5ALBH

Ticagrelor antidote candidate medi2452 in complex with ticagrelor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
VQLQESGAEVKKPGSSVRVSCKASGGTFDSYSIHWVRQAPGQGLEWMGGIIPAFGTLSSAQDFQARVTISADKSTSTAYMELSGLRSEDTAVYYCARGSFDYYFWSASHPPNDALAIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterisation of a Specific Antidote for Ticagrelor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MEDI2452 HEAVY CHAIN
total genus 41
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albH01
3IFNH 3TH3T 4GW1A 5E99L 1CFVL 5C9KA 4GG6F 1SEQL 5HPOA 2NY5C 1CXKA 5GJTH 1A7QL 3S37L 1VSCA 4LP5A 4LRNL 4UT7L 1OVZA 1PG7H 4NRYB 3PHQA 4X6CA 4I2XA 3SGEI 4PB9H 4RX4D 4GAYA 3OR6A 3WNPA 3HG1E 1OAXL 1EHLH 2R4RH 1A7QH 3S37H 1QLEH 3L3KA 4PY7A 3DTXA 3ZTNL 2X09A 5I8CB 4MD4A 4J4PC 4LPYA 2XQYK 5DI8A 4ZO6A 4H26A 1ZANH 1AGEB 2O5YH 3MJ6A 1VGKB 2DI8A 5F7DA 1RZKH 3SKJL 4L1DA 1BX2A 4EDWH 3SDYH 3GKWH 4TRPL 4U1GB 3F62A 4I77L 4H1LG 2R4SH 1JPFA 4U3XA 5SWZD 1R5VA 3ARED 4XNMB 5D5MB 3L1OL 3EFFA 1MREL 3C60B 1HH9B 1AO7B 1SYVA 3BP5A 4GXUN 5HJ3A 3RI5K 3VFRB 2VZSA 2XZZA 3CMOH 3GIVB 1FFOB 4JQIH 5MP6H 2B20A 1P2CA 3C2AH 5DMJB 3IFOB 4YC2C 1NH6A 4J6RH 4OJFL 4LLVB 4D94A 5T3ZH 2FX7H 1KENL 5H35A 2J8UB 4OQ1A 1ZLVH 4HPOL 2ZUQC 1EMTH 3SE3C 3RA7H 5BOPA 4RIRB 1MRFL 1T7WA 3DRTA 3FQUB 1IAIM 3PWUB 1NGQH 1A9BA 5C3LD 1V3LA 2NY2D 3AU1B 1B4JL 1HQRA 4XC3H 2YWZA 4YZFE 3OZ9H 4ONHB 3CU1A 4MX7B 5INCA 4FOMA 3N1GC 4QRSB 2V5MA 1A7RL 4WW2F 4RAVB 3T4AA 1F4HA 2VJXA 1ND0B 4IIQC 4UU9A 1OAKL 4M61B 3HUJB 2JJTA 1IAIL 2XNAB 1HILA 4XBEH 4PB0L 3BKML 5J3HC 3H0TB 3D39B 2LAAA 1JUFB 3K1DA 2VLRD 4APQB 4Q6IC 5FO7A 2D0FA 3LRGA 1ZMYA 3GSUB 1VFAB 5I66A 1LO4H 4ERSH 2A6JB 2Y6SC 5K93A 4YXHH 5D71L 3RZCA 1I1AD 2GT9A 3P4OA 5E2TL 1IAII 4C56A 2VDQL 4JPIB 3IF1A 5IB1A 4CMHC 2PYED 5JHLH 1WAAA 1S9XB 3IDGA 3L5XL 3NIGE 4MJIB 5GSRB 5JIHA 3FO2A 4GBXB 4X9FA 2R56L 3MUGB 4KTYA 3AM8A 1A21A 4MD0A 2QQNL 3PUCA 1WICA 3LRSA 4L8BB 4X6DF 3BRGC 1QSEB 3QUXB 3B5HA 3SDXF 2DLFL 4H5SA 4LCWD 1EO8L 4XP5H 3KPPB 1HXYA 3N06B 1KCLA 3MRCA 5CP3H 2JK5A 1WK0A 3O4LB 2EDEA 2XWBB 5CEZH 5I1JH 3LCYA 2MCPH 2YUXA 3WS6A 5HYQB 3ROLB 5HHPA 3DMMC 1NCUA 4OSUL 1JFQH 1UXSA 2ADIB 4Y2DD 1EEYA 2DQEH 3Q3GA 4Y4HC 2CRIA 4JEGB 3MLVH 3TV3L 1MHHA 4L4VD 4PFEA 1MCKA 3WDIA 4KTDL 4M3JA 3A6BH 1E4XH 4MQ7B 5SWSE 4PJ7A 1JFQL 2JF1A 4D0BB 4MNHB 2R8SL 2V2WB 5KW9H 4TUJA 3VXSE 1GGYA 4MJIA 4YIQB 1FSKC 4KTDH 3QCTL 3SKOB 1QBLL 2R0WL 4NGHH 4RISL 3SDCA 5CJ8A 4AH2B 5LGJA 4MJIE 3BESR 2NTFA 1T6VN 1IGIL 5EU5A 4JRXA 1AFVL 3VG0L 3IDXL 2OS7A 5CGTA 5HGBB 4ELME 3FT4B 2EXYD 4F9PA 1IGJA 1KPVA 1RULL 4X80L 1K8DA 1M7DB 3BZ4B 4NQSB 2I9LA 1VCAA 3F12A 1CDHA 3HN3A 4O02H 3ETBF 4FQ1H 5C8JA 2RCSL 2J4WL 1ND0A 5EU4A 3E1F1 4BA8A 1G7IB 4ZFGH 4Z7WB 3MA7A 4P0DA 1VENA 1B6UA 1MVFA 2MNUA 2VDKH 4PP1C 3GJEB 1CICD 3D85B 4JFFA 4OCWH 4X5XA 3GBMH 3T2OA 1W0VB 4U7SA 2P24B 2N7AA 1HHKB 4JZJB 4LVHB 4JG1L 4TOYH 4NNPL 4K3GA 1MHCB 1KC5H 4JFDA 4YDKH 3DXAD 4FG6C 4YXKH 5IT2L 2DMBA 3ULSA 5I8EB 4MCYB 3A6CH 1X5HA 2HN7B 1ZHLB 4YR6A 3PL6B 3HR5B 2FJFA 2I60H 4IS6B 3FB5B 1FGNH 1U58A 1J8HA 2EDNA 1Z3GL 3AS0A 3MNVB 2Q3AA 2ITCB 4GUPA 2XRAL 4MD5A 1CICC 1Q1JL 2H2SC 5IUSA 1UWEH 1EXUB 4U1NB 2LQRA 3QUZA 3CFBA 1NUDA 3X13B 4PP2B 1PEWA 1INQB 1U8MB 3VXQA 3C08H 3U6RB 4ODTL 4NO0A 5AZ2H 4O2CA 4MCYA 3V8CA 1IFHL 3UBXG 1BD2A 3ZE2F 4LPTA 1FPTL 5K9KB 3ZHLA 1G7JA 3QFJB 3L3IA 2E7HA 1H3XA 5FV2A 2J6EL 4U1SA 2IALA 5TDPA 3TYGL 3E0GA 1MAKA 3RWHA 1YEFH 1A6TB 1YN7B 5JDSB 4NCDA 4F7EB 3WEXB 2YEZB 5HGAB 1BECA 5F1IA 3CVIH 3QXDA 1PLGL 4GAJH 2BRRL 4JDTH 4X6CB 1FL3A 3ARFC 3VFTB 1R5WA 3KS0J 1GHFH 4Z7UF 5DD0L 5I9QC 5J4MA 3MRGB 3RPKA 3RY5A 5D1QB 3RUGA 1X9QA 3RY4A 5GHWL 4PJXE 3EKCA 3IXTB 3IU4H 2ZZUT 4WUKH 1E6OL 4OT1L 3BGAA 5DRZA 1NC2D 2C3XA 1Z9MA 3QUYB 4DVBB 5KSAB 1A1OB 4YO0A 4EI5D 1K2DB 1Q9KA 2BY0A 4KY1H 1MHEB 2VITA 3NCBB 5T5NF 5IF0A 5C70A 1LO2H 5ICXA 1T83C 2HFFB 2QV2A 4C59B 3CFKA 1QSFE 1SJEA 3HPJA 1AO7E 1OB1B 3C8DA 5DGRA 4NN5B 2HFEA 3SJVD 2ZSVA 4D9LH 4F80A 3VXTB 5CP3A 1RU9H 4FQLL 3U7YH 3UTSE 2AEPH 3QUZB 1HE7A 4ZNEA 3SE4C 1TZHB 1WISA 4M7JH 2CDEB 4FZEL 3U1SL 2Z35B 3KNBB 4NQXA 3FFDB 2HT3C 2EC9U 3GIZH 3RGVA 4FQXA 1CFSA 1T0MA 4HT1H 3RWFA 1FAIH 5D1QA 1OL0A 4G8GB 3MRPB 1QVOB 4H8WH 5DEGA 5CEXA 2H32B 3TO2A 1UZ6F 3OKNB 3HZMB 4QTIL 3KPRE 1C5CL 2R0ZL 3GIZL 4JAMB 4MJ5B 5CKAA 3KPPA 1S9WB 3G5YA 2IANE 1BBJA 1RD6A 3DVFA 3E6HB 5AG8A 1WWBX 3I2CH 1GOHA 4OGXL 2BNQA 5GSRA 4ONFL 1AGCB 5GGSA 1OW0A 3VGFA 3EZJB 3Q6FA 3GGWA 5CWSA 5HVGB 1IGIH 3G9VA 3RRQA 4OZFH 3P0YH 5TGBA 3NACH 3RUGB 3O3AA 1WCBA 3RL1B 1ZVSA 4UUJB 3HNVH 4MXQC 1OW0C 3VD3A 1SY6H 5TH2A 1KFAH 5HDQH 4NN6C 4UNUA 2A74A 4NN7B 1W72A 3QA3A 3IDYC 3MMEB 4HK3J 2BRQA 1Q9WA 1JMXA 1U8IB 4LSSH 2UZXB 2O5ZH 1OF2A 1UM4L 2UY7A 1KGCE 5TPWL 4PD4K 5LGKA 3GSNB 4GW5A 3LY6A 3ARXA 3LEVL 5F7FA 4RWYH 3BWAB 4J23A 3R8BB 4PJ8C 3RGVC 3SDCB 3SQOL 4WO4B 5E94B 5J1AA 2J8HA 4OGAC 1PBYA 3NGBC 1L7TL 4MB5A 2D03L 3VRLF 5HHOA 5E6ZA 5HHQA 5TE4L 2QHLA 1SVCP 4CJ0A 1DFBL 2HT2C 1FNFA 5ENWA 1KG0B 3TIDA 4OD2A 4DOHE 3KYKH 5D5ME 5FKAA 5TF1H 4PRBB 1BLNB 1QTYT 4N90D 4YBLB 5IG7B 5HVWA 4PR5B 4HGWA 1FGNL 2ARWA 5TE4H 4JJ5B 2QBWA 3TO4A 2CRMA 1CQYA 2O26U 2R1YB 1UACL 5F3HB 1X5XA 2X10A 1EAPA 1S7SB 3MRJA 4NQUA 4JFFB 4PRHE 3BZEB 3PWLB 2PCPB 3JV6A 4U05A 1YQVL 5JW3L 2JLLA 5D6DA 3VRLE 2EDXA 3BEWA 1TQCB 3QEHB 3AS1A 1A7BA 1RJLB 4L4TA 4CMMB 1LK2B 4Y16B 4FQHB 1DQLH 1SHMA 1YEIH 3QDMB 4GQ9L 4JFDB 4XNMA 5D5MA 5BJTA 1NCAL 1AHWA 5KZCB 1S9VA 3O9WC 4FTVE 4JR9H 3PP3H 3FN9A 3LRSB 3VGGA 3TYGH 4QRRE 4J3SA 3B4NA 2C7UB 3LSOA 3QNZA 3RIAF 2ZCHL 1CGTA 2DWEA 2ZWLT 4K7PH 5LBSH 3T2QA 2E3VA 4C56B 2XTJE 4PIRF 3B2UD 3KGRA 2A6JA 2KZ1B 4LEOA 4FXKA 4QXGL 3I6LD 1L9NA 5F8QC 4ZPVB 1I1FA 1ORQB 3PWNA 4WEBL 3RU8H 4X9HA 3MLTB 1AP2A 1FORH 4PS4H 3KHOA 5D2LA 4OLVH 3WN5C 1W72H 4PG9B 5A43C 4ORZC 4OGZA 3VXPB 8FABA 3IJYA 1CT8B 2Q76A 5DD5H 1S8DA 5IV2B 5EUKB 3HAEH 5DRXB 2XWJA 2V2TB 2G75A 3O6FC 3L3OA 1I7RA 2NY3B 3S37X 2HT3D 4LCYB 2EDLA 2YD9A 1UB6B 1SJHA 1T2JA 3TT1L 1S7RB 4G7VL 3QIUC 1IAKB 3SDXA 2F53E 1I1AC 1I4FB 3OXRA 1DEEA 1CLZL 1QFHA 1DVFB 3DV4A 3C60A 2IADA 3QXWA 3RKDC 1FV1B 4QXUH 3KAAA 1UT9A 3QUXA 1YY9D 3BPCA 2NZ9C 3P9LB 2PYEB 4HS6B 5FK9B 2NXYB 4KK8D 4LLVA 3QPQD 1OM3H 1BIIA 1AY1L 4BQBA 4HS6A 3ZYJA 5DEFB 2FB4L 3FO1B 4OGYL 1JHKL 4L8SA 4HIIA 3MNZB 4OQTL 4PTUB 5C08A 4LKXB 3QH3A 3LIZH 2I5YH 5IB2A 5FGCE 1ONQB 4J3UA 5HJ3B 2HKFH 3VFRA 2ICEA 4CBPA 1JJUA 2F53A 4E5XA 2BC4B 4LSVL 5SWSB 1MJUL 2ED8A 3MREB 1CL7H 4HXAH 4GMSL 1ADQL 4XPAH 5GGVH 4X4XA 4PYGA 1TVBA 4LHUA 1F11B 1GGIH 3HPLA 4Q9CA 1Q9WB 5B38A 3BT2L 4QHKJ 1KJ2A 3WL9A 2XKSA 3IYLW 3P0GB 1B0RA 4I9WE 2VDNL 1F97A 3OKDA 3MLRH 1GGIL 4S0TD 1I3UA 2AXGA 1ETZB 1Y6MR 5CWSB 5IHZA 4KI5F 2E6PA 3VXPA 1WLHA 4PJFE 2BDNH 4NQVB 2ARJB 2EEDA 3UC0H 4MS8D 5IESH 3Q48A 4ELMB 2YZ8A 4XRCB 2DBLH 3QG7H 2B7DT 4W70A 3ZT6A 2BHYA 1CE6B 1ZHBA 2J7LA 3P77B 1SMOA 4ZS6C 3NPZB 3B3IB 2A77L 2DIAA 3OKKA 5GS0D 4Y16A 2FECI 4AEHL 5C0ND 5ILTH 4Q9RH 1T5WA 3WJLA 4IJ3B 4NBXB 3QH3B 1GXEA 1INDL 2YXFA 1KELH 3LKRB 2AXHA 4PV8A 2Z31C 4FQJH 5DVMA 1R3IL 3GBLA 2VLRB 4APQD 3V6OE 3E6FB 1PKQB 3RWJA 5HY9B 2YPVL 4KI5E 2B1AL 3NIDE 4P2RD 4OFIA 3K8LA 2E9WA 1QA9B 1NEZA 3QXAA 4GRMB 4M7LL 4UTBL 4WW2C 3E2HB 3UMTA 1ZA3B 1JN6A 4GXUM 2HFEB 1LVEA 4X83A 5D1XC 5GISL 4EIGB 5J11C 3VFGH 3X11A 1CFNB 4NNXB 5C0DA 4C4KO 4YH6A 4YAQB 1SJHB 3GDBA 4AIXA 4UTBH 4DN3H 3D25B 2EDHA 4KUZH 4U6YB 4LSUL 1Q8MA 5BO1H 2GTWA 3QDMD 4YHPB 4KJYA 3ZL4H 1EHNA 1QNZL 4HIHB 1S7XA 4G6MH 5KG9A 4EOWL 5DLMH 3CD4A 1U8KB 4IOSD 1SYVB 4HUNB 3IGAA 1ORSA 4U1MB 1QRNE 3PV6A 1DQLL 1YEIL 1JGDA 1OF2B 3CFJB 4X9BA 5D93B 4KV5E 4NKMB 5HHVL 2XN9D 4X98B 4KROB 1YMMA 2CLRA 4M00A 1RZIB 1FL3B 5GQBA 5DO2D 3SN6N 1RUAL 3MJ9H 3TNMA 4C57C 2HT2D 2Y4SA 1XF4B 1PYWB 4M1GL 3QHZL 3FL7A 4UT6H 2VDLH 4L3EA 5E24E 4QCIA 4PJEF 1S7WA 3IRPX 3B9VA 3NFPA 4TULL 1CIUA 4XNYH 3B9KA 2DWDB 1RJLA 5GRXG 4CMMA 1FVDB 2BVQA 4NQEE 1FNGA 3WN5A 2FH8A 2DLTA 3U46B 5TDNB 2GITA 3W5NA 4MA1B 1S7TA 1N7MH 5L2JA 3WO4B 4N68A 4FFWC 1XGQA 2PW2B 1UKTA 2IAMB 5E8EA 3QUZD 3IJSA 4ZOBA 3HAEB 3CFIC 4LFHD 2OL3B 4KU1A 3IU3A 3C9NA 2W0FB 3MCLL 4LARH 3RVVD 5B39A 5JORB 3L3JA 2D7OA 4U33A 4HGWB 4RAHA 5CP7B 3VWJA 1AD0B 5JIPA 1QG3A 4IDJH 3EOAA 3HI1A 4LKCA 4N9GA 1AXSB 1YJDH 2JJVA 2PNDA 4LQFH 5DMYA 2UZYB 4XB8A 3P4LA 4BKLB 5EIQA 5EWIH 4OIIH 1UH2A 4X8XA 5T1LA 2XT1B 4DQOL 1JZ3A 3IFPB 4DGIL 5DYOB 4YHIB 3ZTJG 3QQ4B 3D5OF 5FUOL 1JGUH 2MFNA 1Y0LA 4PTTA 3LIZL 5DRXA 2CLVB 2XQBL 3ULUH 2R0KL 5ACZA 4H88L 1P7KA 4W4OA 5DS8B 4YE4H 4OCXH 2NY7L 2B1HL 3IETB 3VXRD 5TDNA 1VADA 2YA2A 3MA7B 4BZYA 1I9RL 2DQCL 4WI6A 3LPFA 1E4KC 3TBSA 1XFPA 2QADC 1JGLH 2H6PA 4V2BA 4XP1H 1Q72H 1NGWB 4LEXH 3ARGA 2IANA 4KHTH 2D4DA 2OJEB 2OMNA 5FYKL 1P1ZA 5EA0H 1FNLA 1KLUB 3HI5H 1HHIA 5DD1L 1S3KL 4XMKL 1ZA6B 3C8KB 1NUFA 3TM6A 4K3DL 1FYTA 4HUXB 4KPHL 3HNTH 4KRPB 4G6AD 3O2WH 4I3SH 3VD7A 3TC9A 1FYHB 5INDA 4Q9RL 5L9DH 2XZQL 2H26B 2CMRL 1KV3A 3T09A 2B39A 4XPFH 4JREC 1RMFH 4ZUVB 3HC4L 5DTFB 1NGYB 4N0UA 1OCWL 1YEGH 5J11B 4GKSA 3FFDA 1U3HB 2IEPA 4NO3B 5I2IA 4QYOB 1N5AA 4XCEA 5E2VL 1FL6B 1Q9LA 3TT3H 5IGXL 4NN5C 1VKXB 1OTTD 4WHTA 1ZANL 3IDMA 5LAXA 1ZGLM 3C8HA 1RK1B 4PLJD 3RL2A 3DO7B 3NCYP 4TNVF 2BSSA 1E4KA 4OLXH 1T5XA 5TF0A 5A2KH 2EDJA 3SE8L 2H3NA 4I77H 2EXWD 2IAMC 3BP7A 4KQ4L 1INEH 3NA4A 5JA9A 4TTDC 3I6LE 3B9KB 5A3IC 1NDMB 2H2PD 5JQ6H 2FD6L 5DSCA 2ZJSH 4IHOA 2XTJC 2CRYA 3JVGA 3DI2B 4QNPF 3ZYIA 2GSIA 1EJOH 3CAFA 6FABL 2EXWC 2IAMD 4GO6B 1VGEL 4ODBD 1XF4A 2DDQH 5FO9B 3CGTA 3BFOA 2G60H 3U36A 1BPVA 5GGUB 5KOMC 3BO8B 4LNRA 1F4XH 1ACYL 3WNOA 3O6FA 2XZAH 4FTVB 1JPTL 3NFPB 3MYJB 2FJGB 3WFHA 4DAGH 1AJ7L 5C09D 1MCJA 4W6YB 5KBNC 3DX9A 2ARJA 4XAKD 5GSVA 4LPCA 4FFWD 1MCOL 3M45A 1A1MB 2WWMC 1PYWA 4JGUA 1KJMB 3FONB 4HIHA 1AJ7H 3SGJA 5JUEH 4OLYL 1P9MA 4JM4H 1TTGA 4P9HH 1OAKH 3UTPE 2K7QA 3MFFB 2PXYC 4OI7A 2AEQL 2CJUL 1A3QA 1KPVB 3ZZ1A 4IOIB 2R2EA 4OCMC 4XNUL 1TNMA 2PR4L 1CU4H 3BIAX 4OCSH 2P8LB 4PJIA 1LDSA 1X5KA 2D9QB 3S3PA 2WQ8A 5JDJA 4IRSA 2Y7QA 4M93C 2AERT 5E2WL 4AL8L 4XVJL 5LGHL 3ULVH 5CMAB 1CI5A 4NM8H 5M95B 1UXSB 3RVTD 3CUPB 3UZEA 2ZUVA 3SJVE 4LRIC 3UTSA 2P43B 3IFOA 2Z91B 5KSVB 1I8LC 1Y18B 4ZNEE 4R0LA 1UH4A 3SCMB 1FFRA 4Y4KA 1MFDH 4MA8L 3EOAB 3HI1B 4I18C 3BKJH 1PSKL 3TVMD 4NKDB 4ZTPL 5K9OA 2DRUA 1ZS8A 5DQDL 2GJ6E 3VRIA 1OOAA 3EJZD 2B0SH 3S36L 2FEDD 4TSCL 3MLXL 4K7FB 2KQNA 4OD3H 5CZVL 1ZVYA 1A3LH 2F5BL 2FR4B 5I9QB 1YQ2A 5EIVA 2W38A 4P3DA 1B0RB 4P2OB 4ORGA 5GGQL 3MRIB 1HSAB 4YK4C 1BVZA 1HHJA 3GJFA 1U2HA 3FB7B 3BSZH 3GJFB 1WBZA 3QIUB 3CC5A 3NTCH 4MJID 2PF6A 4P2RE 1GJIA 3PWPD 4YDVA 5EBLA 4X7DC 1XF3A 3RDTB 4NFDA 2Y5TA 3ZKXC 4X7EC 3MYZA 3EYVA 5I1GL 1HHHA 3DV6A 4JO4L 3MOAL 5CSZB 4L8SB 1ITBB 4ZXBD 2HG5A 2ORBL 1L9MA 4M8QA 4I3SL 3QDME 1ZGLB 3MBED 5E6IC 2DQTH 2PKDA 5L9DL 4X9GA 3LMJH 4RQQB 1A2YA 1JHTA 4Z7VB 2VZVA 4YDJB 5DQJB 3AXLA 3LN4B 3T0DA 5J6HA 4JGMA 2A1WH 5DJDA 2EKSA 2OYPA 3VFVA 3MLYH 5GGRY 3OAUL 1CXFA 4Y4KB 4PB0H 4M5ZH 2JIXD 4KK9D 3K4AA 5C6TL 2DMCA 2IPTL 1GC1L 3C5SB 3L3HA 3AS2A 4XPHH 4OI9A 1OP5H 2JKXA 1M1SA 4ODSL 2QHRL 1MWAA 4CN4A 3VW3H 4WRLA 3GRWA 4JJ5A 4LPVA 3TVMB 1S8DB 3DWTA 1L7IH 5MEOA 3SDCC 4PJ9B 2PO6D 2VISA 4K94C 2QHRH 4YDKL 5KJRH 1MIEL 1NAKH 3UJIH 2OK0H 4Q2ZB 1YYLH 4ZOAA 3VE0B 2X4QB 2Z8WC 5BV7H 1IM3B 1TNNA 3S4SA 3GMLA 4GG6B 2Y07H 1KPUA 2YC1B 2A38A 4QRQA 2OK0L 4MXQD 4OCYL 1FVEA 3IRZA 3L3DB 2H32H 4JQXA 1JI2A 1QBML 4PJBB 2I07B 3BP5B 1Z5LB 3PQYD 5J6HB 1SMAA 1CIDA 2HWZH 2VR5A 5GJSH 3PWPB 3EO9H 5F6HJ 4X4ZA 2XTJD 5C0BE 2L7UA 4TQEH 1L0YA 3RY6C 1KOAA 1OP3H 4QXWA 2ZG2A 4QRRA 1XR8A 5AUMB 4OF6A 1JRHH 3QEHA 4EN3D 1NCBL 4ZPTB 4M9OA 2MCPL 2RAMA 1A6ZA 3O41B 4GG8A 4P9HL 2LABA 1OAZL 5MEQA 1GOFA 3AREC 1A6VH 3CH8A 4E0RB 4FFZL 1VERA 2V5SA 5IB3B 5K9JL 3VXNA 4LVNC 4YZFF 4D0BA 3G5YB 4JDTL 4XVUC 3C09B 4G9FA 1E4WH 4MZ3A 2ZKHH 4PRBA 1LK2A 3T0AA 4XGZA 5JIKA 5JPNB 4F3FB 1CFVH 1KG0A 3KJ4B 1YJDC 4LSTH 3WFEL 4MAYD 3LKNB 4HG4K 4JFOB 2ZNWA 4N5EC 1ZEAL 3HFMH 5LVEA 1NC2A 1JWSB 4U31A 4OFVA 4XPBL 4UINL 4KRPC 4PJFB 2BVOB 4KJQD 4DZ8A 4OF5A 4G9DA 3HC0B 3OKLB 4P57B 4DKFH 3HFML 3HG1A 3VXUE 4AY0A 4LSQL 1M71B 4OLZL 5TFSH 1HHGA 5BW7C 4JO2H 5DK2B 3I6KA 3TIDB 1CICA 3ARRA 4XAWH 3SGJC 4Z7QE 4PRHA 1NGXB 3PDOA 4D9LL 4LK4A 1BEYH 3RL2B 3DO7A 3G9AB 3S9DB 2BSTB 1BVKA 3N0PB 4MXWH 5BVPL 2WW8A 2L7JA 1T2XA 4I48A 1HHKA 1JMZA 3KPRD 2X9YA 1VFAA 5DTFA 3QUMA 2IAND 2J2ZA 3PWJA 3QI9D 1F6AB 3BKYL 1E28B 1HSAA 1U3YA 1I85A 3KPTA 3MLZL 3LKSB 3FRUA 4LIQE 1UGNA 1TITA 3C5ZC 4H20L 3RL1A 4F15B 2E7CA 2H8PA 4JO3L 1EZVX 3OWEA 1P5UA 3JVGC 2A9ML 1A1MA 4JQVC 1CDGA 3ZKND 3OJMB 3E3QC 4JN1L 5IJKA 4HHAA 3IDNA 1DJSA 3V6BR 5DC9B 4M62L 4XBPA 4XVTH 4G8EB 5E03A 2VL5A 5JLZA 3H7LA 3STBA 2LU3A 3QDJB 1KGCD 3LMJL 4KJPC 1SY6L 2R1XA 3KPNB 2OTUA 4N0FA 2J12B 1J05B 2V5YA 1UVQA 5T1LB 3TBSB 2D31A 3TO2B 5HGGS 3MLYL 4OLUL 4PJGA 2P5EA 3CXDL 2ZUQB 4I5BA 3GMRA 2AGJH 5KANG 1HINH 3MRJB 4QNPE 5EORL 3PJSA 1T2QL 4Y16C 4KV5F 1A1OA 4N0YH 4HPYH 4YWGL 1TQCC 2K1MA 3D2UB 1A7OH 3SHSA 5EUOE 1NLBL 1T2QH 2CIKB 2D03H 1YY8A 4PJIB 2F8XC 32C2B 2AVGA 4HWEH 5J06A 2N4IA 4YWGH 1MNUL 1AQKH 5E70A 4JZNA 5IBUG 1HWHB 3TYFB 4YFLF 3RTQB 1T4KB 4YUEL 1A7NH 4W6WB 1NBVH 3Q6GL 5DD0H 1FRGL 5F7DB 1IT9H 1KNOA 3W0WD 5IB4B 2DLHA 1KJVB 4DZBA 3QUML 5DRWB 4ZUUA 1HSBB 4GRWF 2F19H 3O8XB 3DSNA 3MRFB 2GTZB 5EOTA 3REVA 3KPQA 4JB9H 5CEYB 4GBXA 5E1HB 3V6ZB 1H3TA 2YWYA 2DLEA 2EH7H 5DJZB 3B2VL 5E4EB 4OGAD 4ZXBC 1N8ZA 1BQUA 1J8HE 4P49A 1C08A 1FFPB 5HD8C 4NBYB 4GBXC 1YEDB 4YDLB 4OBSA 5CHNB 1YMME 4I13B 3FT4A 4JQVA 5EZOL 2EO9A 1H3WM 5ITBL 1J5OH 3Q6FB 2YEZA 3BVNA 2GHWB 3WLWD 4F57L 3A6BL 1E4XL 4NN7C 5GZOD 1HN1A 4P4KD 2GJ6D 1WAAE 3CXHJ 4NQED 2E7LA 2AJYH 5SV3A 2UWEF 4WV1C 3L3GA 2X1PA 5HHNA 5KVEL 4GUPB 4M48L 3DMMB 3MJ7B 2FEEL 1FNEB 5INCB 1A47A 3O11B 2VLJD 4G8IB 5C0CE 3PWVA 3C6SB 5IVXB 1CGYA 5EIIB 1IRAY 1LP9B 4QRTB 4KMTL 1JPGA 4HSQA 3DHJA 2QSTA 2GYSA 4NO5A 5K59E 4P5KB 1A02N 5I1CL 3K0WA 4WHTB 3IDXH 1S7XB 3FZUC 1RULH 5E5MB 1W0VA 4PJFA 4LSQH 4WJ5B 4BH7A 1KJ2H 2WMPA 4AENA 4PJXF 1A3RH 5IMKA 3HPJB 3RKPA 1F4WL 2VZTA 3ESUF 3SOBH 1T5WB 2VDKL 1M7IA 1LNUB 2QKIA 1A0QH 2AK1L 4N0FB 2ICWB 4Q6YA 2I9LB 1QSZA 1BEYL 5CBEB 2C26A 1N2RA 3PQYB 3ULVF 1A6WL 3I3EA 1KTLA 4F37F 4KRNA 2H2SD 1IILE 1K9TA 4UOJA 4J3TA 4POZD 5EFIA 4PJBE 3VI4F 3SKJH 1F6LL 4JLRB 2WUCL 4XNZC 3VFMB 2IANB 1QFUH 4U1HB 5I71B 1WZKA 3RDTA 1S7VA 2V5RA 5GZND 1Q0YL 4TSBL 4CN1A 1BREA 3CX5K 5H8DA 2X44D 4NSKB 3GMQB 3FHQA 5HDLA 3MUY1 1ADQH 4XPAL 1DFBH 3OF6A 4GOSA 3NIFF 4NP4H 4JRYB 1YY9C 2AJUH 5TF1L 3QIWD 4JN1H 5F88A 4ODVH 1UJ3A 2D7TL 1XF5B 1ZWIA 2DKUA 4LQ1A 1FE8L 4KJPD 1EEYB 2DQUL 3LOWA 3ZO0A 1YUHB 4PRNB 1ED3B 2XA8L 4MA7L 2HYMA 5FM4A 3BHBA 1MCRA 3EDJA 3TH2T 1RZ8B 5EUOB 2ZUSA 3C5JA 4NQEA 3ARSA 5CD3A 2O5XL 4I0KA 4A6YB 5SWZA 1ZT7B 3SPVA 5C9JB 1XCTB 3U6RA 4YNYA 1NKRA 1ZHKB 3PQYE 2OM5A 1EH9A 3LQZA 1ORSB 3P4MB 1MCCA 1SVZA 4O2FB 3CDYA 5DJCB 2E7MA 5CEZD 4NUGH 1YDPB 1KLGB 4GAJL 5CINH 1OGAD 4UAOB 2FJHA 3DURA 3T3PF 1P69B 2BVOA 2Z8RA 1NCCH 3SKNA 4CAGA 2O93L 1OGTB 2BNRD 1OAYL 3SKNB 3H9SE 4LHUG 3IF1B 3C5SA 4HWEL 3BP4B 1NBZA 2HN7A 3FMGL 4XXDA 5CINL 1Z0MA 4JKPL 1MLCB 1G6RB 1FQ9C 5KSBA 2X7LB 4PJHF 3EYFA 1VEMA 2A6IA 3MV8B 1ZHKA 4ERSL 1RUQH 3P11H 1VDGA 3WIHA 1CGXA 1UCBH 4HUVB 1IGFH 3AC0A 5EO1B 2DD8H 1QSFB 3CFEB 1QRND 2Z4QA 4PG2C 1BX2B 4FA8A 4FG6D 1RUMH 2H45A 4XT1C 4LEOB 3DHMA 3Q1SH 3MNWA 1CGSL 1CBVL 5ESAA 3IFLL 5BOZG 1KJ3L 2X1OA 3FOLA 2DLFH 4Z7OF 3NAAH 2DQDH 3EDFA 4MJ4A 3FRUB 4PBVC 4X98A 5FA3B 4LIQH 4U6TA 4U6HB 3QUYC 2A83B 2X4OA 4P23D 3O3EA 4X4MA 4KK9C 3H0TA 1QLRB 3KLSA 5IHUH 1BFOA 2FYYB 3S34H 4HLZH 4JM2D 3EFDL 3UTPD 1V7NL 5C08D 4C54A 1EVTC 3EYUL 2FRGP 2HRPH 2BVPB 5F1OB 3RFZC 4CDGC 2GAZA 5CILH 3FO1A 5JXEC 1KEMH 4J3WA 3BDYH 1FZKA 2VDOH 4XP6H 4J3XA 3RX7A 2OP4L 1U95B 1HKLL 2Z0BA 4Z0BH 4OQTH 3LKPB 1YDPA 1LEIB 2NY1B 4Q2ZA 3RDTD 4KKAC 1AE6H 1I1AA 4FABH 1NC4B 4YC2B 2AXFB 2WK2A 2A2QT 4HD9A 3ZDZF 3LHPH 2B5IB 3OKLA 3HKFA 4OZFA 4AEIL 3DRQA 2IG2L 4U7KA 1LDPH 3E2HC 1TETH 4DJMA 4F7PB 5IWLC 5IROA 3WLBA 2PTTB 3QI9A 5HYQA 3VFNA 2AKRB 5EU7C 4XVSH 3LPWA 4JFOA 1T1WA 5E5MA 5GRYA 3IDMB 4YK4B 5LAXB 3EOBA 4PRNA 3WIIL 3ZDYE 8CGTA 4YBLC 1YEEH 5BMFL 1FV1A 1DUYA 3UC0L 1HOCB 4HS3B 5DVKA 1ULVA 1NJ9B 2HJKB 3IDIA 3MRBA 1M7XA 3CLFL 3P3YA 5BRZD 1EHAA 4OCLC 1ES0B 4ZPVA 2PTVA 4OZIE 1U95A 2OX5A 1D6VL 1TZGL 1BOGA 3MACL 5IHZB 4YHZL 3QPXL 3FOLB 4EVNB 4KRMB 1K8IB 1G7MA 5IFJA 4YDIH 1FYTB 1OGAB 5J56B 2VC2L 1MOEA 1QFPA 3O9WA 1D6VH 1TZGH 5EBLB 4O5LH 2C3WA 4UIKL 1NAMH 2LTQC 1CDUA 2YBRA 3F58H 1P84J 3MRLA 3PDDA 1MFCH 2YPVH 1AGDA 2X4SA 5DUPL 4EJ1C 3TBVA 3QIWB 4UDTB 1IM9D 4UV7L 1DP0A 1NAML 2ICEB 3ROOA 1JZ8A 2YSSA 5AAWA 1ZVSB 4J4PA 1U8OB 3UJTL 3KYMB 1KIRB 1N8ZB 3GMMB 3PWLA 4AM0A 1WCQA 4QO1A 3ULUE 5F3HA 2O5XH 1D3CA 1J1PL 3BH8A 3PE9A 1QNZH 3W0WE 3DURB 3CSBA 1X44A 4ZUUB 3UJTH 4YHLL 5CGMA 1RUAH 3T0EE 2C4XA 1AXTL 4NFBA 1XGTA 2YK1L 4JCLA 3QQ9C 1JCKA 3TPUA 3B8YA 1HDMB 2MSPA 4L4TB 3B9KD 1FIEA 3RUGE 1RV6X 1DQML 3W2DL 2JJSA 3THMH 4WO4D 4JFZH 1JE6A 2W65A 4XNYL 4MAUL 5DHVA 3G08A 1YMMD 1G0DA 2I9TA 3FN0L 2FSEA 1BMGA 2HTLC 4XCYA 3GSNL 1OSPL 2EKSB 1JYWA 3Q5OA 5K9QI 2GK2A 3VJ6B 4OLXL 4NKIH 4Z76A 3L7FA 3OB0K 2WLYA 3QO0B 3WFBL 5AYQA 5H94B 3BOVA 1H3VA 1NL0L 4CU6A 4DTGL 1T21A 3KJ6L 4PRDA 3TVMC 2IBZY 1GIGH 2BCKA 3MRQA 5JQ6L 1UYWL 1C5DB 1YJDL 3G6JE 3D0LA 1S5HB 1U8JA 3GSOB 4QCIB 4DTGH 5C0BD 1MQKH 1REIA 3JV5A 4S1RL 2EIDA 2PW1A 3G6DL 3BVNB 3GEWB 1YN7A 1WZMA 4PJEE 3BKCL 1KN2H 1WWWX 2YR3A 4Y1AB 5F6IB 1C8PA 1HZHL 4LASL 3FQXA 3WFHB 4ZO7A 4UDUA 1G6VK 3K4ZA 3ES6A 4RGMC 5C0BA 2EDWA 1W72B 2NR6D 4PGDA 1NSNL 1T4KA 3U79A 4RGOL 3U7YL 1QR1B 1YEHL 1MEXL 4GJTB 2XKNB 1J0KA 2R2BB 3O0RH 4JFFD 4NRZA 4O9HL 4HKXB 4AEEA 2LTQB 4Z76B 4OZHF 4S1SL 3U2SA 4P46A 4PLOB 1T66C 1MUJA 2CDEA 4Z0BL 3MV9E 3TIEB 5ICZB 4Q6IB 4FNLH 4R2GB 5E1AB 4O4YL 1VEPA 1WBXB 2NQCA 4YHPA 4WDIB 4H88H 2YPKA 2MQCA 3MA9L 5D7LB 3BT2H 1KYOK 3VFPB 2H32A 4JZNB 2QJDA 2H3NB 1PX4A 1WIUA 5CZKA 4EUPA 2Y06H 3VXUD 3MXVL 3T2NH 4PP1D 3INUL 5E2UL 4NM8L 3WIIH 2XZQH 3DUSB 3ULVE 2Y06L 3BWAA 5C2BH 3E6FA 3H8NA 2FLBT 1RMFL 2BY2A 2DQGH 1QLFB 5DD1H 3NABH 1KBGL 2VSDA 3GB7A 3D85A 3GJEA 5F7EL 5C0RH 3S5LB 1F02I 1I3RB 3H9ZA 3WUWA 2IH1A 5CHNA 1KIQB 1H8OA 3MRGA 1QQDA 1T89A 1Q94B 3S98A 3VFWA 3NFSL 2DQGL 5B3JF 5DZLA 4NJAL 5GRJH 1P7QD 3KWWB 3KXFB 3V0VB 1R3KA 3KPSD 1GYAA 1KB5B 1ZA6A 3C6LB 3C8KA 1YNKH 3VXSB 3X12A 1RFDL 4J12A 3MLXH 3MRNA 5GSVB 3F6IA 3E8UH 1Q0XL 1IM9B 2OZ4L 1QFOA 3DNKA 1IVLA 3WUZA 1B0WA 3IXAB 1D5MB 2D9CA 4OUUB 4CNIA 4HGMA 4KROC 3TEUA 3W81A 2GK0B 1DBBH 4P4RB 5I1DB 5I75B 2VXVL 4UV7H 3F12B 5BO1L 2AAVA 4C83B 2NX5E 1PG7W 1VGEH 2V2WA 2DDQL 1CICB 1SM3L 1NMCB 4JPVH 4OUOA 4NO2B 2CIKA 2EDKA 5E8OB 1D9KB 3U4BL 5F6HI 2ADIA 5LGJB 1WBYB 5E9DA 2FO4B 4G5ZH 4WWID 6FABH 1MFNA 1BQHG 1AXTH 5SX4H 3QFJA 4G6FD 4OZFG 4P4KA 3P9LA 5C0AB 3GMOB 2IQ9L 5IB5B 1IEBB 1LEKB 5J9PA 3QO0A 2Y6SD 3QO1B 4JM4L 4WI8A 1KCSH 3OKEB 5I8KH 4QKXB 1KB5H 4L3EE 4NBZB 2CJUH 5HY9A 4K2UL 2MQ0A 4PLKD 3SY0A 4HCRL 2C1OB 1SJXA 1UFUA 3HAEA 4HK0B 2AV1A 1G9NL 1MWAL 5KTEL 2R0LL 3WFCL 4KMQA 1IAIH 5D1ZB 1I7RB 4H25A 5E2WH 1X4YA 3P40A 3TA3A 3I75B 2GAZB 4KMLB 3OPZL 3TJEH 1RIVL 1IQWH 4J1UB 2GSGA 3RJDA 4B5EA 1YECL 4XXCC 2XOTA 5L2KA 3EAKA 2OTUB 1FNSH 3TPUB 3VFTA 3RJQB 5FYLH 4HWUA 1TXKA 2Z31A 3HE6D 4HIXL 5ANME 2EEBA 4G8FB 2XNAA 5CJQL 1CFQA 4NT6B 5ID0A 4BZ1H 1ZLWK 5MEQB 4N0RA 1A6TA 4PJAE 2Y07L 3P9MA 4ZFZA 1MFBL 3QNYB 1HXMA 4IRSD 5DZOA 1P84K 1HHHB 3OR7B 1I3VA 1V3MA 2V9TA 3MROA 3ARBD 4OKDA 1DQTA 3H42H 1XR8B 4APQC 1BQHA 1RZKL 5D7LE 1HYRC 5I1LB 4NFCA 1WBZB 4PJCE 2AQ1A 1VFOA 3UAJD 1I3RA 3UO1L 3WSQH 5C1MB 5D9SA 3T4YB 4Y2DA 4GXVH 1DUYB 3UTQB 4HDIB 4FXGA 4X0KA 1P4BL 5SWSD 3PG2A 4S1QL 2YD5A 3VFOA 4WTXA 4XP9L 2XY1A 2EH8L 5I71C 3SDAD 2I5YL 1D7FA 3VFSB 1FO0H 4LSVH 3QWOA 2AJXH 1MCWW 4PJCF 5CZVH 4ZS6D 2A9NL 2FJFB 3EJYC 3L5IA 3NIGF 1IGYB 2HTKC 4KGJA 3O2VL 4BQ6A 2YA0A 3VRIB 1WFOA 3RPIA 3V4PH 1U0QA 3DIFB 3SKMB 1J1XL 4I4WB 4TNWK 2IADB 1T20B 5DJAB 4XZUA 4ENEC 4RMVA 4XX1E 3EOTH 1I1AB 5EU3A 4L3CA 3WJLC 3MLWH 3D6GA 4JCMA 3GM0A 4ZDHB 3GUTA 2UY6A 5DFVD 3VXMB 3MJ8B 2EYRA 2VO5A 1X5GA 4HKXA 1FZKB 5GRZA 5IESL 5IM7B 3QG6B 1A6ZB 5TQ0H 5E99H 1SEQH 2VIRB 1YPZF 2MWCA 2P5WD 2DTML 5E9DB 5M7QA 4KJQC 4XXCA 4WWKA 1ZT1B 4PGDB 5I8CA 3UTQA 4HW6A 5DEZA 1YEGL 4OLZH 3BISA 2X4UB 4PJGE 1WIOA 1QSEA 1FIGL 1SY6A 1JHLL 5E2VH 2DAVA 4EQ3A 3IS1X 3T0ED 1EO7A 4M6OL 1FG9C 2G2RB 3L5HA 5DJXA 3S5LG 3DXAE 3MBEA 3MV8D 4N5ED 1DQJB 3GZKA 2ZG1A 5E8DH 1DBMH 5L8LB 3OAUH 3CDFA 4PJBA 5E6IA 3C87A 1D5IH 5FV1L 3U30C 3OKDB 5TGBB 3QFJE 5E6IB 4Q9QH 1H8SA 1U3HC 4S11A 1IM9A 2AJSL 4ZQKA 4I0CC 5HYSG 5FOJA 5EOCL 3VW3L 1MQ8A 5MI0B 3S88H 3CFEA 1CFQB 5GRUH 1F11A 1A9BB 4MNHA 1BBJB 1N64H 1QKZH 3PHQB 3O6FB 4RRPA 3AREB 4HIEB 2BZDA 4KUZL 4N1CA 5DQ9B 4CADB 5EZJB 3DXAA 4HQQH 3G04B 2IGFH 3MCKB 2BMKB 2GTWB 1ZHNB 3C60C 2AKRA 4M6ML 1K5NB 4ZTOH 1I75A 4Z0XB 4RAUB 4XHQA 3BD3A 3AFLA 1TZIA 3CDGB 1OARH 5AZ2L 2X1QA 1P6FA 4Z77A 4PLNC 4EN3A 1CFTB 4GRMA 5C92A 2DS4A 1R5VB 1GGTA 1XGTB 5J9PB 4WO4C 2WAHA 1CDIA 4MD0B 3D48R 4PGCB 1F58L 3IKCB 4OLYH 4XC3L 1NGPH 2VLRA 2VITB 1YEFL 2XFXA 3G6AA 3KG5A 2NY6C 2KBGA 1RQ5A 3ZE1F 4H26B 5C7XH 2E8ZA 4JFQB 3UCRA 2QR0B 5FEBA 1RIVH 2Y5TB 3QYCA 4WEUD 1MF2H 2Q76B 2BNUB 4L8CB 4AIZA 3V5HA 3SO3C 4GKSB 4YDVB 5IVZA 3TBVB 4HWNA 1XCQA 4FFZH 5ISZB 3CSGA 2F54E 3VDBA 2VXTL 2BNRB 3MJGX 4RDQG 4HKJB 2QADD 4U6HA 4YQXL 2NY4B 3O3BB 3TNNA 4JO2L 1J8HD 3IXAA 4OM1H 1L6XA 3JTSB 1QZ1A 1HWGB 2APBA 2P4AB 4D9RE 5ECJE 4HUMB 2IH3A 4L1HA 4ONHA 4M5YH 3NCEB 4L29B 2OXHA 3GBML 4M4RA 1GCFA 1QO3B 5EO1A 4Y89A 5IR1A 1GGBH 4GAYB 1P5VA 3ULVD 3KWWA 4BFBD 3BI9X 2APFA 4JG0L 4NSKA 1RZKC 4Y16D 5T5NG 2VNCA 1ERNA 1ZAGA 1ZLWH 4ZFOB 1P4BH 1F3RB 3TCLB 1A6PA 3UDWC 5CEZL 3VFMA 5TJWK 4JG0H 1HIMH 4NRXB 3BZEA 2OXGA 4X5WA 3QCVL 4P59H 2VLJE 5D1XB 5C0CD 4XCNA 4K7FA 3VJ6A 3ILPB 4Y4HD 2UZIH 4LP4A 3DARA 4MYWB 3U4AA 1TMCB 4PRIA 1YEJL 4OF7A 3V6OC 1H0DA 1T0NB 4KH2A 5F9OH 1J1XH 2ICWA 2YPLB 1NMBL 4TNVK 1CD1B 5ALCH 4XC1L 3CNKA 1N6QH 4MNGA 2OR8A 4BSJA 5CGYC 2AQ3A 3WKML 5L7XH 2Z91A 2V17H 4GKZA 5I1DA 1NMBH 3MLUL 4WI3A 2V9RA 5EUOF 3KPSB 4XMKH 4LLQA 1IC4H 3MRRB 4JZOA 3OTTA 5BRZE 5L8KB 4JRWA 1EERB 1KYOJ 3BH9A 3ZYOA 1TCRA 1T83A 5EORH 3FOMB 4XVTL 2P8LA 4DCQB 3ORJA 1VFBB 3BYYA 3HA0A 2VZ1A 5E0QA 4UILL 5IMOB 4G80B 1MIMH 4DKEH 2BXZA 4U6VH 4WVRA 4LAJH 2KKQA 2GK0A 4P4RA 4DW2H 5C71A 3TZVD 1U3HD 1NFDB 4CN6A 3OSKA 1DCLA 5KAQG 5F7YC 3OR7A 2G5RA 2ITDB 5HVFB 1AGDB 1FZOA 5BZWA 1KF9B 1MIML 5F1IB 2AGJL 1L7IL 5DJZA 4R7NA 2D0HA 4P9HC 4N90E 5KS9A 3G6JF 4KK6D 2KDGA 4YDLC 2NTFB 4Q0XH 2CK2A 1SQ2N 1N3NA 3ARFA 2HKHL 1QKZL 3I3DA 4EVNA 2H6PB 5K9KA 4WI7A 3B5TA 1FFNA 2EH7L 3O45A 5GZNC 4Y5XA 3OKYA 5CEXB 3WIFB 2QSCL 3VI4E 4MAYC 2ZP0T 1VB9A 2ZOLB 2DLGA 5CZXC 3W82A 2W60B 3MBXL 4OFYD 1UACH 4J8RA 2Q7YB 1RU9L 4FQLH 2APTA 1FGVL 1OPGH 1QSVA 1UB5A 3MNVA 4Z8FL 5DF0A 2ED7A 3DX7A 3KJ4C 1PKQE 3V8OA 1I8MB 1AXIB 4KKBC 3RTQA 1JF1B 3EHBC 1E27A 5CEZE 3C6LC 5CLTA 3SO3B 3X3FL 1N59B 4RNRB 5AWNH 2BNRE 5B39G 1AD0A 5F1NB 5F21B 3UTTB 4RX4A 4TTDD 5B22A 4MQXD 1SYSB 5D7SH 1U8LA 1H0DB 3OV6A 1N3NB 1DQQB 5LBSL 2H9GB 1WBYA 1SEBA 3CDCA 3S3SA 3R06B 2JCCE 4NOBA 3VXUB 3SDDD 2KZWA 3WS3A 3AMKA 4ETYA 1XMWA 1TJHL 5KANI 3UZVB 3KPLB 3PXHA 1UWGL 2ESVB 2A6KB 2H8PB 3TLRA 3MV7B 1NGWA 3STZB 5D7IA 1KIUA 2YRZA 3RVUC 4KKBD 3K1KC 4PJEA 1G1CA 3H7BA 4I1NB 5EU7E 3RGHA 3MRMB 1MFAH 5L2KE 3QJFA 2R23B 1AGFA 2X5PA 5I1EH 3ARFB 1O7VA 2YUWA 4IRSC 2VABB 1HILB 5I15H 4ZYKA 5CKGA 2VLJA 5TPWH 5C0FA 2OCFD 3CX2A 5JQHC 1Z9OA 4JHWL 2VR9A 3FTGA 1G84A 3UYPA 4ZFGL 5IFAL 1IMHC 1RUKH 4OZHB 4JFFE 5J89A 1Y6KR 5DUBB 1KPUB 2YC1A 3AVEA 4JANA 5EBMB 2RFXB 2AI0L 4MLSA 5C08E 4X7FC 2WWKT 2Z92A 5DJ2A 3HE7A 2CKBA 4E41B 4JFXB 3BUYA 2XACC 5H94A 3JTTB 4ODUA 32C2A 4YHML 1A0QL 5F70A 2XN9B 4RGMB 1JWMA 1KCRH 4YXKL 5IT2H 1EXUA 4U1NA 4NZRL 4QHLA 2P8PA 1IGML 1RUPL 2JCCB 2BSRB 1N6VA 2OL3A 1TENA 5ANMA 2VDRH 2DQIH 4GFTB 1KXTB 2EDYA 2RIKA 3QEUA 4NKOA 4HJJL 4I9WD 4CVXA 5KVMC 1EZVY 4HWZA 3LV3B 4HT1L 4MAYB 5ALCL 1TPXB 1MAMH 5ESVA 1FNGB 2XG4A 3QFJD 5DQ9A 1Q0YH 3B6SB 3BD5A 3NH7L 2EDQA 3LHPL 3GFUA 3DMMA 2ZPKL 3AB0C 4PJ7E 3D3VA 4NQCE 5F71A 2FBOJ 1UM5H 1P6AB 2V2XA 2GEEA 3X3GH 2ICCA 4JY6A 3PABB 5JOFA 1FPTH 5JHDD 2BY1A 1AKJB 1Y6NR 3L3OB 4JE4B 4DWHA 4RFNB 3JWOC 4HIJB 1CGWA 2UUDK 2IBBA 2YSSB 3RI5F 3DI3B 1EFXB 4HZAA 4QGTA 1BOGB 4K94H 3FFCE 2R9HC 4FFVC 5A2FA 1FC1A 3MV01 1BFSA 5B8CA 4OTXL 1B4RA 4APQA 1RZ7L 3CSPA 1CK0L 5IBTH 4NM4L 1D5BB 5ADPL 3HE6C 4KI5D 4P2OC 3N1PC 4E0RA 3I84A 1BAFL 2NXYD 1E4JA 4L29A 4Z7VE 3BQUC 4WWKD 4LLDA 4PJ7F 3SDXE 2Z31D 2BK8A 3HE6A 3MRFA 1C1EL 5ADPH 1URLA 4PJXA 4ZO9A 5I1KH 4HIIB 2YXMA 4TNWF 1NEZG 4XH2B 4BSWA 4QRQB 5C0NC 5D8JH 2XFXB 1OT1A 3WLBB 3KVQA 2C7UA 3ET9F 3QNZB 4PRHB 4HF5L 4JM2B 3V9FA 5E2TH 3NVQA 1QRNA 4BK5A 2R69H 2VAJA 3SKUD 1UA6H 3MBXH 1T20A 5DJAA 4AMKH 1MHHB 3ULUD 3L5XH 2X4RB 3SCMC 3VGBA 3EGSB 3HG1B 2QKIB 3CDGA 1DZBA 2F54D 1DANT 2J8UA 1OPGL 2M1KA 2I9TB 3OKOB 2DLIA 3RZCD 1S7RA 4X6DA 4JDVB 1IAMA 1U8PA 1YZZA 5IHUL 3ARDB 1GZQB 2J88H 4PREB 3BGFC 2Q7NA 3EFDH 3HR5A 2BMKA 4WFHD 3SDAA 4GLRI 1JHKH 1UM6H 2LU4A 2IPUG 3VFOB 1DTUA 4L9LC 3VWKD 2DQDL 3MRCB 4UQ2B 4Y0GA 5AYUL 3B3IA 4JFYA 1HXYB 2E8YA 3JV4A 4PRPA 1MHCA 1MLBB 3STLA 4OSUH 1HH6A 3QEQD 2CXGA 1DL7L 2R2EB 4U1GC 3T65A 4X4YB 4G8EA 4A6YA 4LCCB 4U3CA 3SE9H 5AYUH 1JZ7A 1C5CH 4ZFOL 4ZQKB 5MEPB 3AAZA 5HI5D 1S5IH 1RURH 1ETZA 2J6EA 5F93C 4QOKE 1A6AB 4KGLA 4HK3N 4PJCA 5EZLA 3HR6A 1MI5B 3NCMA 8FABB 4LLDB 4X7SL 1K85A 1UJ3B 5D7JB 4YFDB 4XVSL 4ZUTA 4QY8A 1CVSC 2VE6B 3MRLB 2ATKB 1MVUA 2A0LC 5IVOA 4EXPX 1LO5B 4HV8A 1BVLA 1A9EB 5FKPA 2HG5B 4Y8AA 1G6RA 1MLCA 5L0QB 1NMAH 4J1UA 1IEAA 2QQKH 1V3JA 5IB2B 5ISZE 1C08B 1WZ1H 5E4EC 4LVOC 2G9HB 2BOCB 4ZXBB 3QCUH 4QTHA 4GW1B 4L5FH 3U0PB 1CLYH 2AV1B 5IBLD 2J4WH 2GJJA 3TP4A 3VE0A 1TVBB 3O8XA 1EIBA 2LVCA 2DYPB 4Y19A 3GHEH 3EHBD 3BQUB 5IB4A 3SQOH 1C12A 1DVFD 4M7LH 4ODWB 1H15A 4R96A 1JL8A 2HTLD 1EK3A 3VXRE 4NWUL 3UROR 2VIRA 1NCDL 1CXHA 2UVEA 4PJAB 5BV7C 4Z0XA 2FIKB 3UTSB 3PHOA 3QIWC 4LSUH 4X8JB 3O6MH 1RJZA 5ANMB 1HK6A 3SY0B 2VTFA 4NP4L 4JREB 5ITFB 2AK4B 3W39B 4Y4FB 1TQBB 3FQWB 3L1OH 3MLZH 4NO5B 4ODXB 4HFWB 1C12B 1CL7L 2ED9A 4HXAL 5JHDB 5JW4M 1Q72L 1MFCL 2NZ9D 2XA3A 4PJHB 4ZG1A 1ZGLA 2KPNA 3X17A 2XPGA 5CAYB 2F15A 1I9IH 4GS7B 4GG8B 3H9YA 4ODTH 3MLRL 3AGVA 2GJ6A 4A6YH 2FIRT 1KPRA 5AEAA 5I75C 4ZFZB 1ZT4A 1BVLB 5E00A 1NBQA 1X6NA 3CX5J 1MRFH 3ILQC 5CLWA 4ZFFA 5TQ2L 5C09B 5KS9B 4MAUH 3MV8E 1T03L 1NGQL 3KPSE 1KB5A 4NM4H 4MVBC 2MPAH 2XICA 3R1GL 3WXWH 1AGFB 2AW2A 1X5IA 3BPOC 3RWCB 1NFDE 4AEHH 4PV9A 2NY3C 4TPRL 1OP3K 3OKNA 5TH2B 5EZLB 2FZ3A 4NJAH 1QQDB 5GRJL 3Q5TA 3SDDB 4G8GA 1NANI 2K3TA 2ZNXA 3U7WH 2BRRH 2AJVL 5I74B 1EBPA 4FQJL 1AC0A 4GRWE 3C09C 4RFOH 3VG9C 3K81A 3GI8L 2NX5D 2MJWA 1T1ZA 3DUSA 5T1DH 3X14A 2WQRA 1J87A 4K07A 3HZKB 3CMGA 3WNKA 5C3TA 3IU4L 4OAWB 1E6OH 5ACLA 3K2UH 3SKMA 3DGGB 5ICYA 4LCIL 5FUZH 4ISVA 3IKKA 1ZGLP 1WSST 4WI2A 3V79C 5EN2A 3W0WB 3W9EB 2A6KA 3CSYA 4MB4A 4QHMA 3UTZA 5T3ZE 5F9WB 4AENB 4D0CA 1U92B 4JPWL 4K23L 3OGCB 2JCCF 5IEHA 4RGOH 3WD5H 5I1AB 1Q9KB 2WINA 3MXWL 5IW1A 3H9SA 3CK0H 1FL6A 1Q9LB 5FUOH 4WUUD 15C8L 1OD7A 5C09E 3V5KA 5FGRA 1ROWA 3CU7A 4ZUWA 4PJ5E 5C0CA 4FHBD 1U58B 3G6DH 4HFUH 4LL9A 4XAKE 3ULUL 5ETUA 4CW1B 4K71B 1OP5K 1MJJA 3MV11 4Z7WE 1OB1A 3CK0L 4U1JB 1DN0B 5DK0B 2IWGA 4FNLL 5EN2B 5HHQB 3CXHK 1GZPB 1IKNC 4JANB 4M7KH 3PHSA 1N0LA 1RZJL 4WNQB 3MROB 5IW6B 4R9HA 4JN2A 5GGVL 3O0RL 3LB6C 3DPBA 3QUYA 2FHCA 3TIEA 3QIBA 4MWFA 1EBAA 3BPNB 1ZLSH 2VDLL 5AD0A 5F9JA 3NCJL 3OJVC 1DBAL 5B3JE 4G8FA 4KUCD 1T0PB 1F90H 4NWTL 2PR4H 5KW9L 1WTLA 4D9RD 2HT4C 1FFNB 3O45B 3RHWK 1QBLH 2EE9A 3PNWA 4OD1H 3STZA 3Q5YA 3BP6A 1BM3H 5EH1A 4QRPA 3VXRB 4JVPA 3N9GH 5D2NC 5DR5L 2VOTA 2AP2A 3IETA 3NA9L 5LG1A 3DSFL 3RWEB 1T6WA 1YEEL 5CJQH 4Q58C 1Q9OB 2VDPL 4TVPD 4P2CG 4RMRA 1OD9A 1BM3L 4D8PB 3I3BA 4S0SD 2Y5EA 3WHXA 3RTQD 4OZHE 1QEWB 3ARGB 3ALWA 4NKQB 3V7AG 1U92A 1HCVA 3IAQA 4KAQH 5EO0A 3MACH 5T1MB 3ZTNH 4EUPB 1KIPB 5C07A 3ARFD 2VLLA 3K8KA 4KVCH 4Y4FC 5ESVB 2OI9B 3DETC 4CU7A 3MOBH 1XZ0A 5F8RC 3T1FB 1CLOH 3QDGD 4P3CL 1NGZB 3Q0HA 3GKWL 1GSMA 4AEFA 1E4XI 5DWUH 1VACA 3OKMB 1UC6A 3IFPA 4LSRL 4MD5B 4MZ2A 4KHXL 1IL1A 3CFCH 2R0KH 1WTGT 1XGQB 3LQAH 5JPMA 5JW5B 3FQRB 1RZFH 5IMMB 2W60A 5E8PB 4NRZB 4OV5B 4OCXL 3QXVA 3V7AE 1FC2D 1MCPL 3CMOL 2VLLB 4HBCH 4CADA 2G60L 4KHXH 1DBBL 3NN8B 4YLQT 3SBWA 2DWDA 2XKUA 5KVFL 1Q1JH 25C8H 1QEWA 1WITA 1U6AL 1FJ1B 4LLMA 3FB6B 4A6YL 4HUWA 5I16B 3KLDA 3DVGB 1KSRA 2PW2A 3EUUA 4FFYH 4X5XB 3O9WB 43C9A 1AR2A 1FHGA 2MMXA 1DLFH 1MCOH 4JR9L 3FHAA 3GSOA 1PZ5B 2MPAL 1CXEA 3FAXA 2D0GA 3HNTL 5F9DC 5IEKB 4J3OC 4KDWA 5FYKU 4F2MB 3PDOB 2KUTA 4Z7OE 2ZUYA 5F7NC 1DLFL 4WFHE 5DFVC 2EIZB 3REWB 1VADB 4UDUB 4U1JA 1UEYA 3FB7A 3D3VD 3TN0D 5LXGH 4M6OH 4KTEH 2EC8A 3MRKB 5IVXE 4HS3A 4XMLH 1OWRM 4P23A 3VRJB 2MKLC 1OCWH 2HLAA 3LQMA 4R90H 3RWHB 2FSEB 4I48B 2ZG3A 4PG2A 4FP8H 2Z8VC 3BKMH 3G08B 5LXGL 4UIMA 4QRSA 3KPRB 1CDYA 5F1NA 3UTTA 1GHFL 3K2UL 4TUJB 2BNRA 4F7PA 1ZHLA 3O6KL 4YR6B 2VLME 3PGDA 2LFGA 2JJWA 1MFDL 3GO1L 4K3JH 3VG9B 4G43B 1GAFH 1RUML 3DX7B 2MKWA 2AK4D 4MCZB 1BZ7A 1L0XA 1VESA 3U9UB 2BNUA 2BOBB 1A4JA 3O6KH 5KN5A 3MV9B 3ARQA 2EYTB 4FMFA 4LCWB 1IBGH 1QYGH 4L3AA 4WEMB 1N26A 1RJZB 4TSCH 3WSQL 1J0ZA 3W11C 2RR3A 3B9AA 5MHSE 1EO8H 4XP5L 3HAEG 4E9LA 3BQUD 4JDVA 4IOFC 4S1QH 4BH8A 4UTAH 2NY4D 4ZPTA 4L9LA 4PJGB 2BHUA 3RWCA 2JIXB 3MR9B 1R0AL 4YE4L 1MCLA 3B2UC 3TN0C 3RVWC 1S7UA 3RWJB 2B2XL 1DDHB 2EZ0C 3WJJA 4KDTA 4S1DC 4GXVL 1ZLSL 5DD6B 4P99A 4R7NB 5F7MC 3UDWA 5L2KD 5DJ0B 3QWRA 4ZXBA 4NHUB 4FZ8H 5DJ0A 3QB7C 4KKLC 5FUCE 2WNGA 2R0ZH 4U2ZA 4X6DE 4KK6C 3MLPA 5ESQB 3DROA 1OTSD 4HKZB 4DGYH 1QP1A 3ALPA 4HLJA 1LO0L 4YEFA 5D7IF 1I8LA 3WNNA 4JRXB 1XCQB 3IDIB 1F42A 4OCSL 4ENED 1JYXA 1E6JL 5EZIL 4LNRB 3EYSH 3IDJB 3EOTL 1JTTA 5FECA 5TE6L 2WWKO 3QG7L 4IMLB 3L5WA 3V0WL 3EZ8A 4EZMA 5FCUL 3U9PL 5T33L 2DQFA 3RQ3A 1MWAB 2VLKA 1MJ8H 3GM8A 1QBAA 5CFHA 1S7SA 2FIKA 5CJXC 1BJ1H 5TFSL 2XTJB 2RCSH 4PJAA 4OZ4B 5IK3B 1OSZA 2CUMA 2O5ZL 3GIVA 4YHKL 1DDHA 4KZDH 3PGFH 2ZCKL 1F5WA 2EO1A 3I6GB 1FCGA 4L3CB 5T33H 2BOBA 1IC1A 1XGPB 2NY1D 4BZ2H 4Q9QL 7FABL 3JV4B 5GXBB 4KDTC 5FYJD 1CR9L 4ODXA 3WJJC 4Z77B 4ZTPH 4HX1A 4P3CH 4G7YH 4YDIL 3GNMH 3WE6A 1FL5B 4L9LB 4HLZG 1JZ2A 1RVFL 1N64L 1PKQA 1DEDA 3SE3A 1CR9H 4TVPH 1JWSA 5HDBF 1JZ4A 3SDYL 4WO4A 1KIRA 5GISH 4NNYB 5TDOB 5JO5A 2R29L 1FO0A 4GRLC 4NC2B 3M1BB 3S96B 2C3VB 5ERWA 5DUMH 3RZCB 5IV2A 3BAEL 1MCFA 1A4JB 4P9MH 2F54B 5FO8A 4PPTA 1A8JH 3QP3A 3FJTA 4M4PA 4N8PA 3IJHA 5JHDE 4RFNC 1PZUB 4FQIL 1N0XL 3U4BH 4GAGL 5A16A 4M03A 4PJHE 4NJ9L 2CKBB 3EJZC 3VMPA 5F7UA 5E9DE 3ARVA 4K71C 4X7TB 4JPKL 3ULVC 1Z2KA 1C7SA 1CXIA 3VGHA 1R5IA 1IC4L 1CLCA 1KXQE 1VPOL 1KJ2B 3WL9B 1XIWC 3IDJA 3ABZA 1FVCB 2E5EA 2V2XB 2IPKB 3E6HA 1NFDF 3WFZA 3K46A 1AR1D 3ME0A 1JZ6A 3FQTA 3D0VA 4HCRH 4NRYA 4PJ5D 5DHXB 4UBDD 4YGVB 3VWKA 1JK8B 3LN9A 3CIQA 1BQHB 3T08A 1II4E 2ADGA 2WM0A 2A1WL 1EFXA 4K7PL 5CBAA 5EOQH 4RMWA 3M1BA 3S96A 1KB9K 4W6XB 4M5ZL 3MBEC 1T1WB 3KPLA 4IEFB 2A6DA 1Y18A 1BIIB 5DD6A 4HK0A 5DMKB 1I7ZB 3WV0A 3QXTA 4D0DA 3BZFA 2CIIA 3QR2A 4YHYB 4UB0L 5C0DB 1IE5A 4UT9H 3OKOA 4BELD 1JNNH 2R39A 5BQ7B 3FO9B 5GJTL 5K9OB 1JNHB 1NDMA 1T1YB 4NZTH 4RGNB 4RZCB 4WWKC 4ZSOA 1G7PA 2H1PL 4FQHA 1XZ0B 3LDBB 2VDQH 1QYGL 4V2CB 3OX8A 3PP4H 2R4RL 5ICXB 4HC1A 1CE1L 3O11A 3OJDB 1A1NB 1OGTA 3HHRB 4JFED 5DQDH 4OF8A 1F4AA 4LQFL 1EEZA 1UG9A 5DFWH 1LK3L 3L5WB 4JHBA 1N5AB 3TFKD 1B0GA 4NYLA 2NR6C 1Q9OA 3F5WB 3M17B 1P4IL 4FQCH 4TRPH 4YNYB 3PWNB 4LSDA 3FKUS 2ZSWA 4ALAL 4CL7A 4Y8DC 1EJ6A 4QWWC 3QA3B 4BJLA 3L9RA 4RRPG 5D7SL 1PZ5A 1MJ7H 5HTSA 3C2AL 4QRUA 1EA9C 5CCKH 2DQEL 2DOCA 5ID1A 1D6EA 4HZLA 3QDGE 3ZTJH 1OAZH 4FQXC 3L3KB 2VXSH 4Z95H 3VDCA 4QXTB 5K59F 1SBBA 4KHTL 1TVHB 4J3VA 3EYOB 1WF5A 2ENSA 1V7MH 3RIFF 4HJ0C 5F6IC 1E4WL 5FA4A 1YEDA 5GGUA 4RNRA 4NQCA 3WHE1 2FGWL 3ZDXF 1EFQA 1QD0A 2FR4A 3WKMH 3U0WH 2VQTA 5D1ZA 2GFBA 4DKAA 1KACB 5EO9A 1KCVL 2C5DC 5HDQL 1G6RH 5ACZB 4KKCC 2V7NB 3DVNB 2CKBL 5EOTB 3REVB 1FBIH 1P7QB 4UI2A 1MI5E 2Q8AH 1DQQA 2CMRH 3BIBX 1F4WH 4O2FA 4MDJB 4DKFL 4WCYH 3FFCA 4L8DB 4S1DD 3SJVA 3ZDXE 3DIFA 3QIBC 1PG7L 2VAAB 1C5BH 3GNML 4YHYC 5EIIA 4P5TD 2XIDA 1GL4B 5DT1L 1RFDH 5E8PA 2XYCA 4GH7B 4LCYA 3C5JB 4NQEB 2UWEE 5I76B 5ELIA 4XVUD 3BEVA 4PJAF 4CVWA 4XBGA 4JM2F 4JG1H 1OQXA 4NNPH 4DK3A 1INEL 2ESVE 3KYKL 5IP4A 1J0JA 1BD2D 2F8OA 3ZLQC 5CJBA 2W9LA 3TO4D 4OCYH 2ZUUA 2OLDA 4NQCD 5H2BB 1DUZA 3BKYH 1EJOL 4DN3L 3OB8A 4C83A 3PWVB 1ZLUH 5T1KD 2V9QA 4XB7A 3ZKSD 4R2GD 1BOYA 2F5AH 2D4FA 5E1AA 4LDLB 1TVHA 3KXFD 5IR1B 2VLMD 3WHXB 4MNGE 4TQEL 3WO3B 3X3FH 3GGWB 3WS3B 5AD0B 3X3GL 2YD3A 4XI5D 1LHZA 1T7ZA 2V5TA 5BS0B 2BXYA 1NCBH 3LD8C 1OGAE 1JPSH 4IM8A 1LP9F 5GIRA 3KPSA 4AG4H 4M7ZB 2Q8BH 4WW2A 3QJFB 3L7EA 3H9SD 1E28A 1J88A 3GMPB 5T3XL 4GRLD 4WY7H 1VFBA 4M1GH 1TJGL 3MLSH 5J1TC 1RK0A 4N8VA 2F53B 4PGJA 4Y19E 3RWIB 1CL7I 2DQJH 1C1EH 3D0LB 5I1KL 3L3IB 3LS5H 5F89A 3JXAA 3L95A 3PHOB 4GKZB 4Y5YB 2FL5A 3QJHB 4LSPH 5HD8D 1A4KA 2HJFA 4OD2B 1S9YB 5DD5L 1S9YA 4JY4A 3QI9C 4F8TA 4PY8I 2BJML 4QLRA 2C1PB 2YPLA 4LRNH 2GW5A 5D2LF 3FQNA 5DMGC 4DEPB 5JXED 4H0IA 3L3GB 1CGSH 3QULA 1CBVH 3MO1A 3RWIA 3G5ZA 3GRWH 1J8HB 4GT7A 1FLRL 4U3HA 4ZD3H 4GKOA 2R56H 4Z6AT 5F3BA 3QEQE 2O61A 4Z7WA 2VQUA 1FDLL 4ZFOA 5AUMA 5JXEA 4HJJH 4QOKD 1J0YA 2AJZB 5IMLB 2YBRB 5KSAC 2WSKA 4ELKA 1T66D 1FVCA 5J6GA 3DGCR 1FAKT 3F7RA 4NPYB 4U1MA 1KEGH 1Q38A 3TJHC 1U8HA 1FE8H 1FAIL 1RUPH 3P73B 5EC1A 1WV7T 3PXJA 3EYQC 2QADB 5IW6A 3LVEA 5C8JB 2FHBA 3GSWB 2V17L 2D2OA 2VR4A 4GG6A 1AH1A 2FX9L 4TVPE 4XP1L 3CCHB 3LPGA 3WUWB 3EW3B 3RWFB 3EO1A 3GB7B 2JE8A 4ZUTB 2X4UA 4NQDB 5D7IE 1HOCA 4KKNA 3LQAC 1TQBC 1G6RL 2AEIT 1BFTA 5ACMA 2G5BA 2FWOA 2R0WH 4NGHL 1C16A 4RMQA 1FZJB 4G9DB 3OG4B 5HYJA 3TESA 1AD9A 4HH9B 2DBLL 2QSVA 2X4PB 4P5MA 2DTMH 4OZIA 5E9DD 3UPAA 3BZFB 1IEHA 5A3ID 1HINL 5HHPB 4KUCF 1XH3A 1YN6A 3HMXL 2W65B 2W9DH 1FNHA 3IKCA 4O51B 1A7RH 4DEPC 4XWGH 3EDKA 3UYRL 4KXZI 3ZE0E 1GC1H 5DVLA 1MCEA 5DJDB 1A7OL 2NZIA 4W81A 3GSRA 4ODSH 4YDJA 1XGYH 1CE6A 1CK0H 4HF5H 5B39B 5GGTH 5ENWB 4NWUH 3UEZA 5BXFB 1NCDH 5D7JD 3LN5A 1J86A 2R69L 4DUVA 5HHXL 4OZGB 4PGEA 4Y5VC 2P49B 3HC3H 2HP4A 5HYSB 3ZT7A 1FRGH 2CO7B 3SGKC 1YNLH 2HMID 5DJYA 3QUMH 4MDIB 4R6UA 1KC5L 4WFEE 1ZWIB 4P23B 3VRJA 4OZGF 2E6JA 3ARDC 1M7DA 1K8DB 4NQSA 2FD6H 1BF2A 5I73C 1EUUA 2F5AL 4H1LB 4G3YH 4XWOC 1T80A 1YYML 3VXNB 4M8VA 4OV6F 3DOSA 1MCWM 1UJ3C 5C6WH 1DBKH 3TN0A 4F2MA 3JWNC 3CPLB 1I7TA 2DN7A 4MXVE 1RY7B 1YYMH 2HWZL 5GJSL 5HGDB 2FHFA 2X1WL 3VGDA 3VD9A 1BGXH 1N5YL 1XF3B 2VDOL 4XP6L 3IDUA 3GSUA 1A7PL 2PYEA 2Z4QB 1JRHL 4ELKB 5DJ8A 2ATKA 1NC4D 4HUVA 3JZ7A 4M6AA 5BXFA 2ATPB 3QIUD 1RIHH 4WY7L 4H1LA 5FOBB 2VH5L 2APWA 5F97E 1H5BA 4U4BA 1NJ9A 1TJGH 2HJKA 3MLSL 4UNTA 2E9BA 4ZAKB 3NN8A 2P5WB 1A6VL 1L0QA 4P2OA 3OAYK 5D6CB 2Q86A 3WBDA 4MDIA 2DM2A 1UKQA 1XR9B 5FB8A 3U7WL 5TDOA 2ITCA 3KPOA 2JB5H 3LS5L 1EAPB 2AK4E 4K9EC 2AEQH 1S5IL 4K3HA 4HXBH 3FMGH 3P0YL 2JCCA 3D3VB 3O4LA 3DUUA 4RA0C 4RGNE 2WANA 4L4VA 2X4RA 2ZCLH 5GGRA 1R3JA 3WHE0 4EI6A 2XWTA 3JTTA 3QHFL 1UCBL 5H35B 5F96H 5C9JA 1UM4H 4OZ4A 1IGCL 2P24A 4Q9BA 4TSAH 4E41E 4JO1H 4RAUA 4TN9A 1U41A 2J1KA 3K8MA 1P4LA 3KPMB 4PRIE 4YHZH 1AGEA 4DVRH 4IBLT 4OZHA 1HZHH 1T89C 1EHLL 1AD9B 2C3GA 4R4BB 3B83A 1NANH 2WUBH 3LEXA 1LEGA 1CLZH 2IBZX 2PYFB 3HCVB 1L7TH 2M26A 2YN3A 5EBGA 3MV9D 4ODUB 5FYKE 4UV4L 5IQ7L 1IGMH 4TYUA 3VCLB 1AC6A 2YD7A 1AKJD 1XCTA 3OR6B 4IOIA 5I18L 5I1LA 4PJIF 4NQVA 4IRJB 5ESQA 1R5WB 2YN5A 1AY1H 5J8OA 4PD4J 3S35L 4OFKA 4CVUA 3U36B 1YEJH 3GMNA 5KVDH 2NY2B 1RIUL 4X6EA 5DRNB 1KEML 5H37G 2GKIA 2Y9RT 1H8NA 1MH5B 1AKJA 2DWEB 4EXKA 4MX7A 4BQ9A 5EULV 4LCCA 3SDAC 4JFHD 5I30H 2VABA 3CH1B 2Z31B 3MYJA 2PO6A 2P7TA 3W5MA 3DRTB 5KVGL 2VISB 3QIBD 4OJFH 4NZUH 1V5JA 3Q3GB 3F7YB 1GZPA 1QPPA 3GI9L 2HA1A 4PY8J 4YFLI 1DN0A 5DK0A 3QSKB 3GMOA 1IZKA 1HEZB 4KPHH 5GS0H 4NC1C 1JGVL 5FYJE 5JPMB 1H3PH 4K8RH 4YXLL 1LGVA 2BDNL 4MGXA 3X13A 2NLJA 5F89B 3L3HB 5JW4N 3LN5B 3WUWG 3NACL 1VKXA 3H9SB 3UYRH 2CR6A 3MPCA 1B4JH 4WENB 3A0OA 3WNLA 1CDJA 2VN4A 3PL6C 1J7VR 5CIPA 3O6LL 4C58B 5CJXA 1NC4A 4RQQA 3PGDB 4XP4H 4Z7UE 4L8BA 5GGTL 2P5EB 3C6SA 5IVXA 1X5YA 4LVNB 5C07B 3KJ6H 3LD8B 5KSVA 4WU5B 4X5LA 3BDXA 1S7QA 2F8VA 2V7HA 1CD9B 2OMBA 1D9KD 2HKHH 1P7HL 4IMLA 4LU5L 1P7QA 3DLQR 5I2IB 4TUKH 1UA6L 2VC2H 3MRHA 3QWQB 1JWMB 1ODAA 4JDZB 3ZE1E 1N6UA 4ZYKB 2XN9A 1RZFL 4Y19D 1QLRA 1AI1L 3WD5L 3VFGL 4WW1B 3D39A 3IFLH 3SDDA 4Y5XB 3S3JA 3JUZA 5DUBA 4X4ME 3BDBA 5GS1C 3RVTC 5GIRB 4W68A 4HULB 2QEJA 2IJ0C 1CFSB 1HHIB 1OM3L 3LKQB 1V7NH 2F9BT 2YZ1A 43CAA 4L3ED 5T5FH 3NCFB 5H37H 2F74B 2FO1A 1TCMA 4XWOD 3CFDA 2BCKB 3MRQB 2BSTA 1XF1A 4O4YH 4XHJC 5SWQA 4HEPG 1S9WA 5L0QC 4KRPD 4P48A 4MJ6A 4EQ2A 3VFWB 1JP5A 3P30L 4F57H 1NCAH 5HHMD 3V4UL 2HRLA 4TVSa 5D7IB 2NY2C 5DZNA 4XHJD 3NCJH 3HI6H 5HPMB 2O61B 1KUMA 2VQ1B 5FAAA 4JFZL 5C0AA 1A4KB 3SQBA 3V4VL 4F58L 3N85H 3L7FB 3F5WA 4HFWA 3QPQC 5D7KD 4WDIA 2W1NA 3V4UH 1TJHH 3PGCA 3WFCH 1ACZA 3QULB 3OG6B 4K7PX 1JZ5A 1YPZA 2R1WB 2ERJC 5CUSL 5DHVB 1PQZA 3RBSA 5D1XA 1A1NA 3QCTH 4BUGA 4GRWH 2FEDC 4RISH 1DBAH 4WGVB 2QQKL 2P48B 5F7EH 4JFEE 5C0RL 3RU8L 4WEBH 3UTZB 4M43L 1F90L 4NWTH 1IEBA 3HMWL 5JPNA 1H15B 1XIWA 5MHSD 5HGHA 3F6LA 4P2QA 4XNZB 4OD1L 4RGNC 5D7LD 5I19H 2JJUA 4WFGE 3HB3D 5DA0B 4YO0B 4M43H 4PJBF 1JYNA 3RP1A 2JJSC 4NDMB 4ZOEA 4S1RH 3T77B 1JI1A 1IC5H 3IDNB 1U2CA 4AM0B 1R3IH 4DGVL 3HLAB 5DRNA 4ACPA 3ARYA 4U1SB 5TDPB 2JTDA 2MQ3A 1F2QA 1H5BC 1XGRB 2CH8A 1R6VA 3SGDI 1ZXQA 4B41A 1J12A 4ZUSB 1TLKA 2X42A 5IEKA 3H7BB 3IT8D 1JK8A 3LQAL 4DQOH 1T21B 4EDWL 1YEKH 3RX5A 3LRHA 2F5BH 2W0PA 3MOBL 5D93C 1UWXK 4LHQB 3RY6A 3BN9C 4Y88A 1QACA 2ZUXA 2FB4H 3QRGL 2YA1A 5KVFH 1WFTA 2OJEA 2IALB 5I30L 1FZOB 2XY2A 1C5DA 5BZWB 1R3KB 4KKCD 3SKOA 1I3GH 4R4ND 2YOCA 3D87B 3HRPA 3S4SB 4DGYL 2X1XR 1UENA 4PJHA 1WEJL 3F7VA 2IQ9H 2P5WE 1GC1C 3FQUA 1NLDL 2ORBH 3SJVB 5HI4D 3MXVH 1NEZB 3QXAB 3RA7L 1BBDH 2QQLL 1EEUA 4YGAB 3IDYB 1KB5L 2QR0A 1DBJH 3RZCC 2C3VA 3MC0A 3IU3B 3UPCA 3LB6D 5I73B 3R1GH 3WXWL 1S7QB 3ESVF 1NFKA 3FAWA 4M1DL 4NQDE 4J2XA 4X99B 5KTEH 2QQLH 3UZQA 5FM5O 1NFIA 3CXDH 4X6FB 4NUJB 4ONGH 1KN4L 2AJVH 2Q86B 2P5ED 5C6TH 3ZMRA 2WIMA 4UQ3B 1MHEA 5C0BB 1A5FH 2EECA 3MGTB 4F7MB 4IIQB 4C56E 3MJ7A 3P77A 4N0YL 1XGPA 1IGJB 1PLGH 4Y19B 4PJ8D 1LEIA 1G0YR 4Y4FD 4PRIB 1G9MC 4O2EB 1BZ9A 4R26L 3DECA 1CS6A 3ILPA 2B4CL 5L88H 4BZ1L 1ZT4B 3PL6D 2X4NB 3RNQA 4PV8B 3RWEA 2DQFB 1JTOA 1MIEH 1NAKL 4P2YA 3UJIL 4R7DB 3HMXA 1K4DB 4U1IB 3RTQC 2CPCA 3VI3F 2KL6A 1G7MB 1IEAB 4AQOA 3CPLA 4U1LA 1QR1A 1IC7L 4X7TA 1MRCH 3BXNA 5DXWA 1GGCL 5J0BA 3CC5B 2ZSWB 4LPWA 1GRWA 3UO1H 4AJ0A 2QTEA 1FG2A 5C09A 2AS5M 5DURB 1GGCH 5JDSA 1LEGB 1MH5A 3U4EA 3QIBB 2NY1C 2Y25A 3T2PA 5ESAB 5DJYB 5EC2A 1CF8L 7CGTA 4PBWD 3AAZB 5IM7A 1FO0L 2UWEB 2HT4D 4PRDB 1NGXA 3FT2B 2HRPL 4JFEB 3DVIA 4OCRL 4DAGL 1MHPH 3VD5A 3G5VA 3T0EA 5DC4B 4FQ2L 4HAFA 3V4VH 3CZJA 1F2XK 1HHGB 1NGPL 3DYMA 4I2XE 3FT3B 3CFBB 3AY4C 1T0NA 3QBTB 2RHEA 3FQWA 3BW9A 4WV1B 1U8QA 2W0FA 2AJYL 4HG4J 4PJFF 5E6ID 3L3DA 1IAKA 4R8WL 2WINB 5IW1B 1DSFL 1ZK9A 1AE6L 4KJYB 3OAYH 2JB6B 3T0XA 2FX8H 3D25A 1PX3A 1K5NA 1GZQA 4PREA 4RDQF 4D9QD 3IS0X 1L6ZA 4I5BB 4AZ8A 3CSYB 3LKOB 3WFEH 5C2UB 3BPCB 3HMWH 2FWOB 4BFEA 4GRWB 2FX8L 4HDIA 1BZ7B 4Z78A 1ZA3A 5DD3H 3ZKXB 4JGJA 1I9JH 3NABL 3BQUA 2YPLE 3RWGB 4JFHE 3BUYB 3CH1A 5J13B 2NY6D 2VUYA 2DQHH 1G9EA 5DD3L 3LKQA 1BWMA 3MFGB 1IC5L 7FABH 4KAQL 4O02L 2VLKB 4XCFL 4JVUA 3F65A 3G6JB 1UQSB 1UXWA 3VFUA 1NMCC 4G6JL 4XAWL 3G6JA 2C3HA 5EUKA 2DTSA 3QNYA 1KXVC 2COQA 4EBQH 2B4CC 4NPYA 4RWYL 1PEZA 1MCNA 2NY0B 4G8GE 1EPFA 1NCWL 2OZ4H 4LAQH 1ES0A 5IOPA 3T65B 3SE8H 1DR9A 2NY4C 3RWGA 5IOPB 2R15A 1I1FB 4I2XB 3FO0H 3QUMB 3GMQA 3O4LE 2VUOA 4PBXA 5L2KB 2HJLA 1FN4A 2VXVH 3QCVH 4M61A 4P59L 4UIKH 4KKAD 1U8KA 1OGAA 5TE7L 1KTDA 4XP9H 4NHUA 4LLYB 4RMUA 1CG9B 3EOBB 2ESVA 4HQQL 3T8XB 5M94B 3SDAB 2X70B 3BWUC 2WP3O 4TSBH 2DBJA 3QEQB 2I60L 4WU5A 3SGEH 5I17B 3V2AR 5DJXB 4LLWB 4HS8L 3MV9A 5DUML 1X3DA 2NY6B 3O2VH 4WHCA 3WE6B 5DSCB 5HSFA 1HH6B 2DJ4A 4WV1A 1NLDH 3OKEA 4P2RA 2A6IB 4CUCA 1BLNA 1JGLL 1F4XL 2C1PA 5MENB 4KVNL 5C0IB 1BBDL 3ARBC 3S6CA 3ZE0F 1MI5D 3MLWL 1QRNB 2PN5A 4OIAA 1I8KA 3JV6B 4KZEH 5GZOC 1GH7A 2X4TB 4KVNH 4R4NC 3VXMA 2DM7A 3CUPA 2IQAA 4UMGA 3BPLB 3I02B 2CKBH 1WT5A 3AUVA 1IJ9A 4JFPB 4LCWA 1SJVA 3K4DA 4IJ3C 5EZJA 4OZFB 5FECB 3HE6B 2G5BB 2GJZB 3P4NA 4KTEL 1IGTA 5EG6C 3MUJA 1U3HA 1D5XB 4U6VL 5F7LB 2VXUL 3RVXC 3DYPA 1AQDA 4ETQA 1CDBA 1PW3A 3OXRB 5IJVA 3U83A 1H3UA 3RX8A 4TULH 5E5RB 1PFCA 1NCCL 2ESVD 5C0GB 2FNBA 4XPHL 4WFED 3HC4H 5I17A 3GSXA 1BD2E 2H1PH 5DMIL 1FNEA 3GI8H 4LPXA 4ZOCA 5D7JC 5T1DL 4AL8H 2NW2A 4YPJA 1MNUH 1ED3A 1EFXD 3P73A 3AY4A 3GK8L 5EC1B 4JKPH 3UPRB 3VH8A 3LH2H 3KR3L 12E8H 2X4NA 4K3JL 3RNQB 3TZVC 1OTUD 2HJLB 3SCMD 1KLUA 5D7KE 1G7HB 1MVUB 3X12B 5D2LB 4OF0A 4JRYA 1YYLL 4GMTH 1J11A 1XF2B 4QHKI 1A14H 3BGMB 5SWSA 2E7LC 4EDXA 4XNQB 4LMQE 3HS0A 3LEXB 2Z8SA 3DYOA 4TUOA 1CD8A 3EBAA 4FQCL 2NX5A 4U1HA 4U6XA 2IH1B 1AGBA 4GMTL 2IGFL 3S36H 1HXMB 3EDDA 4NKOB 4G6FB 4Y4HA 3UJJL 4M6MH 1RSFA 4NC1E 5DJ6A 1IM3A 3KPQB 1R3LB 1O7SA 2DM4A