5ALBL

Ticagrelor antidote candidate medi2452 in complex with ticagrelor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
210
structure length
210
Chain Sequence
b'VVTQPPSVSAAPGQKVTISCSGSNSDIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLAITGLQAGDEADYYCGTWLYDRAVGLFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI2452 HEAVY CHAIN
publication title Structural and Functional Characterisation of a Specific Antidote for Ticagrelor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albL01
3PHOB 3IDYC 3RI5K 4N8CH 2WUCL 4MNHA 2ARJB 2V7NB 2XQBH 3S3PA 1SMOA 1CS6A 1E28A 5F7FA 2MHAA 4G6ML 3HZVA 3JV6A 4R2GC 3DETC 1FNAA 5DK0B 1AQDB 4F33B 2XZAL 1SJXA 4OT1L 1RMFL 3DRQA 1KTLB 2IAMC 4PBWD 1MFCH 1ORSB 4JHBA 4L9LA 3BN3B 5HYQA 3BQUA 3VXMA 3LN5A 4FZEH 5JQHC 3U0WL 4L29B 3KLAA 3DXAE 1T7VA 2R9HC 4JQVC 1R3LB 3T1FA 4Y4HB 3O3DB 1FNLA 3QJHA 4TVPL 3JBG7 4KDWA 5F9DC 2FX7L 5DXWA 4PJBA 3MRBA 4O5LH 2GSIA 1L9NA 1N3NB 3CFIC 4Y2DC 4Z76B 1LEIA 3L3JB 5IEKA 3N0PB 1V3JA 4ZUVA 3QZWG 2DQTH 4KJQD 3EIFA 4EUPA 3QR2A 1S5IH 5CEXB 3HNSL 3TWCL 4IOSD 5T1LD 3WLBA 3OKOA 1EHAA 1EHLH 1FYTA 1ZSDB 5IQ7L 1L7TL 2WQ8A 2APVA 3I6GB 3UJTH 4Y5YA 1U36A 5IWLA 4ZUUB 4Q6IA 1NANH 4WI5A 1OGAE 2GFBB 5MI0C 1I3RA 3HNTL 5I6XB 2YA0A 4Q9RL 4LVNC 2FL5B 4ZUTA 3QO1B 4PJBF 2XOTA 1OL0A 1X5KA 3EDJA 1Z3GH 4PJGB 5C0BD 2AEQL 1JZ6A 4IIQA 1SVCP 4QXGH 5LBSH 3REWA 4ZUWA 2C4XA 1RULH 1KB5L 3S96B 4MWFB 2AJVH 2HJKA 3B4NA 4KRNA 1IZKA 4Q7DA 3D6GA 2R29L 4S11A 5KSVB 4S1QL 2AXJA 1NEZG 3WD5H 2C26A 4JPVH 4G6JL 3A6BH 1ZT4B 4X83A 2VXSL 4EEEA 4MD5A 1F3RB 2HFGH 3MTRA 1H0DB 2EDKA 3KYMA 2KBGA 2AK1H 1TJIL 1BX2A 2DQUH 3BIBX 4NO0D 4IRZH 2UY7A 5ESAB 5JZ7D 3ARVA 4QOKA 3EJYC 4JKMA 3P9MA 3QI9C 4JFQA 4NQTA 1ZGLP 4LFHD 3O8XC 1T3FB 2B4CC 2D7PA 4R96B 5CJQH 4L8DA 4HWEH 4HUVA 1DQJB 2R39A 3O3EB 3KYOB 1A7QH 4JVWA 3EYSH 3H3KA 2WBKA 2O5XL 4KDTC 2ESVE 5DEFB 1QQDA 4ALAH 5HPOA 1VPOL 4I77L 4OZ4B 2YZ8A 2WBJD 2FYYB 1SEQH 1HHKB 1J0KA 4LHUA 3EFDH 2Y6SC 3MX0A 1JWMA 5CZVL 2OTUA 5DURD 5LWYH 4ORGA 3K4DA 1F3JA 5FUCE 1PX3A 2JK5B 2IADA 3S4SA 2FZ3A 4LSVH 3PL6B 1T7YA 5DHVH 1H5BC 5DHYA 4C55A 5DJXB 2CLVA 1WFOA 5KSAC 3BDBA 1RJCA 4WY7H 4XXCC 5IGXL 5EIQA 2CRMA 5T33L 4LAJH 4PJ8B 3OKEB 3GHBL 1EO5A 3O9WD 5ALCH 1UYWH 4S10A 1XZ0B 4LEOA 1MJ8L 3FONB 3QQ4B 4Z5RB 4MDJB 4M7JH 5ESQB 4UINL 4GKOA 5IB1B 4EI6B 4JPIA 1NAMH 4G6AC 4YHYB 4JZNA 1R3JB 2CK0L 5DI8A 5EUOB 5IM7B 2R1XA 3U83A 1G9NL 1ZA3B 2J8UB 3KDMA 1UH2A 4G9DA 1A6ZA 2OTWB 4LLQB 4F9PA 1CYGA 1JMZA 3RTQB 4ZOAA 1RZ8B 2N4IA 4U6XB 1D5ZB 5MENA 3JWNC 4C56D 5AZEH 5TF1L 4GXVH 3VXRD 1PZ5A 1IKNC 2BERA 2AXGA 3FL7A 5T3XD 2YPVH 5DD3H 4QXWA 1KPUB 2DRUA 3SDXB 3L5XL 3V7AE 2ZKHH 3IXAB 5IMLB 1KBGH 3EYVB 5I19L 1LD9B 2X6MA 5I74C 3V8CA 1MAJA 5FEBA 3OHXB 1JHKH 3QZWB 5MEOA 4Q0XL 3EAKA 1A7RH 3KPRE 3DV6A 5KG9B 4GRMA 3VFPB 4O00A 4KJWD 2AQ1A 4U0RC 3G5ZA 1ZLUH 1RFDL 3GBMH 1BVZA 3P4MA 4P23B 1IGIL 4CU7A 2PW1A 1JNJA 1CDGA 4P9ML 5LVEA 5E2JA 1EAJA 1MNUL 2WUBL 4OZHF 1N4XH 1R0AL 1MHEB 2Y23A 2ADFL 2ICWJ 1GH7A 5DHVB 3WHXB 3RVWD 1AD9A 1IGTA 4N90E 3F12B 1G7PA 1VFBB 3TBWB 1MFEH 2EDHA 3MR9A 4HC1H 4M00A 5E95B 2X4QA 1NEZB 4GMSL 2WBWB 4E0RA 4HK3J 4QLRA 4XTRC 2R56H 1J10A 3LDBB 4MA3A 3MLZL 1TQCC 5FK9B 3D9AL 1X5JA 4M61B 2X7LA 4KC3B 3V2AR 1NKOA 1NAMB 4OLVH 3D85B 4P46A 4PRPB 4DCQB 4DN3L 2A83A 2AJYH 3HG1A 3MRKA 5DVOA 4CW1A 5K93A 4YBLC 2FX8H 1DUYB 1NUDA 1HINH 3SGEI 1NAKL 1XH3A 3B9DA 3RFZC 4NM4H 1NCCH 1S9XB 2QADD 1H3PH 1ZTXL 3ECBB 1HHJA 3OTTA 3SJVA 3VFMB 4CJ0A 5E8PA 5CD5D 5EC2A 4ZSOE 5T3ZD 3MJ9L 1CE6A 3VRJB 4CN4A 3C2AH 4FZEL 2W9LA 4YHZH 4YFDB 3R1GL 5D7LD 1KJVB 1DJSA 2UVEA 3S37H 3WFEL 2DLFH 1MQ8A 1E4KA 5HDOA 4PJDB 1MCNA 1K3IA 3FKUS 4ODXA 2EYTA 3GSNA 3NACH 4LHQB 4O5LL 5D7JA 3ZYJA 3TF7C 1XIWC 2R15A 3KLHC 1IAKB 1YJDC 1S5IL 3G6JB 4JFHE 2DLHA 4NDMA 3S36L 1P53A 1EHLL 2QQNH 4F8QA 1O7SA 2FR4A 3U9UB 1JGLL 3L7EB 3UJTL 5EN2B 2XG5A 1YNTB 3O45A 5IR1B 3VWKB 4L1HA 4F3FA 4QXTA 3RPIA 5HJ3B 4MQSB 2H8PB 1FP5A 4XBPA 5C70A 5EBMA 5MEQA 4OZIE 3MJGX 3DO7A 2AJVL 4IDJH 4TUOA 3U48A 4PJ5A 5IMOB 4ZS6C 2GJZB 1CT8A 2GITA 2DQEH 4Z95H 3O0RH 4JPVL 5GS1C 3A6BL 1L7IH 5D1QC 3NFSH 4Z7OF 3WIFA 1E4XH 3NFPB 2HJLA 4FXKA 2PYEB 4FP8L 4LL9A 3FTGA 4I0PC 2AK1L 1NQBA 4OIBA 2DQUL 3BPNC 4JKPL 3MYZA 3H9ZA 1G9MC 1Q9WA 4GW4B 3I50H 3UMTA 1GPOH 3MNWA 5FM5O 2P45B 3CH8A 4X0KB 3VGBA 1I8KA 5GSVA 3PHSA 2E27L 1A3LL 2G2RB 2VDOL 4N0FB 4PRPE 5C2UB 5JW4Q 1A7QL 4QGTA 4I9WE 3EYSL 2LABA 5CEZD 1FVEA 1CVRA 2C4FU 2WQRA 4ALAL 3U46B 3CCHB 4D8PA 4OGAC 4ODBD 1A4KA 3B5HA 1SEQL 5T1MA 3MJ7A 5DRWA 2A6DA 3BO8A 4PRIA 1JI2A 5GRXG 5IBTH 1H8OA 4FFYH 5E8NB 1ZHKA 3ULVH 4LSVL 2XA8H 4N8PA 2OQJB 4JANB 4P3DA 1S8DB 3WS3B 2DQGH 4ZPTA 1K6QH 3NCMA 4WY7L 2AV1A 3IXTA 1CFTB 4GG6A 4PJDE 2IBBA 1AE6H 3ETBF 5ALCL 2P7TB 5CSBA 4YHML 3L6FA 5HGAA 5IVXA 3ZE0E 4TNVK 3PGFH 4F58L 5GZOD 4M7JL 1CDUA 1OP3K 5JW3L 5E6IA 1CZ8L 1RJZA 1WAAA 3G04B 3MRNB 3SKMB 5IESH 1OM3H 1S9YB 2EXWD 1S9WB 1NAML 3T04D 3KG5A 4KMLB 4LCIH 4M8QA 4GG8A 4HJJH 5HVHC 1X5ZA 1ROWA 5L0QB 4O4YH 2I24N 5D7IB 4ZTOH 1NDMB 5GGSB 4GG6F 2GK0B 1TIUA 4DTGH 5IIEB 2CKBA 4HQQL 2NY6D 3FZUD 2D0GA 3MFFA 4DVBA 1WIOA 5BO1H 4OZGB 5AZEL 1I8MA 4QXUL 1F11B 1HH9A 1JTTA 3FO2B 4GXVL 5TE6H 3P9LA 3DX6B 3STLA 3O81A 1R5VA 4HPOH 4M93C 1DBAL 1F42A 3DUUB 3RVTC 3NCYP 3BP5A 4M43L 2NY5H 1KBGL 2ADJA 2ZOLA 2CD0A 5HGDB 3RVUC 2X05A 3W0WB 2O26U 4IJ3C 1JHKL 5T5FH 1AIFA 3CFCL 1FNGB 3E6HA 1A7RL 2XV6B 2NXYD 1C5CL 1VKXB 3DPBA 4Z78B 2PUQT 3P30L 3GBML 5JXEA 5SWZA 1X5GA 3NZHH 1X5HA 2K7QA 2RQ8A 3AM8C 1I3VA 2FHBA 5DJDA 2B1HH 1P4LB 1WBZB 4RWYH 2XY1A 1CFSA 4EVNB 2QL1A 4WRLA 3TO4D 4UIKL 4MMZC 2IPKA 3HC0B 2JIXD 1TZIB 3LRSB 4NZJA 4FQHB 5I2IA 3QFDB 3QXWA 5ID1A 2NMSA 2EE2A 1G7IA 4HC1L 1FNEB 1PLGH 4LKCB 4XH2B 2QQLL 1A1OB 2YN3A 1QVOB 1JK8A 4HHAB 1KIRB 4P2QA 5GGVY 4ZFOA 4GRWF 5TDPB 2G5BB 4Z0XA 4M6OL 5L9DH 4H5SA 4OLVL 3QIBD 1GOFA 4MNGB 3P73B 3B6SB 2AJYL 1MY7A 2HLAB 2FX8L 2ZPKH 5CP7B 5C6TH 2NY0B 5KZCD 1K8DB 5HYSG 4ZMAT 5MERB 2E7LA 4K23L 5HD8C 5GIRA 4QHMB 1NCCL 1UENA 1QSEB 5HI5C 2UWEA 3V5DB 2WV3A 3MUZ1 5E5RB 5I18H 1NDGB 2MQ3A 4JB9L 5L2JA 3DROB 3U4EB 4IRJB 3FRPA 5H35B 1S7UB 2AEPH 1C7SA 3UYOD 3DARA 2NY1B 2W0KA 4YZFE 3A67L 4Q6YA 4TVPD 3U30B 3G6AA 1AGEA 2H6PB 2F54E 4ZOBA 3MLVH 3V5HA 5ACMA 3PIQA 5SWSB 5JNYB 2UWEF 1NKRA 2E6JA 1NGXB 4XPGH 4N9GA 1DLHA 1D6EA 1D5MB 4QRRA 4OM0L 1J87A 1BJ1H 5CLTA 4H88L 5I8OL 1PEZA 1FVDB 3D25A 4RRPA 2FATL 1MWAH 3VH8A 4QGYA 4JFPB 4RMQA 4QYOB 1KEGH 1TVHB 3LS4H 5KTEL 4Z7QF 4K7FB 5BMFH 3WO4C 3IJHB 4KI5C 1P5UA 4LCCA 5FHBL 1CDCA 4Q97A 1VACB 2DI9A 5C8JA 2EO9A 4YHIA 1WISA 5FECA 2OSLA 3AXLB 3ULVE 4LLDA 1ZHLA 4GQ9H 5F72S 3WNOA 1V3LA 3G6DH 3F7YB 1L7IL 5JPNB 5GQBA 1RHHB 1WEJH 4S1SH 3HFML 5EZLB 1YDPA 4PJCF 1E4XL 3RZCD 4WO4D 3KPTA 1PBYA 2JJSA 3KJ4C 4R3SA 1U6AH 4NUJB 4N0CD 1WBYB 3NCBB 3PQYD 3LKQA 5CGMA 1I85C 2ITDA 1QA9B 2P24B 4D9LH 4J3XA 5JORA 5GISH 3AFLA 2XFXA 4PP2A 5D6CA 3UROR 1KCRH 1CICD 3BIKA 3G9VA 4U3CA 5J12C 3E8UH 4LSSH 1DLFL 4KKAC 4HKXA 2Y1VA 1XGQB 2AJ3A 5EUKA 5EIIA 1T22A 1IBGH 4MS8D 1RZKH 4K71B 2WSKA 5D7LA 5BS0A 3QCVL 4TYUA 3LPFA 4LQFH 1JRHI 5BV7H 4LPYA 4GUPA 3ZDYF 1BBDL 4OI8A 4FFYL 4Y16D 5C09B 4L4VD 2OJZH 2Z8WC 4JRXE 5DJAA 1WVZA 2XA8L 1BQUA 5JUEL 5HYIA 2MJWA 2F5AH 4BA8A 1MWAB 1VENA 5HHOD 3B9KD 1T6WA 1HILB 3IGAA 3GFUA 5L7XH 1AE6L 4N1HB 5C08B 1J05A 3IT8D 4U1MA 5DQ9B 5SWSE 5E08H 1FIGL 4X6DB 3ALXA 3PGFL 1NCBH 1AGDA 5IESL 4G6AD 1TENA 3KJ6H 1OM3L 1BZ9A 1W0WB 4Q9BA 1FL6A 3IAPA 5EC1B 3NABH 1KTKE 3OAUH 4UILH 3V4PL 3GO1H 3GMPB 3GIZH 5HYSB 4LCIL 3WL9B 4FG6C 2E7HA 1HQRB 2M1KA 2OTPA 1BREA 2KQNA 2NW2A 2F74B 2H41A 4O4YL 4PRDB 4X4XB 1U58B 4C54A 4DTGL 1HIML 4JO4H 1UWEL 5BO1L 3NFNB 4GKNA 3PP4L 4IEFB 1MCJA 2AK4A 1BF2A 4F7PB 5TE6L 1MPAH 2FO4A 1T1XB 5EO1B 4NNYA 3L95B 1ZWIB 3OJ2C 4M4PA 4YC2B 1QSZA 1OB1A 3FQNB 1NUGA 4N8VA 3QISA 3OWEA 4WNQA 2LVEA 4YDJA 3FO1B 2OI9B 4WW1B 5IT2L 1IM9D 4YE4H 1HXYA 1CGXA 4WFFD 3UTSB 4PRHA 3V6FA 4X6BA 1Q9LA 3NZHL 4ZAKC 4U1GC 5DGQA 1I1AA 4IHOA 2ZP0T 4NQDB 5BV7B 1MJJB 5CP3H 1U3ZA 3FCTA 5KW9H 2B1HL 2N56A 1EAPA 1U8NB 1KN4H 3G08B 1FZOB 1AD0B 4I3RH 1UZ8B 5E8OA 4NRYB 2NX5B 1T2QL 4WFHD 2ATKB 3BPLB 4ODWB 5FYJL 3FB5A 4OD1L 5IEHB 1PLGL 2EEDA 4A2MA 3UPRA 1MELA 3SKNA 3GI9H 2C1OB 5C09E 5SX5H 2QLVB 4YXHL 1MCFA 4WUUE 5ITFA 3U6RB 4PR5B 3HZKB 4N5EC 5DSCA 4Z7VB 1F00I 3SDDC 5EU5A 1BQHA 5ADPH 5L9DL 2FIKB 4PGZA 1PYWA 2WAHA 3ILQC 4HDIA 5DRNB 1Y18B 4XBEH 3VXPA 3LKNB 1N0XH 2B0SH 4P4KA 5EULV 3VGAB 3FFDB 1C08B 2FO1A 4HAFA 1RJLA 4PREB 3UCRA 1UEMA 3TJHC 4M1DL 1CBVL 4NKMA 4X7DC 1FZKB 1MLBB 4X98A 1F90H 4KK8D 5I18L 4GRLA 4OD3L 1YPZE 3BH8B 3MLRH 5D5MB 2P8LA 4P3CH 1IFHH 2WLZA 2CRYA 3B8YA 4S1DD 3ZZ1A 4R90H 4LAQL 4Y19A 3ARFC 3B2UC 4KTEH 3ISWA 5E56A 4KTDL 3WFHB 5DC0A 3MLVL 4JO1H 4PJHA 5B22A 5SX4H 1PVHA 5T5NG 3DYMA 3UTQA 4DOHE 3PL6D 3SQOH 4XPGL 4CDGC 3JWDH 4NN5B 3GRWA 1OPGH 3GMNB 1AR1C 1T0PB 3WLWD 4OQTA 1NC2B 4OZHE 4MQXC 4NQCB 3CGTA 1OD7A 1MWAL 2NZIA 3ARGC 1OAQL 2C1PB 4NQSA 4I2XA 2YMXH 4FFVC 4K7PH 4Y5VC 4NCC1 3ULUH 3HE6B 3LS4L 5B8CB 1IEHA 5CAYB 2ZOKA 5AG9A 5BRZA 2NY2C 2P5EE 3IDIA 2V5TA 4PTTA 3ROOB 1EEUA 1K2DA 3JTTB 4PJHF 4YX2H 3T0EA 3TO4A 3B43A 5I73B 3T77A 3MLXL 2JIXA 3SCMB 3QFJA 3PDOA 4UI2A 1XR9B 5GZNC 3C60D 5CGYC 2XTLA 3V6OA 1R3IL 3VFOA 4RMSA 5HPMA 1QLRA 2HFEB 4LBEA 5AAMA 3BUYA 1WEJL 3FN0L 2FDBP 3X3FL 2D9QB 5HY9A 4KMTH 3VRLE 1NEUA 3MOAL 3VXSB 3O6FB 4NBYB 1U6AL 4YGVA 1LEGB 3OGOE 1HYRC 3W2DH 4FABL 1UQSB 3BFOA 3FB6A 2BY0A 5GISL 4Z7VE 4X9GA 5ICZA 4OCYH 5I75B 1I8LC 5HSFA 1HCVA 2Z31C 1Y6NR 3LSOB 1NSNL 4PGJA 1KCRL 5J1AB 1D5XB 2Y4SA 4Z7NE 3E8UL 4LSSL 3TNMB 4XMLH 4C83B 1MJ7L 3L3GA 1A9BA 3CPLB 4JQVA 2QHLA 4P23D 4PBVC 1UA6H 5IHLB 5CS7A 4I48B 5JW5B 4AYFA 3HMWL 5BV7L 4BFGA 4XBGA 4NWUL 5D5ME 1E27B 2YPKA 5D2NE 5F88A 1KIUA 1VDGA 2VQ1B 2Y72A 2F58L 4NJAH 3QJFB 5DQJA 1I4FB 2F5AL 4D2NA 4OZFB 4F2MB 3DTXA 1Y6KR 4HWZA 1XGPB 4MDIA 2VQUA 4UQ2A 1R3HA 1VA9A 5FXCH 5L7XL 3ZKSD 2F8XC 2XPGA 3GHEH 4HS3A 5C0AA 3UJJL 1G0DA 4NZTL 3TVMD 1QFPA 1RK1B 4JG0H 3OKLB 4TUJA 3OXRB 5DO2D 1NCBL 2MOVA 3VJ6B 1D5BA 3KJ6L 3S35L 3QUMH 3BKCH 3NABL 2VLRA 3C08H 3GO1L 4LPTA 3BDXA 5GGRB 1KB5A 4JFEA 3WIHA 2XYCA 4MD0A 3KYNA 1RVFL 5DMYA 4QY8B 4QTHB 3B9EA 1B0GA 4MNQB 3ROLB 3Q3GB 1A6TB 2XZCL 5LKNA 3CFKB 4ODUA 4KRPB 1C8PA 1ORQA 4OF3A 4LSRH 5K9QG 2OJEA 3VFUA 3QEHB 4EI5B 1R3KB 1WITA 3BKJH 2R1WB 3W9DA 3EYQC 3BP4A 4ZPVA 3MRGA 1NGWB 3WDHA 4DFHA 1WFUA 4ZD3L 1BOYA 1IL1B 1BIHA 2BJMH 4F7MA 1FFNA 4Z7UA 1G6VK 3BD4A 3MC0A 3QI9A 5K59F 4CVXB 2HT4C 3O8XA 5D7SL 4OFDA 5FO8A 5GPRA 5I8EA 1MCKA 3SKOB 4Y2OA 4XP1L 4NC1C 1NLDH 2DWEB 1Z9LA 3MCKB 3MLSH 4HV8A 4KDTA 4YHKH 3C2SA 3VXSE 3GB7B 4FXGA 4PS4L 4JN1H 2MQ0A 4KHXH 4CVZB 3U7AA 4YDVA 4PBXA 5CCKH 5D1XD 1IGJB 4HBQA 3ZHLA 4Z7UF 1MI5D 4K2UH 1INDH 1KN4L 4JCLA 2VKWA 1T03L 1AP2A 2DD8H 5DT1H 3EFFA 3TBYB 4RNRB 3X11B 3QEQE 35C8H 1ETZA 3M8OH 5HVGB 2P5WA 5KSAA 1T0MA 4FTVB 4LEXH 4XXCA 1FO0B 3HPJA 2H2PC 2EIZA 1DQLL 1P84K 3KPMB 4JM2D 3LEYH 2Z4QB 2E5EA 5INCB 3OB0H 3OKDB 4TPRL 4CL7A 3ZKQD 1ZGLA 3QUMB 2O5ZH 4JFOB 3NTCH 4QF1B 2JB6B 4LLUB 3RWEA 3IFOA 1BZ7A 4L4TA 3O4OC 2PYED 2HVKB 3MBXL 2FLRT 5HGBA 1N0XL 1Q9OB 3TFKC 4BSJA 2IF7A 1T2JA 5J13C 3QIWD 2ZCHH 4WI4A 5EBGA 3QO0A 5E00A 4G9FD 3CLEL 2R2BA 4KK6C 3W5MA 1IKNA 2X89D 2X70A 3RNKB 4E41B 5IBLD 1U92B 4YNYA 4MNQE 4P3CL 1YEHH 4HIIB 4I13B 5I1AA 3C6LC 1A3RH 4EN3D 5E70A 4R90L 5C7XH 1CR9L 3LKRA 4LLYA 1REIA 1U8LA 5AUMA 1BGXH 3CZFA 3N9GH 2ENSA 3DOSA 3LQAH 2E8ZA 2J7LA 3ME0A 1MCLA 3SBWC 2BVOA 1OCWH 4JO1L 5I17B 4DEPC 4X5XB 4UDUA 3V4UL 4NKOB 3SQOL 5HI3C 1WWCA 3JWDL 2OXGA 3WNNA 3WEXB 1DBBH 3HZYB 2VDMH 5IJVB 2I07A 1JFQH 4LDLB 4FMFA 2B1AL 1Z2KA 1YEIH 5EU3B 1LK2A 4I4WA 1JNHB 2HLFC 4PJ9B 4D0DB 1F02I 1GGYA 2DI7A 2YMXL 4K7PL 3ULUL 1KJ3H 1JPFB 4KI5D 1S7QB 2FWOA 1HQ4B 4P2OD 4YX2L 1CLOL 1XGRA 3EHBD 2D7NA 2C3WA 3FQRA 5J06A 1A9EB 2EYSB 1MRDL 1O5DT 3NCJH 1ED3B 3CMOH 4PP1C 1NJ9A 2DB8A 3WFBL 5JLZA 3M07A 3BDYH 4KK5C 1V7ML 4XZUB 1AKJB 4I18B 3F58H 3ZKXB 4E5XB 2MKLC 4KMTL 1NFDB 1CDJA 2XXMB 5DD1H 4X7TB 4RX4D 5IB3A 3LKOA 5ITBL 5DD0H 2Q8AH 3W2DL 3QDMD 1MH5B 1HXMA 1NFKA 4QRSB 1JGDB 4PGDA 1T20B 1ZVHA 4R0LC 1MVFA 3W0WD 3WCYA 1BVLA 2CXKA 2DLIA 4RA0C 4XMLL 1OAKH 3T4AB 3AREB 5C6PB 2R2HA 1MFBH 5IFHH 5IW1B 1ZE3C 4J8RB 1PDKA 2RJMA 1P4BH 3VG9B 4MXWL 4LLWB 5EZJB 2LFGA 3PWUB 5B3NA 1DZBA 3L5JA 3QXVA 1XIWA 4LCWB 1FL5B 1DQTA 4Z7WE 5E1HB 3MLPA 3OMZA 1NGYB 3QSKB 4HFUH 4NJAL 4MAUH 4TRPL 4BJLA 4X8JB 1JGEA 3CDFA 1D9KB 3FB7B 3RDTB 3TPUB 3VRIA 5BXFA 1KPVB 1VFAA 2ZSVA 2AV7A 4X9IA 1G1YA 3W11C 3DGGB 3LIZH 4JFFD 2L4OA 4YUEH 3UYPA 3V79C 2BSRB 4P5TB 3X3GH 1DTUA 1AGBA 1X5LA 3MRDB 2PETA 4WUKL 4PJIA 4UV7H 1HH6A 1UADC 2BOCB 5I1IL 1INQA 3QUML 4KZEH 3MV7B 3O41B 2HTKC 5FUCC 1FSKB 1T1WB 3RWHB 2E9JA 1R5IA 3C60A 1KTDA 2F5BH 4ZNEA 1JVKA 3QPXL 2NY0D 3UDWA 2A77L 5GS1A 4XCNB 4M6AA 4Y4HC 3QNYB 4LSRL 1QSED 2VZUA 4F7CA 1MLCB 3AC0A 1A02N 5E94A 1L0QA 4M48H 2YD8A 4U1LB 1H3WM 3OKKB 3VMPA 3BKJL 3FT4A 4I0PA 4IRJD 3FQUB 2BJML 1OY3B 1UXWB 1SQ2N 2W92A 1HHGA 1CD9B 3I6LE 2W1NA 4M8VA 1FFOA 3GIVA 3FN9A 3D3VB 3PWNA 4YEFA 1IAII 4RAHA 3QRFM 1NFDE 3EOAB 3PNWB 2VYRE 4YPGB 3P0GB 3TIEA 4P59L 5E4EB 4ZAKD 5I6XC 4JN1L 4KHXL 4JVPA 3KPSA 2EC9T 3NA9L 2CXGA 5CCKL 2DM7A 1P69B 5KBNC 2YPLA 4HIHB 5GRYA 4V1DB 4K2UL 1INDL 4W6XB 5INDA 2OL3L 1WK0A 1G7HA 3T8XB 2DD8L 3NZ8A 4S2SA 2ICEA 4KRLB 4OD2A 4G7YL 1OOAA 4LPVA 5FYJD 5FGSA 1AXTL 4LEXL 5L2KA 3SE4C 4U1JB 2J8HA 1MUJB 4RAUB 4W68A 2ID5A 1IC1A 4KKBC 1U8HA 3LEYL 3O6LL 3QPQC 2OR9L 3TVMA 1VADB 4X5WB 1U2HA 4LU5H 3FT3B 1IARB 2O5ZL 4CRPA 4JFXA 4PLJC 4K3HA 5HYJE 3IDGA 1Q9KA 5EBLB 2HT3C 1EO8H 5D2LB 2ICWA 2FB4H 1ND0B 2E7CA 1BF8A 3LY6A 5D9SA 3KXFA 3TJHD 4FQCH 1OP3H 4PJEE 1QSFE 1SJVA 5LG1A 5JOFB 1CFQB 4NT6A 5ENWA 4NHUA 2VJXA 5BVJA 2A73B 4OB5L 3F65A 5IK3B 2DAVA 2Q3AA 3TN0C 2BNRE 3LAFA 5FYLE 3WKMH 3PWVA 4IOIB 4J1UB 4PJAA 2YD3A 3MYJA 4U1KB 4JQXC 5LJYH 4XPFH 2PYFA 3OJDA 5I15H 3ZDXE 5C1MB 5M7QA 1LE5B 4MXVE 4HMCA 1VFOA 2R0KL 4HX1B 4PJ8C 3LQAL 3N9GL 1U8KA 3R06B 5AWNL 4JZJC 2CLRA 1FLTX 5EBWB 3NMEA 5LXGH 4YR6B 2X09A 1A6WL 4DW2H 1DSFH 1DBBL 4MQXD 3HR5A 3QULA 4G80B 4PJAF 1Y6MR 2P49B 2GJ6B 1JFQL 2YUXA 3AM8A 4QRPB 4YHYC 3WNMA 3H9SA 3GSWB 2EDBA 2HRPH 1B9ZA 3D3VE 1QRNB 5D71L 5C08D 3QNZA 1MI5A 3GGWB 4S0SD 1AFVH 4ZFFA 1BBJB 1KCSL 4OF6A 3RTQC 1DFBL 1DE4B 2BNQB 2F53B 1H3TA 1SJHA 4WHTB 4K94C 3MNVB 5EFIA 4LKXB 3NCJL 5C0DB 4M3JA 3LRGA 3CMOL 3WJLC 4Y5XC 1IEBB 1RZFH 1JTOA 4JM2A 3U7WH 3TGXA 2YHGA 3BDYL 4HW6A 1W8NA 1S7XA 4P57A 4F57L 1I7UA 3QUZD 1M4KA 2XTJD 3BVNB 5DD1L 2VITB 12E8H 1CFNB 4JAMB 2H26B 4GLRI 2XKNA 5IFJB 5KSBA 3MLTA 4KZDL 5DDHA 2ITCB 4MYWB 3T4YB 4JRYD 1DR9A 3QIWA 2VLJA 4PRAB 4G9FA 2IG2H 4XNUH 5C0CB 3UTSD 1UJ3B 1U91A 1WWWX 3E1F1 1PSKL 3LMJL 3QWRA 3K1DA 1SBSH 4FFWD 5KANI 4P9HC 4NQDD 1DDHB 2MKWA 4EUPG 2E7MA 4JLRA 5KSBF 5EDXA 5EU6A 5HHPB 4XCCH 3V0WL 1T4KA 4R7DB 5DJ0B 2VLKE 4PJFB 5F9AC 3CDYA 2IFGA 4NP4H 1JGUH 3BPCA 3TEUA 5C0EA 1RK0A 2NX5D 4U7SA 1CGVA 4MXQD 2R4SH 3B9AA 3HAEG 2KZWA 1U8QA 2XZZA 1JNLH 4WW2B 4MLSA 4OCMC 5CUSL 2R8SL 3HC4L 4PJ7B 5GJTH 4A6YL 1MAML 3IDNB 4ELMF 3LIZL 5M95B 4XXDB 5J3HD 3QEUA 4ZQKB 1RIUH 4WHYG 3D39E 3SY0B 1DBJH 3TZVB 3HE7B 1BM3H 1P7QD 1ZEAH 4QRPE 2WIIA 5H94B 3DI3B 3ZDZE 5AAWA 1SYVA 3VGDA 3S37X 4OV5B 4DZ8A 1JUFA 5DFVC 3GSXA 2G9HA 3UPAA 3U9PL 2EE9A 2GY5A 5F1IB 2BNQE 1K8IB 4FN0A 4K3DH 4X99A 4M48L 4KI5F 4YO0B 4Y4FC 1S7WA 4WTZA 1N6VA 2H9GB 2C3HA 5D8JL 1WIPA 4EUPH 2DF3A 1LO4H 1RIHL 3QDMA 1W72L 4JY4B 4F80A 2CR6A 3C8KB 1Q94B 2Q76A 3RVVC 4LHUG 3Q6FA 3VWKC 3HAEH 2X41A 4QHUB 3ALPA 4AENB 1K4CA 4J12A 4AY0A 3S4SG 4P3WA 5TDNB 1U8OB 2GT9B 3HRZB 4PGEB 4AH2B 5J9PA 5GS0L 4O2FB 5GGTA 3D18A 5CBAA 2DMCA 1MJUH 4KK9C 4NQCD 4YDLB 1HKFA 4ORZC 1YN6A 3HE6D 4WHYH 1DBML 3V4VH 5C0CE 5DK2A 3FQTA 4APQB 1N8ZB 3LZFL 2CDFB 5E9DB 2D31B 4YHPA 3QG6A 1ADQL 2YXFA 3HZMA 3CDGB 3O6KL 4G8GE 3SCMD 1OTTC 4MNHB 1NGQL 4DVRL 2HH0L 5FO9A 2J6EL 2XT1B 1E28B 3QWQB 1E4WL 1T5XB 2MHAB 3HZVB 4PJFE 4TNWF 3D0LA 5JW4R 4JFFA 4X80H 3LB6C 4LU5L 1OP5K 1LO5A 1N7MH 3DRQB 4HH8A 1JZ7A 2Q86A 1QO3A 4L9LB 1KTRL 5HYQB 3BQUB 3VXMB 1I1YA 2FB4L 3LN5B 5C07A 4PJ7E 2GQHA 3D2UA 1I3GL 3O6FD 3ET9F 3KLAB 1ZANH 3L9RA 3T1FB 1OAXH 4L3ED 3JV4B 1C5BH 5H37G 3QH3A 5EO0A 3QJHB 2HFFA 3MA9H 4OF8A 4PJBB 5B21A 1LGVA 3KPQA 3MRBB 3OQ3B 4R26H 5ESVA 2OP4H 1LEIB 5IEKB 3WKML 1KB9K 4PG9A 5GRVK 4ZUVB 4EUPB 3PJSA 1JPSH 5CHNA 3WLBB 3QHTC 5HYEA 5DD6A 3QHFH 4M5YH 2WLYA 4Y5YB 3T3PE 2Q7YB 4H26A 4RGNB 5DJ6A 5GRUH 3HAEB 1ZS8A 2JCCE 1NCUA 2DJUA 1I3RB 4OUOA 4ZUTB 2VR4A 4OCWH 3UTTB 2EKJA 1F4AA 4GBXB 1QLFB 2Q20A 3KPNA 4ZAKA 5HI4D 3IKCA 4IIQB 3REWB 5IJKC 4ZUWB 3LCYA 1MVUA 2HLFD 4QRUA 1WBXB 3UC0H 3VFTA 1FH5L 3DXAD 3ULUD 2HRPL 4Z6AT 3GUTB 5EZIH 1FCCA 4Y1AE 2VO5A 1J0YA 1G84A 2X9XA 5JDJA 3DX8A 4N0UE 2PTUA 1AFVL 4FQXB 3FQWA 4MD5B 1KSRA 5F7NC 5IW3A 2CDEA 1EVTC 1A14L 5IFAH 1IE5A 3KYMB 4CN6A 1BX2B 2ZNXA 5H37H 3P9MB 1RZFL 5DJ8A 4RFEA 3RWIA 5I1DA 1FGNL 3HA0A 3SDDA 2APXA 4L8DB 2ADGB 1T5WA 5E9DE 2BHYA 2VSDA 1TNMA 2IH3A 3SPVA 3QXAA 2H3NA 3MCG1 3I3DA 3THMH 5FF6A 2UVFA 1QQDB 3HC3L 5DMIH 4PJXA 43C9B 4X6CA 4XI5D 2V5YA 4TN9A 4YHLH 4LHUB 3SKJH 4HUXA 1RIVH 1S5HA 1YNLH 5DUPL 2OTUB 4ORGB 4HG4K 1F3JB 3C5ZD 5DMGC 4X4YA 4PLOB 1FN4A 2IADB 4HIJA 3CVHL 5D1ZB 4HS8H 2FZ3B 4XNUL 3ARDB 3S4SB 4BH8B 3ULVC 2SEBA 1KC5H 4XP6H 2P8PA 5DHYB 4MJ5A 2CLVB 5KSUA 3ARFA 1M6OA 1SBSL 2D7MA 4PJXF 3Q5YA 3U2SA 4CVWA 4QKXB 1S9VA 4LEOB 4D0BA 3S88H 1NMBH 3OAZH 2GAZA 3MV8D 1YN7A 3SE8H 4POZD 1J88A 4FQQA 3VDAA 1ZHNB 1A5FH 1M05A 4JPIB 4FTVD 2UY6A 4RCAA 4JZNB 5F71A 1JHTB 4R8WL 5A3IC 5F9WB 4M1CC 2ESVD 3KDMB 4G9DB 5I71C 4RGNE 2HMIC 1EJ6A 1IEAA 4U6HB 5JO5A 2ZJSH 3QUYD 1NH6A 4I3SH 4L8CA 1FIEA 4ODHH 4TQEH 3UTTE 2IANE 4U1IA 3STBA 5MENB 1RIUL 1FZJA 3FJTA 4FRWA 4RGMB 3WNLA 5JPMA 1IILE 2VDNH 3VFVA 1OLZA 2FH6A 1G6RH 5ISZA 3X14A 5HDQL 1FFPA 2AAVA 3QEGH 5KS9A 2NY5C 2NY1C 1OAUH 3VGGA 3MV9B 3AVEA 3RVXD 3WJJC 3MRIA 4OCLC 4AT6B 5MEOB 4K3DL 1YMMD 5CZXD 2D0HA 1AH1A 3GSNH 4E41D 4UOW1 3S34H 5LQBH 3FAXA 4YHOH 3F6LA 3VGFA 3P4MB 4O51A 1QR1A 4DZBA 2PW1B 3JWOH 2IH1A 1A0QH 1LEKA 1I8LA 2Z31A 2E9WA 5KS9F 1K5NA 4M7LT 1QHPA 3S98A 2C3VA 1DN0B 3PWPD 4J4PC 5DTFA 3X17A 5C3LD 3TO2A 1G7PB 3MR9B 2DKUA 5E1AA 4ZXBC 2XKUA 3BP7A 2X4QB 2VL5A 2F8VA 4E0RB 1DQMH 2XACC 5EZOL 3BN9D 3BW9A 3I9GH 5A2FA 2LV4A 2X7LB 4UNTA 1KGCE 1J1XL 4P46B 4XNQA 2PR4H 3DBXA 5F9OL 3U79A 4K3GA 4NM8L 2A83B 3HG1B 4XWOC 2DL9A 4CW1B 3BEWA 2PTTA 4PD4K 2MCG1 1XH3B 3D1MC 3WHE1 1U8JB 5MHSE 2X4UA 3QQ9D 1ZLSH 4CMHC 4KPHL 3V5KA 3VI3E 4O2EA 1HHJB 1N7ML 5E8PB 1G6RB 1MY5A 2JB5H 1RHFA 1CTNA 2X9WA 2OK0H 1MFNA 1DVFD 1ZANL 3IDXH 2VMFA 4KKNA 2OCFD 1U41A 4ONOA 5TQ0L 3S8WA 4K71C 3VFNA 3OR6B 1KEMH 1NUFA 4P48A 1F8TH 4MJID 2EYTB 2HA1A 3GSNB 5JHDA 3ESVF 5IKCA 4R26L 1AGFA 4YAQA 5D7JB 1Z6JT 1JI1A 2Z93B 3RL2A 4LP4A 1JPSL 1IZJA 1VSCA 1LDPL 2I27N 3MRJA 3MV9E 3QHFL 1UWGH 3QYCA 1XCQB 3O45B 5DLMH 4RWHA 2EDEA 4NQUA 5GRUL 4OAWA 1TQBB 4F3FB 3MBEC 4N1CA 3RPIB 3QDJA 2FSEA 4LCWD 3NIFE 5IHUH 1KG0A 5BJTA 4HPYH 5T1KA 4XBPB 1HSAA 5CJBA 5CJXC 5EBMB 5DQDH 5MEQB 4QRTA 5E4IA 3MRQA 1I3UA 1KXVC 1CLYH 4NJ9H 3DO7B 3UC0L 2Q8BH 4MA1C 2DN7A 1QTYT 4PJ5B 1YC8A 3BWAA 5EZIL 3MO1A 4NQEE 4OSUH 4ZS7L 2X2YA 5I8KL 3QIUC 4P5TD 2MWCA 1PKQE 1YMHA 4TULL 3DV4A 2CKBH 1YEFH 5ID0A 4BM7A 3B2VH 1X7QB 3WIFB 5IFAL 5FOBA 2HJLB 4XCEB 4EDXA 1XGTA 3FTGB 5TDOA 4RZCA 3S5LB 2D9CA 3BMVA 4YK4C 1Q9WB 3QDGA 3PDGA 4JPKH 4YC2C 1S7SB 2D2OA 2OYPA 1S78D 1I8KB 5GSVB 4RA3A 5IG7A 2W60B 1LDSA 1F4HA 3MRRA 3BKYL 3BP6A 4W4NA 4LPXA 3CXHK 5B39A 4AZ8A 2NYYD 2OI9C 3ARWA 3THML 5EH1A 1FVEB 1A8JH 2XWJA 1RZKC 4M1GL 4D8PB 4XPAL 5T1DL 1A4KB 5T1MB 2DDQH 3FRPG 3MJ7B 4Z8FL 3VFWA 3MOBH 4L3EA 5DRWB 2A6DB 4PRIB 1HZHH 3V0VA 5BOZG 3QB7C 3OKMB 1FGVH 4GRWH 4PLKC 5DJYA 3NAAH 2BHZA 4HS8L 1UFUA 1MCEA 4HXAL 3C6LA 4UZGA 4P3DB 2NR6C 3RKDD 2ZSWA 2FGWH 2AV1B 4CNIA 2R4RL 2WM0A 4X4MA 2CIIA 4GKZB 1RZJL 1UT9A 2G75A 2VNCA 4GG6B 1EMTH 3SBWA 4DGIH 3V52H 3L6FB 5HGAB 5IVXB 3TBSA 4RRPG 1NFIA 3LHPH 1I8IA 3VH8G 3S88L 1RJZB 1NMBL 5EO9B 3TJEL 5I9QB 3L3OA 5I1EH 4K3JL 2R1YA 4LCYA 5IP4A 4NN6B 5C0BB 4JJHA 3D87B 4MB3A 5IHZA 1T66D 5CGTA 4GG8B 5I16A 3ZLQC 3DXAA 3O2DH 4JDTL 1A1NB 3VGAC 4NHCL 1P84J 4I3SL 4TSBH 1WT5C 2DLGA 2CKBB 1YNKL 1PD6A 4TQEL 3DMMD 3MFFB 4DVBB 3T2QA 1I7ZA 1N59A 1J8KA 1HH9B 5DUML 2NCMA 5DFVD 3STLB 4PJ5E 3RRQA 1EK3A 1FL3A 1R5VB 5IW6A 3QEGL 4NO0B 4NYLA 3VD4A 5D2NC 3BP5B 2ADJB 1NMCC 3WBDA 3DI2B 4JHWL 2GKIA 1AIFB 4IRSD 4NRZA 5CMAA 7FABH 4RIRA 1HOCA 3QRGL 4CADA 1ZAGA 3ES6B 2HKHL 4M9PA 1FDLL 1OGAA 1CE1L 5FA3A 1HDMB 4NN5C 4NKDB 5E03A 3JWOL 3VFGH 1CGTA 2DTSA 1MCPH 2BDNH 1MCIA 4R0LA 5DJDB 2XG4A 4GRWB 4K7PX 2Z91A 3OGCA 5I1KH 4HBCH 5E2UH 5B8CC 3BJ91 2NLJA 4JFDE 4N68A 2IPKB 2R0WH 5I2IB 1DBKH 5GS0D 5ID1B 3N1FC 1FAKT 5BZWA 1G7IB 2A0LD 1TNNA 1ZKAA 2GJ6D 4LVHC 5HDLA 3T2NH 2YUWA 2ERJB 3Q48A 5IB4A 4J3WA 1JK8B 2BOBA 2QQKH 2PO6C 4XGZA 3I9GL 4ZFOB 4BQCA 1S7VA 2ED9A 1U0QA 1QNZL 4GSDH 4Z0XB 1XR8A 4ACPA 4H5SB 1A64A 1C16A 1HWGB 4QO1A 1OP9A 1BAFH 1CD8A 3GK8H 2AJSL 2F19L 4ELME 3MA7B 3AGVA 2ARJA 2ESVA 1EUUA 5CZKA 1E4JA 3KYKH 2EDOA 5GIRB 4JPWH 5DK0A 1AQDA 4F33A 1S3KL 2EH7L 4OIIH 1E6JH 5I75C 5C92A 2FEDD 4C56B 1A6VH 5C0BE 4TNWK 3V0AC 5E2TL 3CSYB 5FGCB 2OK0L 4FFZL 1X44A 3IDXL 3SN6N 1QFUH 3G6AB 1AGEB 4Y4HA 1MRCL 5CJOL 1F8TL 4LOUC 1U95A 3V5HB 3P3YA 4N8VG 1LO2H 3PIQB 1YMMA 5DVLA 4N9GB 1DLHB 4PRBA 1D6EB 5BVPL 4OLWH 4QRRB 5GGQH 5DFWH 5I1CL 4ZOCA 1A6UH 2K7PA 4JEGB 5HDBE 3D25B 1UWGL 1YEKL 2IGFH 3VH8B 1X3DA 1SHMA 5DLML 3H7LA 1KLUA 2J4WH 4XWGL 2VISA 3WXVL 5IHUL 3QO1A 1OQOA 1LWRA 4LCCB 1OTSD 2HG5A 3VFSA 4YXKL 1MOEA 2RFXA 1CLYL 4NJ9L 5C8JB 4HJ0C 4LRNL 1BEYH 1L6XA 3MREA 5DR5H 5FECB 5C9KA 2Y5TA 4LLDB 1ZHLB 4UUJA 1BOGA 3TBTB 4HCRA 2F54D 1OTUC 4KRPC 1ZT4A 1XGUA 2CKBL 2HJFB 4OLXH 3SE4A 1YDPB 3F62A 3B2VL 1HYSC 4FQ1H 1ZLWK 4B7IA 3KPRA 4R3SB 4EI5C 1BQHG 4J2XA 4PJGF 2ITDB 1MEXH 5FKPA 1LVEA 5GGSY 5KOVC 2X4NA 32C2B 4IOFC 1JWUA 3QUKA 2XFXB 4OF5A 4PP2B 4LARH 3P77A 5D6CB 1YY9C 4K9EC 3VDCA 2QADB 3O3EA 2XICA 1NC4A 5HTSA 1I1FB 4NGHL 4HKXB 4U3XA 5EUKB 2AJ3B 4ONFH 5EIIB 1T22B 2CPCA 1CVSC 1J5OH 2PCPA 3C8HA 4FOMA 3ZYZA 5CEZH 5D7LB 5BS0B 3DSFL 1HHKA 3VI4E 1HZHL 4KV5E 3TN0A 4GUPB 2F9BT 4C56E 1D6VH 1QFHA 4LNVA 3VXRE 4LVEA 5DJAB 5AD0A 2A6IA 4JQXA 2AS5M 3GSUA 2EH8L 5T3XE 1AGCA 2XN9E 2P43B 4ONGL 2FGWL 1IGCL 4I5BA 2K1MA 3IGAB 3OKEA 1EMTL 4G8EA 4YBQC 4DGIL 3FFCE 5IF0A 1J05B 3SDYH 4LF3A 1G0YR 3K74B 3DVFA 4U1MB 3T65B 1JYXA 4FQ2H 4JZJA 4QWWD 4AMKH 4MDJA 3LHPL 4NKIL 2DQJH 1AGDB 4MMXC 1BZ9B 2BY2A 3VW3H 5I1EL 1GYAA 1FL6B 3R8QA 5IB1A 4ZSOA 1A2YB 3PWLA 2QQQA 3O3BA 3RQ3A 2EKSA 4HH9A 1QUNA 1TVDA 3HUJB 3GDBA 4U2YA 2NW2B 1MFAL 3A6CL 4TSBL 3RTQA 1RZ8A 3SE9H 4GKNB 3VWJD 5DS8A 3BIAX 1YY8A 3BQUD 4PGCA 3VXMD 2FO4B 3WJLA 3DLQR 4Y5XA 5L88H 1JGVH 4M7KH 1MCWW 3IXAA 5EU4A 5IMLA 1OB1B 3B83A 4N8VB 3UAJC 2VL4A 4WNQB 2E9IA 4YDJB 3QZWA 2PN5A 2CJUL 1HXYB 3FOMA 1ACYH 1Y0LA 4UT9H 5KG9A 3N85H 2OX5A 3CFJA 3OV6A 3VFPA 4X6BB 1IVLA 1Q9LB 2FD6L 4G8FA 3WUWG 1U3JA 2YXMA 3GRWH 4LHJB 1FYTD 4IHOB 4OZIA 4OQTH 2P8MA 1B90A 1MCPL 5EOCH 1ODAA 3FCTB 3K3QA 1ZVYA 4MHHI 4EDWH 1Q72L 4J4PD 5I1KL 5T3ZE 3P4NA 1IGYA 5E2UL 1SJEA 1AXSA 5E8OB 5DHVA 1UEYA 5GGVH 1S7TA 4ZXBD 5FHAH 3OKNA 2EDWA 2YSSB 2OR8A 2R0WL 1IQWH 3GM8A 5DHXB 1U42A 2EEAA 3P11H 1V8HA 4QHKJ 1KCUL 3WYRA 4LIQH 3DUHA 2PKDA 4NZDA 5CSZA 3UPRB 4PV9A 1TTUA 2V17H 3SKNB 5KVEL 1AY1L 1C5DB 5ITFB 3SHSA 4OZIF 1OW0C 4HZAA 4GSDL 1MF2H 3PWJA 5I1LB 3EYFA 4I18C 3D85A 3ZKXC 5JQ6L 3IRZA 4U6YA 1BAFL 3VXPB 4PUBH 4A6YA 3MLWH 2WP3O 1HCFX 2UUDH 1NMAL 4QOKD 4NKMB 4HULB 1S9XA 2XZAH 1JYWA 4LMQE 4HUWB 1EFXA 4X98B 4OT1H 1A6VL 3I02A 4KROD 3A0OA 2P8LB 3QUXC 3HUJE 2EDNA 1JZ5A 3AREC 4WU7A 1KJVA 4LLAA 4W6YB 1FORL 4LHUD 4Y19B 1QFUL 1DCLA 2W9EL 3OSKA 5J11C 4KJPC 4PJDA 4TVPH 1CGSH 1NCAL 3VG9C 2FX7H 4UOW0 5E5MA 3TNNB 4PJHB 1LO2L 4Y4FA 5E2VL 5D93B 3EOYG 1NCWL 3SE3C 5GGQL 1AXIB 2Y7QA 3NH7L 1KLGA 3HNSH 3BSZH 1WLHA 2BMKA 1W72A 1D9KC 1KCKA 1L7TH 2IGFL 4NQSB 1K4DA 3RDTC 4I2XB 1YNTA 3LD8C 4XAKD 3RNQA 4GAGL 5IR1A 3MRMB 1D7FA 4PJDF 5D96C 4YXLL 5HJ3A 3IKKA 4FNLL 3EJZD 3HNTH 4LK4A 5CEZE 5F1KC 1K2DB 3T0EB 3TO4B 1DEEA 2H8PA 3T77B 3ZE0F 2JIXB 2AEQH 3MACL 1FE8H 2JKXA 3OAYK 4JFYA 3QFJB 5FYLL 4UOJA 1KB5H 3WIHH 1FSKC 3AMKA 3VFOB 5DR5L 3QIUD 1PEWA 4LSUH 5HPMB 2GJZA 1QLRB 4XC1L 4K8RL 4S1QH 4LBEB 1ZVSA 1ZLVK 4G6JH 5MEND 3BUYB 4M9OA 4UAOC 5HY9B 4G6FD 5BQ7A 1ADQA 3IDYB 4FQ1L 3ZL4L 5J1SC 4OV6F 1SM3H 4L8SC 1TJIH 2J6EA 4CDHA 3MNZB 4R2GB 1KYOK 1MEXL 4OTXH 2VZ1A 1BIIA 2J1KA 1CXFA 4OGZA 3AS2A 3FB6B 4IMLB 2IQ9L 5F3HA 2JELL 4DWHA 5ICZB 1KN2L 5KZCB 3GKZA 5TE4H 5ACZA 2MCPH 3IF1A 3WUWB 4N0FA 3HPLB 4MSWB 4LQ1A 1CQYA 2O5XH 5I1HL 1A9BB 1J5OL 5CWSA 1WIUA 3CCHA 1VPOH 2XWBB 1EV2E 3DURA 1DANU 5CZVH 2VXVL 5D72H 2VLLB 4X7SH 5F7DA 3TA3D 2YPKB 3EGSA 4NFDA 2IALA 5DQJB 4P2RE 3AS3A 3E3QE 4Y88A 4D9RD 5IGXH 3DTXB 2XZQL 4HWZB 4UQ2B 1R3HB 3MQIA 3BHBA 3GHBH 4HS3B 4PY8J 2I5YL 5SV4A 5MI0B 2IEPA 4LVNB 1MJ8H 4TUJB 4AMKL 5C0IA 3PXHA 4YFLI 4LDOB 4JREB 1SVZA 3VW3L 5IJKA 4P46D 1LHZA 3U1SH 1S9WA 2VLRB 2BVQB 2DQFA 1IGFH 1KB5B 3OJMB 4JFEB 2IPTL 4MD0B 3KYNB 3HG1D 4RFNC 1B0GB 2CK0H 1LILA 3PV6A 1G9NH 4HEPG 3OX8A 2HT2D 4ODUB 5GGSA 1NDMA 4YQXH 3OF6A 4BK4A 3KS0J 2J3SA 1J8HE 2F54A 2OJEB 3SJVD 5J7CC 1IAOA 3I3BA 1F11A 5TF1H 3U0PA 3W9DB 3BP4B 3IDMB 3RZCB 4WO4B 3DX6A 4Z7UB 1MCBA 3ZT7A 3QI9B 2NW3A 3K81A 4M7KL 3PQYB 3DUUA 3L5XH 5C0NC 2PXYC 5FO8B 1RUPL 2Y06L 5I8EB 4HKZA 5HGDA 3RUGA 1EJOL 3MMEB 5JTWA 1M71A 2WP3T 4YZFF 5A40E 3T0AA 2XWTB 2ZNWA 1IQDA 3HCVA 4FXGB 2YWYA 4Z78A 1KB9J 4BZ2H 1R5WA 2AVGA 2V7HA 3M1BA 3GRWL 4YDVB 3OG4B 1IGIH 4OQTL 3T2PA 4EDWL 3JUYA 4ESKA 1WBZA 1MNUH 4JDZA 2HTLD 4R4NC 2WUBH 1CU4H 1FJ1B 2R69H 3CVHA 2J8OA 1R0AH 3EO9L 3EFFB 4KKLC 2ADFH 4L4VB 2J2ZA 4NO2B 4EVNA 5GGVL 1T7XA 1ETZB 5KSAB 2P5WB 3H7BA 2ZUTA 3F7QA 1T0MB 3HC0A 1IQWL 3LRSA 3QFDA 3HPJB 3P11L 4MQ7A 1FNEA 5AZ2H 4LIQL 1RY7B 5HHOB 3B9KB 5GRZA 1NL0L 4GMSH 1A1OA 1QVOA 3TM6A 2WWKT 3L3KA 2ADIA 3EZJB 1MFDL 2VKXA 4LASL 1P1ZA 3Q5OA 3ULVF 4DK3A 3RWEB 3P73A 1BZ7B 4L4TB 1IAIM 4IDLA 4PUBL 4GFTB 4DN3H 5HGBB 1BWMA 2HLAA 1FG2A 1NAKH 4LLMA 4P49A 2VIRA 1TJHL 1QFWI 1GGBL 1K8DA 4ONHB 5FUOL 3QO0B 2VDLH 5E00B 2HRLA 2M26A 4I3GA 4QHMA 2R2BB 3V5DA 3WN5C 1ZTXH 5JA8B 2X70B 4JCMA 2BSTB 3M17B 5C0JA 3VWJA 3MJ9H 4YNYB 4AM0B 5I1AB 2WWMC 3QEQD 2VAJA 3CUPA 4JRXA 2FECI 1UJ3C 4UTBH 2GW5A 3R1GH 5IVOA 4LLYB 3WJJA 3WFEH 1U8LB 2Z35B 4PRID 5F1NA 3CZFB 4GOSA 3C6SB 1CGSL 2BVOB 3VXOB 2VUYA 3MRLB 4KMQA 1LNUA 4HG4J 5SWSA 4UDUB 2DKSA 1IM9B 2CKNA 4XX1G 5FYJU 3V6ZA 3TPKA 1D5MA 3ARYA 3CIQA 3MGAA 5A16B 3PQYE 2JF1A 2RHEA 2I07B 3BSZL 3S36H 3VDBA 4WW2C 4YDKH 5DJCA 1FVDA 1LK2B 4I4WB 4N1EA 4JFPA 1JGLH 1J1PH 2VSCA 2V2TA 4IS6A 3DRTB 3PDDA 4J4PA 4CJ1A 2JJWA 4M5ZL 2X4OB 5E6ID 4K7FA 2QTEA 2FWOB 1Q38A 1PG7X 3HS0B 1XGRB 2VOTA 4ZXBA 3FQRB 3IFLH 5ALBL 4WJ5A 1FE8L 2E6QA 3UJIH 4XVUD 3WIHL 1NJ9B 3K7UA 3UZVB 4LSUL 5JLZB 3MV11 3DX9B 3CFDA 4PGBA 4L4VE 1OF2B 2APWA 1E0OB 3K80A 3SDCD 1BJMA 1I9JH 3RGVC 5JPNA 4MVBD 4NOBA 5GGRY 5EOTB 5HHOE 5CINH 5IB3B 1SM3L 3LKOB 4NC2B 4FP8H 2Y9RT 3DIFA 4NUJA 3U82B 2YD9A 1IT9H 1WZLA 4OTXL 1FG9C 4JKPH 3HHRB 1HXMB 4WHDA 3JV0A 5DRXB 4J3VA 4AIZA 4OLYL 4FHBD 3CD4A 1JPTH 3K1KC 2B4CL 4PGDB 5TE4L 3L1OH 1BD2D 1IGML 1A3LH 1BVLB 2E27H 2MCPL 3WFZA 3HKFA 3PHQA 2BZDA 2VDOH 3QT2A 4LSDA 4XVJL 2DM3A 3FT2A 5I76A 1D5IL 2C9AA 5JXED 5SWZD 1CXIA 3MRFA 1ZT7A 3FOLA 3B9VA 4HGWA 3ARBD 4OF7A 4EOWH 4YDLC 1SYSA 4GJTB 3PE9A 5D72L 2X1XR 3GNML 4TTDC 2O93L 1XIWB 4DKFH 1EEZA 5GGUA 4WUUA 4X7SL 1GHFL 4MAYD 2IPUG 4YPJA 1TVBA 1G7QB 4APQC 1JGEB 1IC5L 3GMMA 5BXFB 4OCXH 2BCKA 2UV3A 2ZSVB 4YH6A 5F6HJ 4UBDC 4KAQH 3MBEA 2P48B 4P2QD 1UACL 4YHMH 5GRVL 4BFIA 4F58H 3K0WA 4PJIB 5FYKE 5JW3H 1HH6B 1CZ8H 1W0WA 1INQB 1ZOXA 1FV1A 5EC1A 3U1SL 1ZT1B 2QSQA 1IGFL 3GBNL 3LS5L 1TCRA 1YPZA 2IBZX 1TTFA 2PW2A 2L7UA 3KPOA 1R5IB 3C60B 4XP5H 1KTDB 2DQCL 3QIUA 4PD4J 4PRDA 5GS1B 5JHLL 1RUKH 4YQXL 1CL7I 1L6ZA 4HQQH 4X6DF 4WFHE 4PJGE 2DTMH 2L7JA 4QXUH 3I84A 4F7PA 3FT4B 1QLEL 3BPNB 1W2KT 5C3TA 1FYHB 3N1QC 1F3DH 4XVSH 1YPZF 3WE6A 1DBAH 1FPTH 1HHGB 4M43H 2AQ2A 4OZHA 1FFOB 3GIVB 1KCVL 3TT3H 4MB5A 2QKIB 3PWNB 2HN7A 4Y5YC 4HWUA 5IWLC 1S7RA 3CFCH 3FO1A 4WW1A 4RGNC 3LKPB 3TIEB 4JQIH 1C5CH 5DUBA 1WUNT 1SMAA 2P5EA 4QRRD 5DZLA 4ENED 1DEDA 3EOBB 3P30H 4BZ2L 2IJ0C 4GBXC 3MXVH 4P2CG 3G5XB 1I9IH 1KXQE 4DGYL 4HXBH 2YPLB 1DQDL 3B5GA 2EC8A 4KKCC 1QKZH 1GAFH 4Y4KC 5INDB 1CU4L 2R69L 3K4ZA 1G7HB 4NCDA 4OCRL 2ICEB 2Q6WA 3SQBA 4OD2B 1F4XH 2YA2A 4NRYA 4OFIA 4H20L 3TA3A 4FQXC 5A2JH 4UIKH 5J8OA 2A6JA 1KF9B 1FVCB 2ATKA 3QDHA 4KVNL 1T83C 1J7VR 4NKQB 4BSVA 1GL4B 3NIGE 4RBPH 5AZ2L 1CCZA 4KH2A 3BE1L 3DHJA 2QQLH 5J4MA 3F5WA 1OARH 3TVMB 3T0VA 2V2WA 4Z7VA 3BH9B 4M6OH 2FIKA 1F3DJ 4P5KA 4XHJC 1Q9KB 3BEVA 1WTLA 2ICWB 5DRNA 4GMTH 3LKNA 5D9SB 3BI9X 2QEJA 4XC3L 3VRLF 2EZ0C 1WT5A 4J23A 3R0NA 4NT6B 5F93C 5ENWB 4BK5A 5DJZA 4PJIE 5BVJB 2DQIL 2VDLL 4K23H 2BX5A 4GAYA 3G5VA 3PWVB 4Z7VF 4PJAB 3MYJB 5D1ZC 4JB9H 5D5MA 1HEZA 3ARDC 5EUOE 4CUCA 3CXHJ 1KELH 4M93B 4XP4H 4LLVA 4ZFZA 5D2NA 2J8UE 4GXUN 4UTBL 2PYFB 4X6FA 4Z7NF 3OJDB 43CAA 2X1WL 1OGTA 5BS0D 3DJ9A 4WTZG 3A67H 4PG2C 4IJ3B 2ZUVA 3H6JA 1ZHBA 1U8KB 4RMWA 3WFHA 1VEOA 4Y89A 2CLRB 4LMQI 1BZQK 4EXKA 4LPWA 1YJDL 2NY3C 5BCAA 3QULB 3SDXE 4OM0H 5D5MF 5CP3A 4H88H 1C1EL 4YDKL 3H9SB 5D1XB 5I8OH 3N1PC 5F9WC 2FATH 1HHIA 3MCLL 2UZXB 1HSBA 5B3JE 1MI5B 1XF5A 5CIPH 1J1PL 1UM6H 5B8CA 4XNZC 5KTEH 4UT6H 4OCNC 3P0YL 3RL1B 2LQRA 1GC1C 1FAIH 2BNRD 5FYLD 4JJ5A 5FHBH 1R24A 2EDJA 2IFFH 3IFLL 4HKBA 3E6FA 3RZWA 2IMNA 4RGMC 3UJIL 3DVGA 1XR9A 5GSRA 2PO6A 4K8RD 3KNBA 4JM2B 1AI1H 1ZLUK 1B4RA 3UTOA 4AQOA 1JMXA 1S7XB 1AR2A 4P57B 1IMHC 1P5VA 1I7UB 1I9JL 4OJFL 1JHLH 3HFMH 4RQQA 2AK4D 2QR0A 5EWIL 2YRPA 5CINL 2EDRA 4UDTA 3VXSA 2XKNB 1IT9L 3GZKA 3MLTB 1G9ML 5DDHB 3SO3B 4WWKC 2DL2A 1NBYB 1UM4L 2NXZC 1JPTL 3QIWB 3L1OL 4G9FB 4OFYA 4WI9A 4J3SA 3BZFB 2W65A 2KDGA 4PRHD 1DLFH 2W0FA 3TNMA 3C9NB 1A7OL 4C83A 3QEQA 4EN3B 3ARSA 1I1AD 4GXUM 3QCVH 3JVGC 2YBRA 4JLRB 1BVKB 4EOWL 5EU6B 4LGRB 1T4KB 3V6BR 3IU3B 3L3DA 1BBDH 4DKFL 1NGPH 1EEYA 3BPCB 5F7KC 5C0EB 1RK0B 1WZMA 2YEZB 3ZKMC 1YEEH 1LO0H 5EPMB 4H0GA 5JUEH 1J0HA 1U8QB 1CF8H 5GRJL 5KVGH 4LSQH 2MPAL 4MB4A 4OZFA 5KAQF 4F2MA 4OCXL 5CIPB 1BECA 4HMEA 3VXTA 1GGCH 4HUKB 4KAQL 1RK1A 4J6RL 2YD4A 3OKLA 1FIGH 3QEUB 3UYRL 4OGYL 3PGDA 2H2SD 3GM0A 2NZ9D 2EDDA 5IVZA 3INUH 4JRWA 1A7NH 4P2OB 3G6JE 2D03L 4GKSA 2WIIB 1X4YA 3V4PH 1CN4A 1AHWC 4MNQA 1SYVB 4R4BB 4P4KD 2AJZA 1A6TA 4DZ8B 1MI5E 2G60L 1JUFB 4XP5L 3GSXB 1V05A 2G9HB 5HGHA 2FBOJ 3ABZA 1RUKL 3GMRB 1Q0YH 1E4KC 2EECA 3SDCA 1HIMH 2AQ3A 4MA7H 1DP0A 1UWEH 5J6GA 3QCUL 4DAGH 3PP4H 2DTML 4GRLD 5FUZH 1RUML 1R3KA 2Y07H 4EI5A 1S7WB 4QTIL 1QBML 1QG3A 5GJSH 4G7VH 4JR9L 5CD3A 1FC2D 4XVSL 1FPTL 1Q0XH 1PGRB 2HKFL 3QDMB 4Y19D 5F89A 3MFGB 1ZLWH 3BYYA 3TT3L 2Q76B 5J12B 3RY5A 2VWEE 3Q6FB 3AY4C 1BD2A 2FJFA 1MCCA 5IT2H 3EYOA 1TQBC 4JQIL 2PYEE 1K4CB 4JN2A 3TH3T 3RBGA 3MXVL 1F58L 1JF1A 3D18B 1I9IL 1IGJA 3MODH 5F96L 4HXBL 1JPGA 2BVUA 1L9MA 3ARBA 4KKLD 1YN6B 1QKZL 1GAFL 5H8DA 4RDQG 5BRZD 2FEEI 3OPZL 2YD1A 5DK2B 3FQTB 3TBYA 1F4XL 4MAYA 5I0ZA 3QQ3A 3T0ED 3QG6B 1T2QH 3HZMB 3RJDA 5GS3A 1FO0A 1CIDA 2EEBA 5FYJH 2AGJL 3QFJD 2IQAB 4MCYA 5ERWA 3RWJB 4OD1H 3TT1H 5FO9B 2VDQL 2EXYD 3HB3D 2V9RA 4F9LC 4TOYL 2VN7A 3D0LB 4YXHH 1OARL 4JFFB 3ZE2E 2BNUA 1I9RL 3S3JA 3EDFA 1LO5B 3F7VA 4JFOA 2B5IC 4LGPB 1QO3B 2JB6A 2NY4D 4OFKA 1I1YB 5C07B 4GMTL 3D2UB 3GSVA 3MXWH 3GSQA 4R2GD 3DETD 3L3HA 3NPZB 3QH3B 5EO0B 2HFFB 2AI0L 4M1DH 2UYLA 3VXUD 4Y8AA 3SGEH 2IAMD 4HD9A 1CBVH 3KPQB 1LQSR 2WWMD 4TUKH 3WIIH 4PG9B 3GSOB 4OD3H 1BWWA 5K9KB 3ARRA 3PJSB 1KELL 1RJYB 2AXFB 4HIIA 4XP4L 5FV2A 5CHNB 5DA0B 2R9HD 4Z7WA 4GAFB 4XT1C 3GJFA 5C0FA 5IUSA 1TMCB 4KJQC 5DD6B 5D7IE 4LAQH 4G8GD 4PLNC 1B3JA 4RSVA 3MRPA 3DX7A 5C2BH 5DJ6B 2WZPD 4EIZC 4OZGE 2DIAA 4KTDH 4Y2DD 2VLME 2Y36H 1UZ6E 2KUTA 3CU1A 5GHWH 4Y7MA 3KPNB 4ZAKB 4U1GB 5I9QC 3HZYA 5IJVA 2X10A 5HXMA 1AC6A 3LQMA 3FMGL 4NN6C 3VFTB 4PV8A 2ATPA 4Z7WF 4EXPX 1U93B 2NNAA 3R4DA 1CG9B 5C0AD 3W0WE 4RMUA 4HWBL 1OAQH 4HFWA 4U3HA 1UM6L 4HIEA 2Z92A 1A1MA 3C8DA 4UT6L 2AJUL 3FQWB 5F6IB 1FRGH 4PJCA 1KIPA 1XMWA 2CDEB 1FAIL 2QBWA 3WV0A 2BVPA 3OXSA 2VLRD 4JFED 2IFFL 2YUZA 3WS6C 3MLXH 1IC7H 1KENH 1QYGL 2YN5A 5CILL 1ED3A 1RURH 3CFEA 3D5OF 1OW0A 1R3IH 1AI1L 5DJ8B 5TGBA 5JZ7C 3RWIB 5I1DB 3SDDB 4URTB 1T1YA 4I18A 1OT2A 2IH3B 2CH8A 3SPVB 5DMKA 3QXAB 1JHLL 3FN0H 3UBXG 3X3FH 2H3NB 1NFDA 2RAMA 3MOAH 5F7UA 4KUCD 3EJYD 4X6CB 3QI9D 1ZK9A 3O8XD 4FABH 1MH5A 4HUXB 4JFFE 1S5HB 1BLNB 2WBJC 4FZ8L 1MCWM 3ZE1E 1FN4B 5M94B 4HIJB 1KNOB 1NSNH 4MNGE 3KLDA 3KPLA 2Z9TA 4B41A 1G9EA 3P4OA 3QUXA 2P8PB 4UIMA 4MJ5B 1MJ7H 1NFDF 5C9JB 1I1RA 1A6PA 3GMLB 5L8LB 2Y6SD 2CIKB 3ARFB 1M6OB 3ARQA 2GTZA 4J8RA 3U2SB 2A38A 4IM8A 4OM1L 5GGTL 2DM4A 1S9VB 1QSEE 3WXWL 4XCFL 3HMWH 5GS2D 5ABDE 3O9WC 3HN3A 1NGPL 4U1NB 2I9TA 3H3PL 4NWUH 2XRAL 2W91A 3SE3A 1YN7B 2VDRH 5IOPA 4FQQB 5DYOB 5KSAD 2P5WD 1YEEL 1M05B 1LO0L 3T0DA 4F15C 2F58H 1CF8L 1D9KA 5HYJA 4ETYA 5KVGL 4U4BA 2VXQL 5I8CB 4LSQL 2OMBA 3D0VA 3LEXB 3RDTA 1MHHB 3MROA 1I1CA 1GGCL 5JO5B 3UJJH 4PJEA 2NY2B 1QSFA 1X5YA 1WQVT 3PUCA 4NZTH 3VA2C 4L8CB 4NRXA 3QWOB 5KJRL 3ARPA 3MRDA 3X12A 1FZJB 4WV1A 1GOGA 3INUL 5JPMB 1A7NL 3S35H 3VFVB 2BNRA 4L4TD 1RSFA 3X14B 5DGRA 1RVFH 1MCHA 3TYFA 4P4RA 5KS9B 2XZCH 3HI5H 4UTAH 2DLTA 4IMKC 4XCNA 3TP4A 1Q0YL 1X5FA 3OAYH 4PJEF 1MLCA 4MA7L 1XF3A 3QUZB 1CL7L 4DAGL 5FUZL 4OF0A 4CKVX 2Y07L 4HUUB 3OKKA 4L8SA 1GGIL 4GH7B 2XTJB 4UNVA 5B39G 4ZD3H 1LE9B 4O51B 4G7VL 5GJSL 5JOEA 1QR1B 4UQ3A 1ZLVH 5C0GB 3C5SA 4KJWC 4DZBB 2IH1B 1Q0XL 1LEKB 5D7SH 2Z31B 3C5JA 5I0DA 3O3UN 2J88L 5TFSL 2X4SA 2WINB 4JRYB 4XP1H 3D3VA 1K5NB 2RR3A 4L3CA 3ZDXF 1CDHA 4MXVF 3L7FA 4YPGA 5DTFB 2IAND 2WNGA 3GJEB 4F7EA 1EUTA 2GJJA 4X6CE 4PS4H 3TO2B 2P47B 2ORBH 5E1AB 3JV5A 5IMKA 3RVWC 4LCCC 2VL5B 2DJ4A 1A47A 3MODL 1UB6A 4HIHA 4M7ZB 1VGEH 3LVEA 1B0WA 2Q87A 1A7PL 1T03H 2BRRH 4V2BA 5JIHA 5LGKA 4XNQB 3SGKC 1GZPA 1HKLH 4BFBD 2PTTB 4XTRD 4XRCA 5FIEA 1DQLH 5EA0L 3TT1L 2FJHA 5HHXL 2X4UB 4CU8A 5E6ZA 3UBXB 4YBHA 4TPRH 3V5KB 4XHJD 4X5WA 4O2EB 1EX0A 1HI6A 2OXHA 3I85A 3C09B 1L0XA 3IFPB 5EB9A 1NUNB 2QADC 4TSAL 2ED7A 4V2CB 1ND0A 1P7QB 5CD5C 3T0WA 3VD9A 3MBXH 2EE3A 3MXWL 4YFEA 1FNFA 1B4JL 3MZGB 5C08E 1BFTA 2VZVA 5JOFA 1W0VA 4X6DE 3VFNB 2I9LA 1KYOJ 1H3GA 2A73A 5FO7B 5JHDB 3CLEH 4X9FA 5IKCB 2GEEA 4TUKL 4YAQB 1U8IA 3WIIL 5A2KH 2VLKA 2IBZY 3RL2B 4OUUA 3L3IB 1UCBL 2ZZUT 4U1KA 4P2YA 5CBEB 4TTGA 2PXYA 1G7JA 3MRJB 3UEZA 1A7BA 1CR9H 1BPVA 1LE5A 4H8WL 1NANI 1U3HC 1N6QH 4H8WC 2A2QT 4KI1A 5C2BL 5HHNA 3WSQH 2ZUQB 1XIWD 2Y36L 1MREL 2XTJE 1N5YH 2VZ3A 3KLHD 3QAZB 3RWFA 1KG0B 1V5JA 1B0RA 3TLRA 5GHWL 3V4UH 5BJTB 1HSAB 3D39A 1E6OH 4QRTB 3VXNA 2EYRA 3MRQB 3FRUA 1GVIA 2QSTA 2B1AH 1WZ1L 3BWAB 3GSWA 4JRYE 3MO1B 4FQPA 2VXTL 2GIYA 4XCYA 1YMHB 3DV4B 3UTSE 3PABA 1FRGL 1C12B 2BNQA 1QPXA 1NGZA 5FOBB 1WICA 1CLOH 2LAGB 4EDXB 1XGTB 1IC7L 4AIXA 1KENL 2H32A 1MRDH 4LKXA 4NQDE 5TDOB 1RURL 4RZCB 4ZS6D 2VN4A 3FQXA 3QDGB 5TE7L 3WFBH 3IJYA 3ZHDA 4N0RA 3ZDZF 4AG4L 2WW8A 2RCSL 1HNFA 4HS6A 5C86A 1V7MH 5D1QD 3MRRB 2NX5E 4BZ1H 3V7MA 5B39B 1AJ7H 2CUHA 2QV2A 3RWGA 5HHVH 4I0PD 5F7YC 3W82A 2XWJB 4JAMA 5C0RH 5ITBH 5IQ9B 4JFZL 4QHNA 1UM5H 5J56B 3P0VL 3VFWB 1T1ZA 4L3EB 3WNPA 3FO0H 3WN5A 4Z9KB 3P40A 5I1GH 4G8IA 4RISL 5DJYB 5ANMA 3VXUA 2IAMA 4FS0A 4M3KB 4YHNB 3BPOB 5TH2A 2YR3A 3WUZA 5C0CA 3C6LB 4OGAD 2ZSWB 3KPSD 3K2MC 4CNIB 2XI9A 2CIIB 3P9WB 5F7EL 2G75B 4PYGA 2CK2A 4L3AA 1T7WA 4G8GA 2YPLD 3MUY1 1KPRA 5FDWB 4MXWH 1N6UA 3TBSB 5DJ0A 1I8IB 4L1DA 5JR1L 4PJFA 4Y2DA 2W0PA 2ICWI 3L3OB 3MOQA 2VDRL 4JO2H 2R1YB 4LCYB 5L2KD 4TRPH 1RQ5A 4WW2A 5IHZB 2EXWC 3LV3A 4PJ7A 5I16B 3DXAB 3O11A 8CGTA 2CRZA 2CGRL 3U36A 2BC4A 1DN2A 5D6DC 4DGVH 3H9YA 1KLFA 4LSTH 4WUKH 1I7ZB 1N59B 4DFIA 1WV7T 3NCCB 4PJFF 5I1IH 2NY6C 3FZUC 3STZA 4XNXL 3H9HA 2YK1L 1TLKA 2BFVL 1FL3B 4NQCE 3ZYIA 3KXFD 5IW6B 5HHQB 4WW2F 1Q8MA 4MJ6A 2DYPA 3HI5L 4PJ7F 3QPXH 4UTAL 2HVJB 3E3QC 2A77H 3RGVA 1TXKA 5CMAB 5LGHL 4JGMA 4RIRB 3RAJH 4CADB 2PF6A 2C5DC 4O02L 2OM5A 1ZGLM 2JCCA 1OGAB 4PFEA 4M62H 2NXYC 5FA3B 2D3VA 2JE8A 3RVTD 2MSPA 3RVUD 2B2XL 3VU2A 1OHQA 4R0LB 2E3VA 3X13B 1EH9A 2XXCB 2Z91B 4UU9A 4NC0B 4ETQB 2R23A 3C5ZB 4Y1AA 2Z8SA 1X6NA 1YQVH 3R8BB 5DWUH 3T3PF 4BSWA 2NLJB 6FABL 4N0UA 1TJGL 4AENA 2D7QA 4P59H 4GO6B 4EBQH 2ORBL 5BZWB 2JCCF 5TDNA 2GT9A 3VMNA 4LGSB 3BYTA 1NLBL 3EO0B 3NA9H 3MRCA 4U6VL 3H9SD 4KUCF 4R4FH 2BOBB 3V6OC 2V2XA 1VGEL 4XGZB 1S7VB 4HJGA 2BK8A 2DBLL 2OL3H 1P9MC 4YWGH 3QXTA 1XR8B 2BRRL 1BFVH 5GXBB 4HCRH 4QEGA 1UJTA 4G7YH 1H5BA 4APQA 3MV8B 1C16B 2CDFA 5E9DA 4MX7B 2D31A 4OLUL 1AXTH 1HKLL 3OZ9L 3QIBC 1WCQA 4UV4H 3AB0B 2ESVB 5JDSA 3TH2T 1T5XA 3O6LH 2OR9H 3QUYB 3IDJB 3G5YB 4AEEA 1UGNA 1QBBA 1XF2B 3PGCB 25C8H 2OS7A 4JY6A 5I30H 1FQ9C 3DYOA 4JFDD 5FDYA 4HGMA 4OKVA 3SDAC 1KJ2A 3ULUE 3RX8A 4R97C 3JV4A 5HD8D 4HT1L 2VR9A 5HI5D 4ZYKA 4HF5L 1INEH 4OB5H 2VLJD 1UC6A 1U95B 5E6YA 2R0LH 1YMMB 5IB2A 2JJTC 3BZEA 1LO3L 3QNXB 4PRBB 3QWRD 3LEVH 4KHTL 1OWRM 1QR4A 2KZ1B 3ARTA 1VGKA 4YIQB 3H3BC 3VFRB 1XCTA 5D7KD 2R2EB 1N6QL 3IVKA 2Q7YA 2R0KH 1X9QA 5EU6D 5B38A 3U4AA 1TPXC 3L5WA 3MGOA 1JWSA 1KLUB 2KPNA 3HAEA 4RMTA 3WSQL 1WSST 2VISB 5I1JL 1N5YL 5AWNH 4LRIC 3NOIA 3PWPB 3UTTA 2IANA 1NBVH 4GBXA 1A6WH 1QLFA 2ARWA 2VDKL 1BFOB 2HG5B 4JREC 1E6OL 3VFSB 4WI8A 3LH2L 3AU1A 2RFXB 1WBXA 1JE6A 3MREB 4Y4KA 4H1LA 4U33A 3GUTA 2Y5TB 1IC4H 1Z5LA 4X6EA 1AQKH 2OL3B 4UUJB 1BOGB 4ZO8A 5D71H 5FCUL 4LSPL 1EPFA 1E4XI 4FQXA 2COQA 1XGUB 3GJFK 5LCVL 3ULSB 2VUOA 1KCSH 1DFBH 15C8L 1T83A 4K3EL 4K94H 3KPRB 3R0MA 5KVDH 8FABA 4P5MA 3W81A 4X9HA 3IFNL 2V5SA 3BZ4A 4WO4C 3RZCC 1EHXA 3MUGA 5FKPB 1LP9B 3SOBH 4XMPH 2X4NB 4N0CC 1B6UA 1JWUB 3QUKB 2FBJH 3P77B 1RZGB 2ADGA 3MV8E 1YUHA 4F57H 4DK6A 5E0QA 4BZ1L 5A1AA 2ZG2A 1AJ7L 2NY7L 4WU5A 1NC4B 4FTVE 5HHVL 4QNPE 1CICC 3BKML 1GJIA 5BZDB 3SO5A 2PCPB 2V9QA 4LPCA 43C9A 3IDUA 5LAXB 1DVFB 5C0RL 5TPWL 1UM5L 4YEEA 1JCKA 1KIQA 4MS8C 4KZDH 3FO0L 3I75A 3AAZA 2X4PA 3TN0B 5I1GL 4KKAD 4MJIB 4OCSL 5D1ZA 4BH8A 3ARDA 5AD0B 2A6IB 3GSUB 4Y16C 1J1OL 1AGCB 3IETB 3OB0K 1EVUA 1PSKH 3LMJH 4NN7C 1JZ2A 4Q2ZA 4PG2A 4EQ2A 2Z8VC 4I5BB 4P9HH 1TZHA 4G8EB 5IF0B 3B9KC 3H0TB 2ICCA 1QBLH 4LF3B 5B4MC 2LVCA 4KGLA 2P46B 4JZJB 1YMME 3BUTA 1G7LA 3V0WH 5BOPA 3M45A 1UH4A 4E41E 1XFPA 1JRHL 4E42A 3EUUA 1ZHNA 4JO2L 4ZSOB 5SWQB 1CFVL 2C4FT 2BY3A 1JHTA 3PWLB 3O3BB 3T3ME 3HI6L 1P2CA 5CUSH 1XF4A 2R8SH 2EKSB 3HC4H 4HH9B 4A6YH 4ZFGH 1G9NC 1KFAL 1MAMH 3HI1A 4U1SA 4U6HA 1CD1A 3RU8L 4D3CH 1JN6A 3UZQA 4DGVL 1IAMA 3PWPE 2GCYA 1LK3L 4LSTL 5DS8B 1X5IA 2A74A 1YY8B 2CDGB 4PGCB 4FQIL 1DQQA 5C07D 4NBZB 3D2UD 3VI3F 4FG6D 4Y5XB 2J12B 3ZSSA 1F4YL 2XN9D 1A3QA 4JKKA 2HFTA 5EU4B 4WTXA 3MV9A 1OQXA 3FFCD 3U9PH 4AT6A 3O4LD 5D1QA 3RAJL 1XT5A 3FOMB 1Y0LB 1UXSA 1N64H 3CFJB 4M62L 5AG8A 4G8FB 5FYKL 1G0XA 2DQHH 1LP9E 1A6AB 4EJ1C 3S36X 4KUZH 4WWKA 1H15A 5D8JH 4KVCH 4OZIB 2P8MB 1RIHH 3TV3L 1HHHA 1W72H 2FHCA 2RB8A 4HIXH 1BFSA 5JMRA 3P4NB 4G43A 1IGYB 4NQEA 4PB0L 1YQVL 1SJEB 1AXSB 5DWUL 1S7TB 1DN0A 2IBGA 1PKQA 3OKNB 5ILTH 3QDAA 4EBQL 4FMKA 3NIFF 3JVGA 2BSSB 3AS0A 4WHCA 5CSZB 4ZNCD 5GS0H 4PV9B 4U7MA 4R4FL 4MJIE 5IB5A 4FQLL 1DBMH 3EOTH 4UB0L 3T08A 4YWGL 1BFVL 3PWJB 4BKLB 4HCRL 3EYFB 4XP9L 3LZFH 4U6YB 1WF5A 1ADQH 3BGMB 4A6YB 3DUSA 1M7XA 1I75A 4UV4L 3F8UB 4N8CL 3O6KH 1WCBB 4AEHH 1UKTA 4WFGD 1NGQH 4DVRH 2XQBL 1QOKA 1ITCA 2HH0H 1U8JA 2J6EH 1E4WH 3VG0H 1H3VA 4N5ED 3SDDD 4LCWE 4ZTPH 3ILQD 4WFEE 2B39A 3LRHA 1EFXB 3MGTA 3DMMB 4XHQA 25C8L 2VABB 3I02B 1M7IA 2XNAA 1G6RA 1MFCL 4NUGH 1AHWA 5I30L 1LMKA 1FZMB 1MHPH 4KK8C 3BMWA 1N2RA 1I3GH 2WMPA 4WU7B 4H25B 1PFCA 4KJYA 3UTZA 4S1DC 1VESA 3OR6A 3UX9B 4X5LA 1INEL 4HMDA 4IRSB 5E5MB 4Y4FB 2R0LL 3HNVH 3KWWA 2RBLA 3GMQA 3MV7E 4ELKA 2Z93A 3MZTA 1JV5A 4ZOEA 2DQTL 4M02A 3LEVL 4YFLF 2Y7QB 3JTSA 3CH1A 6CGTA 1KLGB 3PL6C 1U3HD 3ARFD 2BMKB 3B2UD 1W72B 2K9UA 2DIBA 5HVWA 4NSKB 3WLWC 1K4DB 1XCQA 3CLFH 3RNQB 3AY4A 1YEDB 1ZA6B 4MZ3A 2JTDA 2BXZA 3EO1A 5MEPA 1QFWM 2Z0BA 1AR1D 1DEEB 1U8MA 1NBVL 1Z3GL 3CC5B 4QXGL 5LBSL 2P42B 5DA4A 4JFYB 2GK2A 1RULL 3ARGD 2KKQA 4K55A 2ZG3A 3TCLA 4FFVD 1FH5H 1H8NA 1IC4L 4LP5A 4WI3A 1AQKL 3C60C 2NY2D 3BGAA 3WD5L 3UDWC 1ZVSB 2XKSA 4MCZA 3MRHB 2HFGL 3DNKA 3I2CH 5BQ7B 1X7QA 5JW4N 1A14H 4K94L 4XCEA 5GZND 2V9TA 5CGYD 1CWVA 5KVDL 3JXAA 5ISZD 4HZLA 3JZ7A 2E8YA 4IRZL 3MJ8A 3S5LA 4V1DE 3SOBL 4F9LA 4XMPL 1BIIB 1KOAA 4U1HA 5F3HB 3W39A 1JYNA 1S7SA 5CJQL 2FBJL 5ACZB 1FGNH 2W60A 3EKCA 4HWEL 5DZNA 3IF1B 4XPHH 4ZDHA 4TSCH 1WC7A 3ZT5A 4JFDA 5CWSB 3HC3H 1B6DA 4PTUA 1EZVX 3WMSA 2YWZA 1AO7D 3DURB 3EFDL 4B7LA 4P23C 2Z31D 5DUPH 5LWYL 1UB5A 3OKMA 5DC4B 5DJ2B 2PTVA 1T0NA 2DI8A 5D2LE 5HHMD 4C59B 3CVHH 5F7DB 5IMMA 3EGSB 2MMXA 1YEGH 2IALB 3CK0H 5IBUG 5A2IH 4G6KH 4O2CA 5JIKA 5T1LA 5F97E 4GKZA 4P9HL 3BHBB 3ILPB 4ELMA 3UBXI 1JNNH 1UYWL 2CR3A 1QBLL 5C0IB 2C7UA 2C3XA 3NGBB 3LDBC 1GXEA 3TVMC 5EO9A 4H0IA 3JSSA 5E8EB 4CVUA 5DO2C 2DQFB 2N7AA 4JGUA 5C0BA 3FO9B 3S6CA 5ELIA 3T1WA 1TTGA 4R8WH 3LN9A 3PV6B 3RY6C 4JKLA 4ZFGL 1PJ9A 1EO7A 3DHMA 4J3OC 4HWBA 5ICYA 3OX8B 2O61B 1A1NA 2AEWA 3UPCA 4D3CL 2F54B 2CQVA 3IJSA 5IVXF 1IAOB 3U0PB