5AKUA

Crystal structure of tnks2 in complex with 2-(4-tert-butylphenyl)-1,2, 3,4-tetrahydroquinazolin-4-one
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
209
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Potent and Selective Nonplanar Tankyrase Inhibiting Nicotinamide Mimics.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 70
structure length 209
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 5akuA00
4UHGA 4BUEA 4BU7A 4UI6A 3L3LA 3GJWA 4UFUA 5C5QA 4X52A 4BU5A 2RD6A 4HLFA 4MSKA 4L70A 4L31A 5A00A 4UVWA 4F1QA 4N3RA 4TORA 4BU8A 4UW1A 4BUVA 4PNRA 4UI5A 5AKUA 2RCWA 4UVPA 4UVXA 4LI8A 4PNLA 4TK5A 4TJUA 4UI4A 5AL1A 4HHZA 4KRSA 4M7BA 4UNDA 5LXPA 3L3MA 4L6SA 4LI6A 4TOSA 4OA7A 4BJBA 1PAXA 4J21A 1WOKA 1GS0A 4N4VA 4BJCA 4DVIA 5ADRA 3UDDA 3KCZA 4PNQA 4J1ZA 1UK0A 4L7NA 3UH2A 3HKVA 4L09A 4L32A 4UVNA 4I9IA 4BUUA 4L0TA 3C49A 4L7UA 4BS4A 4HKNA 5EBTA 4BUAA 4L0BA 4TKIA 2PAXA 4L2GA 4W5SA 3FHBA 4UVLA 5AL4A 4L7OA 4UVZA 5LX6A 4L7LA 5AEHA 4BFPA 4L2KA 4UFYA 4U6AA 3SMJA 4MSGA 1UK1A 1EFYA 4K4EA 4BUFA 4L2FA 3C4HA 3KR7A 4BU6A 4UI8A 4ZZZA 2PQFA 4L33A 4J3LA 3U9YA 4GV2A 4GV4A 4L7RA 4UI7A 4TVJA 2PAWA 4TK0A 4N4TA 5ECEA 3MHJA 5AL2A 3GEYA 4BUXA 4DQYC 3UA9A 4HLMA 4PJTA 4PNMA 4TKGA 4J22A 4PNNA 4PY4A 4TKFA 4UVOA 5AKWA 5AL3A 4PNTA 4ZZXA 3KR8A 4KZLA 4PAXA 4PMLA 4UVTA 4BU9A 5C5PA 4BJ9A 4HLKA 4HLGA 4F0EA 4UVUA 3SMIA 3W51A 4IUEA 5ETYA 4HYFA 3BLJA 4K4FA 4L34A 2X5YA 4PNSA 2RF5A 4UXBA 4R5WA 4GV0A 4BUSA 4XHUA 4ZZYA 3PAXA 5LYHA 4TJWA 3UH4A 4R6EA 5C5RA 4UVVA 4OQBC 4TJYA 4BUYA 4F1LA 3GOYA 4L6ZA 1A26A 3P0PA 4HKKA 4HMHA 4LI7A 3GN7A 4L0SA 5ADQA 3CE0A 4L0VA 4L0IA 4PJVA 4RV6A 4BUDA 4J3MA 4UVYA 3P0QA 4L10A 5FPGA 4AVWA 4W5IA 4MT9A 4BUTA 4L7PA 4OQAC 5FPFA 4KZQA 3SE2A 4UI3A 4AVUA 4BUIA 3U9HA 5ADTA 4OPXC 3KJDA 4W6EA 4UUHA 4GV7A 4UVSA 4KZUA 4BUWA 4HL5A 4HLHA 4UX4A 5DCZA 5AL5A 5ADSA 3P0NA 4HHYA 3MHKA 4BU3A 4HKIA
chains in the Genus database with same CATH superfamily
4UHGA 4BUEA 4BU7A 4UI6A 3L3LA 3GJWA 4UFUA 5C5QA 1KHEA 4X52A 4R43A 4BU5A 2RD6A 4HLFA 4MSKA 4L70A 4L31A 5A00A 4UVWA 4F1QA 4YW9A 4N3RA 4TORA 4BU8A 4UW1A 4BUVA 4PNRA 4UI5A 5AKUA 2RCWA 4UVPA 4UVXA 4LI8A 4PNLA 4TK5A 4TJUA 4UI4A 5AL1A 5FH3A 2QEWA 4HHZA 4KRSA 1AYLA 5FH4A 3MOHA 1M51A 2RK7A 4M7BA 4UNDA 5LXPA 2QF1A 3L3MA 4L6SA 2RKDA 4LI6A 2FAHA 4BU3A 4OX2A 5C5PA 2RKAA 4TOSA 4YWBA 4OA7A 4BJBA 1PAXA 4J21A 1WOKA 1GS0A 4N4VA 4BJCA 4DVIA 4RCGA 5ADRA 3MOFA 3KCZA 3UDDA 4PNQA 4J1ZA 4ZZXA 1UK0A 1KHGA 4L7NA 3UH2A 1OS1A 4WPUA 3HKVA 1XKVA 4L09A 4L32A 4UVNA 4I9IA 4BUUA 4L0TA 3C49A 4YW8A 4L7UA 4BS4A 4HKNA 2PC9A 5EBTA 4BUAA 1YGGA 4L0BA 4TKIA 2PAXA 4L2GA 4W5SA 3FHBA 4UVLA 5AL4A 5FH0A 1K3DA 4L7OA 4UVZA 5LX6A 4L7LA 5AEHA 4BFPA 4L2KA 4UFYA 4GNLA 4U6AA 3SMJA 4MSGA 1UK1A 1EFYA 4K4EA 4BUFA 4L2FA 2PY7X 3C4HA 3KR7A 4WPTA 4BU6A 4UI8A 4ZZZA 2PQFA 4L33A 4J3LA 3U9YA 3MOEA 4GV2A 4GV4A 4L7RA 4UI7A 4TVJA 5I67A 2PAWA 2OLQA 4TK0A 4YWDA 4N4TA 5ECEA 3MHJA 4WIUA 3GEYA 5AL2A 4BUXA 2RKEA 3DTBA 3UA9A 4DQYC 4HLMA 1J3BA 4PJTA 4PNMA 4TKGA 4J22A 4PNNA 4PY4A 4TKFA 4UVOA 2QF2A 5AKWA 4PNTA 5AL3A 3KR8A 4GNMA 4WL8A 4KZLA 4PAXA 4GNOA 4PMLA 4UVTA 4BU9A 2GMVA 2QEYA 4BJ9A 4HLKA 2QZYA 4HLGA 4F0EA 5FH1A 4UVUA 4GMZA 4GNQA 3SMIA 3W51A 2ZCIA 1KHFA 4IUEA 5ETYA 1KHBA 4HYFA 3BLJA 4K4FA 4L34A 2X5YA 4PNSA 2RF5A 1YTMA 4UXBA 4GMWA 4R5WA 4GV0A 4BUSA 4XHUA 4ZZYA 3PAXA 2PXZX 5LYHA 4TJWA 3UH4A 4GNPA 4R6EA 1II2A 5C5RA 4UVVA 4WOUA 4OQBC 4TJYA 4BUYA 4F1LA 3DT7A 3GOYA 4L6ZA 1A26A 1YVYA 3P0PA 2RK8A 4HKKA 4HMHA 3GN7A 4L0SA 4LI7A 4WIEA 1AQ2A 5ADQA 3CE0A 4L0VA 3DT2A 4L0IA 4PJVA 4RV6A 4J3MA 5FH2A 4BUDA 4UVYA 3P0QA 4L10A 5FPGA 4AVWA 4W5IA 5FH5A 4MT9A 4BUTA 4L7PA 4WPVA 4OQAC 5FPFA 4KZQA 3SE2A 4UI3A 4AVUA 4BUIA 2FAFA 3U9HA 5ADTA 2OLRA 4OPXC 3KJDA 1K3CA 4W6EA 4UUHA 4GV7A 4UVSA 4KZUA 4GMMA 4BUWA 4HL5A 4HLHA 4UX4A 1NHXA 5DCZA 3DT4A 5AL5A 5ADSA 3P0NA 4GMUA 3MHKA 4HHYA 1YLHA 1OENA 4HKIA
chains in the Genus database with same CATH topology
4UHGA 4BUEA 4BU7A 4UI6A 3L3LA 3GJWA 4UFUA 5C5QA 1KHEA 4X52A 4R43A 4BU5A 2RD6A 4HLFA 4MSKA 4L70A 4L31A 5A00A 4UVWA 4F1QA 4YW9A 4N3RA 4TORA 4BU8A 4UW1A 4BUVA 4PNRA 4UI5A 5AKUA 2RCWA 4UVPA 4UVXA 4LI8A 4PNLA 4TK5A 4TJUA 4UI4A 5AL1A 5FH3A 2QEWA 4HHZA 4KRSA 1AYLA 5FH4A 3MOHA 1M51A 2RK7A 4M7BA 4UNDA 5LXPA 2QF1A 3L3MA 4L6SA 2RKDA 4LI6A 2FAHA 4BU3A 4OX2A 5C5PA 2RKAA 4TOSA 4YWBA 4OA7A 4BJBA 1PAXA 4J21A 1WOKA 1GS0A 4N4VA 4BJCA 4DVIA 4RCGA 5ADRA 3MOFA 3KCZA 3UDDA 4PNQA 4J1ZA 4ZZXA 1UK0A 1KHGA 4L7NA 3UH2A 1OS1A 4WPUA 3HKVA 1XKVA 4L09A 4L32A 4UVNA 4I9IA 4BUUA 4L0TA 3C49A 4YW8A 4L7UA 4BS4A 4HKNA 2PC9A 5EBTA 4BUAA 1YGGA 4L0BA 4TKIA 2PAXA 4L2GA 4W5SA 3FHBA 4UVLA 5AL4A 5FH0A 1K3DA 4L7OA 4UVZA 5LX6A 4L7LA 5AEHA 4BFPA 4L2KA 4UFYA 4GNLA 4U6AA 3SMJA 4MSGA 1UK1A 1EFYA 4K4EA 4BUFA 4L2FA 2PY7X 3C4HA 3KR7A 4WPTA 4BU6A 4UI8A 4ZZZA 2PQFA 4L33A 4J3LA 3U9YA 3MOEA 4GV2A 4GV4A 4L7RA 4UI7A 4TVJA 5I67A 2PAWA 2OLQA 4TK0A 4YWDA 4N4TA 5ECEA 3MHJA 4WIUA 3GEYA 5AL2A 4BUXA 2RKEA 3DTBA 3UA9A 4DQYC 4HLMA 1J3BA 4PJTA 4PNMA 4TKGA 4J22A 4PNNA 4PY4A 4TKFA 4UVOA 2QF2A 5AKWA 4PNTA 5AL3A 3KR8A 4GNMA 4WL8A 4KZLA 4PAXA 4GNOA 4PMLA 4UVTA 4BU9A 2GMVA 2QEYA 4BJ9A 4HLKA 2QZYA 4HLGA 4F0EA 5FH1A 4UVUA 4GMZA 4GNQA 3SMIA 3W51A 2ZCIA 1KHFA 4IUEA 5ETYA 1KHBA 4HYFA 3BLJA 4K4FA 4L34A 2X5YA 4PNSA 2RF5A 1YTMA 4UXBA 4GMWA 4R5WA 4GV0A 4BUSA 4XHUA 4ZZYA 3PAXA 2PXZX 5LYHA 4TJWA 3UH4A 4GNPA 4R6EA 1II2A 5C5RA 4UVVA 4WOUA 4OQBC 4TJYA 4BUYA 4F1LA 3DT7A 3GOYA 4L6ZA 1A26A 1YVYA 3P0PA 2RK8A 4HKKA 4HMHA 3GN7A 4L0SA 4LI7A 4WIEA 1AQ2A 5ADQA 3CE0A 4L0VA 3DT2A 4L0IA 4PJVA 4RV6A 4J3MA 5FH2A 4BUDA 4UVYA 3P0QA 4L10A 5FPGA 4AVWA 4W5IA 5FH5A 4MT9A 4BUTA 4L7PA 4WPVA 4OQAC 5FPFA 4KZQA 3SE2A 4UI3A 4AVUA 4BUIA 2FAFA 3U9HA 5ADTA 2OLRA 4OPXC 3KJDA 1K3CA 4W6EA 4UUHA 4GV7A 4UVSA 4KZUA 4GMMA 4BUWA 4HL5A 4HLHA 4UX4A 1NHXA 5DCZA 3DT4A 5AL5A 5ADSA 3P0NA 4GMUA 3MHKA 4HHYA 1YLHA 1OENA 4HKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UHG A;  4BUE A;  4BU7 A;  4UI6 A;  3L3L A;  3GJW A;  4UFU A;  5C5Q A;  4X52 A;  4BU5 A;  2RD6 A;  4HLF A;  4MSK A;  4L70 A;  4L31 A;  5A00 A;  4UVW A;  4F1Q A;  4N3R A;  4TOR A;  4BU8 A;  4UW1 A;  4BUV A;  4PNR A;  4UI5 A;  5AKU A;  2RCW A;  4UVP A;  4UVX A;  4LI8 A;  4PNL A;  4TK5 A;  4TJU A;  4UI4 A;  5AL1 A;  4HHZ A;  4KRS A;  4M7B A;  4UND A;  5LXP A;  3L3M A;  4L6S A;  4LI6 A;  4TOS A;  4OA7 A;  4BJB A;  1PAX A;  4J21 A;  1WOK A;  1GS0 A;  4N4V A;  4BJC A;  4DVI A;  5ADR A;  3UDD A;  3KCZ A;  4PNQ A;  4J1Z A;  1UK0 A;  4L7N A;  3UH2 A;  3HKV A;  4L09 A;  4L32 A;  4UVN A;  4I9I A;  4BUU A;  4L0T A;  3C49 A;  4L7U A;  4BS4 A;  4HKN A;  5EBT A;  4BUA A;  4L0B A;  4TKI A;  2PAX A;  4L2G A;  4W5S A;  3FHB A;  4UVL A;  5AL4 A;  4L7O A;  4UVZ A;  5LX6 A;  4L7L A;  5AEH A;  4BFP A;  4L2K A;  4UFY A;  4U6A A;  3SMJ A;  4MSG A;  1UK1 A;  1EFY A;  4K4E A;  4BUF A;  4L2F A;  3C4H A;  3KR7 A;  4BU6 A;  4UI8 A;  4ZZZ A;  2PQF A;  4L33 A;  4J3L A;  3U9Y A;  4GV2 A;  4GV4 A;  4L7R A;  4UI7 A;  4TVJ A;  2PAW A;  4TK0 A;  4N4T A;  5ECE A;  3MHJ A;  5AL2 A;  3GEY A;  4BUX A;  4DQY C;  3UA9 A;  4HLM A;  4PJT A;  4PNM A;  4TKG A;  4J22 A;  4PNN A;  4PY4 A;  4TKF A;  4UVO A;  5AKW A;  5AL3 A;  4PNT A;  4ZZX A;  3KR8 A;  4KZL A;  4PAX A;  4PML A;  4UVT A;  4BU9 A;  5C5P A;  4BJ9 A;  4HLK A;  4HLG A;  4F0E A;  4UVU A;  3SMI A;  3W51 A;  4IUE A;  5ETY A;  4HYF A;  3BLJ A;  4K4F A;  4L34 A;  2X5Y A;  4PNS A;  2RF5 A;  4UXB A;  4R5W A;  4GV0 A;  4BUS A;  4XHU A;  4ZZY A;  3PAX A;  5LYH A;  4TJW A;  3UH4 A;  4R6E A;  5C5R A;  4UVV A;  4OQB C;  4TJY A;  4BUY A;  4F1L A;  3GOY A;  4L6Z A;  1A26 A;  3P0P A;  4HKK A;  4HMH A;  4LI7 A;  3GN7 A;  4L0S A;  5ADQ A;  3CE0 A;  4L0V A;  4L0I A;  4PJV A;  4RV6 A;  4BUD A;  4J3M A;  4UVY A;  3P0Q A;  4L10 A;  5FPG A;  4AVW A;  4W5I A;  4MT9 A;  4BUT A;  4L7P A;  4OQA C;  5FPF A;  4KZQ A;  3SE2 A;  4UI3 A;  4AVU A;  4BUI A;  3U9H A;  5ADT A;  4OPX C;  3KJD A;  4W6E A;  4UUH A;  4GV7 A;  4UVS A;  4KZU A;  4BUW A;  4HL5 A;  4HLH A;  4UX4 A;  5DCZ A;  5AL5 A;  5ADS A;  3P0N A;  4HHY A;  3MHK A;  4BU3 A;  4HKI A; 
#chains in the Genus database with same CATH topology
 4UHG A;  4BUE A;  4BU7 A;  4UI6 A;  3L3L A;  3GJW A;  4UFU A;  5C5Q A;  1KHE A;  4X52 A;  4R43 A;  4BU5 A;  2RD6 A;  4HLF A;  4MSK A;  4L70 A;  4L31 A;  5A00 A;  4UVW A;  4F1Q A;  4YW9 A;  4N3R A;  4TOR A;  4BU8 A;  4UW1 A;  4BUV A;  4PNR A;  4UI5 A;  5AKU A;  2RCW A;  4UVP A;  4UVX A;  4LI8 A;  4PNL A;  4TK5 A;  4TJU A;  4UI4 A;  5AL1 A;  5FH3 A;  2QEW A;  4HHZ A;  4KRS A;  1AYL A;  5FH4 A;  3MOH A;  1M51 A;  2RK7 A;  4M7B A;  4UND A;  5LXP A;  2QF1 A;  3L3M A;  4L6S A;  2RKD A;  4LI6 A;  2FAH A;  4BU3 A;  4OX2 A;  5C5P A;  2RKA A;  4TOS A;  4YWB A;  4OA7 A;  4BJB A;  1PAX A;  4J21 A;  1WOK A;  1GS0 A;  4N4V A;  4BJC A;  4DVI A;  4RCG A;  5ADR A;  3MOF A;  3KCZ A;  3UDD A;  4PNQ A;  4J1Z A;  4ZZX A;  1UK0 A;  1KHG A;  4L7N A;  3UH2 A;  1OS1 A;  4WPU A;  3HKV A;  1XKV A;  4L09 A;  4L32 A;  4UVN A;  4I9I A;  4BUU A;  4L0T A;  3C49 A;  4YW8 A;  4L7U A;  4BS4 A;  4HKN A;  2PC9 A;  5EBT A;  4BUA A;  1YGG A;  4L0B A;  4TKI A;  2PAX A;  4L2G A;  4W5S A;  3FHB A;  4UVL A;  5AL4 A;  5FH0 A;  1K3D A;  4L7O A;  4UVZ A;  5LX6 A;  4L7L A;  5AEH A;  4BFP A;  4L2K A;  4UFY A;  4GNL A;  4U6A A;  3SMJ A;  4MSG A;  1UK1 A;  1EFY A;  4K4E A;  4BUF A;  4L2F A;  2PY7 X;  3C4H A;  3KR7 A;  4WPT A;  4BU6 A;  4UI8 A;  4ZZZ A;  2PQF A;  4L33 A;  4J3L A;  3U9Y A;  3MOE A;  4GV2 A;  4GV4 A;  4L7R A;  4UI7 A;  4TVJ A;  5I67 A;  2PAW A;  2OLQ A;  4TK0 A;  4YWD A;  4N4T A;  5ECE A;  3MHJ A;  4WIU A;  3GEY A;  5AL2 A;  4BUX A;  2RKE A;  3DTB A;  3UA9 A;  4DQY C;  4HLM A;  1J3B A;  4PJT A;  4PNM A;  4TKG A;  4J22 A;  4PNN A;  4PY4 A;  4TKF A;  4UVO A;  2QF2 A;  5AKW A;  4PNT A;  5AL3 A;  3KR8 A;  4GNM A;  4WL8 A;  4KZL A;  4PAX A;  4GNO A;  4PML A;  4UVT A;  4BU9 A;  2GMV A;  2QEY A;  4BJ9 A;  4HLK A;  2QZY A;  4HLG A;  4F0E A;  5FH1 A;  4UVU A;  4GMZ A;  4GNQ A;  3SMI A;  3W51 A;  2ZCI A;  1KHF A;  4IUE A;  5ETY A;  1KHB A;  4HYF A;  3BLJ A;  4K4F A;  4L34 A;  2X5Y A;  4PNS A;  2RF5 A;  1YTM A;  4UXB A;  4GMW A;  4R5W A;  4GV0 A;  4BUS A;  4XHU A;  4ZZY A;  3PAX A;  2PXZ X;  5LYH A;  4TJW A;  3UH4 A;  4GNP A;  4R6E A;  1II2 A;  5C5R A;  4UVV A;  4WOU A;  4OQB C;  4TJY A;  4BUY A;  4F1L A;  3DT7 A;  3GOY A;  4L6Z A;  1A26 A;  1YVY A;  3P0P A;  2RK8 A;  4HKK A;  4HMH A;  3GN7 A;  4L0S A;  4LI7 A;  4WIE A;  1AQ2 A;  5ADQ A;  3CE0 A;  4L0V A;  3DT2 A;  4L0I A;  4PJV A;  4RV6 A;  4J3M A;  5FH2 A;  4BUD A;  4UVY A;  3P0Q A;  4L10 A;  5FPG A;  4AVW A;  4W5I A;  5FH5 A;  4MT9 A;  4BUT A;  4L7P A;  4WPV A;  4OQA C;  5FPF A;  4KZQ A;  3SE2 A;  4UI3 A;  4AVU A;  4BUI A;  2FAF A;  3U9H A;  5ADT A;  2OLR A;  4OPX C;  3KJD A;  1K3C A;  4W6E A;  4UUH A;  4GV7 A;  4UVS A;  4KZU A;  4GMM A;  4BUW A;  4HL5 A;  4HLH A;  4UX4 A;  1NHX A;  5DCZ A;  3DT4 A;  5AL5 A;  5ADS A;  3P0N A;  4GMU A;  3MHK A;  4HHY A;  1YLH A;  1OEN A;  4HKI A; 
#chains in the Genus database with same CATH homology
 4UHG A;  4BUE A;  4BU7 A;  4UI6 A;  3L3L A;  3GJW A;  4UFU A;  5C5Q A;  1KHE A;  4X52 A;  4R43 A;  4BU5 A;  2RD6 A;  4HLF A;  4MSK A;  4L70 A;  4L31 A;  5A00 A;  4UVW A;  4F1Q A;  4YW9 A;  4N3R A;  4TOR A;  4BU8 A;  4UW1 A;  4BUV A;  4PNR A;  4UI5 A;  5AKU A;  2RCW A;  4UVP A;  4UVX A;  4LI8 A;  4PNL A;  4TK5 A;  4TJU A;  4UI4 A;  5AL1 A;  5FH3 A;  2QEW A;  4HHZ A;  4KRS A;  1AYL A;  5FH4 A;  3MOH A;  1M51 A;  2RK7 A;  4M7B A;  4UND A;  5LXP A;  2QF1 A;  3L3M A;  4L6S A;  2RKD A;  4LI6 A;  2FAH A;  4BU3 A;  4OX2 A;  5C5P A;  2RKA A;  4TOS A;  4YWB A;  4OA7 A;  4BJB A;  1PAX A;  4J21 A;  1WOK A;  1GS0 A;  4N4V A;  4BJC A;  4DVI A;  4RCG A;  5ADR A;  3MOF A;  3KCZ A;  3UDD A;  4PNQ A;  4J1Z A;  4ZZX A;  1UK0 A;  1KHG A;  4L7N A;  3UH2 A;  1OS1 A;  4WPU A;  3HKV A;  1XKV A;  4L09 A;  4L32 A;  4UVN A;  4I9I A;  4BUU A;  4L0T A;  3C49 A;  4YW8 A;  4L7U A;  4BS4 A;  4HKN A;  2PC9 A;  5EBT A;  4BUA A;  1YGG A;  4L0B A;  4TKI A;  2PAX A;  4L2G A;  4W5S A;  3FHB A;  4UVL A;  5AL4 A;  5FH0 A;  1K3D A;  4L7O A;  4UVZ A;  5LX6 A;  4L7L A;  5AEH A;  4BFP A;  4L2K A;  4UFY A;  4GNL A;  4U6A A;  3SMJ A;  4MSG A;  1UK1 A;  1EFY A;  4K4E A;  4BUF A;  4L2F A;  2PY7 X;  3C4H A;  3KR7 A;  4WPT A;  4BU6 A;  4UI8 A;  4ZZZ A;  2PQF A;  4L33 A;  4J3L A;  3U9Y A;  3MOE A;  4GV2 A;  4GV4 A;  4L7R A;  4UI7 A;  4TVJ A;  5I67 A;  2PAW A;  2OLQ A;  4TK0 A;  4YWD A;  4N4T A;  5ECE A;  3MHJ A;  4WIU A;  3GEY A;  5AL2 A;  4BUX A;  2RKE A;  3DTB A;  3UA9 A;  4DQY C;  4HLM A;  1J3B A;  4PJT A;  4PNM A;  4TKG A;  4J22 A;  4PNN A;  4PY4 A;  4TKF A;  4UVO A;  2QF2 A;  5AKW A;  4PNT A;  5AL3 A;  3KR8 A;  4GNM A;  4WL8 A;  4KZL A;  4PAX A;  4GNO A;  4PML A;  4UVT A;  4BU9 A;  2GMV A;  2QEY A;  4BJ9 A;  4HLK A;  2QZY A;  4HLG A;  4F0E A;  5FH1 A;  4UVU A;  4GMZ A;  4GNQ A;  3SMI A;  3W51 A;  2ZCI A;  1KHF A;  4IUE A;  5ETY A;  1KHB A;  4HYF A;  3BLJ A;  4K4F A;  4L34 A;  2X5Y A;  4PNS A;  2RF5 A;  1YTM A;  4UXB A;  4GMW A;  4R5W A;  4GV0 A;  4BUS A;  4XHU A;  4ZZY A;  3PAX A;  2PXZ X;  5LYH A;  4TJW A;  3UH4 A;  4GNP A;  4R6E A;  1II2 A;  5C5R A;  4UVV A;  4WOU A;  4OQB C;  4TJY A;  4BUY A;  4F1L A;  3DT7 A;  3GOY A;  4L6Z A;  1A26 A;  1YVY A;  3P0P A;  2RK8 A;  4HKK A;  4HMH A;  3GN7 A;  4L0S A;  4LI7 A;  4WIE A;  1AQ2 A;  5ADQ A;  3CE0 A;  4L0V A;  3DT2 A;  4L0I A;  4PJV A;  4RV6 A;  4J3M A;  5FH2 A;  4BUD A;  4UVY A;  3P0Q A;  4L10 A;  5FPG A;  4AVW A;  4W5I A;  5FH5 A;  4MT9 A;  4BUT A;  4L7P A;  4WPV A;  4OQA C;  5FPF A;  4KZQ A;  3SE2 A;  4UI3 A;  4AVU A;  4BUI A;  2FAF A;  3U9H A;  5ADT A;  2OLR A;  4OPX C;  3KJD A;  1K3C A;  4W6E A;  4UUH A;  4GV7 A;  4UVS A;  4KZU A;  4GMM A;  4BUW A;  4HL5 A;  4HLH A;  4UX4 A;  1NHX A;  5DCZ A;  3DT4 A;  5AL5 A;  5ADS A;  3P0N A;  4GMU A;  3MHK A;  4HHY A;  1YLH A;  1OEN A;  4HKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...