5ALBH

Ticagrelor antidote candidate medi2452 in complex with ticagrelor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
b'VQLQESGAEVKKPGSSVRVSCKASGGTFDSYSIHWVRQAPGQGLEWMGGIIPAFGTLSSAQDFQARVTISADKSTSTAYMELSGLRSEDTAVYYCARGSFDYYFWSASHPPNDALAIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI2452 HEAVY CHAIN
publication title Structural and Functional Characterisation of a Specific Antidote for Ticagrelor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albH01
3GKWL 1OGAD 4YHYC 1DR9A 2V5SA 1F4HA 2CLRB 3BHBA 4S1SH 3X3GH 4WJ5A 4FQQB 2YD2A 4GW1B 3VWJB 1G9NC 4N8PA 4ZS7L 2A9NL 1W8OA 3W0WB 4XNXH 4GG8B 3MRJA 1SHMA 3ZKMC 3VWKD 5IB5B 4DUWA 1RU9H 3GBMH 3MJ8B 1IC5H 5IG7A 3SDAD 1UZ6E 2P48B 4AMKH 5IB1A 4DQOL 3GKZA 4WU5B 2MWCA 4J8RA 3LHPL 1KFAL 1QPXA 5E2JA 5HYSB 3B6SB 3V95A 5DUPL 2DQHH 4M43L 3K1KC 2FHFA 3VXUD 3ZKSD 5F9JA 1ADQH 3FB7B 3H0TB 5E99H 2NY0C 3P0VL 2JB6B 1CXIA 3FQNA 1G7LA 3DLQR 5DD0L 3EO1A 2CIIA 2M26A 1Q9LB 1S7VB 2D4DA 1UB5A 5C0EA 3DBXB 1P6FA 3MLRH 4HDIB 3IETB 5D1ZB 3QHFL 2ICCA 1OARL 2GAZA 2VUOA 3B4NA 3CDFA 3ARDC 4I3RH 1DANT 5I71C 1CFNB 4Y2DA 2R56H 1HSAA 4OCRH 2WBJC 3WL9A 1M7DA 5J4MA 1BZ7B 1OCWH 3KS0J 4CVXA 4QWWD 1VCAA 4OZIB 4AIOA 4NYLA 4DZ8A 2JB5H 3F12A 5EO9B 3VFSB 4M5ZL 3MBEB 1D5MA 1X7QA 1VADA 4X7TA 3VWJD 3KWWB 4HT1L 1FQ9C 5ISZE 5DJDB 4E42B 4EIGB 3W0WD 1S7SB 3RY6C 3IGAA 3RVTD 2VXQH 4GRMB 4OFIA 4UDTB 1Q0XL 4FQ2L 5HYIA 1PLGL 1R5WB 3ROLA 3NCJH 4QXTA 3CX5J 5DMIH 2EDDA 2IPUK 2JJUA 2APFA 1BVZA 1A64A 2AQ2A 4GG6A 1MRFH 3QI9D 1CR9H 2QQKH 4IRZL 4QOKE 3VH8G 2DQUL 4U1NB 1QHPA 3QDAA 3QDMB 4HKXB 1FBIH 3RWEA 4BK5A 3A6CL 1T20A 3DVGB 3BSZH 1ZVSB 5LWYH 3U7YL 4GQPH 1MIEL 5CS7A 1GCFA 4K07A 1F90H 4H0GA 4K7PH 3C5ZC 1EO8L 2EH8L 4HIEB 4BFGA 1LD9A 4PJ9B 1T66D 3F58H 5D7IB 1KLGA 2RAMA 2JJTA 3EO9H 1JPTH 4PG9A 3QIUC 1F3JB 4BUHA 1R6VA 3BT2H 4QRQB 1K8DA 1RK1A 3K8MA 1E4WL 5MEOB 1DBMH 3VD3A 3WV0A 5GPRA 5A3ID 2YD1A 3DXAE 3MBED 4LAJH 5TE6L 1TPXC 3IDXH 4RMRA 3UBXI 4MA7L 4MJIE 4JO2H 1BAFH 4FQ1H 5GS3A 5JZ7D 3BZEA 4GRLB 5E03A 1OF2A 2ARJA 4HULB 1N5YH 4NQSA 4P4RB 4KK5C 3U36B 3BUYA 2AJUH 1JRHI 5FUOL 3BEWB 4I0PC 3KPQB 1G7PB 4OGYL 4LIQH 3RJDA 5EC1B 3TIDB 5FYKE 4LARL 4XVSL 1TQBC 2R1XB 4WO4B 1MQKH 4ZOAA 3J8F7 4JZNB 1IGFL 3QDMD 3IF1A 3BUTA 1RMFL 3G08A 4JFHD 1FZOB 2E6PA 2P45B 1KEML 1ZT1A 3WUZA 1ZWIA 4BZ2L 4JM2B 5C08B 4G6AC 1A3LH 1F4WH 1PSKL 2IQ9L 1HHKB 5KN5A 2W9EH 1EEZB 1CG9A 5MEQA 4PJEB 1LK2A 1V3LA 2P47B 1W0WA 3LS4H 4XAKE 3S36H 4HAGA 2UZIL 3WFDH 1U8HB 2F5AL 3L1OL 4ODSL 1KBGH 1K5NA 2AK1L 4P5TB 3O3DB 4PRHB 4XGZB 5FCUH 4J3VA 1LO3H 4X6CB 5C0JA 4XPHL 2AKRA 5LGJB 3IT8D 4RFNB 1BIHA 4U1HB 5GSVA 1GRWA 1P7KB 5EU3B 2R2BA 5F96H 4JN1L 2A6JB 1CK0H 3S3PA 2ZUXA 3PWVB 4F7EB 3T0AA 2IFFL 5KSBE 5DEFB 2VDOL 2OL3A 2ID5A 1MCWM 3AXLA 1T22A 5KBNC 3OAZK 4NC0B 4QT5A 3UPRA 5TDOB 1HE7A 4S1SL 4P59H 3X3GL 3VXRD 2F53E 2NZ9D 1EEUA 3MCG1 2XWJA 3CFJB 4EDXB 4XNXL 4WO4D 1CWVA 1L6XA 5GGSB 1QFWI 3BH9A 1IC5L 1MLCA 3I9GH 1I9RL 1UWEH 2VQTA 3NTCL 1QBLL 3TM6A 1IEBA 5C08D 2OR8A 2HRLA 1JGVL 3IDYC 2ZUTA 2BVQA 2C4XA 3VD7A 1JPGA 4G6KH 5I8OL 3MO1A 3RNQB 5E99L 4PRIA 3DI2B 4NO3A 3MTRA 4G7VH 3UDWC 1LO5A 4P5TD 4WWKC 4I1NB 4PRHD 5EORH 5JQHC 3V6OA 1DVFC 4G8GA 3S6CA 3MLRL 4OTXH 4PTUA 5TH2A 1ZA6B 4OIBA 3Q3GB 1XR8A 5K59E 2APXA 4B53A 4XH2B 2XQYG 2OJEA 2BHUA 5JORA 3HMXH 5IB2B 3NGBC 3HUJA 4OCRL 3MCKB 4JM2F 1L0XA 4Y4FC 4JFZH 4TOYL 2AK4E 4P2RB 8FABA 2ZCLL 5CJQH 4MNGB 1VFMA 2E7HA 3C2SA 3MRNA 5DF0A 1U8MB 1Y6MR 2ZG2A 5CGYC 1UXSA 4JAMA 4JRYE 3BIKA 1WT5C 4N68A 5F7KC 4X6CF 1W2KT 3T2QA 3CFDB 1RJYA 1I9IL 3KYMB 3RL1B 5I1EH 1TFHA 5IIEB 5DFVD 1GSMA 3TEUA 3TPKA 1UA6H 3MMEB 3NCJL 1BX2B 5FKPA 5DMIL 3T2NH 4U1JB 4XVJH 1QLRA 4KK6D 5IMOB 1GZQB 35C8H 2R23A 1CR9L 4EN3A 1U41A 4KKLC 5JDSB 4HJ0D 1RIVH 2O5ZH 2BVOA 1OAKH 2AXJA 4HUNB 5JLZA 3SE8H 2HG5A 5KVDH 1R5IB 1MI5E 5IHUH 1GH7A 2GTZB 2XT1B 2ORBH 4XAWH 4F7TA 3BSZL 3HI1B 1BIIB 2VZOA 3WNLA 5LWYL 4D0DA 5AG8A 3DX8B 2AGJH 3MRGA 5EZIH 2PTTB 4E5XB 3MLPA 3VFRA 5IMMA 5FM5M 5EH1A 3F58L 2BNQA 4EBQH 4FG6D 3EO9L 1JPTL 4CL7A 3QUXC 4P2RD 3C6LC 3GHEL 4ZUSB 5TQ0L 3BT2L 4LP5A 1MCKA 1DBML 1SYSB 4JFPA 4NCDA 4R0LA 1IVLA 2OL3L 5FA4A 3TBTA 3EDDA 4AZ8A 2XTJD 3IDXL 4P4KC 4JO2L 4AIZA 3MA9H 4G43B 1NKOA 4KDVA 3TYGH 1YDPB 3LSOA 5J1AA 4XVTH 1T1YA 2V5RA 3X13B 2GT9B 3MRQB 3RX5A 4HWZB 2AJ3A 4M6AA 5MP6H 3WHXB 1LO2L 2ICEB 2K7PA 2F8OA 2AJUL 1ZSDA 1J0KA 3I6KA 3IVKA 4NNYB 2LU4A 2R4RH 2G60H 1ETZB 5CFHA 5J3HD 3KDMA 3WIHH 5I1HL 2R0WH 1Z9OA 4LIQL 5BV7B 4L8BA 3MREB 1ZT4B 1QSZA 2EZ0C 3DYMA 4KJWD 4LGPB 1FG9C 1FJ1A 1I4FA 5DJ0A 1MQKL 4N8VB 4NQCB 5CD3A 2A6KA 3EJJX 2ARWA 1PY9A 3ZDYF 4Z7QE 4WI4A 2VIRB 3BP6A 4WHCA 1PG7H 1A3LL 4YC2B 3M1BB 2PNDA 2W9EL 2ZCKL 3LDBB 2V9TA 5HPOA 3QWQB 1DE4B 4FMKA 4PJDB 4PRBB 3LS4L 1DDHA 2F19L 3S36L 2FJHB 3ECBA 3WFDL 1PZUB 4HWBH 5C6WH 1T0PB 1KBGL 3NA4A 1IEAB 4UT7L 5CSGA 3RHWF 1P7QB 5TDPB 3JTSA 1EGJA 5KSUA 5FCUL 1YEKH 2J8UB 3WKNA 4LF3A 4YEFA 4PLOB 4WI2A 1R3HA 3QQ9D 1FFNA 1IAII 1KLUA 2Q8BH 4BJLA 2WUBL 5HHOA 4PREA 2N56A 4D94A 3TESA 2B20A 4KJQD 5FO8B 5F96L 2FJFA 1CK0L 5HHXH 3DJ9A 5T1LA 5EOTB 4MJ6B 1AHWC 1MCSA 1GIGH 4PB9L 5FGBC 4F8TA 1ZT7A 5L0QC 1A7QL 5ETUB 4M62H 1T1WB 1OAXH 3UC0H 4J3SA 3OR6A 2W59A 4JO3L 4P59L 3K1DA 2JF1A 3P9LB 3RTQC 2JJTC 1WFOA 4OF5A 3O8XA 2D7NA 1DN2A 4NQCD 2DQJL 1VGKA 4J1UA 3PJSB 4HPOH 4PJ7A 4C59B 1U36A 3U2SA 4YPGA 3I9GL 2CR6A 2VZUA 2YBRA 1UWEL 4JRXB 4CMHC 2MFNA 2UY6A 1WWWX 1XGYH 1YNTA 1OTTD 1INDH 1K8IA 3QEQE 1HHJA 4G6KL 3BO8A 5C0FB 3T4AA 2ZOKA 2W9LA 1UKQA 2FHCA 4WW2C 1CDBA 4G7VL 4IRJA 1QLEH 4JO1L 5MEPA 4WVRA 3LD8C 3SDCB 3L5WB 3STBA 2NY4C 3PWJB 4O51A 4F7MB 4LASH 4ONGH 4OTXL 1HOCB 2X4TB 4CU8A 4GUPA 1FLTX 4XP9H 5DJZB 1RSFA 2C9AA 3HMXL 5IF0B 4YO0B 3MR9B 4UOW1 1NGYA 5C2UB 4E41B 4QHKJ 4K94H 5I1DA 1T2QH 1UWXK 3ZZ1A 4KRPB 4JKMA 2GK0A 3IDGA 2EDEA 4U1KA 3VGFA 1T1XB 3DIFB 3HCVB 5IESH 4KHTL 1PX4A 5DGRA 1CE6A 4OAWB 1E4XH 2HFEB 3D18B 2IANE 4JANB 3QAZC 1W0VA 3AREB 5DO2D 2YOCA 3CSBA 1SJHA 1IGML 1YYMH 1UH3A 1KN2H 3BMVA 5I1EL 3SDXB 4RIRA 5KW9H 5C70A 4M00A 1AXSB 2NTFA 4BFBD 3OXRB 3STLB 4Y4KB 3L3HB 3E6HB 5GS1A 3T2NL 4XVJL 5K9JH 4QRTB 1JNNL 35C8L 3JV0A 4FQLH 1T5XA 5I8CA 1RIVL 2O5ZL 3FOLA 1OAKL 3SE8L 1FC1A 3N06B 2VLJA 4KI5E 1OSPH 2BDNH 4JQIL 4AH2A 5IHUL 3PL6B 3BRGC 5FEBA 2ORBL 3F7VA 4XAWL 5D2LF 1X5HA 2EDXA 5A2LH 4YR6B 2IAMC 5DYOB 1U3HB 2YZ8A 3QNYB 4MHHG 3VCLB 2AGJL 2Z92B 5EZIL 3WEXB 4CNIA 3CNKA 4OZHA 2IBZX 1YJDL 2IH3B 4O2EA 3UTQA 3P73A 4EBQL 5BO1H 3T1FB 1YEDB 4Z77A 4E41D 4ZNEA 3TJEH 4NHUB 5AYUH 3C8DA 3WE6A 4TNWK 3BJLA 4JDZA 4XHJC 4MD5A 1JV5A 1Q9KB 4KJPD 1CF8H 3L9RB 1NDMA 2NNAA 3RPKA 1GGCH 3MYJB 4WGWB 3G6AA 4UQ3B 3GSVB 4MA8H 4UI2A 3MA9L 1QSEA 2OX5A 3TYFB 4JPIB 4EUPB 4XVTL 2D03H 4YBHA 1ERNA 1WZ1H 2OZ4A 1SEQH 1WFNA 3CD4A 5FYJD 3QO1B 2EC9U 4HS3B 5SWZA 4RAUA 5GQBA 1KJMB 1JK8B 1NFIA 3Q6GH 3NPSC 4JFFA 4LLQA 2NXZB 2R4RL 3B8YA 3MJGX 4H5SB 3FCTB 3ZO0A 4GSDH 4NN6B 4Z9KB 3QWOB 3EJZD 5DVKA 2BMKB 4ETQA 4NRZB 1QRKA 1FCGA 4XC3H 4IOIB 4IS6A 3PL6D 1C1EH 3WIFA 5K9QG 1VACA 5GJTH 1BLNB 4QCIB 2F8XC 4WEBH 3SDXF 1TTUA 3SKOA 3LV3B 3NZHH 3CSYB 3RBGA 5I73B 3L5IA 4PIRF 3MJ9H 5H37G 5KVGH 2H41A 1YYLL 3KPRE 5HGBA 5DD6A 2VE6B 2X4RB 3KJ6L 4LNRA 4HWBL 5FFLA 2D0FA 3KXFA 2XKUA 2P8PB 4L8DB 1LWRA 1HHIA 4JPKH 4U3CA 1HXYA 4HLZG 2DMBA 3TH2T 3NIFF 4IMLB 7CGTA 1QEWB 4P23B 4YFEA 3L95A 1K2DA 3PDGA 3GSQB 3KLAA 3DV6B 2Q8BL 1WLHA 5IJKA 3RKPA 5DQDL 2UY7A 1MHHB 5CSBA 4PY7A 5HHXL 5HSFA 3RU8H 2QR0A 1VEPA 2LTQC 3I2CH 4MNQA 1G7IB 2FSEA 1SY6A 4BQBA 1MNUH 2NXZD 3PWNA 5ITFB 3RUGB 1OAXL 3UZQA 1S7UB 2YD6A 4KY1H 4Z18A 4YUEH 3DX6A 4P2OA 3MCLH 1CIDA 1N2RA 1I9JH 2YRPA 1A4KB 3B43A 4TUOB 2CDFB 5EBMA 4QO1A 4PJIF 4YAQB 5SV3A 3HNVH 5ICZA 1N64H 3HE6B 4X80H 1S7QA 4R0LC 5AZEH 4NJAL 2E6QA 4KROC 2UWEA 4OLYH 1L6ZA 4XI5D 4G9FD 3BGMA 3NCFB 4R3SA 3EYQC 3ZDZE 3F5WB 2WWKO 5KSVB 3LEXA 3LQMA 1INDL 3TIEA 2QSVA 3QDGD 2G75A 3M07A 5E5MB 1AKJA 4LAQL 2BSED 3RX7A 2YN5A 1QVOB 4YPJA 1QLEL 4U7SA 4WV1C 3WO4B 3FRPA 4IRSB 4LASL 3UTTB 3V4VH 3HI5H 4M1CD 3NCMA 4A2MA 4P23D 1WITA 4PLJD 4XP9L 1NBVH 5AZ2H 4X99B 1U8IB 4X7CC 4TUJB 3QCTL 3PP4H 4FQCH 5TFSL 5IVXB 3ARBA 1T2QL 1WC7B 3VFUA 3CDCA 2OZ4L 2XV6B 4R97B 2J5LB 4OUUA 4L3CA 5IESL 4KK8D 4ZMAT 4GBXA 5F89A 3SDDB 4U1IA 5GGQH 1UM5H 1JMXA 2OM5A 4ZS6D 1I1RA 1WWBX 2GJ6A 4RGNE 4F8QA 3RIAF 3VRIB 1X4ZA 1KG0A 1YYML 5KW9L 1KN2L 4XWOD 2FL5B 3TNMA 3OHXB 3TJHD 2HWZH 3HE6D 3QHZH 5SWSA 3TBVB 3BI9X 1YJDC 4U6XB 1UXWA 2HT2D 4AEFA 4GG6E 1ZHNA 4XX1E 3FFDB 3GIZH 3U82B 4FQLL 4NCC2 4AT6A 5ID1B 1RHFA 3PP3H 1Q94A 5CSZB 4GAFB 4AYFA 2ERJC 5JOFA 3HMWH 1OGAA 5I2IA 3LPWA 3ULVD 1E28B 3QFDB 4C4KO 1A1MA 1A02N 1OSPL 2BDNL 4H88L 4D0CB 5CZVH 2DM2A 1EBPA 4K71C 4JG1H 3BPOC 4WTZA 3IFLH 2EC9T 3D6GA 3JTTA 1KEGL 3UTTD 3FTGA 4LPVA 2B1HH 3VWKA 2EXYD 5FKAA 3DOSA 5I16B 5J6HA 5I18L 1D5XA 3VFWB 5HHQA 3MRDA 2BVTA 4ZFZB 1FH5H 4L3ED 4A2LA 1C8PA 3MOBL 2WW8A 1OAQH 3HRPA 5GZND 5BO1L 1C16B 5J12B 1JN6B 2OI9C 1JNLH 1BVKB 4RFEA 5JW3H 3NIGE 1FZJB 2ATPB 5GZOC 2NYYD 5KSAC 3CVHB 3CUPB 1CF8L 4MDIA 3SDDD 4FXGB 4KKBD 3DSNA 1IC7L 3GMLA 1U8QB 2Q86B 3IKCA 4JZJC 2MHAB 4HFUL 4X6BA 5HYQA 2Z8VC 3CSGA 3Q6GL 1QFHA 1U6AH 3ARWA 3RWDA 2HMID 3LCYA 1MWAB 4FQXB 3HAEB 1KELH 4JHBA 4GSDL 2WIIB 1KUMA 2BNRB 3MV01 4FFVD 4NOBA 5A40E 4XCFH 1KT2B 4S11A 1XCQB 3BN9D 2XN9B 3EAKA 2CLRA 4FQQA 4XC3L 4GW1A 3VWJA 1C1EL 3LVEA 1BZQK 5GJTL 3W0WA 3VGAB 4WEBL 4GG8A 1KCRL 5DFWH 5IB5A 4H20H 4GLRI 1TZGH 3MJ8A 1V7ML 3I50H 3NZHL 4ZXBC 3VD4A 2AXGB 1CTNA 1SQ2N 3MJ9L 2YC1B 3R06B 5KVGL 1Z9MA 3QWRA 4O9HL 4K7PX 5HYSA 3QI9A 3B6SA 5D72H 4QYOB 1FSKB 4AL8H 3BW9A 4ELKB 1EK3A 4YHMH 5GS1C 2IJ0C 5CEYB 4F58H 4JPKL 3BGAA 5L7XH 3NOIA 1AO7E 4OF0A 3NCYS 3FB7A 4UIKH 3H0TA 3Q6FB 2AP2A 5JHDD 3BKJH 5DMKB 2JB6A 4WFFD 1YMHB 2G5BB 1T0MB 1Q9LA 1S7VA 4Y4HC 5DURD 3DBXA 3RKDD 1BBJB 5D1ZA 1GGUA 3IETA 4HDIA 4NSKA 3AM8C 4ZUVB 3CPLB 3RU8L 3I2CL 4Z7OF 3RZCD 1YC8A 3PABB 3FL7A 2BJML 1CFNA 1MNUL 3IFOB 2IG2H 1UJTA 4NBXB 1BZ7A 2UZYB 4FQXD 4MB4A 1EAJA 1EZVX 4HIIB 4OZIA 4H1LB 4CU7A 2BNRD 4YUEL 3S98A 3MCLL 5HPMB 5EO9A 4K7FB 1I9JL 3VFSA 2FO4B 4I4WB 3MBEA 4Q6IB 4JFXB 5I75B 4FFYL 1XIWB 5A16B 3GMMB 3KWWA 3HNVL 4F15C 5DJDA 4E42A 4X7SH 1N64L 4X80L 1S7SA 1Q1JH 3WKML 1TMCB 2K9UA 3I6LD 4OLYL 4GRMA 4KXZH 4UDTA 3DETD 1R5WA 5LGHH 4GMSL 3BEVB 3FRPG 3H7LA 3F8UB 3QUMH 3VFGH 4HJGB 4YQXL 1S5IH 3OKEB 1BMGA 4JB9H 5E4EC 2HT3C 1SMOA 3V6OE 2P49B 4U1NA 4G8GE 4TULH 1DQLH 3QDMA 4HKXA 3L5XH 3V4VL 3HE7B 4HEME 4OZGF 4ZG1A 2W0PA 1CD8A 2APVA 1F2QA 1NBVL 2YN3A 5FYLE 5J9PB 1RULH 2CMRH 5AZ2L 1ZVSA 1ZHLB 3GSOB 5HDBE 2Y06L 3HUJE 2B1AL 3PP4L 1TTGA 2VZTA 3MRKB 1F11B 3RIFK 4HIEA 4J4PA 3X3FL 4OFYD 4J6RH 4PJ9A 3ZDXE 4YX2H 2QTEA 5D7IA 2VN4A 1ZKAA 4LCCC 4MMXC 1BQUA 5E08L 1EHNA 4RAVB 1FL3B 1H5BB 1F3JA 5ADOH 2VZ1A 4Y16B 2VXUH 4QRQA 5GGQL 2CUMA 1UM5L 5MEOA 1LNUB 4KVCH 4LCIH 3MLYH 3M17B 1UEMA 4ELMF 2P24B 1XIWD 1KCSH 1MELA 3QHZL 4OCNC 2VSDA 4GRLA 4LEXL 1IZJA 4PRAB 1JHLL 3O45B 2XACC 4P4RA 4WTZG 3GIZL 3U36A 1EFXB 2NQCA 3BEWA 2XXMB 3KPQA 5E8OB 1G7PA 2YD4A 3LB6D 3S88L 5EC1A 3MLXL 1M1SA 4AENB 2R1XA 3PWPE 4JG1L 5T3XD 5JPNB 5C1MB 3BYTA 4WO4A 3IFLL 4PUBH 5M94B 4JZNA 5HYJE 1YY8B 1HKFA 5D8JH 2MMXA 4CDGC 2B1HL 3HE7D 1ONQB 2DM7A 1FZOA 4J3UA 1XGPB 4HWEH 1FH5L 4HKZB 4XPAH 3S8WA 3UTPE 4JM2A 5C08A 1CQYA 1OAQL 4XBEL 1HHKA 1JNLL 4M4PA 1TVHB 5JW3L 1EEZA 4PJEA 1OB1B 3T0BA 1ULVA 1KTKE 5BOZG 1U8HA 2RB8A 3QCUH 1QNZH 4P5TA 1LMKA 4NN7B 2XRAH 2VDLH 3O3DA 3QFJB 4PRHA 4XGZA 4Y16D 2XKNB 4LHUB 3QPXH 5E1AB 5LGJA 2FEDD 1OPGH 4U1HA 5D6DA 1NCDH 1P7KA 5EU3A 4NO0B 1J88A 5TF0A 1U6AL 2A6JA 5LKNA 1S9KC 5F7WC 1HYSC 3PWVA 4F7EA 3GSNB 1EFXD 5DEFA 3GJFH 4XCFL 5FUCE 3GZKA 4N8CH 3VFMB 3ARBC 4LKCB 3BH8B 1IGYB 2J8OA 4N0YH 5TDOA 3C2AH 1CXLA 1EHLH 5HDQH 3SO3B 2PYEB 3T3ME 1UWGH 3CFJA 4X5XB 4OZFH 4EDXA 5HYSG 4MQXD 4UINH 5GGSA 5L88H 4GBXC 3FONB 3QRGL 1INEH 4IHOB 4KVNL 1HDMB 1TZGL 3I50L 4D9RE 5JA8B 2FZ3B 2PXYB 3ZE1E 1X3DA 5C09E 5DA0B 1QO3A 1NLBL 4MZ2A 5B8CB 1P9MA 4YHML 5L7XL 1UM4H 3MROB 4HG4K 3EOTH 4X7EC 2WUCH 3KPOB 4UIKL 3RNQA 3BKJL 1G0YR 3O9WD 4CN4A 4CKVX 4G6MH 3QSKB 4YLQT 3QFJD 5HHOE 4LHUD 3CMOH 3RGVD 5T1KB 5HGHB 2VDMH 2XZCH 1DQQB 3BP7B 3TBWB 1W72H 1ZA6A 3AB0C 3Q3GA 3LMJH 1C5CH 4R90H 4NO0D 4XH2A 5I1LB 5KVEL 4PJHB 1X5GA 5T33H 5IB2A 5DHVH 4XZUB 3MCKA 1LVEA 2D4FA 3SDAC 1A6WH 4JREC 3QT2A 3N9GL 4P2RA 3S4SB 1FYTB 4LVOB 4MNGA 1MF2H 3S37L 3QG6B 4OSUH 1U8MA 4M1GH 5F9WC 1WBYB 4S2SB 4GRWE 2ZUUA 1QLFB 4PJ7E 4BQ9A 2V2XB 4B5EA 3OBAA 4O58H 2PYED 3CFDA 4B7LA 3KYMA 3BQUB 5DUMH 3EW3B 5ERWB 1IC4H 3RL1A 1K4CB 2DQIH 2J12B 5IIEA 4OLZH 3WN5B 5LGHL 2I26N 4GAGH 3MMEA 1BX2A 3QUML 3WD5H 1HKLL 3HZKB 1PG7X 2EEBA 4AQ1B 4XVUD 5IB4B 1GZQA 4YHIB 1OAZH 1J1XH 1BHGA 4KTDH 3VXOB 4JB9L 5JDSA 1UH2A 3B9KC 5DS8B 1OL0A 4FQJH 1WIPA 4MMZC 1U42A 4TULL 1DQLL 1R5IA 4UOW0 3L5XL 4QWWC 1BM3H 2ILLA 2GTZA 4PTTB 4NUGL 4XNQB 3IRPX 5KTEH 3HI1A 1BIIA 4MZ3A 3RQ3A 5T1KD 5TF1L 3DX8A 3SKJL 5F6IB 2PTTA 5DLMH 3VWJC 4E5XA 1NPUA 1RHHB 2ZWLT 4TVPD 4V1DE 2NTSP 1TJHH 1EHAA 4Y5YB 1UFUA 4J6RL 4MX7B 1T03H 1ZGLM 1J0JA 2Z35B 2VSCA 4ZUSA 1JI2A 1FYTD 5I9QB 4G6FD 4QTIH 2VXUL 1JYXA 1MRDH 4KVCL 4LCIL 1N3NB 1SYSA 3MLYL 3QI9C 1WQVT 2AJZB 2JELH 2DQDH 1FCCA 3U46B 3QO0B 5KVFL 4QHKI 1H3TA 5IWLA 4HMEA 5DHVA 4DGIH 4G43A 1G9MH 3F7QA 1RV6X 1YDPA 3BQUD 1YN6B 3RPIB 1FORH 5I0ZA 3H2WA 3X13A 1OP5H 2GT9A 4O2CB 1SJXA 3EDJA 4X4YB 4XB8A 4NZTH 3MRQA 2IC2A 2FR4B 4HWZA 3WHXA 2GUOB 1IM9B 1G7QB 2ICEA 5C0CD 5KOMC 1YECL 2A9MH 4NNYA 3A67H 1A4JB 2W60B 1ETZA 3BDXA 2W92A 4JFEE 5D1QD 1OM3H 1CIUA 2VLJE 4JY4B 3SCMB 4YHNB 5F97E 3MREA 1T66C 4YXLH 1ZT4A 2VDPH 3VE0B 1S3KL 5EZOH 4PUBL 1NEZB 1A6TB 4N8VA 4NQCA 1WWAX 4NO5B 5D8JL 4R4NC 4A6YH 4F9PA 5GRYA 3BWUC 4OZHE 1CGWA 3ZL4H 2VIRA 4XPAL 4I18B 4DGYH 2NY2B 3FFCB 4HLJA 4RA3A 2BY3A 5MI0B 1D5ZB 4NUJB 3M1BA 3QISA 5JZ7C 3K80A 4ONOA 4L1DA 1DE4A 4PJDA 4PRBA 2FJHA 4EDWH 4Y5VB 1IEAA 4N0CD 3QCUL 1QNZL 1TTFA 5TDPA 2XRAL 2VDLL 1QSEE 5IMLB 2J8UA 1A0QH 3QPXL 1KJ2B 3HPJA 2IEPA 2HKHH 4LOUD 1OPGL 4DKEL 5SWZE 1I1AD 4XXDB 1UB6B 4JFFE 5MENB 4YHYB 5F9OH 5FO8A 4WUUB 4XMKH 5E6IB 2R15A 1Q8MA 1ZHKB 4MJ6A 1YNLH 1JE6A 5ETUA 4ZFOL 1T1WA 1G84A 4N8CL 3AMKA 3MBXH 1AE6H 4MB3A 5I6XC 3SCMD 4N0YL 5T5NF 4XPFH 5IW1B 5HDQL 2F54B 3P9LA 1UWGL 1KLFA 4UINL 5L88L 3WMSA 3VD5A 5CZXD 3PJSA 1INEL 1IBGH 4I77H 1T2JA 2WP3O 4WI6A 4YDVB 5L2JB 3PGDB 3RWHB 3HZYB 2NY0B 5I0DA 4EQ2A 4JRXA 2FRGP 2NY2D 3FFCD 2CUHA 5BW7A 1FYHB 4H8WH 3BISA 3CK0H 4NNXB 3KXFE 1AP2B 3N85L 4AM0B 1XGQB 1UM4L 5E2WH 3EOTL 2WUCL 2JCCB 5C0FA 5TE4H 1WTGT 2XA8H 3ARDB 2YEZA 3ILPB 4TPRH 5AEAA 2WBJB 4PRDB 1IM3B 3L5WA 3CMOL 3PWJA 4F7MA 3GBLA 3RVWD 2VDML 5F71A 1HOCA 2XZCL 3MUY1 2X4TA 5A2KH 3LMJL 1A3RH 1C5CL 5DJZA 1FFOB 1FGVL 3BWAB 4R90L 3RY4A 5MEND 4M6OH 5IF0A 4YO0A 3MR9A 3SGDH 5T33L 4NFCA 4QRPB 4WUUD 5E6ID 2EDOA 4O4YH 5FB8B 5I8EB 4E41A 1A6WL 5ALBL 3SJVE 4DEPC 2X4NB 4YGVB 4Y7MA 2BRRH 1MF2L 2C5DC 2X10A 4OSUL 3Q1SL 1T1XA 4M1GL 3ZKMD 3DIFA 3HCVA 1XGTB 2IALB 1WGOA 4JEGB 4OAWA 4PJGB 2HFEA 3D18A 4O58L 4JANA 2LV4A 3WFZA 1WIOA 3AREA 3BZDA 3IAQA 1SM3H 2C1PB 1FLRH 2EDTA 2ZG1A 2DQIL 5EUOA 3SDXA 3O3AB 1H8SA 1AXSA 3PHSA 1UH4A 2J4WH 2IMMA 2H8PB 3OXRA 4GAGL 3STLA 2YSSB 4Y4KA 2DBLH 4PGCB 2NY0D 3L3HA 3WD5L 3E6HA 3G6DL 5D6DC 2HTLC 4QRTA 1VPOH 4NKMB 1J1XL 3KYNB 2AJSH 3W39B 5IW6B 4FTVB 4DZBB 4HXBH 5IBUB 1B4JH 4JM4H 1JRHL 4PJ5E 3RBSA 3C5ZB 4LPYA 1BM3L 5JOPD 3PL6A 1X5YA 3FB6B 3V4PH 2GJZB 2WBJD 2VO5A 4KTEH 1I7ZB 2FH6A 4XBGB 1DEDA 1OAYL 4YR6A 2MQ3A 5DYOA 3QIUB 1U3HA 2L4OA 3QNYA 3VCLA 3WEXA 5DLML 4ZAKC 2IH3A 1EJOH 4LQ1A 3ZSTA 4NT6B 3V52H 3TV3L 1YEGL 2FCBA 1JP5A 2W07A 2EDNA 3P9MB 3I6GB 4JJ5B 5DFVC 1JL8A 1TPXB 2P5WB 1T03L 3T1FA 1YEDA 4PJXB 1CBVH 2HFGH 1ROWA 2R2EB 5LGKA 2C3GA 4NHUA 1MJJB 2EDBA 1PZ5B 1Q9KA 4NWUH 2GJ6E 2JELL 2DQDL 3L9RA 4Q0XH 4HJ0C 2DQFB 3MYJA 1P9MC 4UQ3A 3GSVA 3C09C 4I0PB 4IIQB 5EPMB 3TYFA 3P2TA 4JPIA 2XZZA 1G9ML 4DGIL 4EUPA 1U93B 1HYRC 1FORL 4Z7QF 3R1GH 1Z0MA 3QO1A 4NZTL 1TQBB 4HS3A 5GXBB 3U7WH 1KJMA 1JK8A 1CFBA 2WNGA 2QEJA 4N8VG 2A9ML 4UT6H 2XFXB 5DRWB 1MHPL 1OGAE 2W1NA 4H5SA 1OM3L 3WFCH 3FCTA 4MQSB 1NAMH 5HDOA 3QWOA 3TP4A 4YXLL 1A14L 2BMKA 4PJCA 2VDPL 2ZOLB 4MAYC 1WWCA 4OLWH 1D9KD 4H0HB 3C5ZD 4NRZA 1MOEA 4IOIA 4L4JA 3ZL4L 4GFTB 3VXPB 2OTWB 2UVEA 5K33A 4EXPX 1BLNA 4QCIA 4QHLB 1T5WB 3RRQA 3QIUD 5C8JB 4DGYL 2XTJC 4HK3N 3LV3A 1QFWL 2WBKA 3DMMC 4OJFH 1F4XH 2DWDB 3CSYA 3PP3K 4U6HB 3T1WA 2IFGA 4GT7A 5IHZB 3FT4B 3P11H 1IKNA 2VE6A 2X4RA 2P5WD 1DBAL 4EDWL 2FYYB 1YY9D 2P8PA 4L8DA 3OF6A 5J3HC 4PGDB 5E5RB 1A0QL 1Y6KR 4IMLA 2HKHL 1QEWA 4P23A 4PGBB 5EOCH 4KK5D 1GC1L 3GSQA 5TE7H 4KJWC 4YJZL 3DV6A 3JWDH 1DQDL 1A6VH 5F9OL 3DRQB 1CN4A 2LE9A 4XMKL 1MHHA 1BGXH 5DZOA 5DZLA 4X83A 3T4YB 3ULUD 3MACH 4JQVA 1H3XA 5FYJL 2EDJA 2EDQA 3UEZA 1G7IA 1EERB 4XBPB 2XICA 5IHLB 2D0GA 5ITFA 3RUGA 2BX5A 3DV4B 3MBXL 4PJXF 1AE6L 1A7PL 4HH9B 1S7UA 1RZJH 3HNTL 3NFNB 4U1SB 4Z0XB 3V6FB 2YUXA 3N1MC 4TNVK 2ADJB 3ROOB 1GGBH 2EIDA 3W0WE 1A4KA 2AJVL 2DI9A 4TUOA 3IDYB 2CDFA 4PJFB 3U0PB 1IBGL 1CXKA 4I77L 4L9LC 4YAQA 3WJJA 3TFKD 3IU4H 3HE6A 5DRXB 3MV9B 3QQ9C 1NAMA 1PKQB 4H8WL 3VGBA 3F5WA 1DVFB 1FVDB 3HC4H 4RISH 1NUNB 5LJYH 2CLZB 5E2WL 4PYGA 4DKFH 3MV8E 5E5MA 4OLVH 5IVOA 4HWNA 5TE4L 5A2FA 2ZKHH 2XZAH 4TPRL 1CE1H 1QVOA 3NGBB 1WAAF 4Y4FB 4IRSA 3UTTA 5EULV 3EOBB 5I30H 3JV6B 4EEEA 2E6JA 4RGOH 1A3RL 4WHDA 5IVZB 3CVHH 4DOHE 5IFAH 4M6OL 4X99A 1U8IA 3MOAL 4TUJA 2KPNA 3AS2A 4Y19B 3MV7E 4O4YL 1MFAH 2OMBA 3LKPB 5IVXA 1WC7A 2X9WA 3O11B 3O3UN 2BRRL 1NMBH 4EI6B 4WI5A 2CSPA 4X7DC 2RCSH 4YC2C 1OTTC 3SDDA 1UEYA 3BDYH 4PD4J 1S9YB 4M5YL 3HAEH 4M9PA 2KL6A 3DNKA 3S3SA 2WANA 1CXEA 4OQTA 5J13C 3VRIA 1SBBA 4NRYB 4JFOB 1TIUA 2OBGA 3OHXA 3TBVA 1FZKB 2DBLL 4HCRA 5GGRB 4ORGA 2FX7H 3QA3B 3QDHA 2B39A 3FFDA 4YWGL 2AJSL 1R3KB 3G5YB 5ID1A 5CIPB 1BQLH 1Z6JT 5CSZA 4NC1E 1H15B 3WO3B 1RVFL 4HXBL 1B4JL 4JM4L 1E28A 3QDME 3QFDA 5JQ6H 1ACYL 4D0CA 1FNAA 2A6DB 2CQVA 4JFHE 3V4PL 2RR3A 3QXUA 4Y4FD 4KTEL 1U0QA 1S7WB 1G9MC 4GKSB 5IV2B 3QUXB 4PJFF 3C6LB 3MZGB 3TH4T 1EH9A 1OW0C 4L4VB 5I16A 3VFWA 1EJOL 5DO2C 3P4OA 4ZFZA 3V52L 5D7IE 4PGEB 4HUUB 4OCSH 4P4KB 2XXCB 4Y19D 1C16A 1JN6A 1FPTH 1G6VK 1F8TH 2R0ZH 1CBVL 4EUPG 1BVKA 3HA0A 4X5LA 4X9GA 5CEXB 1FFPA 1FZJA 1OWRM 2ATPA 1A6UH 4IOSD 4NWUL 3CVHA 3CUPA 4Q0XL 4PJ8D 3ARSA 4FXGA 1A9EB 3SBWC 3JXAA 2IBZY 3T2PA 1U8QA 1J1OL 3JUZA 2Q86A 3SGJA 4PG2A 3RP1A 2MHAA 5E0QA 3R1GL 4KKLD 3F65A 4YDKH 3IDNB 2I25N 3TZVD 2AS5M 1ED3B 3U7WL 3RZCA 1IAIL 3DUSB 3O2DA 3VXMB 1RUKH 3OWEA 4TNWF 1O5DT 4PP2B 1MWAA 4I9WD 1ODAA 3WFCL 3BMWA 3HAEA 1MVUA 4FQXA 2QSTA 5I1IH 3GK8L 2WIIA 1NAML 3MFGB 2BNRA 3DTXB 3LZFL 4LLDB 1KT2A 2FIRT 2HVJB 1XCQA 4OLWL 4UMGA 2A74B 1E0OB 4ODVL 2EIEA 1I85C 5D7JD 3ULVL 2VZVA 2RGSA 5J89A 2YPLE 1GC1C 4OB5L 4KJPC 1UM6H 4FP8L 1DCLA 4ORZC 3QUXD 2D3VA 3GRWH 3C6LD 1BFOB 2KZWA 4JDTH 5C08E 1CFSB 5GIRB 4L4VD 5LVEA 1F4XL 3P77A 4KKCD 2AXGA 4NQDB 4NHCL 2JLLA 4ZO7A 4XMLH 1BEYH 4X6FB 2YC1A 3P11L 3R06A 2ADFH 4JRWA 4KKNA 5F7DB 3NZ8B 1I75A 4QYOA 1C7SA 4ELKA 5CEYA 4PR5B 2C3VB 4X6CE 3RWEB 3L6FB 4JE4B 3Q6FA 2PYFB 3JUYA 4JFDB 1AHWB 5DMKA 3SN6N 2NY6B 5EOCL 1YMHA 4MWFB 3RDTB 2G5BA 1T0MA 3V0VB 5L0QB 5CBEB 4PJAB 4HF5L 3JWDL 2FB4H 1A6VL 2DL2A 1BBJA 2OS7A 1N26A 4APQC 4ZUVA 4OKDA 4F7PB 4S1QH 4JKWA 3CPLA 1WZKA 1XMWA 3RTQB 3MACL 4H8WC 3PABA 4OFYA 3VXMD 1JUFB 2YS4A 5JR1H 1P4BL 1LEGB 4G9DB 3AUVA 4HIIA 4N0UA 4H1LA 4CMHB 5HPMA 4Q9QH 2APWA 1GGBL 4K7FA 2FO4A 4G8FB 4I4WA 5LQBH 3EYUL 3C5SB 3EJYC 4Q6IA 2NX5B 5IT2H 1SJEB 4JFXA 3GMPB 1XIWA 5A16A 3GMMA 3IU4L 4RZCB 2FLBT 1C5BL 3WS6C 3RY5A 3TO2B 1X9QA 3VW3H 2Y25A 1I3RB 4WW2B 1MJUL 3BEVA 2X41A 2GSIB 2NY4B 4WHYG 4ZOBA 3Q5OA 5DD5L 3HC4L 3D2UB 4NQDD 3OKKB 5E4IA 2KDGA 4HJGA 5EFIB 3FO2A 3HG1B 4I0KA 3OKEA 4HXAL 4X4XB 4N90E 3SPVB 3WNPA 4OLVL 1CGUA 1T0NB 5DVLA 1URLA 2NXZC 1HHGB 4YE4H 4L8SC 2DLEA 1Q72L 2ZSVB 1YQ2A 5DK0B 4JFDD 4LVNB 4NN6C 3HE7A 2NY6D 3VFVB 2R1YB 5I30L 3RDTD 1M05B 2VAJA 3CVHL 5J9PA 1INQB 1NSNH 1E4KA 5IFAL 2F5BH 3KYOB 1ZHLA 3GSOA 3QDJD 3BX7C 5F21B 1K3IA 4JY6B 2Z4QB 2PUQT 1LK2B 4I3SH 4F2MB 3MRKA 4YHLH 5CCKH 2CPCA 4P2RE 4X6DB 3RTQD 1F11A 2Y5EA 1NMBL 3H3KA 3LIZH 4MNGE 4ZTPL 3PQYB 4XI5C 1FL5B 2RCSL 4QXUH 2RBLA 1CGSL 3B3IB 1FL3A 4RAVA 1H5BA 1PQZB 4Y16A 1MWAL 1LNUA 4CW1B 4POYA 5KJRH 5DC0A 3UPAA 2EDWA 3ZDYE 3M17A 1H3WM 2NX5D 3CLFH 1WBXB 1KCUH 2P24A 4PJAF 4P2CG 3BIBX 4M1CC 3T0EC 4P23C 1DL7H 2ZUQC 2FX7L 4PRAA 5HJ3B 1HQRB 3O45A 4RQQB 1IFHH 4JR9H 3VJ6B 2NY4D 3TN0B 1J8HD 1EFXA 2IAMB 4XP6H 3D2UD 2PN5A 4RX4A 1BQLL 3D48R 5E8OA 4WGVB 4IDJH 2LFGA 5I74C 5JHLH 1AFVH 4ESKA 4AENA 3LY6A 1KPVB 4PRPB 4L4TD 3G5XA 5JPNA 4KH2A 1D5IL 4KK8C 5EDXA 1NGQH 4QGYA 4OCWH 1YY8A 1DTUA 4XPTH 5JO5B 5JIHA 1KN4L 3X14B 1ONQA 1S8DB 2HKFL 4ZS6C 3VG0H 1TNMA 2CO6B 1XGPA 1MCOH 1OOAA 3ES6A 4HKZA 1CGXA 4WW2F 4C55A 4XWOC 4OCSL 4JGUA 2IMNA 2HLAB 2AI0H 1FPTL 2R0ZL 1F8TL 4BQ6A 3VFOB 2Y5TB 1TVHA 4GLRH 3PQYD 1OB1A 2HT2C 2PO6C 4LLYB 4J23A 1A6UL 1A7OH 4C83B 3O9WA 3KLSA 2R4SH 3QFJA 2XKNA 4LHUA 3ULVC 5E1AA 3VXSD 5J1SC 3MZTA 1P2CB 2P46B 43C9B 3FHQA 1JTOA 4NO0A 2NMSA 3V5DB 1RUKL 3WBDA 4EQ3A 4I48B 2EXYC 2VLKB 4OLUL 3IU3B 4LGSB 5CD5D 5I1IL 3GSNA 1FIGH 2ICES 2EH7H 3TN0D 3NA9L 2DJSA 3BE1H 5F8QC 3W82A 1R24B 5GZNC 3BIAX 4HEPG 4WCYH 3VFMA 4NQCE 5JMRA 4LKCA 3BH8A 4ZFGL 2B0SH 1IGYA 5DC4B 3UO1H 1HWHB 1NMCC 1AH1A 2BZDA 5BS0B 2PYEA 4PRPD 2J1KA 2NYYC 3ZTJG 4X5XA 1ES0B 1OP5K 3JWDC 3QQ3B 1UM6L 3FONA 3SDDC 1SJVA 5T3XL 2NY1D 3GRWL 2VB5A 4IHOA 4JDTL 1HDMA 2DI7A 1AXTH 3VRJB 4XHJD 2FZ3A 2PXYA 4KMTH 2DKMA 4UDUA 4YBLC 3BKMH 5F1NB 5GS0D 3H42H 3HHRB 4KUZL 5B8CA 3P30H 3H9YA 3FHAA 3MROA 1RZJC 2J8UE 1ZEAH 4PS4L 3KPOA 2XY2A 2LTQB 2HJFB 3R4DA 5FHAL 2MPAH 1PG7W 1N6UA 1LEKB 4FFVC 2X4QB 5IFHL 2Y4SA 5D9SB 2W0LA 5CINH 2C7UB 3OKDB 4Z7UB 2FB4L 3BN9C 5CJ5A 4DAGH 5HGHA 5T1KA 1DQQA 2VLLB 3BP7A 4H1LG 3TBWA 3UJIH 5MHSD 3DVFA 5IBTH 1E4XI 2AXFB 5I1LA 2DBJA 3GMNB 5D7LE 1QFUH 1K6QH 4PJHA 2PW1B 4XZUA 2VLKD 5JR1L 1QHOA 3S35X 4CVUA 3MV11 4MNHB 3S4SA 1FYTA 5EIVA 1QP1A 3QG6A 3QUZC 4KROB 1F13A 4Q9QL 2A0LC 1WBYA 4X98B 4S2SA 5LQBL 5IT2L 1MFBH 3RJQB 3ULSB 3LKSA 1QLFA 2V2XA 4S1RH 1EUUA 5BS0D 3MPCA 2EDLA 3QBTB 3BQUA 5JXED 3LN9A 4BZ1H 5HD8D 3IFPB 5ERWA 3VW3L 3LN4B 4JRXE 5C07B 1UCBH 1K4CA 3BAEH 5HDBF 2QL1A 4ETYA 1XH3B 1YEHH 3DECA 3WN5A 4WV1B 5C0CA 1LEIB 4PG2C 3RKDC 4ODWB 3L7FB 3V7AG 1A2YB 1Y18A 4OI8A 3HZKA 5IB4A 4WI8A 5D1QA 3MRIB 4YHIA 3RZCC 3BKYH 2RIKA 3VXOA 4O00A 2ZCHH 5DS8A 4N5UA 4YE4L 4DGVH 4FQXC 3CFEB 4HKBB 5AD0A 2H1PH 4WTXA 1KOAA 3QXDB 5GGVY 4PTTA 1X5FA 4XNQA 1CYGA 1LILA 1NSNL 1EA9C 2F5BL 2GW5A 1AC0A 1B9ZA 1S78D 2XQBH 4I3SL 1RHHA 4E41E 4YHLL 5CCKL 3KPTA 3LIZL 4Y5YA 5B3JF 4MX7A 2DLTA 3QZWA 4BH7B 2Z35A 2JK5B 4QXUL 1JGDB 3DETC 3O4LE 4OZ4B 1P84K 3W11C 1H0DB 3VRLF 4X4MA 5KJRL 1SVZA 1N3NA 3KG5A 3EYQD 3D0VA 5ISZD 2AJZA 4N9GB 1VENA 3U46A 3QO0A 5E8NB 1IAKB 3SDXE 4C54A 5IEHB 2OR7A 1KCUL 2EDFA 2ERJB 3RIFF 1IC1A 1YN6A 5C3TA 3RPIA 1JPST 4O2CA 5C07D 4X4YA 1I1YB 2FR4A 4K71B 1TJGH 2GUOA 3CZFA 1G7QA 4XNYH 3BPOB 4HKJB 3WLBB 3HNSL 4JR9L 4XP6L 1RJZB 3D3VB 3AFLA 4LU5L 2BY2A 1A3QA 4FXLA 2W60A 2YD5A 5DRZB 3OQ3B 3B83A 4OGXH 4JY4A 3NIFE 3SCMA 4IDJL 5GSRB 5E00B 5JHLL 1AFVL 1VGKB 2DMKA 2OTPA 5I1KH 3CU1A 4NKDB 2QSCH 3VE0A 1NEZA 1A6TA 2OI9B 4UNUA 1NGQL 3M8OH 4XPTL 4NO5A 3WLWC 3VFPB 2W0FB 3UMTA 2BVYA 3VG0L 5KSAB 4OIIH 4Q6IC 1MCOL 4I18A 3FFCA 3HZMB 1XIWC 4OBSA 1DJSA 1OY3B 1WISA 4LHUG 1D5ZA 2AI0L 4NUJA 1GAFH 5CGTA 4DN3H 2Y9RT 4JZJB 2VMFA 5DVNA 4TVPL 1NGPL 1NJ9B 3ESVF 2Q8AL 1A7OL 3L3GB 4Y5VA 2QQNH 3DXAD 3P4LA 3NCCB 2R4SL 5IMLA 1QQDB 4MJID 3LB6C 1KJ2A 3T3MF 2F74B 2XOTA 1RJLB 4U7KA 2AQ3A 4XXDA 2AQ1A 3O6KH 25C8H 1UB6A 5MENA 3AGVA 3E0GA 3HKFA 3T3PE 4WUUA 5E6IA 3ZE1F 5HY9B 2GJJA 2OCFD 1LE9B 1ZHKA 1G6RH 1FIGL 4XCEB 2EH7L 3BE1L 4YHPB 3RL2B 5FYKD 2IPUG 1ND0B 4WCYL 2AJXH 4AEHL 4ZXBB 1KF9B 3AS0A 1NC2B 3UO1L 5IW1A 2F54A 3KPPB 3THML 4M7JH 3ZLQC 3HTLX 5CILH 1A7NH 1S9XB 2E7MA 5F3HB 1X4XA 5GS1B 2I27N 3S5LB 2Z31C 4YDVA 1AXTL 3VDAA 5D4QA 3QB7C 5L2JA 3PGDA 2FEDC 5KSAD 3HZYA 3RWHA 5DD1H 1I3GH 1OQXA 2D9CA 1QA9B 4Y4HB 1ZOXA 4XAKD 4NNXA 3H42L 1AP2A 1E6OH 3CFKB 3P30L 2A1WH 2JJWA 4AM0A 1XGQA 2A77L 4NM4H 2JCCA 1GGIL 2H3NB 2P7TB 2MPAL 5E8EB 4Z95H 1I7RB 3ARDA 2JJVA 3RNKB 5IQ9B 5CINL 2WBJA 4PRDA 1IM3A 1DBBH 1GHFH 1QYGL 3S4SG 4F37K 1UACL 1FZMB 2IQAB 5EB9A 3UJIL 5IBTL 1HCFX 4BSVB 1FFOA 3BWAA 3CFBB 4MQXC 3MLSL 4KHXL 2AK4B 4QRPA 3RUGE 5BZDB 5FB8A 5I8EA 4M48H 5EU6B 4F15B 2EO9A 5I17B 1U8KB 2X4NA 2ZNXA 4YGVA 1RAMA 4K9EL 2F53D 1XGTA 4XP5H 1M7IB 2IALA 1GOGA 1NC2D 4PJGA 1VESA 2VAAB 4S1RL 2C3WA 1FG2B 4BZ1L 1NFIB 1CL7I 2R69H 3O9WC 4KGLA 1UCBL 2C1PA 3BAEL 2DIJA 5E4EB 5H94B 2KUTA 3O3AA 1OTSC 1YEHL 3RGVC 2H8PA 1B0RB 2YSSA 1U8NB 4PGCA 3TPUB 1S7XB 3V8CA 3KNBB 3NN8B 2F15A 3SKNB 2J2ZA 3MLUH 2NZIA 4QHUB 2NPLX 4Y4HD 2DLFH 5H2BB 1BF2A 4NKMA 3KYNA 3BKYL 3W39A 2DQGH 4KU1A 5IW6A 1NANI 2ZCHL 1UVQB 1KXTB 4DZBA 2PCPB 3EFDH 5EOQH 3O4OB 3UTTE 4U0QB 4MXQD 3HZVB 2H1PL 3C5ZA 5FIEA 2Y7QB 3CXHJ 1RZ7H 1UZ8B 2BOBB 1JGUL 3FB6A 2GJZA 4YHOH 4XBGA 3OG4B 4JGJA 3QIUA 2XQBL 4LCCB 1ZLUH 3NCEB 3SKUD 5KOVC 4YFLI 2WM0A 4L29B 5HGBB 2EYSB 3QIBC 2VRAA 3RVUC 3VG9C 1S7RB 4NT6A 4BH8B 2AK4D 3QXAB 15C8H 1L4IA 4WFEE 2MKWA 3P9MA 4JJ5A 2P5WA 3WSQH 4DW2H 4PJXA 5EU6D 1J05B 3KPSB 2R2EA 1MJJA 3JV4B 4FQIH 4XVUC 4JRYD 5E7BA 4NKOB 1PZ5A 5B8CC 5DFTA 2DQFA 1DP0A 1A21A 4I0PA 4IIQA 5DVMA 5EPMA 4OZHF 2QR0B 4F7CB 1U93A 1J9CT 4FNLH 4OT1L 2UV3A 3NPZB 2HT3D 3PDOB 5TQ2H 3FN9A 1TJGL 4XNYL 1YMMB 2QQLH 1NEZG 1FE8L 1NAKH 3ME0A 3MLWL 2XFXA 5DRWA 4FA8A 1Z9SA 5F9DC 4OGXL 2DD8H 4XCCH 1IMHC 1MI5D 5I1KL 5CEZE 3INUH 2ZOLA 2QSCL 1ZVHA 5AWNH 4LFHD 2IPKB 4R7DB 4ZO8A 3FQTB 5CJXC 2UWEB 3E3QC 1VFBB 4RFOL 3BJ91 3VXPA 2OTWA 4Z7OE 4OIIL 4QHLA 1T5WA 5C8JA 2DWDA 3GO1H 5B22A 1GAFL 4U6HA 1A8JH 4ZPTB 5IHZA 1F02I 3FT4A 1OP9A 2H45A 3GGWB 2WWKT 2YKLH 5B39A 5HVHC 1IRAY 4WFFE 2FYYA 2VL4A 3D39B 3KPSD 2QQNL 4U2YA 2VC2H 1MCIA 4PGDA 2OJZH 4JLRB 5D1QC 2JE8A 4PGBA 2H6PB 4ODHH 3OB8A 2Q7YB 3H7BB 4MGXA 5BZWB 3PXHA 4OCLC 3IKKA 3O6KL 1L0QA 3MX0A 25C8L 2YUVA 3MLZL 2BHZA 2HVKB 2VQ1B 2VWEC 3PWUB 4XC1H 3RVXD 3VDCA 3SGEH 3DRQA 1JBJA 3PG2A 1BD2B 4YXKH 1VHPA 3T4YA 3EKCA 4DVRH 3QUYC 4KPHL 1KTLB 1VERA 2BNRE 4XBPA 1XGUB 4U1IB 3VI3F 2CKBH 3DV4A 2AJXL 4DK6A 2C3XA 2XN9E 4HH9A 1UGNA 2APTA 5DUBB 2Q87A 3U83A 4Z0XA 3NFNA 2HYMA 4OZGE 4U1SA 3V6FA 4XP4H 2ADJA 4OD1H 3ROOA 1T7YA 4M7JL 5DXWA 4J12A 5CILL 3GSRB 1A7NL 4N0CC 5HHVH 2CH8A 5D6CB 4N1CA 4HS8H 5C0BB 4PJFA 3U0PA 1MFDL 4R7NB 1FFRA 5DRXA 5DD1L 1I3GL 1KACB 3N1PC 2A73B 3ARFD 5JUEH 1I1AC 5ACLA 1PKQA 5CJOL 4OF8A 1DVFA 2OR9H 1FVDA 3U6RB 2V6HA 4HGWB 3KPNB 4NM4L 3ARTA 3AB0B 2J6EA 4Z95L 3ZTNL 3D39D 5CMAB 2NR6D 2E8YA 12E8H 1WCBB 2W65B 4Y4FA 1JFQL 3SDAB 3SCMC 4JREB 4U49A 1HYSD 2MCPH 3EOBA 3MRMB 1CLZH 1U8OB 2UWEF 3JV6A 3TT3H 1JCKA 3RI5K 5GGTA 5IVZA 5F9WB 5CJBA 1RIUH 5FDWB 2DAVA 3ZYOA 5CZXC 2EEDA 3VXUB 4JPWH 1BD2D 5KZCD 4Y19A 1WT5A 2OP4H 3LKPA 4M48L 5HHNB 1P4IL 3O11A 3SOBH 3H3PH 4EI6A 4G80B 3W9EB 3ULUL 2NY2C 2VDQH 3LKOB 4KAQL 5E2TL 2DYPD 5LCVH 1A22B 2M2DA 4XP5L 5MI0C 3I3DA 4G8EB 1MY5A 4DFIA 3MOQA 1T7ZA 1GVIA 1S9YA 4KGJA 4WDIB 4Y5VC 4Z7VB 1HIML 1HXMB 3B9KB 4NRYA 3VXTB 2WQ8A 2RQ8A 4JFOA 4TSBH 3MJ7B 4KQ3H 3DHJA 3OTTA 2GHWB 2CKBA 5IBUG 1FZKA 2DKSA 5GGRA 2DQEH 3I84A 5F8RC 1B88A 3MLUL 3QA3A 1MJ7H 5BMFL 2DLFL 1B90A 4YEEA 4KJYB 1R3KA 3G5YA 4LLAA 5CIPA 5T3XE 5E6IC 4PBWD 5IFJB 5DD3H 2C4FT 3EO0B 1H15A 5EOQL 1JYVA 3V7AE 7FABL 1WF5A 1NDGB 1CZ8H 2A6DA 1RZ7L 4YHOL 3OKLB 1XAUA 4UBDD 1S7WA 5IV2A 4GKSA 1CDUA 2B7DT 3QUXA 5C3LD 1R3IH 3C6LA 1S9VB 2VN7A 1B3JA 1NCCL 4L4VA 1MH5B 3QI9B 3BW9B 4PGEA 4HUUA 4P4KA 3WSQL 4DW2L 4X8JB 2EICA 5CEXA 4O5LH 1F4AA 2Z0BA 2HAZA 2IAND 4H0IA 3X12B 4OBRA 1A9EA 4NSKB 1CGVA 1LK3H 1EVUA 3TF7C 5F88B 2E27H 3CX5K 4XB7A 5F72S 1KCKA 5IB3B 4FNLL 3LQAH 5CEZH 3ZYIA 1T1ZB 3B9KD 3IDNA 1JZ6A 3VMNA 5TQ2L 4P49A 1ED3A 3C08H 3MRRB 3DUSA 4OD3H 2DTSA 3VXMA 2GK2A 3I75B 1NAKL 2XKSA 1N6QH 2X1PA 4PP2A 2DL9A 4Y8AA 3VI4E 2DD8L 4KI5D 5JNYA 3DTXA 4FQHB 4D9LL 4LLDA 3INUL 1KXVC 2HVJA 3PF2A 1BJ1J 3LEYH 3DYOA 2A74A 2J6EL 1L7TL 5E5UB 1JWUB 5ESAB 1UT9A 4Z7VF 1BFOA 1JF6A 1B0WA 5F44A 1CFSA 5GIRA 2X7LA 1UENA 5I19H 3D85D 1P4LB 4NQDA 3I85A 1IZKA 4X6FA 4G8IB 5GGTL 1T89C 4HK3J 3CC5A 1T7WA 5D93C 1ZLVH 2RFXB 2YKLL 5F7DA 3NZ8A 2D7TH 3V5KB 5DR5H 3GM0A 5T3ZH 2HJKB 1RUAH 1MSPA 4PR5A 2C3VA 2VC2L 1CLOL 3L6FA 2PYFA 4H26B 4J3XA 4JFDA 3UXFA 1AHWA 1S5HB 3OAYH 4ODHL 5FGBA 4MWFA 3RDTA 3V0VA 2IWGA 5CBEA 4RMQA 1J11A 4PJAA 4AEIH 1D9KC 3MXWL 4XC1L 1ADQA 3OB0H 4KK9D 4NFDA 5I6XB 3V79C 4R96B 3ESUF 5DJYB 1KIPB 4U1LB 4C57C 4F7PA 2V5TA 1HNFA 4KI1A 3RTQA 3AU1B 4DVRL 1JUFA 1AGDB 1DLFL 3CU7A 5HI5D 4GH7B 4R4ND 4UT9H 1WIUA 2CKBL 3KHOA 3FQXB 1ZHBB 1LEGA 4G9DA 1RURH 4XP4L 2PYEE 4OD1L 4G8FA 1YEFH 3C5SA 1YY9C 2NX5A 4K3JL 5HHVL 1AQKH 4HS8L 2DIBA 1F58H 1SJEA 3GMPA 4LLVB 2O93L 4NZRL 2FD6H 4ODUB 4RZCA 3P0GB 3TO2A 2GCYB 3B5TA 1I3RA 4WW2A 3L5HA 4AG4L 5FK9B 3KPRD 4IIQC 2AW2A 2OR9L 2GSIA 3K74B 3D2UA 1QPPA 3OKKA 1DFBH 4TNVF 4OZIF 3VXRB 5EFIA 3HG1A 3ULUC 4X4XA 3SPVA 1T0NA 1HN1A 4OCYH 4MD4B 5GS0H 12E8L 2P8MA 3QUMB 1HHGA 1ZLWH 1ZMYA 5GGVH 1NUGA 1CCZA 3WDIA 2ZSVA 5DK0A 4DEPB 2MCPL 1GXEA 3VFVA 2R1YA 3DUHA 4DN4H 4X5WB 3TT3L 1M05A 4TVPE 3UJJL 3RVVD 4LSTH 1INQA 3IDIB 3KYOA 1AR2A 4D9QE 1RIUL 4PJHE 1YEEH 4ERSL 4JY6A 5ACMA 4JPWL 2ESVB 3TFKC 2Z4QA 1JHTB 2OP4L 2APBA 4XMPH 4F2MA 1JNJA 4X6DA 2YXMA 4Z8FH 5DA4A 3SOBL 3WYRA 3PQYA 3NBNA 1FL5A 2ZUSA 5LCVL 4Z5RB 2DJUA 3B3IA 5EUKB 1JGLH 1PQZA 1HH9B 4WEMB 3I3BA 3IFNH 4CW1A 4KZDH 3VXSA 1H8OA 3G5ZB 5L8LB 1FGNH 4LPWA 1WBXA 4TSBL 5I8KL 4JHAL 4KQ3L 3BGFC 4XT1C 5A2IH 1TZIB 2ZSWB 1ZANH 3FT2B 5HJ3A 5D7IF 1HQRA 1MJ7L 1XZ0B 4RQQA 3VJ6A 3TN0A 2IAMA 2DQTH 5D5MB 1KB5H 4ZAKB 5D2NE 3KYAA 2PF6A 1DEEB 1KPVA 4PRPA 2MSPA 3TWCH 4R8WH 1RU9L 4O2FB 3GBML 3O6MH 2W38A 4LEOB 4AMKL 1BJ8A 5ANMB 2YUZA 1R3IL 5JO5A 3X14A 4Y2DD 3N0PB 1S8DA 4LRIC 2FGZA 5EBLB 2V7HB 5SV4A 1QO3B 2E7LA 5AUMB 2DQHL 3V7MA 2ESVD 1I8LC 5J6GB 3C09B 1ADQL 2HLAA 4ZQKB 2Q20A 3VFOA 2Y5TA 5GISH 4O5LL 1S7TB 4X4ME 4LLYA 1BFVH 1F2XK 1KCVH 1MHEB 4Q7DA 4NJ9H 4C83A 4NQEB 4RGND 5INCB 5CP7B 1LK3L 3PIQB 4O02H 3S97C 2HTLD 2XPGB 1WZLA 1P2CA 2D2OA 4I3RL 1ACZA 43C9A 3OPZH 1FVCA 2R56L 3C08L 4MAYB 5ALCH 3V5DA 1OCWL 1W0YT 4I48A 2P5EB 2VLKA 4PJEF 1JVKA 3IU3A 1Z0NA 2JB5L 5FGCB 3B8SA 3QXTA 2GQHA 1B4RA 4Z78B 4GKZB 4JN2B 1AQDB 2XTJB 3RHWK 1R24A 4ZAKD 5B38A 3DMMB 4IJ3C 3MUHL 2VXQL 5BS0A 4UV7H 1ES0A 1YZZA 3GJFB 1MEXH 3QQ3A 4ZFOB 4PJ8C 2NY7H 1NBZB 2NY5H 2MOVA 3R0NA 1SBSH 5I19L 3VRJA 1MRFL 2XIDA 4F9LC 3IDJB 2QQKL 4OZFB 2Y36H 1ZAGA 4Y1AE 3TZVC 3ARXA 2HH0H 2FO1A 3U0TB 1AO7B 4NZUH 5F1NA 2D0HA 2D7TL 5DR5L 3G6JB 1AY1H 4GJTB 1RUAL 3G04B 4Q58C 4GMTH 1FBIL 4ZOCA 3SGDI 2HJFA 3NIDF 3V9FA 1XCTB 2FECI 4NQED 1LEKA 3L3JA 5HHPB 2X4QA 5D9SA 4AEIL 2C7UA 3OKDA 3C8KB 4Z7UA 1F90L 5MENE 5DGQA 4K7PL 3PNWB 1CD1B 4WUUE 2VLLA 5D96C 5D7JC 2I5YH 4OCMC 2AXFA 4MAYD 4N1EA 3GMNA 5IHBA 2PW1A 2P5ED 4UT9L 4L9LB 4KKCC 1W72B 5L2KE 4MNHA 1RURL 1QRNE 3H9HB 4N1HB 1NLDH 5L8JB 2F54E 3HMXA 2WLZA 4GXUN 4YK4C 4X98A 4RWHA 1BAFL 4JCMA 5DHVB 4FQ1L 1AI1H 3DMMD 5FYKH 1R3JB 3H9ZA 3ULSA 3ZE0F 1FL6B 2FD6L 2CR3A 2VDKH 3IFPA 1N5YL 2FX8H 5BXFB 3FOMB 3OGCB 3LN4A 2DTMH 2R0KH 5C07A 1PEWA 1XH3A 2BCKB 4M7LH 5C2BH 4WV1A 1LEIA 4ODWA 4YNYB 3L7FA 5ABDE 1LGVA 1A2YA 4X9HA 2JCCE 4J7RA 3MRIA 1AO7D 3GNMH 1DUYB 4BKLB 1N0XH 3J7HA 1JGEB 4OCYL 5GS0L 3OJVC 4C56B 3UBXB 4CU6A 3FRUB 5GGVL 4LLWB 4AQOA 3CFEA 4HKBA 3DX9B 1ZTXH 3QXDA 3WXVH 2Y6SC 2BXYA 4LSTL 4RRPA 1F4WL 4LMQI 4LRNH 3NABH 1YEEL 4M93C 4QRPE 5F1SA 1DBKH 4XMPL 4WRLA 4Z8FL 5J13B 1A47A 3UZEA 1BQSA 1NQBA 1Q0YH 4BH7A 5BVJB 1CDCA 2J88H 2JK5A 1JGDA 1LO3L 4OZ4A 1D6EB 3DXAA 1JPSH 3HPJB 1JGLL 4UUJB 2BY1A 3MUGB 1H0DA 3IFNL 4IMKC 5FM4A 1FAIH 4N9GA 2FNBA 5E8NA 1IAKA 2FATH 4MJ2A 5IEHA 5ITBH 4Z7WB 4L9DA 1I3UA 4R2GC 4S1DD 1BREA 2NY6C 3RDTC 1I1YA 1ZANL 4ACPA 4WFHE 2R2HB 1LO4H 4HKJA 3WLBA 4TQEH 4FTVE 1RJZA 2DQTL 3D3VA 3KJ4C 1ZLSH 5C9KA 1KB5L 4WUKH 5DSCB 5DRZA 3PWPB 2BSRA 2HT4D 4G8GD 5GSRA 1NCTA 5HYJB 3HC3H 5E00A 3B9VA 2ZG3A 4C56D 4G3YH 4HMCA 4PJBB 1FNFA 3O6ML 4NKDA 3U79A 5FYLD 3WIHA 3ZT5A 5E56A 1X6NA 2X42A 5EA0H 1CXHA 1RFDH 3VFPA 2W0FA 1PVHA 1JTPA 3T0XA 5KSAA 3UP1A 5SWQB 2P8LB 3HZMA 2P5WE 3EYOB 4W4OC 4PJXE 4A6YB 3EFFB 3O2VH 5GISL 4JZJA 4WIQA 1CVSC 2R29H 2YEZB 4KRNA 1NJ9A 5C86A 5EORL 3L3GA 4E0RB 1ZLUK 1T3FB 1QQDA 2F74A 1RJLA 4HWBA 2N7AA 2K1MA 3OPZL 1OWWA 2VNCA 3V0WH 1XF5B 4JFZL 2HTKD 4EN3D 4LVNC 5HY9A 5CJQL 4PJDF 1LE9A 4ODBD 4GAYB 3LEVH 4EI5C 4XCEA 3RL2A 4YHPA 2OSLB 3DYPA 2EYTB 2IADB 3K7UA 1WAAE 1ND0A 2J8UF 3PWPD 3TBYB 4ZD3H 4ZXBA 4J2XA 1NC2A 3F7YB 3GI9H 5HYJD 3KPPA 5EUOB 5LAXB 4UV7L 3K3QA 2VXVH 1S9XA 3TA3B 4NIKB 1UA6L 2NY7L 5F3HA 5F93C 2NY5L 4HQQH 5E6ZA 5C09B 3S5LA 4F57H 5C0GB 1EAPB 3QR2A 4Z7WF 1SBSL 4HS6B 2EDYA 5AYQA 2Y36L 1QA9A 2HH0L 5GRJH 4YHZH 3FQWB 4NZUL 1OT2A 1T6WA 4Y4HA 5ICYB 1J7VR 4XWGH 1OP3H 5EIIB 3CFKA 5KVDL 1CICC 4APQB 3AM8A 4GMTL 5CD5C 2H3NA 2P7TA 5E8EA 1I7RA 3L7EB 3TN0C 3RNKA 5IQ9A 4MCZB 1PW3A 5FECB 1M71B 1G7MB 5K9OB 1UCTA 3IAGC 3SDYH 3WNMA 5HHMB 5EU7C 1FZMA 2IQAA 2I5YL 5F7NC 2FHBA 3CFBA 2R1WB 4BSVA 4WI9A 2AK4A 4KMQA 4HHAB 2NY1C 4HZAA 4P2QE 4P5MB 5BRZB 2HLFD 5BZDA 3CXDH 6FABH 5EU6A 5I17A 1U8KA 3WFEH 2E7LC 1NLDL 3CLEH 2CRYA 5GS0C 5KG9B 3VGGA 2I60H 1M7IA 2GSGB 3TYGL 5FYKL 3ALWA 4K3GA 4PJFE 1HZHH 2VAAA 1FG2A 3NH7H 4CUCA 2VDKL 3MV9E 5MP6L 1JZ3A 2YPKA 3TA3D 2DTML 4Y2OA 5H94A 4HGMA 2O5XH 1PKQE 1CDIA 4FHBD 5C09D 4M7LL 2G60L 4L8SB 3WIHL 1B0RA 1LDPH 4HUXB 1R0AH 2R0WL 1U8NA 3TPUA 1S7XA 3D0LB 1J86A 3V6BR 3KNBA 3EIFA 3NN8A 2DS4A 3SKNA 3RAJH 4QHUA 3GNML 4PJCB 5H2BA 2H32H 4RRPG 4ODTH 3RWGB 1BZ9B 4JPVH 2AAVA 4APQD 1P1ZB 1UVQA 2CRZA 3HI6H 5FA3A 2VR9A 2PCPA 1V3KA 5HHOD 1YPZB 3HZVA 3H9SE 2Y7QA 5IK3B 5C0AB 3RIAK 5FAAA 1UZ8A 2BOBA 3DVIA 3WXVL 5EUOF 4G9FB 2MQCA 1PG7L 4V1DB 1CI5A 1ZK9A 4LRNL 3NABL 1OVZA 4LCCA 2BOCB 4BA8A 4RDQF 5HHMD 2YWYA 3BOVA 3QDGB 4Y19E 4HZLB 1DBKL 4L29A 1MREH 2EYSA 5JXEC 3ZT7A 5HD8C 2AV7B 2BVPB 3O3EB 1S7RA 5GGUB 4BH8A 3EJYD 2DQCH 2FGWH 3QXAA 4OV5B 1Q0YL 4PYHA 5BRZD 2J88L 3B2UC 3KPMB 1YEKL 4I2XB 1J05A 3KPSA 2YRLA 3T0EB 3JV4A 2ZUQB 1U8LB 4ONFH 1X5KA 4NKOA 3HLAB 1WFUA 3QH3B 2FATL 1K4DB 3QIWB 3UX9B 3CCHB 2ICWJ 5I1AB 4F7CA 1DQJB 1OTUC 2WZPD 3WXWH 5FO7B 1GIGL 2FJGB 5I74B 3PDOA 5GRWA 2VLME 1YMMA 4M62L 4JFEB 3UC0L 4TQEL 1S78C 3DURB 4D0BB 4WUKL 1UJ3C 1QFOA 1HSBB 3BD3A 3HC3L 4G3YL 4HPOL 5C7XH 3T2OA 2IPKA 4R7DA 1A6AB 3FQTA 1MLBB 5C0AD 1RFDL 4L4VE 1NAMB 1VFBA 2PO6B 2DOCA 3T8XA 2NXYD 1J87A 4V1DD 4YFDB 1XGYL 4MA1C 1LE5B 2AV1B 3T3PF 1KIUA 4LSDA 3REVB 3O2VL 4ZPTA 2QBWA 3ARUA 3EBAA 4P9MH 3HPLB 3L3IB 3GGWA 4QKXB 3WNOA 5B3NA 2P4AB 4PJCF 3D39A 4ONGL 3T0ED 2YA2A 3MJ9A 4JLRA 3G9VA 5FF6B 3CFCH 1YPZF 3F7PC 4DWHA 1CU4H 1NGXB 2H6PA 5HBBA 2Q7YA 2CIKB 3H7BA 4L3EB 5BZWA 3QPQD 1WV7T 3QIWD 2NY5C 3V0WL 2VQ1A 2HVKA 3PWUA 3VXME 4JHWH 4K94L 5FO9B 4ZNCD 3QJFB 1BD2A 3A6OA 1NMCB 3GKWH 4QRRB 3U4BH 1RI8A 3LEVL 4JFED 2VLJD 1KTLA 3GBNH 4KUCD 4W6WB 5CZKA 1E4XL 4ZS7H 4FFWD 1YN7B 1ORSB 5EZJB 1XGUA 1LP9B 1I7TB 3S5LG 3CIQA 1O0VA 1KULA 1ITCA 4BQCA 5DUBA 3ET9F 1MCNA 4KRLB 5C0IB 3AMLA 4CAGA 4YBLB 1JTTA 1EMTH 2VXVL 3DUUB 3GSRA 4PY8J 2HRPH 5D6CA 5F1OB 5C0BA 5D70H 4ORGB 4HQQL 4F57L 1N0LA 3LN5B 3SE3A 4R7NA 2PO6D 5K9JL 5DUPH 2A73A 4RBPH 5GRJL 1CL7H 4YHZL 1G7JB 3RUGF 1X5IA 5FM5O 4XWGL 3E6FB 3U6RA 3C8HA 2V9QA 4HGWA 1IGCH 2ADGB 1MAKA 1OSZB 3KPNA 4HWUA 4Q9BA 4BFIB 3NVQA 4JFDE 5IM7B 3WNKA 5CMAA 3QHFH 1WCBA 1AGFB 4PJAE 1OARH 1KPUB 2W65A 1N8ZB 1KB9J 1NANH 3SDAA 1ZS8B 4ZFFB 4JFFD 3CMGA 3MRMA 4L8CB 1U8OA 3P4OB 1AGBB 2UVFA 3MGAA 5D71H 3QUZB 1AGEB 2CKNA 4LSQH 2VXSH 3K4ZA 3SJVB 5FDWA 1ZLVK 3TJEL 1FFPB 3VXUA 5AYUL 3K8LA 4QRUB 1KC5H 4QRRD 6FABL 5HHNA 3ULVF 5JHDB 4UILH 1AD0B 4G80A 3W9EA 3LKOA 1GGCL 3CLEL 1I9EA 3OAYK 1N59B 4MA8L 5DURB 4F37F 3AS3A 4G8EA 2D03L 1HZHL 3GM8A 1WZ1L 1SEQL 3KLHD 3OB0K 4HUVA 1PLGH 3NH7L 4WDIA 3RZCB 4N0FB 4Z7VA 1HXMA 3B9KA 3VXTA 4U1GB 4BUGA 2O5XL 3VMOA 4OF7A 3MJ7A 2WAHA 1LDPL 5IVXF 4DKAA 1RZ8B 4UTAH 2VTFA 3KR3H 5HYEA 1R0AL 1MVUB 2GITB 2Q1EA 4MS8D 1WEJH 2LVEA 3HG1E 3ZMRA 1TVDA 2DQUH 4PJ5B 4KJYA 2CUIA 4ODTL 2EIZB 4JPVL 4M03A 5IFJA 1LP9F 3EO0A 3A6CH 4FN0A 3WDJA 5SX4H 1PDKA 1XGRB 1NDGA 4MD0B 4MXVF 3VH8A 3OKLA 3PV6B 1QD0A 3QUKB 4U1MB 3P77B 2EH8H 4OF3A 1S9VA 3ILQC 4NWTH 1NFDB 3QUZD 1MREL 1GGYA 4OF6A 1MVFA 2A0LD 4DKDC 1MH5A 3SJVD 3U9PH 3FMGH 3PQYE 2DQCL 2FGWL 2JJSC 4NM8H 4X8JA 1MCDA 1ZLWK 2B5IB 5TE6H 3DI3B 4P57B 4MA7H 1G7HB 3FQUB 3PHQB 3X12A 4FZEH 5CJ8A 5F88A 4FMFA 5J06A 4JY5H 2X05A 1UADC 2X89D 4MXQC 3WXWL 5IB3A 1VB9A 3FKUS 1T1ZA 4U6YB 1N5AB 5DJCB 1CDJA 4DUXA 3S9DB 3MRRA 4LARH 4R4FH 4CMMB 3I75A 4N0UB 4KY1L 5KVMC 1V3JA 3UYRH 1VKXA 3QYCA 5DK3A 3LPFA 4PJ5D 4B50A 2XA3A 4PGZA 1JZ8A 1RMFH 4FQHA 4PRPE 2D7OA 5C7XL 1NC4B 4G42B 1BOYA 2VZSA 5AZEL 1KEMH 4LIQE 1JYWA 3WDHA 4POZC 2B2XH 4PLNC 1GYAA 1L9NA 1QR1B 2J8HA 1JWUA 1IGIH 5ESAA 4K94C 4PV9B 3W11D 3FO2B 2DN7A 4ODSH 1P4LA 1EHXA 2ATKB 4PRIE 5IMKB 4P9ML 4G8IA 1J5OH 2AK1H 2X70B 3PV7A 2RFXA 3UCRA 4XPHH 3V5KA 2GJ6D 3RZWA 5IBLD 2HJKA 1QR4A 2CDEB 3HI5L 4M7KH 1JF1B 5AAMA 5TGBB 4H26A 3CFCL 2OQJB 1S5HA 2WQRA 4HW6A 2Y1VA 1TDQA 1J18A 4OGAD 1EJ6A 2BHYA 2WWMD 4FQCL 3O4OC 4JHWL 1YEJH 2Q7NA 3ZYJA 4R96A 5DJYA 4PPTA 1KIPA 2VDOH 4U1LA 3FO9B 3TH3T 1NFDF 3U4BL 1RZGA 3AU1A 1JNHB 3SKMB 4CRPA 1AGDA 3GBNL 1FC2D 3WLWD 3F62A 3IS1X 2Z31B 4OI7A 3FQXA 2ITDB 3FAWA 1ZHBA 1JWMB 43CAB 3Q0HA 2XZQH 3IAPA 5BS0E 4HK0B 4MLSA 1EMTL 3CSPA 1I9RH 1NC4D 2HWZL 2HRPL 1T80A 5D70L 4LLVA 3NTCH 1QBLH 4ODUA 5DT1H 1DQTA 4M4RA 2GCYA 1JGVH 5HI4C 5ILTH 5B3JE 4HUWB 2IGFH 2LQRA 1IJ9A 3C60B 3EHBD 1CL7L 5FK9A 5I8OH 3MV8B 3HMWL 3RVXC 1RZFH 3LQZB 1IGJB 1IGCL 3VXRA 3WJLA 3VFNA 5CZVL 3VRLE 4TTDC 3G5XB 3O81A 1WICA 3IB4A 4MD4A 3RWFB 1MHCB 4MVBD 3QUMA 4Z7UE 4DOHB 1V7NH 3ES6B 4X5WA 5D71L 3U30C 2BNQE 3MV7B 4DK3A 4LSQL 2VXSL 3IDIA 4TOYH 1N7MH 3SGKC 5J57B 1A1OB 2ZCLH 4NBYB 1U92B 2ESVA 1XFPA 4MJ5B 1JHTA 1KC5L 4UILL 2B8OT 5H35B 3O9WB 1OAUH 3ARFC 2AEWA 4Z5RA 3NFSH 1I9IH 2Z31D 3RGVB 5EUKA 1HH9A 3RI5F 4IEFB 4V2CB 2BY0A 2I9TB 2EDKA 4HX1B 2CJUH 3B2VH 3G5ZA 5C07E 3ZHDA 2NR6C 3LKRB 1AIFB 3QWRD 1SYVB 4UTAL 3KR3L 3AAZB 5HGDB 4F3FB 1KELL 1TZIA 1WEJL 2ZSWA 3VD9A 4W81A 3C60D 1UKTA 3FT2A 3MGTB 3RWJB 3IJHB 1KTDB 1XZ0A 1HNGA 1U58B 3MV8D 4LLUB 1OHQA 3NMEA 3EYVB 4RMWA 5D5MA 5F7EH 4I8DA 4ZAKA 5F7UA 4LLMB 4OUOA 3BZFB 3I02B 3QIBB 4KQ4H 5D1ZD 3VG9B 5IKCB 1DEEA 4H20L 4O2FA 5B4MC 4LEOA 5ANMA 1V5JA 3GMOB 2X4SB 3H6JA 4NWTL 4UDUB 5EBLA 2V7HA 3MV7D 5FHBH 1T04B 5TDNB 5D72L 3U9PL 3FMGL 4AL8L 3GHEH 5AUMA 5TQ0H 5JW4N 1D5BA 4NOFA 4NM8L 1E6JH 4F58L 1QBMH 5J6GA 5E2UH 3SE3C 4ZQKA 1E4JA 1HEZB 2YZ1A 2OL3H 3VI4F 1IAMA 2LU7A 1S7TA 3GB7B 1MHEA 1OTSD 1CDGA 4LP4A 4NQEA 4FZEL 1DQMH 5INCA 5AAWA 5CP7A 3V5HB 2J7LA 3EOAB 3OL2A 3PIQA 4JY5L 1LO2H 2BSSB 4JHZA 2XPGA 1KPRB 3X17A 1MCLA 2IG2L 5I1HH 4L1HA 4MAYA 4UBDC 1V05A 1SEBB 3D3VE 4R4FL 5DQ9B 4BELD 2BP3A 2P5EA 5C0NC 4G6FB 3UYRL 2COQA 3U9UB 2GY7B 4GKNB 1D3CA 4HD9A 4HIJB 2JTDA 4Z78A 1T4KB 4GKZA 4ZODA 4JN2A 1AQDA 3LKSB 1NKRA 4WWID 2GEEA 3DMMA 2YPLB 3JV5A 4HV8B 1U91B 3QIBD 2N4IA 4X7SL 1AR1D 1Q1JL 3RVUD 4I13B 2B2XL 5DJAB 2XG4A 1HILB 3GJFA 4LDEB 5HVHB 2ZCKH 5C0CB 4ZFOA 1IGIL 1MCHA 4WEUD 4J4PD 1NBZA 4PJ9D 3VFGL 1Y18B 4XXCC 5FYLH 2F19H 1S5IL 5D1QB 3IDJA 4CJ0A 1KIQB 1N4XH 2MCG1 4OZFA 4UT7H 1J5OL 5JXAH 1I8MB 3U0TA 1MCCA 1AO7A 5D1XC 2V9RA 4LCUB 3G6JA 5INDB 4TN9A 5AD0B 3G04A 4M7KL 3VA2C 5L9DH 2WUBH 5ENWB 1RULL 2AERT 1YUHB 1IKFH 2CMRL 1XCTA 3QUYB 4KI5C 3DARA 5HHPA 4GRLD 4WHTB 3C8KA 4LSVH 1YEJL 3PNWA 4PB9H 4JQXA 4NCC1 2VISB 1CD1A 3HR5B 5DC9B 1A7QH 4YX2L 1QTYT 3NFPB 3QZWB 1T83C 1IE5A 4JO3H 5ADOL 5K9KB 4L9LA 2PTUA 3GSUB 1W72A 3MFFB 1NCWH 3LS5H 3D0VB 2DQJH 3H9HA 2CK2A 3MA7B 2XZQL 2EDHA 2FWOB 1MCRA 1I1AB 4OFPA 3BN3B 3SHSA 5EO0B 1KCSL 2YPLD 1R3JA 1FL6A 5DT1L 1VGEH 4JM2D 4CADB 2FX9H 3CZFB 4JG0H 3IXTB 5ILTL 3FOMA 3OGCA 3S35H 5BXFA 2IGFL 1UQSB 4PJHF 4PBXA 2BCKA 1YEIH 5FCSH 4KK9C 4YNYA 1EFQA 1RZFL 4JO1H 5EO1B 4BKLA 1DUYA 1KNOB 4GXUM 1J0IA 3VFTA 1JGEA 3ZSSA 5HI5C 4C56A 3UBXA 4HBQA 3S34H 3VXQB 1X5ZA 3FRUA 4M1DH 5FYJU 2D31B 4LLWA 5E95B 1C08B 1V7NL 3GI8H 3L5JA 3DX9A 3QUYD 2IBGA 4HWEL 4UOJA 4WFGE 3T09A 1N7ML 4ZNEE 1EO5A 2E5EA 1I8KB 1R5VB 1OP3K 3TT1H 4GW4B 1EUTA 5EU6E 5IR1B 4KHTH 1DN0B 2W0KA 3FB5B 3E2HC 1OAUL 3AY4C 3IDUA 5GS2H 5BVJA 3OKMB 3NFSL 4XX1G 1D6EA 1AGCB 4UUJA 3QEHB 1IGMH 3MUGA 2YD8A 1NCDL 2CJUL 3B2VL 3GUTB 1MAJA 5L8KB 2ARJQ 3LH2H 1JNNH 4Z7WA 1TXKA 5C0RH 3QULB 1KCLA 1CFQB 1CLYH 4OLEA 4KWUA 3DX7B 3ALXA 2EEAA 2R2HA 3N1GC 3RVVC 3GSXB 4N90D 4JQIH 3C2AL 3H3BC 5F7EL 5IP4A 1EHLL 5DSCA 3PWPA 1OW0A 3PGCB 4KQ4L 5HYJA 3QCVH 1EGJH 1L7IH 2PR4H 1TZHB 2ZJSH 3MSPA 5EU4B 3EYSH 4PJBA 5H37H 1YJDH 1CFVH 4F33B 5EWIH 5FHBL 3QNZB 3OZ9H 1XR9B 5EZLB 5SWQA 3U4AA 2P8LA 4H25B 3SBWA 4HLZH 4K3HA 3VI3E 1E6JL 1QBML 5E2UL 3EYOA 4A6YA 1BVLB 1TQCC 3KPSE 4FS0A 3EFFA 3OJDB 3IDMB 5E70A 4G6ML 3SGEI 1MIMH 4QHMB 5FOJA 2NCMA 4XNZC 5D7KD 3TCLB 3MXVH 4E0RA 1DQML 4YH6A 3WJLC 2UZXB 4EVNB 32C2B 1W72L 1T3FA 3MNZB 5EC2B 4Y5XB 4GRWH 5IW3A 4MNQE 2YD7A 5GGSY 2X40A 4LPXA 2WLYA 5DWUH 2EC8A 3AC0A 4CVZA 1YMME 1XF5A 1WFTA