 1D2BA 1XNQL 4PZ8A 3HZXA 1YNJD 2A69D 3BG3A 1Q86C 1FJGQ 1O80A 1SYCA 4JI8Q 5C4JB 2VQEL 3A54A 1F9SA 1G2TA 3K5OA 5CR3A 2ZM6L 3ULJA 4DV2L 4G7OC 3TP7A 1J6QA 4XTCS 3D6CA 1I94Q 4JPBW 1VQ6A 3C2PA 4FF4A 3E9HA 2ES2A 5KIXA 2IY5B 1G8ZD 3S24A 1ESFA 5CBEE 2A5HA 3D0FA 2E2IB 3CMAA 2JA6G 2ZTDA 1MIUA 1P8LA 3KLWA 3E6ZX 1ICWA 1MSHA 3OIQA 4A3MG 1YHQA 1K8OA 4DR2Q 4QIWE 4H0LC 3J7YW 3GTMB 2JA6H 1GHKA 1BUVT 3M9BA 4XQJA 4PNYA 4IFDJ 1TT2A 1SMYD 3PIO3 2JA8G 3H3VI 4LF4Q 1XYIA 1W6KA 1VQMA 3E5SA 2LS01 2B39A 3ICEA 2Z4IA 1JWMD 1AP0A 1TWAB 1VQJA 4OELB 5DNFA 2Z6KC 3I72A 4A3CH 5ELEA 3MXNB 5J22A 2B2WA 4KD4A 4IFDI 1KDAA 3A7LA 4PMCA 4BBSG 2IT1A 1H9SB 2EVBA 1R9TH 1BCPF 1Y1VH 3UE1A 3J80c 2UUAL 4OONA 4RMFA 1U9RA 4IALA 1I4XA 3I91A 2EJFC 3FDTA 2B8FA 2KJXA 4DUYL 4A3BB 2O5IC 2OQ0A 3NBIA 1TIID 1N34L 2F3IA 4C3IG 4DNIA 1PH1A 1GJXA 3F2BA 1I94L 4UDUC 3I4NB 4ZUIA 3HOVH 1ASYA 3CCVA 3U9SA 1SE2A 5C4JH 3ND8A 1SJHD 5KRUA 5IYCG 3BVZA 2L11A 1NE3A 3E3XA 3GTGH 3K5NA 3FVQA 4HCEA 1NMGA 1EL0A 2DUDA 1GUGA 1PTOC 1X32A 1NY4A 3A56A 4U68A 3RUZA 5ELFA 1Z7TA 4A3FG 1PMRA 2R93G 1I6VC 4LF8Q 4WRDA 4BY7H 4BS9A 5DEHA 3S17B 2D0OA 1Q7YC 3HOWG 3UE0A 1VQ7A 4DR6L 4A3MB 1A2UA 4RGOS 4DV7Q 4LFCQ 4BXXH 3BDLA 3E0JA 3GO5A 4JOIC 2ZTCA 4JCVE 1K3BC 1CA6A 4K2KA 3F2DA 1Q8IA 4K6LA 1PVOA 1FJGL 3HKZB 1VQ8A 2AQ2B 2AUKA 3T16A 4DV2Q 1C7YA 1V1PB 2DNCA 1HXYD 3K0XA 3NENA 1FNWA 2XNAC 3T51B 3AMUA 4ALPA 1J5EL 3QB3A 1STYA 3G6JB 3CRLC 4UY8C 2OTLA 4A93H 3CQZH 2K33A 5FLXc 5LL6S 2KUMA 2VY3A 3GDEA 3MXPA 4DV3Q 2LFNA 4B3MQ 1E22A 2PZTA 5EBDA 3DMUA 1HHVA 2ZJQA 2DJFC 2GVBA 3I4OA 2NYZD 2G9DA 1LV9A 1IW7C 1KD1C 3S2HH 4ZCKA 3CD6A 4GLXA 2UXDQ 4L63B 1U4LA 3BZKA 5IGCA 5E4XA 3J81c 2XVSA 3TEHB 3NE5B 1S5ED 2SDFA 3LX0A 2B3GA 3EIVA 1JOKA 4RGNA 2HT1A 3W3AA 4A3GB 2RA4A 5J1ZA 2NN6H 3MEFA 4JW0A 1DOKA 1RKNA 3BZDB 3ERSX 4FF2A 1FD7D 1J8IA 1ONLA 2R7FA 3PGZA 1DOMA 2JN4A 3I70A 1TWHB 1OXSC 3VYTA 2RCNA 4HR7B 3KF6B 3RD4A 2VQFQ 3HFZB 1EU4A 2Y0SB 1RODA 1EWCA 4KY5A 1WTPA 2JA5G 4ULLA 4B3SQ 3M4OH 4JI6Q 4X3SA 2YTXA 1G51A 2V4DA 4B08A 3KLSX 3HOVG 1A3VA 3VA7A 2JA7G 2JE6I 1SYGA 2K5WA 4HSVA 3K80C 5HY6A 3OWEB 1ENFA 1GVPA 3ER0A 1TKWB 5JJIA 4L5SA 3S2DH 1BDOA 1MBYA 5DLQE 3J81j 4JC0A 2JYOA 1E2VA 1CFMA 5BR8Q 1JJ2A 2L12A 4A3DB 1EY4A 4PQXA 1JR0D 2O4XA 2PNHA 2F0UA 1U0LA 4V0BA 3J81i 5IYCH 5C5MA 4UAIA 3QOLA 2K32A 4LF4L 1EWHA 3PO2B 4FNFA 2EIFA 1SSOA 1E24A 1E0BA 2XTIA 5M3MH 1VQ4A 3H09A 1BOSA 4DV7L 1IXRA 3QO2A 5M9OA 4ZQ3A 1HTPA 2R92B 1SYFA 4R8IA 1S72A 2OXPA 1PTOB 3BZCA 4KKTA 4MN3A 1A3UA 2F0KA 4HEDA 2UUAQ 3CC4A 4O42A 2NVTB 3S1MH 4O2DA 1TWGB 1F2MA 1Y1WB 5M5XH 5A2QE 3AYHB 3W1BA 1SR3A 4DV6Q 1WOCA 2FJ2A 5BN4A 3CCEA 1I4PA 4R8NA 4L5QA 1PZKD 5C4XG 3K6OA 3KK7A 4A76A 2JA6B 1FYCA 2K6AA 4A3JH 5GQOA 4H44C 4E6IA 2Z9HA 1TS2A 1KNEA 1DZ1A 2A73B 5I6WA 4IFDH 2XSCA 1EY0A 3S1QB 4J15A 2SNSA 2AUJD 4A3KG 4Z9CB 2EYOA 4K5VA 3J7AF 2KEEA 4UP8A 4J1MA 3KLSA 3KJOA 2RHSB 2WV6D 1WTHA 3S1NB 1JOOA 1GOZA 1WCMB 3NTIA 4RCNA 1TWHH 1E1TA 1VQLA 3Q6SA 5ELOA 1L1OB 3VR4A 3I90A 1LTSD 1PFNA 2A6ED 1E1OA 4RAUC 3PO2G 1CKNB 1SBBB 1ZEQX 2LXKA 1IBLL 5M3MB 2A6HC 2UXCQ 4BBRB 3RNUA 1GKHA 1VQCA 2QDLA 2R93H 1IHZA 2RHQB 3MHBA 1X3PA 4JV5Q 3T4AC 1SNQA 3ULLA 3I4NH 5LL6X 2LY7A 4GNXB 5ELCA 4JOIA 3QJYA 1Y8PB 1B44D 1TWFB 1QVGA 1AH9A 1TWGH 2MGSA 4IQZA 1AE2A 1YJ9A 3RZDH 2A8VA 3MVVA 3KUPA 1HPCA 3WOEA 4ZK9B 3OW7A 1HZAA 4X6AH 3CRKC 3C3LA 2A19A 2K52A 5C4XB 1NNXA 4OWTB 4V190 2XGTA 3JC66 4Q5VA 5EJWA 2R3ZA 3SE0A 4MIUA 2NVQH 3FPUB 3D8GA 4RGTA 5FO7B 1NJIC 2VZAA 1EEID 3NTKA 1HUNA 4DR1Q 1E2WA 2JSOA 2JA7H 3MC0B 4HIKA 1HNXQ 4CDFC
chains in the Genus database with same CATH topology
1VQNA 3GD7A 2H5XA 4YCWA 4DR3L 1PH2A 2UU9L 4IJHA 4X62L 2PI2A 4HJAA 5LMNQ 3U58A 2BA0A 2JJQA 1N9WA 2ZJPA 4DUZL 1VQ5A 4LUVA 5IYDH 2N78A 1G6PA 4RG1A 1A8VA 5C3EH 2K5VA 1WI5A 4X65Q 4IJLA 3DLLA 2ID0A 5H1SE 2ATWA 5JEAG 2PMZE 2GN5A 1SE8A 3OTOL 3CCRA 2R6GA 1DGSA 2VNUD 1HNWL 3NBHB 5C3EG 3E0EA 2RF4A 1HNZL 1A62A 3L7ZC 4DV6L 2MO0A 3CMEA 3GTJH 4HJ5A 1I6HH 2FXQA 3GTKH 1Q8KA 2OWOA 3HOYH 2F4VL 2B29A 4POGA 1MJCA 4R4TA 4GKJL 3CXCA 2LSSA 4PG3A 2ZJRA 1KAWA 2R7DA 2C35B 1L2FA 1VCIA 5IYBH 1HZBA 1N8RC 3RZOH 2QA4A 3RLFA 3PUXA 2KHJA 2E8GA 3CCLA 4LF9Q 1Q12A 1QUQA 4JI2Q 1N33Q 3BJUA 1JJCB 2Z6KA 3AFPA 3ULPA 4NXNQ 2R7ZH 1XMQQ 1IBMQ 4L5TA 1BKBA 5IYDG 1TWFH 4LFCL 4GN5A 2JA9A 2NZHA 3PUZA 3HOXG 3STBD 1PH3A 4LF5Q 2HHHL 4OX9Q 4P71A 1C9OA 1Y14B 1XNQL 5FLMH 4JI7L 4PZ8A 4QL5A 2HIXA 3HOZG 3OW2A 3RLOA 2YTVA 1YI2A 3VDYA 4OWWB 2AKWB 3STBC 1CKNA 1Q86C 1FJGQ 3CPWA 1NMFA 4KHPQ 4JI8Q 4EX5A 1CSPA 1YZ6A 2VQEL 1MJEA 1HNWQ 3H0GH 4AQYQ 4MZ9A 3K81C 3CC7A 4DV4L 2ZM6L 4B3SL 2AMCB 3ULJA 4DV2L 4BY1G 1I94Q 1J6QA 4LUZA 4XTCS 4GKJQ 3I2ZA 2E2JH 2KCTA 4C3IH 1VQ6A 3G48A 2UXBL 5C0XI 4DR5L 3E9HA 4PZ6A 2MQHA 5C4XH 2ES2A 4HJ9A 1X55A 3CC2A 1S40A 4JI0Q 5M5YH 1VS0A 2IY5B 1QZHA 3S24A 3AFQA 1IBLQ 5LMUQ 3FP9A 3D0FA 3M4PA 1HH2P 3CMAA 1UWVA 3KF8B 3F2CA 2I0QA 4JI2L 2JK8A 4NXNL 2JA6G 3S17H 1IBML 2ZTDA 1MIUA 1P8LA 2MFIA 1N32L 3KLWA 1HJPA 1Y1VG 5AJ3Q 4A3MG 2EXDA 1YHQA 1RL2A 1X6OA 4JBWA 4QIWE 4DR2Q 3HOZH 3OTOQ 2JA6H 2HHHQ 4R4IA 4IFDJ 3M9BA 2E2IH 1OXTA 4KI0A 1PYSB 1YEZA 4H02A 3I4NG 2JA8G 3GTOH 4XIGS 3H3VI 2CKZB 2PI2E 3PSIA 4LF4Q 3HOUH 1L1OC 3J7ZC 1K3RA 1T9HA 4QGUA 1VQOA 1YJWA 1VQMA 2VQEQ 3JAMc 2LXJA 3ICEA 1QUQB 4KLKA 4YWMA 2AHOB 4GN4B 4R4QA 1P16A 1VQJA 1VQDA 1PH9A 3L2PA 2K14A 2Z6KC 4LFBQ 4A3BG 1FGUA 2K4KA 1PFSA 4APVA 2QEXA 1XPRA 4A3CH 3MXNB 4A3IG 3KDFA 1K83H 3CAMA 4HJ8A 4A3CG 1WYDA 4JI1L 1VQPA 4IFDI 4TVAB 4A3BH 5FJ8H 4NB3A 1KL9A 1UE6A 1YHBA 2IT1A 2K5NA 4BBSG 1R9TH 1Y1VH 3UE1A 3J80c 1HR0L 2UUAL 1D8LA 1QZGA 3AEVA 4OONA 1EOVA 4JI7Q 4RMFA 1FVIA 3CW2C 3KYHC 4YHHL 1D7QA 4JYAQ 1OXUA 4DUYL 4DR1L 4KHPL 2OQ0A 2R92G 1K9MC 4AQYL 2N49A 1ASZA 2HIVA 5C0XJ 1N34L 1PYBA 2F3IA 4DNIA 1PH1A 3KFUA 1XNRQ 4R4OA 3B6YA 3F2BA 1I94L 1PV4A 1Y1WH 1UE1A 2JQOA 4C2MH 1I3QH 2CWAA 4DUZQ 3HOVH 3EN2A 4GLVB 1OXXK 3HKSA 4DR7L 1BBUA 4IFDG 2NVTH 4B3TQ 1ASYA 3CCVA 2B63H 1IBKL 1XPOA 4DR4L 4X64L 4Y52H 2VL6A 5C4JH 1EWIA 2KHIA 1XPUA 2N3SA 2PQAB 5IYCG 1NE3A 1X3GA 3GTGH 3S15H 1LTLA 2NN6I 4DK3C 1HNZQ 1NMGA 4GKKL 2I5HA 4DR2L 2DUDA 1E3PA 4L5RC 1UE5A 1EIFA 2JA8H 1TXYA 1XMOL 2WB1G 1NY4A 2OTJA 4OWXB 1BVSA 1EIYB 4NXML 1JE5A 3G71A 4A3FG 2R93G 1IZ6A 4LF8Q 2D62A 3M7NA 4BY7H 2K5HA 4LF9L 4BA2I 4Y7NH 4DV5Q 3I4MH 2D0OA 1Q7YC 3HOWG 5M3MG 1V1QA 2EQSA 3UE0A 4DV3L 2Z0SA 4P72A 1VQ7A 2Q2TA 2UUBQ 1NTGA 4GOPC 3T1YQ 4BY7G 4DV7Q 4LF7Q 2I5LX 4LFCQ 2Q2IA 3CCUA 3A0JA 1N36Q 4BXXH 2Y0SE 1VQGA 1JT8A 2NN6G 1XNQQ 1EQRA 2WFWA 3GO5A 4JOIC 4DAMA 2ZTCA 3U4ZA 2R7ZG 4JCVE 3PO3H 1EUJA 1CUKA 3F2DA 2UXDL 1C0AA 1PVOA 2WB1E 2OCEA 4DV0Q 1FJGL 2MO1A 4QY7A 1VQ9A 3F1ZA 5JJKA 1CKMA 3W5OA 1S3OA 1VQ8A 2ZM6Q 4DV2Q 1C7YA 4GKKQ 1Z47A 4A3FH 3S14H 3K0XA 3NENA 4MNOA 5M5WH 1KXLA 4ALPA 1J5EL 1SLJA 1JB7A 4NXMQ 4IPHA 4BBRH 3HOXH 5M3FG 3U4VA 2ALYB 3CQZH 2OTLA 1NBWA 4UY8C 1XNRL 4A93H 4X62Q 5GADC 3T1HL 5FLXc 3S16H 3HKZG 2VUMG 4DV5L 4DR7Q 3GDEA 2VY3A 1WFQA 4DV3Q 2AWOA 2CWPA 4B3TL 4B3MQ 2VUMH 1E22A 1N32Q 4X65L 3KOJA 2B63G 2ZJQA 5IWAQ 2GVBA 3I4OA 1FL0A 1VQHA 3AQQA 1PH4A 3M3YH 4JG2A 2BA1A 1KD1C 4FDBA 3S2HH 4NPSA 3CD6A 3GTLH 3RN5A 4GLXA 2UXDQ 1Q81C 4PMWA 4YWLA 1PH6A 3CCSA 2WAQE 3BZKA 3UDIA 3HOYG 3UDFA 3J81c 2K50A 1VQIA 3CCQA 1HZCA 3TEHB 4R4CA 4A75A 1U5KA 3CPFA 2JA5H 2R92H 3HKZE 4K0KQ 2B3GA 5EAYA 4A3JG 3EIVA 1OTCA 1GD7A 3PF4A 4LFBL 4BBRG 5M3FH 4IO9A 2HT1A 2E2HH 3PO3G 3CP0A 4LFAQ 4JI1Q 3MEFA 1YJNA 3A5UA 1X9NA 3ERSX 3A74A 2R7FA 3PGZA 4DPGA 5LMNL 2ASBA 1HR0Q 3RN2A 5HGQA 4KHZA 1LYLA 1OXSC 2OQKA 2RCNA 2WAQG 4B3ML 2IX0A 1X54A 4A3KH 3KF6B 1VQEA 2VQFQ 3HFZB 1W3SA 3PIPA 2PQAA 1TWAH 2HQLA 3TREA 5IWAL 1QVCA 2IHFA 4YY3L 2JA5G 5C44G 1K73C 1UE7A 5GROA 4DV4Q 4B3SQ 3M4OH 4JI6Q 3UDXA 2YTXA 2E5LL 4BXXG 5IE8A 1G51A 2N8NA 3A5ZB 3UDGA 4IPCA 4C3HH 3HOVG 3PUWA 3M85A 4AH6A 2JA7G 1K0RA 2JE6I 5IP7G 3HOWH 1KRTA 1O7IA 4DK6C 3K80C 3E9IA 4POFA 4X64Q 3GTMH 4DR6L 5HY6A 1GVPA 3ER0A 5JJIA 1XMQL 4L5SA 1X3FA 4PZ7A 1B7YB 4HJ7A 3S2DH 4YCUA 1HR0W 5DLQE 3J81j 4JC0A 4IPDA 5BR8Q 1JJ2A 4LF6L 2UUCL 3Q8DA 1XMOQ 5K36G 3RLNA 2PNHA 3M4QA 1U0LA 4MTNA 3J81i 5IYCH 3HOUG 4WJ3M 2VQFL 4LWCA 4HIOA 4HIMA 4LF4L 5C44H 2L15A 2JEAI 3G6EA 3PUVA 4X66Q 3LGJA 3H15A 2EIFA 3WWVA 4P73A 4HIDA 1E24A 4TQUS 4GOPB 2XTIA 5M3MH 1VQ4A 4JBKA 4YY3Q 5LMNW 4DV7L 4JI5L 1VQAA 1Q82C 1IXRA 4GOPA 1Y1WG 1N36L 3J7A5 5J3BA 4DAYB 3PO2H 1PH7A 3NEMA 4A3DH 1A63A 4A3IH 2UXBQ 5IP9G 4DR5Q 1S72A 1L1OA 4A4IA 1EYGA 2Q2UA 4JI0L 4LNQA 5E7NA 3BZCA 1M1KC 4GLAC 3FKIH 5LMUL 1X65A 5C0XG 2UUAQ 3CC4A 1Q46A 1PH8A 3S1MH 4JBJA 3TS2A 4O2DA 1G291 1YVCA 4IPGA 1KQSA 4UP9A 4A3MH 1PH5A 1VQBA 1YIJA 4JYAL 2KBNA 3I56A 4IOCA 1K8GA 4A3LG 3PF5A 2NZOA 4JI3Q 3H0GG 4JV5L 5M5XH 2GVAA 3S1QH 4R1JA 3AYHB 3W1BA 1SR3A 2MNAA 3D31A 3I55A 1J5EQ 2KENA 4DV6Q 4A3DG 1PA6A 1WOCA 1HZ9A 3CCEA 4JI6L 1SRUA 4A3LH 3KDFB 1H95A 4L5QA 2E5LQ 2BH8A 5IP7H 5C4XG 4QQBX 3T1HQ 4GNXC 1JMCA 3I7FA 2F52A 4A76A 1I50H 1L0WA 3KJPA 4A3JH 5GQOA 1IBKQ 1LUZA 4DR4Q 1VQKA 3S1NH 1B8AA 4OO1I 1GO3E 1JJGA 4LW1A 5ELNA 3F8TA 3SGIA 3PV0A 1SFOH 3CF5A 3GTPH 1CKOA 1WCMG 4A3GG 1XTDA 1YHAA 4J15A 5BR8L 4UPAA 4BBSH 4A3KG 5FJ8G 2UUCQ 4LF6Q 4O0AA 1OXVA 1XJVA 1KRSA 5FLMG 1WCMH 3OYYA 4UP8A 3L0OA 3KJOA 2RHSB 1SROA 3RR5A 5JEAJ 1Z9FA 5IT9c 2CCZA 1B70B 1BBWA 3FHWA 3S1RH 1Q1EA 1VQFA 1IYJB 2Y0SG 4DR6Q 3TS0A 1X56A 4LFAL 1TWHH 2ZTEA 1E1TA 3T1YL 1VQLA 2V1CC 2QGQA 4LF7L 4OO1G 3FKIG 5ELOA 4JI4L 3H3VH 1L1OB 3CCMA 4YCVA 1MKHA 5GAHC 4DR3Q 1K8AC 3PIOA 4WJ4A 2UU9Q 3TRZA 4B3RQ 1V9PA 1E7ZA 3PUYA 4LUOA 3TQYA 1E1OA 3PO2G 1CKNB 2DGYA 1IL2A 2LXKA 1SMXA 4DV0L 4C3JH 4P75A 1IBLL 4OXPA 2D0PA 2I5MX 2UXCQ 3RNUA 4P74A 2AWNA 1YITA 2CQOA 1GKHA 1VQCA 2Q2HA 2YTYA 3K8AA 4DKAC 5AJ3L 4DV1L 2R93H 3EBEA 2RHQB 1EFWA 2F4VQ 1I5FA 2VS1A 4JI3L 2YU9H 1W2BA 4JV5Q 3ULLA 4GNXA 3I4NH 5IP9H 1HNXL 2YV5A 3CCJA 4AIMA 1YBYA 2VW9A 4GNXB 2NVXH 4LF8L 1Q1BA 2A1AA 1KC8C 2BH2A 4BY1H 4JOIA 4IOAA 3NELA 3W1GA 1TWCH 4YWKA 1QVGA 3I4MG 1AH9A 1TWGH 1A0IA 1KHIA 2CFMA 3IRBA 1AE2A 2UUBL 1YJ9A 2YYZA 1CSQA 3K7AH 3RZDH 2A8VA 3PCOB 4AYBG 4JI4Q 3K7UC 4LF5L 4OX9L 4B3RL 1HZAA 1LM0A 4X6AH 1RIPA 2WP8J 2A19A 2K52A 4A3EH 4OWTB 3U50C 2XGTA 3BU2A 3JC66 4A3EG 3KF6A 4X66L 3DM3A 4QJFA 4A3GH 1M90C 1EQQA 1GM5A 4JI8L 1YNXA 1V43A 1WJJA 2IHEA 3G4SA 4JBMA 2KCMA 5GAGC 4ME3A 1NJIC 2NVQH 2UXCL 1PHJA 2JEBI 4GS3A 4JI5Q 2VZAA 3JAMi 4K0KL 1AE3A 4UP7A 4YHHQ 3ZJYC 3J80i 4DV1Q 4A93G 1SN8A 4DUYQ 4DR1Q 5JJLA 1X3EA 5GAEC 4EQ5A 5IYBG 1N33L 4AYBE 2JA7H 1QVFA 1KIXA 4BA1I 4GN3B 4HIKA 5IY0A 1N34Q 1HNXQ 2NVYH 2IX1A 1UEBA 2K75A 3GTQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN A;  3GD7 A;  2H5X A;  4YCW A;  4DR3 L;  1PH2 A;  2UU9 L;  4IJH A;  4X62 L;  2PI2 A;  4HJA A;  5LMN Q;  3U58 A;  2BA0 A;  2JJQ A;  1N9W A;  2ZJP A;  4DUZ L;  1VQ5 A;  4LUV A;  5IYD H;  2N78 A;  1G6P A;  4RG1 A;  1A8V A;  5C3E H;  2K5V A;  1WI5 A;  4X65 Q;  4IJL A;  3DLL A;  2ID0 A;  5H1S E;  2ATW A;  5JEA G;  2PMZ E;  2GN5 A;  1SE8 A;  3OTO L;  3CCR A;  2R6G A;  1DGS A;  2VNU D;  1HNW L;  3NBH B;  5C3E G;  3E0E A;  2RF4 A;  1HNZ L;  1A62 A;  3L7Z C;  4DV6 L;  2MO0 A;  3CME A;  3GTJ H;  4HJ5 A;  1I6H H;  2FXQ A;  3GTK H;  1Q8K A;  2OWO A;  3HOY H;  2F4V L;  2B29 A;  4POG A;  1MJC A;  4R4T A;  4GKJ L;  3CXC A;  2LSS A;  4PG3 A;  2ZJR A;  1KAW A;  2R7D A;  2C35 B;  1L2F A;  1VCI A;  5IYB H;  1HZB A;  1N8R C;  3RZO H;  2QA4 A;  3RLF A;  3PUX A;  2KHJ A;  2E8G A;  3CCL A;  4LF9 Q;  1Q12 A;  1QUQ A;  4JI2 Q;  1N33 Q;  3BJU A;  1JJC B;  2Z6K A;  3AFP A;  3ULP A;  4NXN Q;  2R7Z H;  1XMQ Q;  1IBM Q;  4L5T A;  1BKB A;  5IYD G;  1TWF H;  4LFC L;  4GN5 A;  2JA9 A;  2NZH A;  3PUZ A;  3HOX G;  3STB D;  1PH3 A;  4LF5 Q;  2HHH L;  4OX9 Q;  4P71 A;  1C9O A;  1Y14 B;  1XNQ L;  5FLM H;  4JI7 L;  4PZ8 A;  4QL5 A;  2HIX A;  3HOZ G;  3OW2 A;  3RLO A;  2YTV A;  1YI2 A;  3VDY A;  4OWW B;  2AKW B;  3STB C;  1CKN A;  1Q86 C;  1FJG Q;  3CPW A;  1NMF A;  4KHP Q;  4JI8 Q;  4EX5 A;  1CSP A;  1YZ6 A;  2VQE L;  1MJE A;  1HNW Q;  3H0G H;  4AQY Q;  4MZ9 A;  3K81 C;  3CC7 A;  4DV4 L;  2ZM6 L;  4B3S L;  2AMC B;  3ULJ A;  4DV2 L;  4BY1 G;  1I94 Q;  1J6Q A;  4LUZ A;  4XTC S;  4GKJ Q;  3I2Z A;  2E2J H;  2KCT A;  4C3I H;  1VQ6 A;  3G48 A;  2UXB L;  5C0X I;  4DR5 L;  3E9H A;  4PZ6 A;  2MQH A;  5C4X H;  2ES2 A;  4HJ9 A;  1X55 A;  3CC2 A;  1S40 A;  4JI0 Q;  5M5Y H;  1VS0 A;  2IY5 B;  1QZH A;  3S24 A;  3AFQ A;  1IBL Q;  5LMU Q;  3FP9 A;  3D0F A;  3M4P A;  1HH2 P;  3CMA A;  1UWV A;  3KF8 B;  3F2C A;  2I0Q A;  4JI2 L;  2JK8 A;  4NXN L;  2JA6 G;  3S17 H;  1IBM L;  2ZTD A;  1MIU A;  1P8L A;  2MFI A;  1N32 L;  3KLW A;  1HJP A;  1Y1V G;  5AJ3 Q;  4A3M G;  2EXD A;  1YHQ A;  1RL2 A;  1X6O A;  4JBW A;  4QIW E;  4DR2 Q;  3HOZ H;  3OTO Q;  2JA6 H;  2HHH Q;  4R4I A;  4IFD J;  3M9B A;  2E2I H;  1OXT A;  4KI0 A;  1PYS B;  1YEZ A;  4H02 A;  3I4N G;  2JA8 G;  3GTO H;  4XIG S;  3H3V I;  2CKZ B;  2PI2 E;  3PSI A;  4LF4 Q;  3HOU H;  1L1O C;  3J7Z C;  1K3R A;  1T9H A;  4QGU A;  1VQO A;  1YJW A;  1VQM A;  2VQE Q;  3JAM c;  2LXJ A;  3ICE A;  1QUQ B;  4KLK A;  4YWM A;  2AHO B;  4GN4 B;  4R4Q A;  1P16 A;  1VQJ A;  1VQD A;  1PH9 A;  3L2P A;  2K14 A;  2Z6K C;  4LFB Q;  4A3B G;  1FGU A;  2K4K A;  1PFS A;  4APV A;  2QEX A;  1XPR A;  4A3C H;  3MXN B;  4A3I G;  3KDF A;  1K83 H;  3CAM A;  4HJ8 A;  4A3C G;  1WYD A;  4JI1 L;  1VQP A;  4IFD I;  4TVA B;  4A3B H;  5FJ8 H;  4NB3 A;  1KL9 A;  1UE6 A;  1YHB A;  2IT1 A;  2K5N A;  4BBS G;  1R9T H;  1Y1V H;  3UE1 A;  3J80 c;  1HR0 L;  2UUA L;  1D8L A;  1QZG A;  3AEV A;  4OON A;  1EOV A;  4JI7 Q;  4RMF A;  1FVI A;  3CW2 C;  3KYH C;  4YHH L;  1D7Q A;  4JYA Q;  1OXU A;  4DUY L;  4DR1 L;  4KHP L;  2OQ0 A;  2R92 G;  1K9M C;  4AQY L;  2N49 A;  1ASZ A;  2HIV A;  5C0X J;  1N34 L;  1PYB A;  2F3I A;  4DNI A;  1PH1 A;  3KFU A;  1XNR Q;  4R4O A;  3B6Y A;  3F2B A;  1I94 L;  1PV4 A;  1Y1W H;  1UE1 A;  2JQO A;  4C2M H;  1I3Q H;  2CWA A;  4DUZ Q;  3HOV H;  3EN2 A;  4GLV B;  1OXX K;  3HKS A;  4DR7 L;  1BBU A;  4IFD G;  2NVT H;  4B3T Q;  1ASY A;  3CCV A;  2B63 H;  1IBK L;  1XPO A;  4DR4 L;  4X64 L;  4Y52 H;  2VL6 A;  5C4J H;  1EWI A;  2KHI A;  1XPU A;  2N3S A;  2PQA B;  5IYC G;  1NE3 A;  1X3G A;  3GTG H;  3S15 H;  1LTL A;  2NN6 I;  4DK3 C;  1HNZ Q;  1NMG A;  4GKK L;  2I5H A;  4DR2 L;  2DUD A;  1E3P A;  4L5R C;  1UE5 A;  1EIF A;  2JA8 H;  1TXY A;  1XMO L;  2WB1 G;  1NY4 A;  2OTJ A;  4OWX B;  1BVS A;  1EIY B;  4NXM L;  1JE5 A;  3G71 A;  4A3F G;  2R93 G;  1IZ6 A;  4LF8 Q;  2D62 A;  3M7N A;  4BY7 H;  2K5H A;  4LF9 L;  4BA2 I;  4Y7N H;  4DV5 Q;  3I4M H;  2D0O A;  1Q7Y C;  3HOW G;  5M3M G;  1V1Q A;  2EQS A;  3UE0 A;  4DV3 L;  2Z0S A;  4P72 A;  1VQ7 A;  2Q2T A;  2UUB Q;  1NTG A;  4GOP C;  3T1Y Q;  4BY7 G;  4DV7 Q;  4LF7 Q;  2I5L X;  4LFC Q;  2Q2I A;  3CCU A;  3A0J A;  1N36 Q;  4BXX H;  2Y0S E;  1VQG A;  1JT8 A;  2NN6 G;  1XNQ Q;  1EQR A;  2WFW A;  3GO5 A;  4JOI C;  4DAM A;  2ZTC A;  3U4Z A;  2R7Z G;  4JCV E;  3PO3 H;  1EUJ A;  1CUK A;  3F2D A;  2UXD L;  1C0A A;  1PVO A;  2WB1 E;  2OCE A;  4DV0 Q;  1FJG L;  2MO1 A;  4QY7 A;  1VQ9 A;  3F1Z A;  5JJK A;  1CKM A;  3W5O A;  1S3O A;  1VQ8 A;  2ZM6 Q;  4DV2 Q;  1C7Y A;  4GKK Q;  1Z47 A;  4A3F H;  3S14 H;  3K0X A;  3NEN A;  4MNO A;  5M5W H;  1KXL A;  4ALP A;  1J5E L;  1SLJ A;  1JB7 A;  4NXM Q;  4IPH A;  4BBR H;  3HOX H;  5M3F G;  3U4V A;  2ALY B;  3CQZ H;  2OTL A;  1NBW A;  4UY8 C;  1XNR L;  4A93 H;  4X62 Q;  5GAD C;  3T1H L;  5FLX c;  3S16 H;  3HKZ G;  2VUM G;  4DV5 L;  4DR7 Q;  3GDE A;  2VY3 A;  1WFQ A;  4DV3 Q;  2AWO A;  2CWP A;  4B3T L;  4B3M Q;  2VUM H;  1E22 A;  1N32 Q;  4X65 L;  3KOJ A;  2B63 G;  2ZJQ A;  5IWA Q;  2GVB A;  3I4O A;  1FL0 A;  1VQH A;  3AQQ A;  1PH4 A;  3M3Y H;  4JG2 A;  2BA1 A;  1KD1 C;  4FDB A;  3S2H H;  4NPS A;  3CD6 A;  3GTL H;  3RN5 A;  4GLX A;  2UXD Q;  1Q81 C;  4PMW A;  4YWL A;  1PH6 A;  3CCS A;  2WAQ E;  3BZK A;  3UDI A;  3HOY G;  3UDF A;  3J81 c;  2K50 A;  1VQI A;  3CCQ A;  1HZC A;  3TEH B;  4R4C A;  4A75 A;  1U5K A;  3CPF A;  2JA5 H;  2R92 H;  3HKZ E;  4K0K Q;  2B3G A;  5EAY A;  4A3J G;  3EIV A;  1OTC A;  1GD7 A;  3PF4 A;  4LFB L;  4BBR G;  5M3F H;  4IO9 A;  2HT1 A;  2E2H H;  3PO3 G;  3CP0 A;  4LFA Q;  4JI1 Q;  3MEF A;  1YJN A;  3A5U A;  1X9N A;  3ERS X;  3A74 A;  2R7F A;  3PGZ A;  4DPG A;  5LMN L;  2ASB A;  1HR0 Q;  3RN2 A;  5HGQ A;  4KHZ A;  1LYL A;  1OXS C;  2OQK A;  2RCN A;  2WAQ G;  4B3M L;  2IX0 A;  1X54 A;  4A3K H;  3KF6 B;  1VQE A;  2VQF Q;  3HFZ B;  1W3S A;  3PIP A;  2PQA A;  1TWA H;  2HQL A;  3TRE A;  5IWA L;  1QVC A;  2IHF A;  4YY3 L;  2JA5 G;  5C44 G;  1K73 C;  1UE7 A;  5GRO A;  4DV4 Q;  4B3S Q;  3M4O H;  4JI6 Q;  3UDX A;  2YTX A;  2E5L L;  4BXX G;  5IE8 A;  1G51 A;  2N8N A;  3A5Z B;  3UDG A;  4IPC A;  4C3H H;  3HOV G;  3PUW A;  3M85 A;  4AH6 A;  2JA7 G;  1K0R A;  2JE6 I;  5IP7 G;  3HOW H;  1KRT A;  1O7I A;  4DK6 C;  3K80 C;  3E9I A;  4POF A;  4X64 Q;  3GTM H;  4DR6 L;  5HY6 A;  1GVP A;  3ER0 A;  5JJI A;  1XMQ L;  4L5S A;  1X3F A;  4PZ7 A;  1B7Y B;  4HJ7 A;  3S2D H;  4YCU A;  1HR0 W;  5DLQ E;  3J81 j;  4JC0 A;  4IPD A;  5BR8 Q;  1JJ2 A;  4LF6 L;  2UUC L;  3Q8D A;  1XMO Q;  5K36 G;  3RLN A;  2PNH A;  3M4Q A;  1U0L A;  4MTN A;  3J81 i;  5IYC H;  3HOU G;  4WJ3 M;  2VQF L;  4LWC A;  4HIO A;  4HIM A;  4LF4 L;  5C44 H;  2L15 A;  2JEA I;  3G6E A;  3PUV A;  4X66 Q;  3LGJ A;  3H15 A;  2EIF A;  3WWV A;  4P73 A;  4HID A;  1E24 A;  4TQU S;  4GOP B;  2XTI A;  5M3M H;  1VQ4 A;  4JBK A;  4YY3 Q;  5LMN W;  4DV7 L;  4JI5 L;  1VQA A;  1Q82 C;  1IXR A;  4GOP A;  1Y1W G;  1N36 L;  3J7A 5;  5J3B A;  4DAY B;  3PO2 H;  1PH7 A;  3NEM A;  4A3D H;  1A63 A;  4A3I H;  2UXB Q;  5IP9 G;  4DR5 Q;  1S72 A;  1L1O A;  4A4I A;  1EYG A;  2Q2U A;  4JI0 L;  4LNQ A;  5E7N A;  3BZC A;  1M1K C;  4GLA C;  3FKI H;  5LMU L;  1X65 A;  5C0X G;  2UUA Q;  3CC4 A;  1Q46 A;  1PH8 A;  3S1M H;  4JBJ A;  3TS2 A;  4O2D A;  1G29 1;  1YVC A;  4IPG A;  1KQS A;  4UP9 A;  4A3M H;  1PH5 A;  1VQB A;  1YIJ A;  4JYA L;  2KBN A;  3I56 A;  4IOC A;  1K8G A;  4A3L G;  3PF5 A;  2NZO A;  4JI3 Q;  3H0G G;  4JV5 L;  5M5X H;  2GVA A;  3S1Q H;  4R1J A;  3AYH B;  3W1B A;  1SR3 A;  2MNA A;  3D31 A;  3I55 A;  1J5E Q;  2KEN A;  4DV6 Q;  4A3D G;  1PA6 A;  1WOC A;  1HZ9 A;  3CCE A;  4JI6 L;  1SRU A;  4A3L H;  3KDF B;  1H95 A;  4L5Q A;  2E5L Q;  2BH8 A;  5IP7 H;  5C4X G;  4QQB X;  3T1H Q;  4GNX C;  1JMC A;  3I7F A;  2F52 A;  4A76 A;  1I50 H;  1L0W A;  3KJP A;  4A3J H;  5GQO A;  1IBK Q;  1LUZ A;  4DR4 Q;  1VQK A;  3S1N H;  1B8A A;  4OO1 I;  1GO3 E;  1JJG A;  4LW1 A;  5ELN A;  3F8T A;  3SGI A;  3PV0 A;  1SFO H;  3CF5 A;  3GTP H;  1CKO A;  1WCM G;  4A3G G;  1XTD A;  1YHA A;  4J15 A;  5BR8 L;  4UPA A;  4BBS H;  4A3K G;  5FJ8 G;  2UUC Q;  4LF6 Q;  4O0A A;  1OXV A;  1XJV A;  1KRS A;  5FLM G;  1WCM H;  3OYY A;  4UP8 A;  3L0O A;  3KJO A;  2RHS B;  1SRO A;  3RR5 A;  5JEA J;  1Z9F A;  5IT9 c;  2CCZ A;  1B70 B;  1BBW A;  3FHW A;  3S1R H;  1Q1E A;  1VQF A;  1IYJ B;  2Y0S G;  4DR6 Q;  3TS0 A;  1X56 A;  4LFA L;  1TWH H;  2ZTE A;  1E1T A;  3T1Y L;  1VQL A;  2V1C C;  2QGQ A;  4LF7 L;  4OO1 G;  3FKI G;  5ELO A;  4JI4 L;  3H3V H;  1L1O B;  3CCM A;  4YCV A;  1MKH A;  5GAH C;  4DR3 Q;  1K8A C;  3PIO A;  4WJ4 A;  2UU9 Q;  3TRZ A;  4B3R Q;  1V9P A;  1E7Z A;  3PUY A;  4LUO A;  3TQY A;  1E1O A;  3PO2 G;  1CKN B;  2DGY A;  1IL2 A;  2LXK A;  1SMX A;  4DV0 L;  4C3J H;  4P75 A;  1IBL L;  4OXP A;  2D0P A;  2I5M X;  2UXC Q;  3RNU A;  4P74 A;  2AWN A;  1YIT A;  2CQO A;  1GKH A;  1VQC A;  2Q2H A;  2YTY A;  3K8A A;  4DKA C;  5AJ3 L;  4DV1 L;  2R93 H;  3EBE A;  2RHQ B;  1EFW A;  2F4V Q;  1I5F A;  2VS1 A;  4JI3 L;  2YU9 H;  1W2B A;  4JV5 Q;  3ULL A;  4GNX A;  3I4N H;  5IP9 H;  1HNX L;  2YV5 A;  3CCJ A;  4AIM A;  1YBY A;  2VW9 A;  4GNX B;  2NVX H;  4LF8 L;  1Q1B A;  2A1A A;  1KC8 C;  2BH2 A;  4BY1 H;  4JOI A;  4IOA A;  3NEL A;  3W1G A;  1TWC H;  4YWK A;  1QVG A;  3I4M G;  1AH9 A;  1TWG H;  1A0I A;  1KHI A;  2CFM A;  3IRB A;  1AE2 A;  2UUB L;  1YJ9 A;  2YYZ A;  1CSQ A;  3K7A H;  3RZD H;  2A8V A;  3PCO B;  4AYB G;  4JI4 Q;  3K7U C;  4LF5 L;  4OX9 L;  4B3R L;  1HZA A;  1LM0 A;  4X6A H;  1RIP A;  2WP8 J;  2A19 A;  2K52 A;  4A3E H;  4OWT B;  3U50 C;  2XGT A;  3BU2 A;  3JC6 6;  4A3E G;  3KF6 A;  4X66 L;  3DM3 A;  4QJF A;  4A3G H;  1M90 C;  1EQQ A;  1GM5 A;  4JI8 L;  1YNX A;  1V43 A;  1WJJ A;  2IHE A;  3G4S A;  4JBM A;  2KCM A;  5GAG C;  4ME3 A;  1NJI C;  2NVQ H;  2UXC L;  1PHJ A;  2JEB I;  4GS3 A;  4JI5 Q;  2VZA A;  3JAM i;  4K0K L;  1AE3 A;  4UP7 A;  4YHH Q;  3ZJY C;  3J80 i;  4DV1 Q;  4A93 G;  1SN8 A;  4DUY Q;  4DR1 Q;  5JJL A;  1X3E A;  5GAE C;  4EQ5 A;  5IYB G;  1N33 L;  4AYB E;  2JA7 H;  1QVF A;  1KIX A;  4BA1 I;  4GN3 B;  4HIK A;  5IY0 A;  1N34 Q;  1HNX Q;  2NVY H;  2IX1 A;  1UEB A;  2K75 A;  3GTQ H; 
#chains in the Genus database with same CATH topology
 3GV3 A;  4YCW A;  1PFM A;  4TRD A;  3U58 A;  1PH2 A;  3NUC A;  2JJQ A;  1N9W A;  5CV8 A;  1VQ5 A;  3NWT A;  4RG1 A;  3DLL A;  5JEA G;  2PMZ E;  2GN5 A;  3I3C A;  2F0P A;  1SE4 A;  3CCR A;  3NHH A;  1STE A;  2E74 C;  2Z6B A;  4KKU A;  2F4I A;  1Y69 U;  1HNW L;  3E0E A;  1ZXT A;  1OO9 B;  2A74 C;  5AFW A;  4DV6 L;  1CHQ D;  1HFG A;  2L5T A;  3R3O A;  4POG A;  4GKJ L;  4PG3 A;  4O1N A;  3R8B A;  2ZJR A;  4F88 A;  2R7D A;  2C35 B;  2QA4 A;  4OO1 H;  2EDG A;  2XRS D;  4DK1 A;  3PUX A;  2KHJ A;  1N33 Q;  1STG A;  3BJU A;  1JJC B;  3ULP A;  3SK5 A;  5IIF A;  1F77 A;  2R7Z H;  3J81 L;  1EIG A;  1GUO A;  2OEO A;  1TWF H;  4MHE A;  4KHV A;  4K6D A;  1PH3 A;  3PUZ A;  1Q90 A;  3MXN A;  3STB D;  4P71 A;  2HIX A;  1WTV A;  3HOZ G;  4OWW B;  1NMF A;  4DK0 A;  1YZ6 A;  2K1B A;  1QJO A;  4AQY Q;  4MZ9 A;  2CW0 C;  5FLX L;  4DV4 L;  3H91 A;  3R2I A;  2NB0 A;  2M00 A;  5I2X A;  3G48 A;  1D1I A;  2UXB L;  5C0X I;  5C4X H;  2MQH A;  4JI0 Q;  4K5X A;  4HJ9 A;  1VS0 A;  2F0S A;  2XRQ D;  2Q8I B;  1IBL Q;  5LMU Q;  3M4P A;  3F2C A;  3A8I E;  2G5D A;  4JI2 L;  4F87 A;  4G7Z C;  1V8Q A;  4KJO A;  1X6O A;  4JBW A;  2F0T A;  2Q8T A;  3URY A;  1ET9 A;  1OXT A;  5COY A;  1PYS B;  4XIG S;  1F9P A;  4QGU A;  2K5D A;  1GUN A;  4QMG A;  3QIA A;  4KLK A;  1D5X C;  2AHO B;  4GN4 B;  4R4Q A;  1P16 A;  3EA6 A;  4IUP A;  4RH6 A;  2K14 A;  4A3B G;  5C44 B;  1A2T A;  4APV A;  4CJ0 B;  4HJ8 A;  3CAM A;  3GTK B;  3HOY B;  3DEP A;  4A3B H;  4C2M B;  5HGT A;  2PNR C;  4NB3 A;  1MHW C;  4KN7 C;  1S5B D;  5KEE A;  2F3V A;  1SMY C;  1D8L A;  4JI7 Q;  1FVI A;  3MXU A;  3CW2 C;  4C3J B;  3AB9 A;  4DR1 L;  1WTX A;  2R92 G;  1K0S A;  5CV9 A;  1CI3 M;  2N49 A;  3NSW A;  1ASZ A;  3NQT A;  5C0X J;  3S1M B;  3KFU A;  1ILP A;  2OT2 A;  2EOT A;  4H7B A;  1PV4 A;  3DUZ A;  3P20 A;  2CWA A;  1ZYR C;  2B2Y C;  1OXX K;  5G3L F;  1IBK L;  4DR4 L;  4Y52 H;  3GTL B;  3IKJ A;  2F0F A;  1EWI A;  1ZYR D;  1XPU A;  2N3S A;  4HMI A;  1F9R A;  1EIH A;  3K7A B;  4OL7 A;  1EU3 A;  4DK3 C;  5T1I A;  5EGT A;  2RQX A;  4DAV A;  1UE5 A;  1EIF A;  1XMO L;  5EPL A;  1PRT D;  4OWX B;  5NUC A;  4CHT B;  3G71 A;  3W2D A;  2QKI C;  1AW7 A;  2K5H A;  4LF9 L;  3I4M H;  5CYU A;  1V1Q A;  4DV3 L;  3T1Y Q;  4OGQ C;  2O2L D;  2Q2I A;  3LWE A;  3CCU A;  4A3K B;  1N36 Q;  1JT8 A;  1VQG A;  1LO5 D;  2NN6 G;  3MA2 B;  1EQR A;  2WFW A;  4DAM A;  1LAC A;  3GTO B;  2R7Z G;  3OOC A;  1EUJ A;  1CUK A;  3MTS A;  3VYS A;  4OIK A;  2RSO A;  1SDF A;  2MO1 A;  5A35 A;  2EXZ A;  3NQI A;  4DXG A;  3K5L A;  1VQ9 A;  2QEJ C;  5CGK A;  1XTC D;  3S14 H;  4CKC A;  2DNE A;  1SLJ A;  1A3T A;  4BBR H;  1XNR L;  3U4V A;  2ALY B;  3MFY A;  4WFN 3;  3S16 H;  5EKL A;  1WFQ A;  1HUM A;  2XIW A;  4X65 L;  1B50 A;  1YNJ C;  3ITP A;  2D9U A;  2B63 G;  5FO9 B;  1C48 A;  3WDN A;  2EY5 A;  1EFI D;  3M3Y H;  1I4R A;  2BA1 A;  4FDB A;  2A68 D;  4M8A A;  3GTL H;  5E3F A;  5JAV A;  4IUN A;  4PMW A;  4YWL A;  2WAQ E;  4DF7 A;  3UDF A;  3CCQ A;  1SNO A;  1VQI A;  1B3A A;  4R4C A;  1H9S A;  4A75 A;  2ZXP A;  1MD2 D;  3HGB A;  4TSS A;  3OSO A;  5DAU A;  4IO9 A;  5CV4 A;  1G2S A;  5CV6 A;  1X9N A;  3A74 A;  3SXH A;  5C6A A;  2FIN B;  2F3W A;  2ASB A;  3RN2 A;  2WAQ G;  4B3M L;  1ZKO A;  3K58 A;  5DM6 3;  1VQE A;  4XQN A;  1W3S A;  3Q22 A;  2ZT9 C;  5F2D A;  1EOT A;  4F8M A;  3TRE A;  4RGM A;  2MJ8 A;  4OEM B;  1QVC A;  2IHF A;  3PQI A;  1UE7 A;  4DV4 Q;  2EY2 A;  4BXX G;  5IE8 A;  3A5Z B;  4IPC A;  4LK1 C;  4WJW A;  3S15 B;  1BQQ T;  1SXT A;  3HOW H;  1J9O A;  4X64 Q;  3EJI A;  3QWN A;  3GQB A;  4FXK C;  1F2Z A;  2KED A;  4FF3 A;  4KKS A;  4K2L A;  4HJ7 A;  3SR1 A;  1HR0 W;  3J7A V;  1EYC A;  4DA2 A;  1K8M A;  4I7A A;  4MTN A;  3NTH A;  4WJ3 M;  2VQF L;  3MAQ A;  4HIO A;  1G6Z A;  4X66 Q;  1Y8N B;  5C4Z A;  2F0J A;  4GOP B;  1EY5 A;  5ISR A;  2NWG A;  1Y1W G;  3J7A 5;  5E1F A;  3FPP A;  4DAY B;  3SEB A;  2JA5 B;  1A6X A;  3PO2 H;  1WTO A;  1PH7 A;  4A3D H;  2L55 A;  2L0C A;  1JC7 A;  1BCP C;  1O7Z A;  2JA8 B;  1L1O A;  4A4I A;  1EYG A;  2Q2U A;  1S5C D;  1YNN D;  1MGS A;  3HOV B;  1HCZ A;  3O13 A;  4A3F B;  5K5P A;  1LAB A;  5IOC A;  1M8A A;  1KQS A;  1DXM A;  4QUC A;  4A3M H;  1PTO H;  1YIJ A;  2RDF A;  1K8G A;  3I56 A;  4JYA L;  3S1Q H;  4R1J A;  3S16 B;  3D31 A;  4A3D G;  1O7L A;  1HZ9 A;  2JP1 A;  5IP7 H;  4DXF A;  4QQB X;  3I7F A;  1WVL A;  2E75 C;  2QDB A;  2LKV A;  3BS1 A;  2SOB A;  1IBK Q;  1AZP A;  4DR4 Q;  3S1N H;  4OO1 I;  1GO3 E;  1NAP A;  4LW1 A;  3F8T A;  1LTA D;  2EYJ A;  3TZU A;  1CKO A;  1WCM G;  1XTD A;  1YHA A;  4QF4 A;  1VF7 A;  1EY7 A;  2SNM A;  5FJ8 G;  2UUC Q;  3IAY A;  1KRS A;  5I9O A;  3OYY A;  1GUW A;  1SRO A;  1RTO A;  5IT9 c;  5BN5 A;  5COR A;  1B70 B;  3S1R H;  4HCS A;  3C1E A;  3X3M A;  1VQF A;  4C3H G;  3TS0 A;  4LFA L;  1I4Q A;  2KOL A;  2QGQ A;  4LF7 L;  3NXW A;  4YCV A;  1MKH A;  5GAH C;  1WD0 A;  1V9P A;  1S4Z A;  4IUU A;  2R93 B;  1CK1 A;  3EQL C;  4DV0 L;  3GTJ B;  4C3J H;  1I6H B;  3TSS A;  3K59 A;  1RJT A;  1I3Q B;  2CQO A;  4DKA C;  2Q2H A;  2YTY A;  2QCP X;  4HSP A;  5AJ3 L;  4DV1 L;  3EBE A;  4CDD C;  1EFW A;  2F4V Q;  1I5F A;  2VS1 A;  2YU9 H;  2F0E A;  4AIM A;  1YBY A;  2WAC A;  2NVX H;  2IJ0 A;  2BH2 A;  1Q1B A;  2A1A A;  4BY1 H;  5FO8 B;  3JAM E;  3W1G A;  3SK4 A;  3VR2 A;  3PMF A;  1B1Z A;  1A0I A;  3IRB A;  5HUR A;  3K7A H;  1KAB A;  4HTH A;  2I46 A;  3K7U C;  3HS0 C;  4LF5 L;  4B3R L;  4ZLT F;  3HG9 A;  4Y7N B;  3N6R A;  2C5C A;  5JJZ A;  5L37 A;  3V96 A;  3R93 A;  1CQV A;  3KF6 A;  4X66 L;  4QJF A;  1STB A;  2PZU A;  4JI8 L;  1WJJ A;  3G4S A;  4I7Z C;  2UXC L;  2ZXO A;  1PHJ A;  2JEB I;  4GS3 A;  4AYB B;  1AE3 A;  1UAP A;  1CT1 D;  4UP7 A;  3J80 i;  4DUY Q;  5JJL A;  1JIC A;  4EQ5 A;  2ENB A;  4AYB E;  4RHS A;  4BA1 I;  5IY0 A;  4BBS B;  3H94 A;  1CA5 A;  2K75 A;  3PIP 3;  4A3E B;  3S1R B;  2CVR A;  4X62 L;  4DUZ L;  2ZJP A;  4X3T A;  3AU7 A;  4LUV A;  2N78 A;  4IUV A;  4C1N I;  1WI5 A;  4IJL A;  4XXE A;  1SE8 A;  3OTO L;  4TKO B;  1DGS A;  4EQP A;  5IGD A;  1TY2 A;  2VNU D;  1BXT A;  4DGZ A;  1E2Z A;  2RF4 A;  1KAA A;  1HNZ L;  4IUQ A;  1PRT F;  3NPP A;  4NW2 A;  1Q8K A;  2HUG A;  1TY0 A;  4ZAI A;  4FF1 A;  3TDQ A;  1L2F A;  1VCI A;  5IYB H;  3RZO H;  1N8R C;  2F0V A;  2G9H D;  3RLF A;  4LAA A;  2Z4H A;  4IUR A;  2PW7 A;  5I9P A;  1XMQ Q;  4GN5 A;  1T5E A;  2NZH A;  2HDL A;  1C9O A;  4QL5 A;  4C1N K;  2WKD A;  3OW2 A;  3RLO A;  2JXM B;  1CKN A;  3D4D A;  3CPW A;  2M2L A;  4KY7 A;  1CSP A;  4EX5 A;  3GV6 A;  1HNW Q;  3CC7 A;  4B3S L;  3SK6 A;  1HA6 A;  1QNK A;  4BWG B;  4ABN A;  4BY1 G;  1JOR A;  2B2T C;  2WII B;  3M4Y A;  1BCP D;  4GKJ Q;  1DON A;  2KCT A;  1UEA B;  3OIP A;  4DR5 L;  3TP5 A;  3Q0A A;  1KDC A;  5M5Y H;  2B2W C;  4NKL A;  3TBI B;  1QZH A;  5M5W B;  3FP9 A;  3VYU A;  1HH2 P;  1UWV A;  2L4N A;  4NXN L;  3S17 H;  4UHV A;  1LT6 D;  5ELD A;  1N32 L;  1HJP A;  1AZQ A;  5AJ3 Q;  2EXD A;  1RL2 A;  3OTO Q;  4EGV A;  1EEF D;  3EFX D;  4KI0 A;  4H02 A;  2PI2 E;  3PSI A;  3ERO A;  1M4V A;  1L1O C;  3J7Z C;  1YJW A;  1VQO A;  3HOZ B;  2QW7 A;  3C46 A;  2FMC A;  1JOQ A;  1SYD A;  4C3J G;  1VQD A;  4LFB Q;  1XX8 A;  4FXG C;  2HCI A;  1FGU A;  2K4K A;  1PFS A;  1XPR A;  2QEX A;  4A3I G;  1ENA A;  1K83 H;  4A3C G;  4JI1 L;  1VQP A;  4N9P A;  2K5N A;  4G7H C;  2PW5 A;  1HR0 L;  1LTG D;  3AEV A;  3ONA B;  4RHR A;  4YHH L;  2I07 B;  1D7Q A;  3RZD B;  1OXU A;  3NK9 A;  1EQT A;  3HP3 A;  4A3I B;  5IGG A;  1EYD A;  3B6Y A;  4FVM A;  1UE1 A;  2JQO A;  4C2M H;  4DUZ Q;  2VB2 X;  3EN2 A;  3HKS A;  1H9R A;  1QWY A;  2B63 H;  2K03 A;  4G57 A;  2BDN A;  2KHI A;  2PPB C;  1DOL A;  4NDX A;  3BVM A;  3FEW X;  2NN6 I;  1HNZ Q;  4GKK L;  4DR2 L;  2PO4 A;  4L5R C;  1ENC A;  2JA8 H;  1UUP A;  5D14 A;  1F9Q A;  5FLX E;  1EIY B;  4U67 3;  1VF5 C;  1IZ6 A;  2NUC A;  2D62 A;  3VR3 A;  4CKB A;  5IGF A;  4DV5 Q;  1FR3 A;  2EQS A;  4P72 A;  2UUB Q;  4GOP C;  2F1M A;  4BY7 G;  4N8F A;  5JPM C;  3A0J A;  4XT1 B;  4KY6 A;  4DU9 A;  2NVQ B;  2XWJ B;  2KCC A;  1FNV A;  1XNQ Q;  4Q0F A;  3U4Z A;  2KCN A;  3H6M A;  1D1K A;  5CMD A;  3J80 E;  4FXD A;  3TZD A;  3W5O A;  1S3O A;  3I4M B;  1V1P A;  2FMM A;  4HAE A;  2ZM6 Q;  1HFN A;  4FYD A;  1Z47 A;  3I4L A;  5M5W H;  4MNO A;  2NZ1 D;  1KTK A;  2DY8 A;  1WTQ A;  4G4K A;  1EY8 A;  4NXM Q;  3F2U A;  3KBX A;  5M3F G;  2F0Q A;  2K28 A;  4X62 Q;  5GAD C;  3VYR A;  2VUM G;  4DFA A;  2CH4 W;  3FMC A;  2VUM H;  1N32 Q;  1HA5 A;  3KOJ A;  2MUY A;  5IWA Q;  1FL0 A;  1VQH A;  2C9O A;  4JG2 A;  3TME A;  4XQQ A;  3CCS A;  1RF2 D;  3UDI A;  2R7Z B;  1NSN S;  2RKS A;  5A2Q L;  2K50 A;  2L9H A;  3CPF A;  2R92 H;  3NP8 A;  4L6T B;  1DCZ A;  1OTC A;  3PF4 A;  2NTT A;  4LFB L;  5M3F H;  1MSG A;  2E2H H;  3PO3 G;  4QCL A;  2IPK D;  4JI1 Q;  1YJN A;  3A5U A;  2HQE A;  1GUS A;  2SEB D;  4FP5 D;  4DPG A;  3HOU B;  1HR0 Q;  1LYL A;  3Q24 A;  3DEO A;  3PIP A;  1MI2 A;  4A3J B;  4YY3 L;  3K5M A;  5C44 G;  1K73 C;  5GRO A;  1I50 B;  2VB3 X;  4IN3 A;  2E5L L;  3GTQ B;  2NTS A;  3UDG A;  1PRT C;  4C3H H;  1WTR A;  3PUW A;  1K0R A;  5IP7 G;  1KRT A;  1O7I A;  4DK6 C;  3E9I A;  5FKA C;  1QNU A;  1EZ6 A;  3OPO A;  1B9N A;  1STN A;  1X3F A;  4PZ7 A;  1KLU D;  1B9M A;  4YCU A;  5CV7 A;  3K57 A;  4IPD A;  4LF6 L;  2HCC A;  2MP1 A;  3M4Q A;  3QR8 A;  2KQ3 A;  1B3Q A;  4LWC A;  4HIM A;  5C44 H;  2L15 A;  2JEA I;  3FRP B;  2BE5 D;  3PUV A;  5I2Y A;  3LGJ A;  3WWV A;  4HID A;  4TQU S;  4JBK A;  5LMN W;  1VQA A;  1Q82 C;  4XYO A;  1ICF B;  3D4R A;  4KMU C;  1NUC A;  1A63 A;  2E2D C;  3MWY W;  3EVQ A;  5IP9 G;  2UXB Q;  1QIL A;  4JI0 L;  1QB5 D;  5E7N A;  4GLA C;  2A6H D;  5LMU L;  1X65 A;  5C0X G;  3TS2 A;  1PH8 A;  4JBJ A;  2AQ1 B;  3T56 B;  1G29 1;  1YVC A;  3S9W A;  3OHX C;  4IPG A;  4DNR B;  2M9V A;  1PZI D;  4MTK A;  4UP9 A;  4X3K A;  1VQB A;  3PF5 A;  2NZO A;  4JV5 L;  3H0G G;  2N55 A;  5C3W A;  1SFO B;  3GTP B;  4KJN A;  2MNA A;  3I55 A;  2A68 C;  1J5E Q;  1PA6 A;  1JCK B;  4JI6 L;  4HN7 A;  1X3Q A;  1U4R A;  2E5L Q;  2VXW A;  1CQF A;  1G91 A;  1RCV D;  4IUT A;  4JVZ A;  1I50 H;  1CZG A;  4GZY C;  4ME5 A;  3P1H A;  2HDM A;  1B8A A;  1PZJ D;  3D4W A;  2KEC A;  1CM9 A;  5TSS A;  3CF5 A;  4A3G G;  5JPN C;  4L8J A;  5BR8 L;  2B2T A;  4LF6 Q;  4O0A A;  1GHJ A;  5FLM G;  3H3V C;  3P7J A;  3L0O A;  2X69 A;  2TSS A;  4X3U A;  5IGE A;  3MFG A;  3VR6 A;  5JEA J;  1SAP A;  1D6E C;  2CCZ A;  1AEX A;  5J39 A;  1Q1E A;  1IYJ B;  2Y0S G;  4DR6 Q;  2E76 C;  1X56 A;  2EYF A;  4QB4 A;  3FKI G;  4JI4 L;  1ET6 A;  1RHP A;  3OMG A;  4WJ4 A;  4DR3 Q;  1K8A C;  3PIO A;  3TRZ A;  4B3R Q;  4LUO A;  1R4P B;  2F03 A;  1TS5 A;  2B8G A;  1VMP A;  2DN8 A;  2DGY A;  2E2J B;  3IFT A;  1LTB D;  2A6E C;  5IOD A;  2X6G A;  4ZUJ A;  1YIT A;  2F0H A;  1EY6 A;  3K8A A;  4QUF A;  2DJG C;  5C3X A;  4GNX A;  4NP5 A;  2BCO A;  2YV5 A;  3CCJ A;  1R9T B;  1KC8 C;  2Z8L A;  2BDO A;  1LTI D;  4IOA A;  1QOH A;  4YWK A;  1D5M C;  1BNZ A;  1KHI A;  3N52 A;  3PCO B;  1EYA A;  4AYB G;  1DM0 B;  3VA5 A;  3DWQ A;  4OX9 L;  4CJ2 C;  3TP6 A;  1AN8 A;  1RIP A;  4DAY A;  5K36 H;  4A3E H;  1PDQ A;  4A3E G;  1M90 C;  1EQQ A;  1BR9 A;  1STA A;  1GM5 A;  2IHE A;  4JBM A;  4ME3 A;  2BOS A;  1NCV A;  1SYB A;  5CV5 A;  1H9K A;  1W6J A;  3ZJY C;  4DV1 Q;  4A93 G;  1SN8 A;  1PTO D;  5IYB G;  3QG1 A;  1QE6 A;  3JAM L;  4KK7 A;  1KIX A;  1QVF A;  2F0L A;  4GN3 B;  2IX1 A;  1EQV A;  5HGQ A;  1VQN A;  3GD7 A;  4DR3 L;  5LHY 1;  3U9O A;  3T13 A;  4X65 Q;  2ID0 A;  3KBG A;  5H1S E;  2ATW A;  1KNA A;  2H4O A;  4KD3 A;  3ZYY X;  4A93 B;  2R6G A;  3NBH B;  3L7Z C;  2MO0 A;  4HJ5 A;  2FXQ A;  1AFP A;  3GTK H;  2OWO A;  3HOY H;  2NVY B;  2K01 A;  1SE3 A;  4IZ8 A;  1L0Y B;  2B2V C;  2EYM A;  3BDO A;  2MHV A;  3T53 B;  3CCL A;  2E8G A;  1JB3 A;  4LF9 Q;  1PRT B;  1Q12 A;  1L0X B;  2Z6K A;  3AFP A;  4NXN Q;  3CHB D;  1BKB A;  4FO2 A;  2JA9 A;  4OX9 Q;  3HOX G;  1BO0 A;  1TS4 A;  4M1U B;  3SVM A;  1Y14 B;  4EVO A;  5FLM H;  4JI7 L;  4RWS C;  1I4G A;  2YTV A;  1YI2 A;  3BYT B;  3VDY A;  5KGU A;  2AKW B;  1XWE A;  3STB C;  4KHP Q;  3GP7 A;  1MJE A;  4J6H A;  3PO3 B;  1V1O A;  3H0G H;  3K81 C;  2E2H B;  2AMC B;  4LUZ A;  4LMQ D;  1IYU A;  3IL8 A;  3I2Z A;  3ND9 A;  3V05 A;  4C3I H;  2E2J H;  4PZ6 A;  1HQM C;  1X55 A;  3CC2 A;  1S40 A;  4K8J A;  3AFQ A;  3BDC A;  3KF8 B;  2I0Q A;  2JK8 A;  3SDZ A;  1DYQ A;  5CBA E;  2WIN B;  1IBM L;  2MFI A;  1Y1V G;  4OHJ A;  4K8I A;  1TU2 B;  1C8C A;  5KNC A;  3HOZ H;  4J8Q A;  2HHH Q;  4R4I A;  2E2I H;  1YEZ A;  3I4N G;  4XT3 B;  4NMZ A;  3D3R A;  3GTO H;  2CKZ B;  3HOU H;  1K3R A;  1T9H A;  3M3Y B;  2VQE Q;  3JAM c;  2LXJ A;  4QIW B;  1LTR D;  1QUQ B;  5KND A;  4YWM A;  2XN9 C;  2KA7 A;  1VMC A;  1Z6H A;  1PH9 A;  3L2P A;  1Y1V B;  5FK9 C;  3KDF A;  1WYD A;  3I8Z A;  4R9W A;  4TVA B;  3DM1 A;  5FJ8 H;  1KL9 A;  1UE6 A;  1YHB A;  4N9T A;  3WOF A;  1GXD C;  4CGY B;  3KLR A;  1QZG A;  1EOV A;  2RCF A;  3LWU A;  5KYI A;  3DXJ C;  3KYH C;  1I4H A;  5JVG 3;  2EJG C;  4JYA Q;  3GTG B;  4KHP L;  5KNB A;  3D6W A;  1NR2 A;  1CTM A;  1K9M C;  4AQY L;  2H1E A;  2HIV A;  1PYB A;  5KYL A;  5T1G A;  2EZV A;  1XNR Q;  4R4O A;  4KTA A;  2BE5 C;  4KV6 A;  1Y1W H;  1I3Q H;  2WB1 B;  4LJZ C;  4GLV B;  4DR7 L;  1BBU A;  4IFD G;  2NVT H;  4B3T Q;  5BN3 A;  1XPO A;  4X64 L;  2VL6 A;  5FOB B;  3H0G B;  3S15 H;  2PQA B;  3TP8 A;  1X3G A;  1C4Q A;  1LTL A;  5JOB A;  2K5Q A;  5D3D A;  4H13 C;  4BY7 B;  1IKL A;  2I5H A;  4K5W A;  5EQ0 A;  1E3P A;  4CKE A;  1TXY A;  4K14 A;  2WB1 G;  2OTJ A;  4B9W A;  1BCP B;  1BVS A;  2FFK B;  4NXM L;  1JE5 A;  5DM7 3;  3M7N A;  4BA2 I;  4Y7N H;  5EBC A;  3A7A B;  5M3M G;  2Q2T A;  1JWU D;  2Z0S A;  3A55 A;  1TQO A;  1NTG A;  1HTL D;  4LF7 Q;  2I5L X;  2Y0S E;  1R4Q B;  4P2C B;  3PO3 H;  3BYY B;  1C0A A;  2UXD L;  3KF8 A;  2WB1 E;  2OCE A;  4DV0 Q;  5JEA H;  1CZW A;  1PTO F;  2EJM A;  4QY7 A;  1PFB A;  2EYP A;  4I65 A;  2HD3 A;  5EPJ A;  1H9M A;  3F1Z A;  2D2C C;  2VUM B;  1CKM A;  5JJK A;  2KVM A;  1ILQ A;  3FKI B;  4GKK Q;  4A3F H;  3L3O C;  1JB7 A;  2RDG A;  4IPH A;  3HOX H;  1D5Z C;  1NBW A;  1SNP A;  4XYQ A;  3T1H L;  3HKZ G;  1CHP D;  4DV5 L;  4DR7 Q;  3J81 E;  2PQE A;  2AWO A;  2CWP A;  4B3T L;  4CBV A;  4ZKC B;  2A69 C;  3AQQ A;  1PH4 A;  3J80 L;  3SHL A;  1LT3 D;  1XXG A;  2K05 A;  4NPS A;  3RN5 A;  1Q81 C;  4YIJ A;  1PH6 A;  3HOY G;  2OF1 A;  1HZC A;  2JA5 H;  1U5K A;  3TN2 A;  1JQY D;  4WOR A;  3G7L A;  3HKZ E;  4K0K Q;  4DAP A;  1O7Y A;  5EAY A;  1KXL A;  4A3J G;  1GD7 A;  4BBR G;  1K28 A;  3CP0 A;  1YNN C;  1FNU A;  2LMC B;  4LFA Q;  2IWH A;  3NBH A;  1Y8O B;  2KHS A;  1PXU A;  5LMN L;  4KHZ A;  5M3F B;  2OQK A;  3HEJ A;  2J4X A;  2IX0 A;  1X54 A;  4A3K H;  4ID6 A;  3M7G A;  1S5D D;  2PQA A;  3BVG A;  3MEH A;  3V2T A;  4DN4 M;  1TWA H;  2HQL A;  1UNS A;  4C3H B;  5IWA L;  5IGB A;  5M5Y B;  1KDB A;  2EPB A;  3UDX A;  2D5D A;  1GUT A;  1A15 A;  2B2V A;  1SEB D;  2N8N A;  2WKC A;  2PYK A;  3K0Y A;  3M85 A;  4AH6 A;  2ICE C;  4CJ1 B;  4POF A;  3GTM H;  2RSN A;  4F7X A;  1EY9 A;  1B4O A;  2F0N A;  1XMQ L;  1ML0 D;  5G3L D;  1B7Y B;  4BY1 B;  1TWC B;  3VR5 A;  2UUC L;  3Q8D A;  1XMO Q;  5K36 G;  3RLN A;  2IX3 A;  4N8X 1;  3R2T A;  3HOU G;  3S2D B;  4RKL A;  1IL8 A;  1HRJ A;  3G6E A;  3A8K E;  3H15 A;  1DJR D;  1K83 B;  4P73 A;  2F0D A;  4YY3 Q;  4JI5 L;  4GOP A;  1N36 L;  5J3B A;  2F0O A;  1H9J A;  1STH A;  1S5F D;  3NEM A;  3OWF A;  4A3I H;  4DR5 Q;  1LT4 D;  2EY1 A;  3CKI B;  4LNQ A;  1M1K C;  4ILW A;  3OMC A;  3FKI H;  2FHT A;  5M5X B;  3S14 B;  2EYH A;  1Q46 A;  3HRZ C;  1PYW D;  1PH5 A;  4PMB A;  2KBN A;  2NVX B;  4IOC A;  2QIL A;  4JI3 Q;  4A3L G;  3QOJ A;  2GVA A;  4RKB A;  2B63 B;  3CU7 A;  3L9A X;  2KEN A;  3IFD A;  4RCO A;  4A3L H;  1SRU A;  3KDF B;  2PCF B;  2BH8 A;  5JVH 3;  2EYL A;  4ZYS A;  3T1H Q;  5EPK A;  4GNX C;  1JMC A;  1TVX A;  2F52 A;  1HQR D;  4RA8 A;  2X6L A;  1L0W A;  5IT9 L;  3KJP A;  1LUZ A;  1RDP D;  1VQK A;  2L1B A;  3MZ5 A;  1RD9 D;  1JJG A;  1SNM A;  5C5L A;  3HOW B;  5ELN A;  3SGI A;  3PV0 A;  1SFO H;  3GTP H;  2RBM A;  1RTN A;  4UPA A;  4BBS H;  1B53 A;  1OXV A;  1XJV A;  3C1F A;  5CC4 A;  3Q23 A;  1WCM H;  2CH4 A;  2F0M A;  4CDC C;  1LLR D;  1Q3L A;  2DY7 A;  4PV1 C;  3RR5 A;  1Z9F A;  1SND A;  1BBW A;  3FHW A;  1O78 A;  2F0I A;  2ZTE A;  3T1Y L;  2O5J C;  2V1C C;  5C3E B;  1SYE A;  4OO1 G;  3H3V H;  3CCM A;  5IT9 E;  2UU9 Q;  3UI2 A;  1E7Z A;  3I73 A;  3PUY A;  4KN4 C;  3TQY A;  1DD2 A;  3ERQ A;  1IW7 D;  3NWS A;  5E4W C;  3DWP A;  1IYV A;  1IL2 A;  3RZO B;  1SMX A;  4ZRZ A;  2XWB B;  4P75 A;  2AQ3 B;  2CHB D;  4OXP A;  2D0P A;  2I5M X;  4ZKB B;  1FGB D;  4P74 A;  2AWN A;  2CW0 D;  3CQZ B;  5C0X H;  1BBX C;  1BF4 A;  1B2T A;  4JI3 L;  5EKI A;  1W2B A;  2TMP A;  2K04 A;  2IW3 A;  3S2H B;  5IP9 H;  1HNX L;  1LT5 D;  2VW9 A;  1JE4 A;  4DNT B;  4LF8 L;  2RDH A;  2J7Z A;  3NEL A;  1TWC H;  2F0G A;  2B2U A;  5D65 A;  4HMJ A;  3I4M G;  2MPM A;  2CFM A;  1QG7 A;  2UUB L;  2YYZ A;  1CSQ A;  4B9X A;  2CQA A;  4JI4 Q;  4EQO A;  1LTT D;  1PLF A;  2Q8R E;  2IL8 A;  2PZW A;  3DWA A;  1II3 A;  1LM0 A;  4OIJ A;  1KLG D;  2WP8 J;  1T5X D;  2GA4 B;  1TR5 A;  2K7V A;  2P5Z X;  3U50 C;  3BU2 A;  4A3G H;  4S3S A;  3DM3 A;  3SK8 A;  5C4H A;  2NBF A;  1YNX A;  1V43 A;  2KCM A;  5EKK A;  5GAG C;  1F2Y A;  1ESR A;  4JI5 Q;  1JWS D;  3JAM i;  4K0K L;  4YHH Q;  2PMZ B;  1QCB D;  1X3E A;  5GAE C;  1N33 L;  1U4P A;  1WTW A;  2B2U C;  4JK1 C;  1N34 Q;  2NVY H;  3P75 A;  2RVL A;  1UEB A;  3GTQ H;  4RFB A;  2H5X A;  2UU9 L;  2B2Y A;  4IJH A;  2PI2 A;  4HJA A;  5LMN Q;  5IYD H;  2BA0 A;  1H95 A;  4C56 C;  1G6P A;  1A8V A;  3MXG A;  5C3E H;  3M4O B;  2JA7 B;  2K5V A;  4CDE C;  2J0T D;  2ZXR A;  2R61 A;  1U4M A;  5I6Y A;  1F2L A;  5I4D A;  5C3E G;  1TS3 A;  4ODG A;  1A62 A;  2F0W A;  1SNC A;  3CME A;  2ICI A;  3GTJ H;  1I6H H;  1EZ8 A;  3LNN A;  2F4V L;  2B29 A;  1MJC A;  4R4T A;  3RMH A;  4EQN A;  3CXC A;  3HOX B;  2LSS A;  4XDX A;  1KAW A;  2WAQ B;  1HZB A;  2EE1 A;  3DHQ A;  1IKM A;  2QF7 A;  1SJE D;  3A8J E;  1QUQ A;  4JI2 Q;  5ELB A;  2EY6 A;  1IBM Q;  4L5T A;  1WD1 A;  2N88 A;  5IYD G;  4LFC L;  2YU9 B;  4C3I B;  4LF5 Q;  5D3I B;  2HHH L;  3X3N A;  1VDZ A;  2Z1C A;  1NR4 A;  1D2B A;  1XNQ L;  4PZ8 A;  3HZX A;  1YNJ D;  2A69 D;  3BG3 A;  1Q86 C;  1FJG Q;  1O80 A;  1SYC A;  4JI8 Q;  5C4J B;  2VQE L;  3A54 A;  1F9S A;  1G2T A;  3K5O A;  5CR3 A;  2ZM6 L;  3ULJ A;  4DV2 L;  4G7O C;  3TP7 A;  1J6Q A;  4XTC S;  3D6C A;  1I94 Q;  4JPB W;  1VQ6 A;  3C2P A;  4FF4 A;  3E9H A;  2ES2 A;  5KIX A;  2IY5 B;  1G8Z D;  3S24 A;  1ESF A;  5CBE E;  2A5H A;  3D0F A;  2E2I B;  3CMA A;  2JA6 G;  2ZTD A;  1MIU A;  1P8L A;  3KLW A;  3E6Z X;  1ICW A;  1MSH A;  3OIQ A;  4A3M G;  1YHQ A;  1K8O A;  4DR2 Q;  4QIW E;  4H0L C;  3J7Y W;  3GTM B;  2JA6 H;  1GHK A;  1BUV T;  3M9B A;  4XQJ A;  4PNY A;  4IFD J;  1TT2 A;  1SMY D;  3PIO 3;  2JA8 G;  3H3V I;  4LF4 Q;  1XYI A;  1W6K A;  1VQM A;  3E5S A;  2LS0 1;  2B39 A;  3ICE A;  2Z4I A;  1JWM D;  1AP0 A;  1TWA B;  1VQJ A;  4OEL B;  5DNF A;  2Z6K C;  3I72 A;  4A3C H;  5ELE A;  3MXN B;  5J22 A;  2B2W A;  4KD4 A;  4IFD I;  1KDA A;  3A7L A;  4PMC A;  4BBS G;  2IT1 A;  1H9S B;  2EVB A;  1R9T H;  1BCP F;  1Y1V H;  3UE1 A;  3J80 c;  2UUA L;  4OON A;  4RMF A;  1U9R A;  4IAL A;  1I4X A;  3I91 A;  2EJF C;  3FDT A;  2B8F A;  2KJX A;  4DUY L;  4A3B B;  2O5I C;  2OQ0 A;  3NBI A;  1TII D;  1N34 L;  2F3I A;  4C3I G;  4DNI A;  1PH1 A;  1GJX A;  3F2B A;  1I94 L;  4UDU C;  3I4N B;  4ZUI A;  3HOV H;  1ASY A;  3CCV A;  3U9S A;  1SE2 A;  5C4J H;  3ND8 A;  1SJH D;  5KRU A;  5IYC G;  3BVZ A;  2L11 A;  1NE3 A;  3E3X A;  3GTG H;  3K5N A;  3FVQ A;  4HCE A;  1NMG A;  1EL0 A;  2DUD A;  1GUG A;  1PTO C;  1X32 A;  1NY4 A;  3A56 A;  4U68 A;  3RUZ A;  5ELF A;  1Z7T A;  4A3F G;  1PMR A;  2R93 G;  1I6V C;  4LF8 Q;  4WRD A;  4BY7 H;  4BS9 A;  5DEH A;  3S17 B;  2D0O A;  1Q7Y C;  3HOW G;  3UE0 A;  1VQ7 A;  4DR6 L;  4A3M B;  1A2U A;  4RGO S;  4DV7 Q;  4LFC Q;  4BXX H;  3BDL A;  3E0J A;  3GO5 A;  4JOI C;  2ZTC A;  4JCV E;  1K3B C;  1CA6 A;  4K2K A;  3F2D A;  1Q8I A;  4K6L A;  1PVO A;  1FJG L;  3HKZ B;  1VQ8 A;  2AQ2 B;  2AUK A;  3T16 A;  4DV2 Q;  1C7Y A;  1V1P B;  2DNC A;  1HXY D;  3K0X A;  3NEN A;  1FNW A;  2XNA C;  3T51 B;  3AMU A;  4ALP A;  1J5E L;  3QB3 A;  1STY A;  3G6J B;  3CRL C;  4UY8 C;  2OTL A;  4A93 H;  3CQZ H;  2K33 A;  5FLX c;  5LL6 S;  2KUM A;  2VY3 A;  3GDE A;  3MXP A;  4DV3 Q;  2LFN A;  4B3M Q;  1E22 A;  2PZT A;  5EBD A;  3DMU A;  1HHV A;  2ZJQ A;  2DJF C;  2GVB A;  3I4O A;  2NYZ D;  2G9D A;  1LV9 A;  1IW7 C;  1KD1 C;  3S2H H;  4ZCK A;  3CD6 A;  4GLX A;  2UXD Q;  4L63 B;  1U4L A;  3BZK A;  5IGC A;  5E4X A;  3J81 c;  2XVS A;  3TEH B;  3NE5 B;  1S5E D;  2SDF A;  3LX0 A;  2B3G A;  3EIV A;  1JOK A;  4RGN A;  2HT1 A;  3W3A A;  4A3G B;  2RA4 A;  5J1Z A;  2NN6 H;  3MEF A;  4JW0 A;  1DOK A;  1RKN A;  3BZD B;  3ERS X;  4FF2 A;  1FD7 D;  1J8I A;  1ONL A;  2R7F A;  3PGZ A;  1DOM A;  2JN4 A;  3I70 A;  1TWH B;  1OXS C;  3VYT A;  2RCN A;  4HR7 B;  3KF6 B;  3RD4 A;  2VQF Q;  3HFZ B;  1EU4 A;  2Y0S B;  1ROD A;  1EWC A;  4KY5 A;  1WTP A;  2JA5 G;  4ULL A;  4B3S Q;  3M4O H;  4JI6 Q;  4X3S A;  2YTX A;  1G51 A;  2V4D A;  4B08 A;  3KLS X;  3HOV G;  1A3V A;  3VA7 A;  2JA7 G;  2JE6 I;  1SYG A;  2K5W A;  4HSV A;  3K80 C;  5HY6 A;  3OWE B;  1ENF A;  1GVP A;  3ER0 A;  1TKW B;  5JJI A;  4L5S A;  3S2D H;  1BDO A;  1MBY A;  5DLQ E;  3J81 j;  4JC0 A;  2JYO A;  1E2V A;  1CFM A;  5BR8 Q;  1JJ2 A;  2L12 A;  4A3D B;  1EY4 A;  4PQX A;  1JR0 D;  2O4X A;  2PNH A;  2F0U A;  1U0L A;  4V0B A;  3J81 i;  5IYC H;  5C5M A;  4UAI A;  3QOL A;  2K32 A;  4LF4 L;  1EWH A;  3PO2 B;  4FNF A;  2EIF A;  1SSO A;  1E24 A;  1E0B A;  2XTI A;  5M3M H;  1VQ4 A;  3H09 A;  1BOS A;  4DV7 L;  1IXR A;  3QO2 A;  5M9O A;  4ZQ3 A;  1HTP A;  2R92 B;  1SYF A;  4R8I A;  1S72 A;  2OXP A;  1PTO B;  3BZC A;  4KKT A;  4MN3 A;  1A3U A;  2F0K A;  4HED A;  2UUA Q;  3CC4 A;  4O42 A;  2NVT B;  3S1M H;  4O2D A;  1TWG B;  1F2M A;  1Y1W B;  5M5X H;  5A2Q E;  3AYH B;  3W1B A;  1SR3 A;  4DV6 Q;  1WOC A;  2FJ2 A;  5BN4 A;  3CCE A;  1I4P A;  4R8N A;  4L5Q A;  1PZK D;  5C4X G;  3K6O A;  3KK7 A;  4A76 A;  2JA6 B;  1FYC A;  2K6A A;  4A3J H;  5GQO A;  4H44 C;  4E6I A;  2Z9H A;  1TS2 A;  1KNE A;  1DZ1 A;  2A73 B;  5I6W A;  4IFD H;  2XSC A;  1EY0 A;  3S1Q B;  4J15 A;  2SNS A;  2AUJ D;  4A3K G;  4Z9C B;  2EYO A;  4K5V A;  3J7A F;  2KEE A;  4UP8 A;  4J1M A;  3KLS A;  3KJO A;  2RHS B;  2WV6 D;  1WTH A;  3S1N B;  1JOO A;  1GOZ A;  1WCM B;  3NTI A;  4RCN A;  1TWH H;  1E1T A;  1VQL A;  3Q6S A;  5ELO A;  1L1O B;  3VR4 A;  3I90 A;  1LTS D;  1PFN A;  2A6E D;  1E1O A;  4RAU C;  3PO2 G;  1CKN B;  1SBB B;  1ZEQ X;  2LXK A;  1IBL L;  5M3M B;  2A6H C;  2UXC Q;  4BBR B;  3RNU A;  1GKH A;  1VQC A;  2QDL A;  2R93 H;  1IHZ A;  2RHQ B;  3MHB A;  1X3P A;  4JV5 Q;  3T4A C;  1SNQ A;  3ULL A;  3I4N H;  5LL6 X;  2LY7 A;  4GNX B;  5ELC A;  4JOI A;  3QJY A;  1Y8P B;  1B44 D;  1TWF B;  1QVG A;  1AH9 A;  1TWG H;  2MGS A;  4IQZ A;  1AE2 A;  1YJ9 A;  3RZD H;  2A8V A;  3MVV A;  3KUP A;  1HPC A;  3WOE A;  4ZK9 B;  3OW7 A;  1HZA A;  4X6A H;  3CRK C;  3C3L A;  2A19 A;  2K52 A;  5C4X B;  1NNX A;  4OWT B;  4V19 0;  2XGT A;  3JC6 6;  4Q5V A;  5EJW A;  2R3Z A;  3SE0 A;  4MIU A;  2NVQ H;  3FPU B;  3D8G A;  4RGT A;  5FO7 B;  1NJI C;  2VZA A;  1EEI D;  3NTK A;  1HUN A;  4DR1 Q;  1E2W A;  2JSO A;  2JA7 H;  3MC0 B;  4HIK A;  1HNX Q;  4CDF C; 
#chains in the Genus database with same CATH homology
 1VQN A;  3GD7 A;  2H5X A;  4YCW A;  4DR3 L;  1PH2 A;  2UU9 L;  4IJH A;  4X62 L;  2PI2 A;  4HJA A;  5LMN Q;  3U58 A;  2BA0 A;  2JJQ A;  1N9W A;  2ZJP A;  4DUZ L;  1VQ5 A;  4LUV A;  5IYD H;  2N78 A;  1G6P A;  4RG1 A;  1A8V A;  5C3E H;  2K5V A;  1WI5 A;  4X65 Q;  4IJL A;  3DLL A;  2ID0 A;  5H1S E;  2ATW A;  5JEA G;  2PMZ E;  2GN5 A;  1SE8 A;  3OTO L;  3CCR A;  2R6G A;  1DGS A;  2VNU D;  1HNW L;  3NBH B;  5C3E G;  3E0E A;  2RF4 A;  1HNZ L;  1A62 A;  3L7Z C;  4DV6 L;  2MO0 A;  3CME A;  3GTJ H;  4HJ5 A;  1I6H H;  2FXQ A;  3GTK H;  1Q8K A;  2OWO A;  3HOY H;  2F4V L;  2B29 A;  4POG A;  1MJC A;  4R4T A;  4GKJ L;  3CXC A;  2LSS A;  4PG3 A;  2ZJR A;  1KAW A;  2R7D A;  2C35 B;  1L2F A;  1VCI A;  5IYB H;  1HZB A;  1N8R C;  3RZO H;  2QA4 A;  3RLF A;  3PUX A;  2KHJ A;  2E8G A;  3CCL A;  4LF9 Q;  1Q12 A;  1QUQ A;  4JI2 Q;  1N33 Q;  3BJU A;  1JJC B;  2Z6K A;  3AFP A;  3ULP A;  4NXN Q;  2R7Z H;  1XMQ Q;  1IBM Q;  4L5T A;  1BKB A;  5IYD G;  1TWF H;  4LFC L;  4GN5 A;  2JA9 A;  2NZH A;  3PUZ A;  3HOX G;  3STB D;  1PH3 A;  4LF5 Q;  2HHH L;  4OX9 Q;  4P71 A;  1C9O A;  1Y14 B;  1XNQ L;  5FLM H;  4JI7 L;  4PZ8 A;  4QL5 A;  2HIX A;  3HOZ G;  3OW2 A;  3RLO A;  2YTV A;  1YI2 A;  3VDY A;  4OWW B;  2AKW B;  3STB C;  1CKN A;  1Q86 C;  1FJG Q;  3CPW A;  1NMF A;  4KHP Q;  4JI8 Q;  4EX5 A;  1CSP A;  1YZ6 A;  2VQE L;  1MJE A;  1HNW Q;  3H0G H;  4AQY Q;  4MZ9 A;  3K81 C;  3CC7 A;  4DV4 L;  2ZM6 L;  4B3S L;  2AMC B;  3ULJ A;  4DV2 L;  4BY1 G;  1I94 Q;  1J6Q A;  4LUZ A;  4XTC S;  4GKJ Q;  3I2Z A;  2E2J H;  2KCT A;  4C3I H;  1VQ6 A;  3G48 A;  2UXB L;  5C0X I;  4DR5 L;  3E9H A;  4PZ6 A;  2MQH A;  5C4X H;  2ES2 A;  4HJ9 A;  1X55 A;  3CC2 A;  1S40 A;  4JI0 Q;  5M5Y H;  1VS0 A;  2IY5 B;  1QZH A;  3S24 A;  3AFQ A;  1IBL Q;  5LMU Q;  3FP9 A;  3D0F A;  3M4P A;  1HH2 P;  3CMA A;  1UWV A;  3KF8 B;  3F2C A;  2I0Q A;  4JI2 L;  2JK8 A;  4NXN L;  2JA6 G;  3S17 H;  1IBM L;  2ZTD A;  1MIU A;  1P8L A;  2MFI A;  1N32 L;  3KLW A;  1HJP A;  1Y1V G;  5AJ3 Q;  4A3M G;  2EXD A;  1YHQ A;  1RL2 A;  1X6O A;  4JBW A;  4QIW E;  4DR2 Q;  3HOZ H;  3OTO Q;  2JA6 H;  2HHH Q;  4R4I A;  4IFD J;  3M9B A;  2E2I H;  1OXT A;  4KI0 A;  1PYS B;  1YEZ A;  4H02 A;  3I4N G;  2JA8 G;  3GTO H;  4XIG S;  3H3V I;  2CKZ B;  2PI2 E;  3PSI A;  4LF4 Q;  3HOU H;  1L1O C;  3J7Z C;  1K3R A;  1T9H A;  4QGU A;  1VQO A;  1YJW A;  1VQM A;  2VQE Q;  3JAM c;  2LXJ A;  3ICE A;  1QUQ B;  4KLK A;  4YWM A;  2AHO B;  4GN4 B;  4R4Q A;  1P16 A;  1VQJ A;  1VQD A;  1PH9 A;  3L2P A;  2K14 A;  2Z6K C;  4LFB Q;  4A3B G;  1FGU A;  2K4K A;  1PFS A;  4APV A;  2QEX A;  1XPR A;  4A3C H;  3MXN B;  4A3I G;  3KDF A;  1K83 H;  3CAM A;  4HJ8 A;  4A3C G;  1WYD A;  4JI1 L;  1VQP A;  4IFD I;  4TVA B;  4A3B H;  5FJ8 H;  4NB3 A;  1KL9 A;  1UE6 A;  1YHB A;  2IT1 A;  2K5N A;  4BBS G;  1R9T H;  1Y1V H;  3UE1 A;  3J80 c;  1HR0 L;  2UUA L;  1D8L A;  1QZG A;  3AEV A;  4OON A;  1EOV A;  4JI7 Q;  4RMF A;  1FVI A;  3CW2 C;  3KYH C;  4YHH L;  1D7Q A;  4JYA Q;  1OXU A;  4DUY L;  4DR1 L;  4KHP L;  2OQ0 A;  2R92 G;  1K9M C;  4AQY L;  2N49 A;  1ASZ A;  2HIV A;  5C0X J;  1N34 L;  1PYB A;  2F3I A;  4DNI A;  1PH1 A;  3KFU A;  1XNR Q;  4R4O A;  3B6Y A;  3F2B A;  1I94 L;  1PV4 A;  1Y1W H;  1UE1 A;  2JQO A;  4C2M H;  1I3Q H;  2CWA A;  4DUZ Q;  3HOV H;  3EN2 A;  4GLV B;  1OXX K;  3HKS A;  4DR7 L;  1BBU A;  4IFD G;  2NVT H;  4B3T Q;  1ASY A;  3CCV A;  2B63 H;  1IBK L;  1XPO A;  4DR4 L;  4X64 L;  4Y52 H;  2VL6 A;  5C4J H;  1EWI A;  2KHI A;  1XPU A;  2N3S A;  2PQA B;  5IYC G;  1NE3 A;  1X3G A;  3GTG H;  3S15 H;  1LTL A;  2NN6 I;  4DK3 C;  1HNZ Q;  1NMG A;  4GKK L;  2I5H A;  4DR2 L;  2DUD A;  1E3P A;  4L5R C;  1UE5 A;  1EIF A;  2JA8 H;  1TXY A;  1XMO L;  2WB1 G;  1NY4 A;  2OTJ A;  4OWX B;  1BVS A;  1EIY B;  4NXM L;  1JE5 A;  3G71 A;  4A3F G;  2R93 G;  1IZ6 A;  4LF8 Q;  2D62 A;  3M7N A;  4BY7 H;  2K5H A;  4LF9 L;  4BA2 I;  4Y7N H;  4DV5 Q;  3I4M H;  2D0O A;  1Q7Y C;  3HOW G;  5M3M G;  1V1Q A;  2EQS A;  3UE0 A;  4DV3 L;  2Z0S A;  4P72 A;  1VQ7 A;  2Q2T A;  2UUB Q;  1NTG A;  4GOP C;  3T1Y Q;  4BY7 G;  4DV7 Q;  4LF7 Q;  2I5L X;  4LFC Q;  2Q2I A;  3CCU A;  3A0J A;  1N36 Q;  4BXX H;  2Y0S E;  1VQG A;  1JT8 A;  2NN6 G;  1XNQ Q;  1EQR A;  2WFW A;  3GO5 A;  4JOI C;  4DAM A;  2ZTC A;  3U4Z A;  2R7Z G;  4JCV E;  3PO3 H;  1EUJ A;  1CUK A;  3F2D A;  2UXD L;  1C0A A;  1PVO A;  2WB1 E;  2OCE A;  4DV0 Q;  1FJG L;  2MO1 A;  4QY7 A;  1VQ9 A;  3F1Z A;  5JJK A;  1CKM A;  3W5O A;  1S3O A;  1VQ8 A;  2ZM6 Q;  4DV2 Q;  1C7Y A;  4GKK Q;  1Z47 A;  4A3F H;  3S14 H;  3K0X A;  3NEN A;  4MNO A;  5M5W H;  1KXL A;  4ALP A;  1J5E L;  1SLJ A;  1JB7 A;  4NXM Q;  4IPH A;  4BBR H;  3HOX H;  5M3F G;  3U4V A;  2ALY B;  3CQZ H;  2OTL A;  1NBW A;  4UY8 C;  1XNR L;  4A93 H;  4X62 Q;  5GAD C;  3T1H L;  5FLX c;  3S16 H;  3HKZ G;  2VUM G;  4DV5 L;  4DR7 Q;  3GDE A;  2VY3 A;  1WFQ A;  4DV3 Q;  2AWO A;  2CWP A;  4B3T L;  4B3M Q;  2VUM H;  1E22 A;  1N32 Q;  4X65 L;  3KOJ A;  2B63 G;  2ZJQ A;  5IWA Q;  2GVB A;  3I4O A;  1FL0 A;  1VQH A;  3AQQ A;  1PH4 A;  3M3Y H;  4JG2 A;  2BA1 A;  1KD1 C;  4FDB A;  3S2H H;  4NPS A;  3CD6 A;  3GTL H;  3RN5 A;  4GLX A;  2UXD Q;  1Q81 C;  4PMW A;  4YWL A;  1PH6 A;  3CCS A;  2WAQ E;  3BZK A;  3UDI A;  3HOY G;  3UDF A;  3J81 c;  2K50 A;  1VQI A;  3CCQ A;  1HZC A;  3TEH B;  4R4C A;  4A75 A;  1U5K A;  3CPF A;  2JA5 H;  2R92 H;  3HKZ E;  4K0K Q;  2B3G A;  5EAY A;  4A3J G;  3EIV A;  1OTC A;  1GD7 A;  3PF4 A;  4LFB L;  4BBR G;  5M3F H;  4IO9 A;  2HT1 A;  2E2H H;  3PO3 G;  3CP0 A;  4LFA Q;  4JI1 Q;  3MEF A;  1YJN A;  3A5U A;  1X9N A;  3ERS X;  3A74 A;  2R7F A;  3PGZ A;  4DPG A;  5LMN L;  2ASB A;  1HR0 Q;  3RN2 A;  5HGQ A;  4KHZ A;  1LYL A;  1OXS C;  2OQK A;  2RCN A;  2WAQ G;  4B3M L;  2IX0 A;  1X54 A;  4A3K H;  3KF6 B;  1VQE A;  2VQF Q;  3HFZ B;  1W3S A;  3PIP A;  2PQA A;  1TWA H;  2HQL A;  3TRE A;  5IWA L;  1QVC A;  2IHF A;  4YY3 L;  2JA5 G;  5C44 G;  1K73 C;  1UE7 A;  5GRO A;  4DV4 Q;  4B3S Q;  3M4O H;  4JI6 Q;  3UDX A;  2YTX A;  2E5L L;  4BXX G;  5IE8 A;  1G51 A;  2N8N A;  3A5Z B;  3UDG A;  4IPC A;  4C3H H;  3HOV G;  3PUW A;  3M85 A;  4AH6 A;  2JA7 G;  1K0R A;  2JE6 I;  5IP7 G;  3HOW H;  1KRT A;  1O7I A;  4DK6 C;  3K80 C;  3E9I A;  4POF A;  4X64 Q;  3GTM H;  4DR6 L;  5HY6 A;  1GVP A;  3ER0 A;  5JJI A;  1XMQ L;  4L5S A;  1X3F A;  4PZ7 A;  1B7Y B;  4HJ7 A;  3S2D H;  4YCU A;  1HR0 W;  5DLQ E;  3J81 j;  4JC0 A;  4IPD A;  5BR8 Q;  1JJ2 A;  4LF6 L;  2UUC L;  3Q8D A;  1XMO Q;  5K36 G;  3RLN A;  2PNH A;  3M4Q A;  1U0L A;  4MTN A;  3J81 i;  5IYC H;  3HOU G;  4WJ3 M;  2VQF L;  4LWC A;  4HIO A;  4HIM A;  4LF4 L;  5C44 H;  2L15 A;  2JEA I;  3G6E A;  3PUV A;  4X66 Q;  3LGJ A;  3H15 A;  2EIF A;  3WWV A;  4P73 A;  4HID A;  1E24 A;  4TQU S;  4GOP B;  2XTI A;  5M3M H;  1VQ4 A;  4JBK A;  4YY3 Q;  5LMN W;  4DV7 L;  4JI5 L;  1VQA A;  1Q82 C;  1IXR A;  4GOP A;  1Y1W G;  1N36 L;  3J7A 5;  5J3B A;  4DAY B;  3PO2 H;  1PH7 A;  3NEM A;  4A3D H;  1A63 A;  4A3I H;  2UXB Q;  5IP9 G;  4DR5 Q;  1S72 A;  1L1O A;  4A4I A;  1EYG A;  2Q2U A;  4JI0 L;  4LNQ A;  5E7N A;  3BZC A;  1M1K C;  4GLA C;  3FKI H;  5LMU L;  1X65 A;  5C0X G;  2UUA Q;  3CC4 A;  1Q46 A;  1PH8 A;  3S1M H;  4JBJ A;  3TS2 A;  4O2D A;  1G29 1;  1YVC A;  4IPG A;  1KQS A;  4UP9 A;  4A3M H;  1PH5 A;  1VQB A;  1YIJ A;  4JYA L;  2KBN A;  3I56 A;  4IOC A;  1K8G A;  4A3L G;  3PF5 A;  2NZO A;  4JI3 Q;  3H0G G;  4JV5 L;  5M5X H;  2GVA A;  3S1Q H;  4R1J A;  3AYH B;  3W1B A;  1SR3 A;  2MNA A;  3D31 A;  3I55 A;  1J5E Q;  2KEN A;  4DV6 Q;  4A3D G;  1PA6 A;  1WOC A;  1HZ9 A;  3CCE A;  4JI6 L;  1SRU A;  4A3L H;  3KDF B;  1H95 A;  4L5Q A;  2E5L Q;  2BH8 A;  5IP7 H;  5C4X G;  4QQB X;  3T1H Q;  4GNX C;  1JMC A;  3I7F A;  2F52 A;  4A76 A;  1I50 H;  1L0W A;  3KJP A;  4A3J H;  5GQO A;  1IBK Q;  1LUZ A;  4DR4 Q;  1VQK A;  3S1N H;  1B8A A;  4OO1 I;  1GO3 E;  1JJG A;  4LW1 A;  5ELN A;  3F8T A;  3SGI A;  3PV0 A;  1SFO H;  3CF5 A;  3GTP H;  1CKO A;  1WCM G;  4A3G G;  1XTD A;  1YHA A;  4J15 A;  5BR8 L;  4UPA A;  4BBS H;  4A3K G;  5FJ8 G;  2UUC Q;  4LF6 Q;  4O0A A;  1OXV A;  1XJV A;  1KRS A;  5FLM G;  1WCM H;  3OYY A;  4UP8 A;  3L0O A;  3KJO A;  2RHS B;  1SRO A;  3RR5 A;  5JEA J;  1Z9F A;  5IT9 c;  2CCZ A;  1B70 B;  1BBW A;  3FHW A;  3S1R H;  1Q1E A;  1VQF A;  1IYJ B;  2Y0S G;  4DR6 Q;  3TS0 A;  1X56 A;  4LFA L;  1TWH H;  2ZTE A;  1E1T A;  3T1Y L;  1VQL A;  2V1C C;  2QGQ A;  4LF7 L;  4OO1 G;  3FKI G;  5ELO A;  4JI4 L;  3H3V H;  1L1O B;  3CCM A;  4YCV A;  1MKH A;  5GAH C;  4DR3 Q;  1K8A C;  3PIO A;  4WJ4 A;  2UU9 Q;  3TRZ A;  4B3R Q;  1V9P A;  1E7Z A;  3PUY A;  4LUO A;  3TQY A;  1E1O A;  3PO2 G;  1CKN B;  2DGY A;  1IL2 A;  2LXK A;  1SMX A;  4DV0 L;  4C3J H;  4P75 A;  1IBL L;  4OXP A;  2D0P A;  2I5M X;  2UXC Q;  3RNU A;  4P74 A;  2AWN A;  1YIT A;  2CQO A;  1GKH A;  1VQC A;  2Q2H A;  2YTY A;  3K8A A;  4DKA C;  5AJ3 L;  4DV1 L;  2R93 H;  3EBE A;  2RHQ B;  1EFW A;  2F4V Q;  1I5F A;  2VS1 A;  4JI3 L;  2YU9 H;  1W2B A;  4JV5 Q;  3ULL A;  4GNX A;  3I4N H;  5IP9 H;  1HNX L;  2YV5 A;  3CCJ A;  4AIM A;  1YBY A;  2VW9 A;  4GNX B;  2NVX H;  4LF8 L;  1Q1B A;  2A1A A;  1KC8 C;  2BH2 A;  4BY1 H;  4JOI A;  4IOA A;  3NEL A;  3W1G A;  1TWC H;  4YWK A;  1QVG A;  3I4M G;  1AH9 A;  1TWG H;  1A0I A;  1KHI A;  2CFM A;  3IRB A;  1AE2 A;  2UUB L;  1YJ9 A;  2YYZ A;  1CSQ A;  3K7A H;  3RZD H;  2A8V A;  3PCO B;  4AYB G;  4JI4 Q;  3K7U C;  4LF5 L;  4OX9 L;  4B3R L;  1HZA A;  1LM0 A;  4X6A H;  1RIP A;  2WP8 J;  2A19 A;  2K52 A;  4A3E H;  4OWT B;  3U50 C;  2XGT A;  3BU2 A;  3JC6 6;  4A3E G;  3KF6 A;  4X66 L;  3DM3 A;  4QJF A;  4A3G H;  1M90 C;  1EQQ A;  1GM5 A;  4JI8 L;  1YNX A;  1V43 A;  1WJJ A;  2IHE A;  3G4S A;  4JBM A;  2KCM A;  5GAG C;  4ME3 A;  1NJI C;  2NVQ H;  2UXC L;  1PHJ A;  2JEB I;  4GS3 A;  4JI5 Q;  2VZA A;  3JAM i;  4K0K L;  1AE3 A;  4UP7 A;  4YHH Q;  3ZJY C;  3J80 i;  4DV1 Q;  4A93 G;  1SN8 A;  4DUY Q;  4DR1 Q;  5JJL A;  1X3E A;  5GAE C;  4EQ5 A;  5IYB G;  1N33 L;  4AYB E;  2JA7 H;  1QVF A;  1KIX A;  4BA1 I;  4GN3 B;  4HIK A;  5IY0 A;  1N34 Q;  1HNX Q;  2NVY H;  2IX1 A;  1UEB A;  2K75 A;  3GTQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...