5ALBL

Ticagrelor antidote candidate medi2452 in complex with ticagrelor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
210
structure length
210
Chain Sequence
VVTQPPSVSAAPGQKVTISCSGSNSDIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLAITGLQAGDEADYYCGTWLYDRAVGLFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI2452 HEAVY CHAIN
publication title Structural and Functional Characterisation of a Specific Antidote for Ticagrelor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5albL01
4NHCL 1BFVH 4ZO8A 2W0KA 3ZKND 3K80A 3NZ8B 4F9LA 1JPSL 4P5TA 4JN1L 1MFAH 3KLHD 3IDGB 3AS2A 5CSZB 4M1GH 2HT4C 5DMIH 1TZHB 5E8PA 1CE1H 4GMTH 1JL8A 4HH9B 4NZTL 2KQNA 2CGRH 5DMGC 3SE3A 4FQHA 4IHOA 4P23D 3N06B 2XWTB 2DIJA 4L3AA 1NKRA 1MJ7H 5FHAL 4RGOH 3SN6N 4LHUA 4L9LA 5E0QA 4ZS7H 4PUBL 2AXGB 4BSVB 3NFSH 3O6FB 1MCDA 4G3YH 5LGHL 3U36B 3I9GL 5IB4B 5D7KE 3W0WE 5E2VH 1AD9A 4ZFZA 3DUUB 1DANU 2H32H 2OL3A 5K9QG 4KWUA 4GQ9H 4BQCA 5IQ9A 3H3PH 2PR4H 3MV9E 5I9QB 2EDHA 3ARBA 4U0RB 5J12B 2H32B 5DURB 1S9WB 4LCCB 5F72S 5FUZH 3CU1A 2AK4B 5C7XL 2WUCL 2FEDC 2V5SA 3RKPA 3VGHA 3ZYZA 5D71H 4PJAA 2Z93B 4OLVL 3RNQA 1NCCL 1DDHA 4UOW1 1OAZH 4QHKI 2HH0H 1MUJA 1RULH 2OSLB 3EKCA 5EIQA 4L8DA 4IMKC 3SDDC 4X98A 3RVUC 2ZCKH 1EVTC 4Y5YB 5CAYB 1GGYA 1HI6A 3IDIB 4HFWA 3F5WA 3QO0A 3DMMD 4MXVF 3GM8A 2GJ6B 3QDMD 1ZANL 1F13A 2X44D 2ZWLT 2NTFB 4L4TA 2IADB 1T5XB 4LQFH 4PJHF 5D7JB 3DBXB 4Y4KC 2HMID 2RJMA 1JP5A 3QNXA 2HJKB 4NDMB 5I8OH 3VA2C 5I16A 1VB9A 1NGXA 5J56B 1TPXC 4YHKH 3TF7C 1HHKB 4XCFH 2PYEE 3H7LA 4JY5L 5IUSA 1ZWIB 2YWZA 3KPSA 3ROOB 2DJUA 4LU5H 1BZQK 1MCFA 3TCLA 5CEXA 3SDYH 5I1IH 4JFDE 2Q7NA 3NIFF 4Y16C 1U42A 4FFVC 4JCLA 1JNHB 1PJ9A 2GSIB 5HHME 3RX7A 3P40A 5IKCA 2DQCL 2V7HA 4X0KB 2FHBA 1ZLWH 2KBGA 3V0WH 4XWOD 1FSKC 4PJ8C 2NW2B 5CMAB 5FUOH 3T0BA 3RDTD 4F7CA 2DICA 1Q9WA 3BRFA 5F6HJ 2VXSH 2JTDA 4Z5RA 4ZOBA 3G5ZA 3MJ7A 4QXTA 4MQTB 2W91A 2IAMB 4ODVH 5IMOA 4X6CF 3EZJB 2VDKH 2IWGA 4IDLA 4R7DB 1FNSL 5F9AC 4J12A 5MEOA 4Y5XC 1NAMH 3FQTB 5B8CB 3KPRA 1VFAB 3QIUC 1LVEA 3DVIA 5DJ2A 4U6XB 5HVGB 5HXMA 1P9MA 3UJIH 1NAMB 1KELH 3WKNA 4UQ3B 5FGSA 3BJLA 3JV4A 5FGBA 3NCCB 4PJDE 5ICYB 1OT2A 3BD4A 2KZ1B 5E8OA 5E8DH 4IRSC 2X1PA 4Q9QH 1S9XB 3VE0B 2R4SL 1Q1JL 2AJUL 3K8LA 1D6VH 2KDGA 4PRDA 3BWUC 4KJWC 5KSVB 4FMKA 1ZGLB 3GMMA 3TT1H 2ZUUA 2B39A 3FN0H 1S7XA 2XTJD 1WIUA 1W0VB 5BS0D 4UV7H 3GSUB 4G43A 4M61A 4JFFD 4UB0L 4XMLL 5K9KA 4EKXA 4D0BB 5A16A 2X7LA 2AJYL 4KPHH 5JW4R 1MEXH 5FA4B 1R3IH 2DD8H 2MCPL 4X9HA 1I3GL 2W60A 2GFBA 5E8NA 3EFDH 3SGKC 4ZUVA 1JPTH 4ZD3H 3QUXB 5I6XB 5GRUH 1HHIA 2D2OA 1IC5L 4O4YL 4WFGD 4AJ0A 2V9TA 1IEBA 4LPUA 4BZYA 4ZNCD 4P4KD 4JG1H 4P57A 4APQC 4ETYA 4N90D 4FQXA 3S4SG 4QYOA 3U4EA 1KCVL 3D0VB 5FYJL 5MHSD 4UUJB 2R29H 2X4PA 2PUQT 1NBVH 4I18A 4FFWC 5JHDB 4ONGL 5MI0B 1EAJA 1UA6H 5F93C 1H3PL 2DQTH 1E0OB 5C0AD 5F9WB 4MNGE 5JO5B 3EDFA 5DGQA 2D0FA 4WW2A 2EYSB 2N7AA 3DX8B 1Q9OB 4GKZA 3QRFM 2UWEE 3VXUE 5T3ZH 5IROA 2F53D 1DQLL 5L0QB 4ZO6A 3MJ8A 4MA8L 4YR6A 3VFUA 1BX2A 1XR8A 3RJDA 3QIBD 1NGPH 1A1NB 1AR1C 3MJGX 3MLVL 3SGDH 2A6KA 3LEXB 4RA0C 4Y19E 4UI2A 4XP9H 3UP1A 2P7TA 4DJMA 2VDOH 1NFIA 2Q87A 1JZ7A 2PYFA 2IH1A 4HKZB 4NCC2 3LEYL 4WV1B 1F11B 3T1FB 3FQWA 3FFCD 1TVBB 1TZIA 1U8KA 1Z0MA 5D5MF 2ICWB 2HT3C 4UT9L 2Z8VC 4ZAKD 3EYOA 1IRAY 3C8KB 1HILA 1YMMD 3WUWB 4IOFC 3ARUA 1KIQA 3RVVC 1U3HD 1XT5A 2VZUA 3NFPB 4U6HA 2AKRA 3LKSA 3FO9A 4TUJA 4NQTA 3WJLC 4QNPE 3IVKA 3BN9D 1YEGH 4JDVA 2G5RA 3CDGB 5DHVA 3QEHA 5IWLA 4JO1H 1O7SA 1RZIA 4M8VA 4P9HC 5FECA 2CIKB 1EX0A 4M6ML 4HIXH 4JB9H 2LVCA 3SHSA 1A3RL 3C60C 4XNUH 5CGYD 5HVHB 1OOAA 3F7PC 1LO5B 2RQ8A 3RGVA 2MNUA 2OXGA 4JFOA 4MCYB 3SE9H 4J4PD 4H5SB 3VRIA 3CSYA 1B0RB 3LVEA 2YA1A 1NC4B 1J1OH 1AP2A 1UM4L 4UIKH 3WHE0 4HF5H 3WMSA 5KVEH 3E8UH 1M7DA 3MLPA 5IFAL 4TVPE 3VXOB 2FBJH 1LDSA 2YHGA 1JHKL 5DJZA 5EPMB 3WUWG 3OKKA 3IXAB 4WI9A 2YA2A 5TGBA 3ZE2F 4Z95L 4CU8A 5I1LB 2NXZB 1RHHB 4S1QH 4AIXA 5FYKD 1OSZA 2HKFL 2J8UB 1FDLH 4HC1A 5DI8B 3TO4B 1UFUA 4NQVB 2Z31C 2W0PA 3O2DA 4QHLA 4MNQA 3VWJA 2ITDB 4CJ0A 1N8ZA 1R5VB 2ZNXA 2BXYA 3LRGA 3RTQA 3NMEA 1ZA6A 2F5AH 4ZTPL 5TDOB 3H9SA 1T1XA 3IAGC 4LLWA 1NGWA 5KS9B 4U6TA 5IHZB 1HSBB 3EYQC 4MD5A 2LTQB 4ZSOE 4NOBA 3ULVH 3LKOA 1OARL 5T3XL 5DK2B 3F58H 5F9OH 4HS3B 2CDEB 3SBWC 3V9FA 3JWNC 2YBRA 2ADJA 3ARTA 5I18H 2W9EH 1UWGH 7FABL 2ZG1A 4LFHD 4OD3H 3GBML 4WRLA 1YEKH 4ODTL 1EK3A 1B2WL 4LLYB 4X8XA 1FZKA 4DKFH 4QRQA 4E5XA 1QEWB 1WBXA 1FYTD 2C5DC 4F9PC 5DUBA 5D6CB 3WFCH 2NY5H 4LMQE 2J1KA 3FQRA 1JNLH 4R4FH 1QKZH 5BV7L 3RIAF 3TYFB 2AQ2A 5CCKH 3ZO0A 4K3HA 1AGBA 4YBQD 4M62L 5B3NA 1ZE3C 3WIHH 5I8EA 1YJDC 4G7VH 4ODSH 1OP5K 5E2WL 4X8JB 4PY8I 4HS8L 3TV3H 1I85A 5I8CB 2ZUQC 1N59A 4OKVB 2IBBA 1BIIB 2QQLH 3PGDA 3SCMD 2VAAB 4TSAL 3NIDE 2P8LA 2YD6A 4GO6B 2ARJA 2ZUSA 1T1YB 3FQNA 1A9BA 5H2BB 1AGCA 1KN2H 5IGXL 3MFGB 3ARDD 2BFVL 3U0PB 4UZGA 4YHML 1X44A 5E6ZA 4DGIL 1G9MH 3IDUA 3QUKB 3NOIA 5I9QC 5HGGS 3LD8C 4WGVB 4L8CA 1KCRL 1KXQE 2MWCA 2C7UB 4U0RC 2EKSB 3RKDD 4RIRB 5EOCJ 1DUYB 3L5WA 2XWBB 1A7OH 1C5BH 1L4IA 4LCCC 4AL8H 3TVMB 2AJ3B 2VN4A 4FN0A 5I1HL 1NL0L 3D39B 4EXKA 2HT2C 5F3BB 1DBJL 4NSKA 3FB5A 3EGSA 2HFTA 5JW5B 1AQKL 3U9UB 3QCTH 1KTLB 4XZUB 1YNKH 1F6FB 2COQA 2DYPD 3QUZB 4Y5YC 3D85B 4BYHA 3QH3B 5HDBF 4NKIL 3FN9A 3WS6C 4ACPA 4PJFF 4P5TB 3QG7L 1HHJA 1X5FA 1NUDA 4PRPD 4U33A 4I77L 3V52L 4U3HA 3PWVB 5E8PB 5DJYA 3O6LH 4OFPA 3VDBA 2C3HA 3UBXA 3ULUD 4J1UA 4P23A 5TFSH 2NQCA 5GRJL 4FQHB 4XC3H 4P0DA 3T0AA 1IGYA 4Z7WE 5A3ID 5SX5H 4XC1H 3I50L 4CN6A 3WCYA 5CZVH 4UNUA 1Q72H 3PWLA 4X4ME 4LHUB 4L9LB 5GSVA 3X11A 5BOZG 3TFKC 4MJ4A 1UYWH 4X4ZA 3G6DH 4ODXB 2OL3H 4LDLB 3TH3T 1F4XL 5KN5A 3UYPA 3UDWA 1JHLH 1AD9B 4M7ZB 4ZFZB 2OL3B 1WJ3A 4OTXH 5FM5M 4F80A 2QADD 1QSFB 2EDEA 3ARBB 1DBAH 1NBYA 2N4IA 1WFOA 3RZWA 4P2YA 1ZHBA 4KK9C 5K59E 1SBSL 2A9ML 1IGIH 5EZIL 2WWKT 2JK5A 1R24A 3MGTA 4H8WL 5DRNA 4JEGB 3ZTJH 2WUBL 1WT5A 2AXFA 3LHPL 3R06A 4Y4HD 1IEAA 1DDHB 5E24E 1CFVH 2ZCHH 3SE8H 1MUJB 4RQQB 3Q5TA 3MRIA 1WICA 3B2UD 2GTWA 4L8DB 4X98B 4BFGA 1HQRA 5ETUB 3KJ6L 4GSDL 5EOTA 1HI6B 3DMMA 4JE4B 3GDBA 5AAMA 5T33L 4HFWB 3F5WB 3QO0B 5C70A 3QDMA 2D9CA 2WV3A 4KRPB 2DDQL 3X3GL 1SEQL 1I1FA 5ELIA 1C16A 1WCQA 4PB9L 3BE1L 4LNVA 1RUQL 5CJQL 4P5MA 1G9EA 3QNXB 2HRPL 4Q6IA 4Y2DD 3SDCB 3VFOA 4XP5L 2Q86A 3MV11 5I16B 3O81A 4YHZH 4YHIA 1NGXB 3IS1X 5C07E 4LKCA 1EEYA 4M1CD 4F15B 1T83A 2BSED 1EO7A 4TTGA 5MEPA 4HWBL 4RMTA 5DJCA 3I6KA 5CEXB 1U58A 4XCNA 4EZMA 2B5IC 4JGJA 2FJFA 3Q6FA 4JREB 4P59L 5IKCB 3CFDA 2V7HB 4DWHA 5A1AA 3OPZH 4ONHA 4XPTH 2R1YA 2F74A 3RDTA 3QUXC 4OGAC 5I6XC 1LE5A 1AKJD 4KHTH 1A0QL 4F7CB 3HKFA 4MAYD 4GJTB 5JXAL 1QRNE 1Q9WB 3PWPD 4PY8J 5LVEA 1Z6JT 5ECJE 5F7DA 2FRGP 4Z5RB 3EO9H 1D7FA 3G5ZB 3MJ7B 4QXTB 5IMOB 4NM8L 2XPGA 5AYQA 4JQVC 4JM2A 3RI5K 2R56H 2VKXA 5MEOB 4WVRA 3RUGB 5FCSH 3KPRB 1WFUA 1SVCP 3RWDA 5C0RH 4R8WH 1VPOH 5F9WC 3GSWA 1AD0A 3JXAA 1UWEL 5TJWK 3IKKA 3JV4B 2Q8BL 1JZ5A 3QCUL 1Z9SA 4Y7MA 1O5DT 3GSQA 2BVUA 4RGNB 5E8OB 3V5HB 3QXTA 5L0QC 3STZA 5E03A 4YHOH 3CMOH 3GMMB 3WBDA 5GQBA 1YC8A 4NZDA 1BQHG 1S7XB 2EEDA 3STBA 5EUOF 5BS0A 3SKMA 5DK0A 4HIEA 1ACYL 2FECL 4JFFA 1JBJA 2X4OA 4G43B 3BKJH 4M61B 3RU8H 4HKBA 1M4KA 5K9KB 4EI6A 3KYMA 5A16B 2X7LB 5A2JH 1N2RA 1ZV5A 3WJJA 3AS0A 2H2PC 3OAUL 2Z0BA 1LO0H 4R4BA 1I9IH 2W60B 2P45B 3CX5J 2GFBB 5E8NB 1HHHA 4LLMA 4ZUVB 5MEND 2D7QA 3EJYC 5GGSY 1HHIB 1E4XI 4Y8DC 1KOAA 4P4KA 3UC0L 5GJTH 1IEBB 1OTSC 1T4KA 4XPFL 3WN5A 3P73A 4P57B 2BRQA 3UPCA 5I8KH 2ZUTA 2O5ZL 4FQXB 4I2XB 1WLHA 4QYOB 5HI5D 3U4EB 3V4VH 2J8HA 2VL5A 1CVRA 3U4BH 4NZUH 4GAJL 4G6KH 2X4PB 1FL5A 1WFNA 4I18B 5C0AA 1MVUA 3F12A 4QTIH 3NPSB 1PYWA 2Z4QA 4NCDA 2YOCA 4EOWH 3UTZA 1U8LA 4LPWA 4WW2B 5BRZA 1BWMA 1CGSL 4S1DC 1AC6A 1F2XK 4N1HB 4NO5A 1I8MA 2A1WH 2F53A 4GKZB 4JRWA 2DJ4A 2PKDA 3O4LD 4LAQL 1NGQH 2A77H 2QSCH 1EHLL 1C08A 3MJ8B 3QIBA 4UDUA 4YR6B 3VFUB 3AMKA 2XWJA 1BX2B 5DJXA 1XR8B 3S8WA 1DBMH 4BZ2H 5EU7C 1R6VA 1QBAA 2VIRA 1IFHL 2A6KB 3AXLA 4NQDE 3HG1D 4CBPA 2I26N 3LKQA 1MFEL 2PF6A 4KY1L 1X6LA 4EDXA 2P7TB 4HGMA 5HGAA 1NFIB 4UIMB 2PYFB 2IH1B 5GGQH 2WBKA 3FFCA 4JQIH 5JHLL 3FQWB 4ZAKA 3IKCB 1J11A 1TZIB 1U8KB 5D72H 3EYOB 3O3UN 4KVCH 4QCIA 2EH8H 3HNVH 4G8EA 1HILB 1EEUA 1F58H 1KEMH 4LASH 1OTTC 1U3HA 4P9ML 4TQEL 1KIQB 1UCBL 5DHVH 2V2TA 1U3ZA 4U6HB 2AKRB 3TN0D 3FO9B 4TUJB 4ODHH 3IVKB 2PN5A 5EORH 1ERNA 2FGWH 1KJ2A 4JDVB 4K8RL 1IAIM 3MRBA 4OZGA 3QEHB 5DHVB 1LEKA 5KBNC 1RZIB 5E6ID 3DI3B 1HH9A 5C6PB 5FECB 4LEXH 4R4NC 1IZJA 1XIWB 1LNUA 2EE6A 2EC8A 4LSVH 3HE7A 3KJ4B 4MWFA 4JFOB 3WD5L 5DVMA 3VRIB 3CSYB 4H0GA 3VFGL 3FTGA 2XA8H 1UVQA 3MYJA 1AP2B 2NY5C 1M7DB 4X7SL 5T5NG 5DJZB 4YWGL 3AROA 3L5XL 1E27A 2IQ9H 4JZJA 1UC6A 3OKKB 5CLWA 4L5FH 4Z78A 5MEQA 4HC1H 4J6RH 5TGBB 3ZYJA 3FZUD 2PXYD 4F8TA 3O2DH 1ZLUH 2FECI 1CFSA 4BH7A 4MXVE 3THML 1OSZB 2CD0A 1EVUA 4HULB 1PLGL 4YLQT 4QHLB 5D7KD 3QNZA 4MNQB 3VWJB 4OGYL 2VDQL 1F4YL 3W0WD 4PJHE 2BX5A 4PGCA 5IHUL 5IESL 3QULA 1BAFH 3P0VH 3RTQB 4LCIL 1ZA6B 3BT2H 3MV9D 3Q5YA 5KTEL 1CFNA 4XVUC 3H9SB 1T1XB 4YDLB 2BSRA 1NGWB 3T77B 2NY7H 2R9HC 4MD5B 4AT6A 3ARFD 2PW1A 1JRHL 3LKOB 5IBTL 1HCVA 4JLRA 3CZJA 1ROWA 1MCOH 1ZEAH 3G9AB 2M26A 3NIFE 3TVMC 2D7NA 5GJSL 3QI9D 2YBRB 1BBDH 2ICES 2V9QA 4M43H 4OQTL 2ADJB 2VXVL 1PBYA 2NYYD 3ARRA 5ADPH 4KZEH 1P4BL 1FZKB 1V7NL 2Z8RA 1G7IA 4QRQB 1A7QH 4E5XB 1WBXB 4D3CH 5DUBB 1F02I 1MHEA 3QUZC 2JCCF 2J88L 3X13A 4QXGH 5B21A 4DZBA 3FQRB 3TBVA 4F9LC 4JY6A 4X6CE 2FIKA 4P5TC 3AB0C 1OD7A 5KW9L 3BDBA 35C8L 1AGBB 1NMCC 3INUH 4MQSB 2K9UA 5KZCB 4LHJB 1P53A 1KPRA 3W11D 5FKAB 5BMFL 4F58H 5I8EB 4KKCD 5HHVH 3SE3C 4WWID 2R69H 2MTPA 2PYED 3SCMA 1JGEA 1N59B 4RISH 4LL9A 3B9KD 3PGDB 1UENA 3G5YA 4J3WA 5GIRB 5H94A 4JFDD 2P8LB 3NAAL 2VWEC 1DEDA 5CD5C 5HHMD 3I3BA 5T1DH 1F2QA 2ARJB 4BQ6A 3GJFA 2JE8A 3ARDA 3EHBC 3DXAE 5DUPL 1A4KA 3FQNB 1INEL 1A9BB 3P4MA 1L7TH 1EAPA 3P9MA 3NH7H 1UQSA 1HCFX 1MF2H 1QFUH 3S37X 3SGEI 4JKMA 1S3KH 4WEBH 5F1NA 3DLQR 1QLRA 1N5YH 5AG9A 4L8CB 3ARBC 1I8LC 1LD9A 1DBBH 3L5WB 4V2CB 2XRAL 1CWVA 4LSSL 3HB3D 1J1PL 2P5WE 1CU4L 3FQUA 4Q6YA 3VGAC 4NSKB 5C86A 3FB5B 3EGSB 1X5LA 3DVNA 4B41A 4WUKL 3CXHJ 2BVPA 4U7KA 3F65A 3CVIH 3O11B 2DYPA 3ZT5A 5KAQF 4HAFA 1TTGA 2YPVH 5ANMA 4QEGA 4L8SA 4FABL 5A40E 5SX5K 3T0XA 3TCXA 3IDJA 1AIFB 5E2UH 4PRPA 3ZZ1A 1DSFH 4KRPC 3VFMA 1HHJB 5IIEA 2D03L 4P49A 3QG6A 1R0AL 3UBXB 5IM7B 4GAYA 3NZHL 5SX4H 4M7LT 1SJVA 5J6GA 4J1UB 4P23B 1YEEH 4JFXA 3SDCC 5JOFA 3S36X 2XN9E 1IGYB 4QKXB 3U30C 3BESR 3QYCA 4TNWF 1YQVL 3QEGL 2Q1EA 4OZHA 4XPGH 3Q6GH 1ZVSA 1TETH 4F15C 4ERSH 2UZXB 3PWLB 5GSVB 5IG7A 1GZQA 3X11B 5MERA 1H8OA 4LPCA 5IR1B 4KV5F 5ACZA 1JRHI 4JREC 5KN5B 2DMBA 2CLVA 1FP5A 2DIBA 1N5AA 1VADA 1NCDL 3CJJA 3TJEH 3T0EE 3EDEA 4OFVA 2YD2A 1NBYB 2H41A 5DUMH 1KG0A 2R0KH 1ZHBB 3ILPA 2Y06L 2Q7YB 5IJKA 1EMTH 2JK5B 1I7TB 1R24B 3MGTB 5D5ME 5DRNB 3DSNA 4Y4HA 4TVSa 2AXFB 4AEIH 1BFVL 3P30L 1HYRC 3R06B 4NN6B 1IEAB 1MFAL 3TA3D 5BO1H 4LBEA 4M1GL 3SOBH 5KSUA 4Z9KB 1B4JH 3MRIB 2NY0D 1CE1L 1PY9A 3OJDA 4GMTL 1HQRB 2B1HH 2CGRL 5FOBA 2BSTA 2MMXA 5CGTA 1P9MC 1UKQA 3DMMB 3MXWH 3VXUD 4Y1AE 1EPFA 3QDMB 1EFXD 5FGBC 2P4AB 4DGVH 5HHXH 4Q0XH 1J88A 3BP7A 1I1FB 3RWHA 4LPYA 3NGBB 1C16B 4RGNC 5FYLE 5L6YH 1HINH 1MJ7L 2Y6SC 4Y2DA 4RGOL 1MWAA 3U4AA 4Y19D 5I15H 4KKBC 4P5MB 4ZS7L 4Q6IB 3NFSL 4G3YL 5DRXB 3VFOB 2Q86B 4YHIB 2NPLX 5E2VL 4LKCB 1XZ0A 1YN6A 1EEYB 2AABH 4FFZH 4GQ9L 1FGNH 2NY6D 3H3PL 1AO7E 1OCWH 3ZE2E 4MXWH 5MEPB 1UM5L 5DJCB 3I6KB 1U58B 4XCNB 1TVHA 2B1AH 5FUZL 2FJFB 1IEHA 3Q6FB 2WANA 1RU9H 3CFDB 5D71L 2DAVA 1AKJA 4ONHB 4NKQB 2F74B 2YD8A 3RDTB 1OAZL 4MAYA 3L3OA 2HH0L 5HY9A 1RULL 2D3VA 3PWPA 4RGMB 2ZCKL 3TWCH 4I3RH 4KTEH 5DFVD 2VJXA 4JRYA 2XPGB 4ELMF 4HSQA 5EZOL 2CK2A 1VACB 3VWKD 3K0WA 4LQFL 4TVPD 3RWDB 5DC9B 4XRCA 4JDZA 3NPSC 3OTTA 2O5YH 3BKCH 3GSWB 1AD0B 3MCKA 5I8OL 3KR3H 5IBLC 4WW2C 4NWTH 3V8CA 1RZ7H 5CEYA 1UJ3C 1RUKH 4FQJH 1JGDA 3GSQB 4YHKL 3V4UL 4XCFL 4FTVE 1BFSA 2E9WA 3QFDA 4LU5L 3STZB 1A6TA 3SDYL 2EE3A 2N56A 3HNTH 4ZYKA 2XTJB 4WWKD 5F88A 3L3GA 2J7LA 5BS0B 5K9OA 3SKMB 5DK0B 8FABA 4HIEB 5C8JA 3V0WL 4O51A 2AS5M 4JFFB 2R8SH 2X4OB 1TNMA 3MO1A 5FUOL 5EIIA 1C7TA 4HKBB 4HBQA 3KYMB 2BMKA 3LAFA 1N2RB 5FF6A 1NFDA 2H2SC 3PDOA 2IBGA 2VXSL 1NJ9A 4TUKL 1KXVC 4M8QA 1Q9LA 4X6EA 3MV8E 5K9QI 1C1EH 4ODVL 2VABA 1FO0A 2VDKL 1HHHB 4LLMB 5E5RB 3TH2T 5IB3B 1YMHA 4MA1C 1NAML 2CUIA 3GSXA 4P4KB 4TTDC 4UBDC 4NQEA 4Q9CA 1P84K 1T4KB 3WN5B 1P5UA 4ODUA 3P73B 3VMNA 3UJIL 1LO3H 2W07A 1KELL 3ROLA 1Y18A 3VGBA 1ODAA 2ED7A 2VL5B 4XMPH 1XIWC 5I0ZA 4L8BA 4RRPG 1T2JA 5E8DL 2FR4A 1A7RH 4Q9QL 5C0AB 1MVUB 3F12B 3GSVA 1D6VL 4K3JH 2RFXA 4YBLC 1PYWB 2Z4QB 5FA3A 3QAZB 1H8NA 2NR6D 3UTZB 1U8LB 3TT1L 3FN0L 5GPRA 3GSNB 1FAIH 3C6LD 3O4LA 1NMBH 2XQYG 4NO5B 1I8MB 3PGCA 2F53B 2MFNA 1CL7H 1YEHH 4UV7L 1MHPH 4EJ1C 1P7HL 1FFQA 5HDBE 3U0TA 5INDA 1C08B 3QIBB 4UDUB 1D5IH 3EUUA 2XWJB 4KPHL 4PJFE 5DJXB 1S7RA 3HG1A 5IT2L 1MEXL 4WI6A 2VIRB 3AXLB 1R3IL 2DD8L 4YK4C 3LKQB 1RMFH 4PRBA 5HYEA 1A14L 4EDXB 5CJOH 5HGAB 1JPTL 4DZ8A 4ZD3L 5TPWL 1IGJA 5GRUL 1KCUH 3RTQC 3FFCB 1A1MA 4LLQA 1VENA 1BIHA 3WXWL 4ZAKB 2BVTA 1Y6MR 32C2A 1YMMB 4JG1L 1JIBA 1OAYH 4QCIB 1GOHA 4HPOH 4G8EB 5CSBA 2DQGH 4X5LA 1BHGA 1U3HB 4X7DC 5E56A 3HUJA 3SKOA 1KJ2H 3TN0A 2R29L 4IRZH 3V6OA 2V2TB 4MXQD 3BUYB 1MVFA 3FB7A 5DD1H 1UA6L 1QR1A 1KJ2B 1XF5A 2DQTL 4NHUA 5D7LE 3MRBB 1LEKB 4OZGB 5DLMH 1HH9B 1R3HA 4WI8A 1QO3A 3ILQC 1K85A 3OB8A 2ORBH 1LNUB 1ZLUK 1IL1A 4U1HA 4HJJH 5T3ZL 4MWFB 2DTSA 3LS5H 5ABDE 3FTGB 1UVQB 3MYJB 1NGPL 5CJ5A 5J4MA 1JHTA 4XP9L 3RNKA 4FQ2H 2VDOL 1E27B 4R9HA 4JZJB 5BQ7A 2I27N 2PXYA 1WQVT 2IH3A 4Z78B 5B39G 5MEQB 4LSTH 2EZ0D 4QGTA 3VGFA 1CFSB 4BH7B 1XGPA 4OD2B 4QRTA 3W0WA 1AHWC 1YPZB 3QNZB 4FMFA 5D93C 2CIIA 4OZFG 3MV9A 3B9EA 4O00A 3WSQH 3QULB 4CMMA 4OLUH 1CFNB 1NPUA 5FV1L 2Y23A 1FFOA 2BSRB 1YEGL 3ARFA 5F6IC 4AENB 4AT6B 2HLFC 2IQAA 3S3SA 2PW1B 4HIXL 2Y5TA 4JO4L 5D7IF 4JB9L 4JLRB 3QI9A 5C6TL 4KFZC 4XNUL 3G9VA 1A6WH 4F37K 3JZ7A 1FH5H 3T0WA 1X5AA 4XBGA 2ZUWA 4LVEA 5DO2D 5GGSA 3RQ3A 1B9ZA 1J1OL 4UIKL 1B0GA 4HF5L 2ZSWA 2I60L 1FYTB 2FBJL 2OJZH 3W82A 1MHEB 3TIEA 3X13B 5DYOA 3KLHC 4DZBB 4JY6B 2FIKB 4S1QL 1FVEA 4X7EC 4PS4H 4ODWA 2X10A 4HEME 1A47A 4WI3A 1KPRB 1AGDA 1HWHB 1F97A 4P23C 4XPBH 2PYEA 5B38G 5C07D 2YN5A 2F5AL 3MLXH 3B9KA 3SCMB 1JGEB 5JLZA 2ARJQ 5IB5B 4JFDA 3LKNB 3GRWA 1KGCE 3K3QA 3G5YB 3GJFH 4FQLH 1HKLH 5H94B 1KB5A 1ZHLA 5E00A 3ULVL 4UQ2A 3L3KA 2AJZA 4CJ1A 3ARDB 1A4KB 3F58L 3RZCC 3P4MB 4DK6A 1M7XA 5F9OL 3DX7A 1EAPB 3P9MB 1RVFH 3UDWC 4JFZH 1UQSB 1QRND 1QR4A 5EUOE 5I18L 1UWGL 5C0DB 4OD3L 5F1NB 5A2IH 1MFNA 4XNYH 1QLRB 1YEKL 4NKDA 1CT8A 3H3KA 3T4AA 4DKFL 4OFYD 4POZC 3CSBA 1FC2D 1TXKA 4MSWA 3CZFA 3D0LA 3OKOA 5IOPA 3FQUB 4NN6C 1JNLL 1QKZL 5J11C 3DVNB 1UT9A 4JDTL 5GHWL 5CCKL 4QXUH 4DUVA 2BVPB 4RNRA 2DYPB 1V5JA 2YPLE 4PJDA 4EN3D 3R4DA 3WIHL 1A6ZA 1WC7B 4G7VL 4ODSL 1A6AA 5ANMB 3ZDZF 3DMMC 3TV3L 3H0TA 3ULUH 2R1WA 3IDJB 5CBAB 4PRPB 4MVBD 2QQLL 3OJVC 3VFMB 5IIEB 2ICWI 4NO2A 3NGBC 3VFRA 3QG6B 1LWRA 5I1KH 2CQVA 4GAYB 3N1PC 5J6GB 4P46D 1OTUD 4DTGH 2Y4SA 4JFXB 3E3QC 4Q6IC 5JOFB 2ZKHH 4BQ8A 3VFPA 2E7MA 1KN2L 2JLLA 2P8PA 3QRGH 5FDWA 5FB8A 1VGEH 2N1KA 4PJAE 5KVMC 4OZHB 4X4XA 1G9ML 1ZVSB 4CVUA 1UJTA 1T83C 3TGXA 1NCUA 2RBLA 3GHEH 1GZQB 2KUTA 2OK0H 3CFJA 1AFVH 5MERB 1A7OL 1C5BL 4PV8A 4G9DA 4AL8L 5ACZB 1JK8A 4XWOC 1MJUL 2CLVB 2E9BA 5FAAA 1VADB 3WFZA 2QADB 1VESA 2V5MA 1JMZA 3QCTL 1T2XA 4RGMC 3O3DB 4L4TE 3LEVH 1JUFA 1KG0B 4LSUH 1YNKL 3U7YH 4XBEH 3IJSA 5D2NE 3I84A 3PUCA 4Y4HB 3UYRH 3K7UA 3UPAA 3TA3A 5CEZE 4MNGA 4GRMA 4OV5A 2NY4C 4H0IA 4LBEB 25C8L 1J1XH 3OJDB 1TCRA 2UWEA 1DQTA 5TFSL 3VXUA 1D9KB 1GCFA 5FOBB 2BSTB 5JXED 1EFXA 4XC3L 3SDXF 1HKFA 3ZE1F 2QHRH 3MZGB 4NN7C 1WITA 3GIVA 5CLTA 1BBJA 2D9QB 3NA9H 1MWAH 5CP7A 4XC1L 1GC1H 1FL6A 1QSEE 1NEZA 3HMWH 3RWHB 3BP7B 2H3NA 5CZVL 1CXLA 4U1MA 4TOYH 2P48B 3HI5H 4Y19A 1BJ8A 3KNBA 3NCBB 4Y2DB 1Q72L 4NQDD 2JIXD 1MWAB 1G84A 5KANI 4PYGA 4UTBL 1UYWL 1NCNA 4OLXH 2OL3L 2VL4A 4PR5A 2ZPKL 4O2FA 4OTXL 1XZ0B 1YN6B 4KGJA 4K3DL 3P77A 3QCVH 3EYSH 1DBAL 4NBZB 2Q76A 5D7SL 1B90A 4HIJA 4X5WA 4Y88A 1TVHB 1IGIL 1FBIL 1F4AA 5IFJA 1AKJB 1RI8A 2R0WH 1CFVL 1VEPA 3OG4B 1MIMH 5GGTL 3SE8L 1E4KC 3L3OB 4KXZH 5HHPA 2UZYB 4JFHE 4KDVA 5HY9B 3PWPB 1G0YR 4WJ5B 2J8UF 4P4KC 3RIFK 5JDJA 4MGXA 4MA3A 1SHMA 3WFDL 4AEFA 3UPRA 3PIQA 2AEQH 1HHGA 1MCWW 4N1EA 3GMNB 4XCYA 3VWKA 1C12A 3D9AH 1PKQE 3UTSE 4YXKH 1BD2E 4JGMA 4FFYH 5CZKA 3DUHA 4XRCB 4JDZB 5CEZL 3BH8A 3WO4B 1S7UA 4H25A 3WV0A 3QAZC 4EUPG 3MCKB 1DE4A 2D7OA 1CICD 2D4FA 5CEYB 1JGDB 3QHFH 4OF3A 2XQYK 3QPQD 3N85H 1CTNA 3VG0L 2JCCE 1C5DB 3ZDXF 3QFDB 1JI2A 3QIBC 4WWKA 2CR3A 1A6TB 4ZYKB 3MQIA 4DUXA 3SY0A 1FNFA 3VXSD 1MH5A 5K9OB 3O2VL 2P24A 4R26L 3OPZL 5C8JB 4XPTL 4PJCF 4ZSOA 1SYSB 3OXSA 1KYOJ 2BMKB 2EDOA 5FF6B 1NFDB 4D9LH 1FO0H 1NJ9B 3EO9L 5E7FA 1R3JA 4M8QB 1Q9LB 4X6EB 4GKOA 2CLRA 4U3XA 2ICWJ 4GAFB 4PBWD 5MENB 2VABB 5DA4A 2NZIA 15C8H 1FO0B 3FQXA 1MI5E 1YMHB 5CZXD 4UV4H 3BN9C 1MJ8H 4WU7A 4Z7QF 4NZTH 4P48A 1WVZA 1P7QD 4R8WL 1VPOL 1WK0A 4ODUB 3TP4A 1PY4A 4YGVA 3D1MC 4GFTB 1FVDA 3ROLB 1Y18B 5EO1A 3W2DH 5CGYC 3HLAB 3OKEA 2XZAL 1NC2D 4L8BB 4Z18A 2F5BH 4J4PC 2FR4B 1M6OA 4LHQB 3GSVB 1FNLA 1F8TL 2RFXB 4YHYB 5K9JH 4YHOL 5FA3B 3CMOL 3C6LA 1SBBA 4P3DA 4P2RE 3V79C 3R0NA 5F9DC 3O4LB 1YNTA 3PGCB 4JZJC 5DRWA 2WP3O 3HPLA 1HN1A 3U0TB 2OP4H 3RU8L 5INDB 3LRHA 4OUOA 5CHNB 4U4BA 2GT9A 1S7RB 3HG1B 3LDBB 2MQ3A 3DXAD 5E6YA 5C7XH 3SQOL 1OF2A 1LO0L 4DEPC 4LIQH 4PRBB 1I9IL 5GRZA 4DZ8B 2NTSP 1IGJB 1BQUA 2QV2A 1I3VA 2CUMA 1A1MB 4LLQB 2H26A 2CPCA 5GJTL 1T20A 32C2B 1U8PA 2WLYA 3VFTA 3K8KA 1RFDH 2LAGB 3DETD 4LEOA 5I8KL 2BNQE 5T1LA 3HAEB 3N50A 3S35L 3V4VL 1O0VA 2P5WD 3U4BL 2EDJA 3HUJB 2A6DA 3SKOB 3U7WH 4NZUL 3TN0B 1BQLH 4G6KL 5IB2A 2FJHA 4KV5E 5F7HA 4LARH 1Q9KB 4M93C 5KSAD 3FB7B 4QTIL 4B0MM 5E6IB 4W68A 1XF5B 4NHUB 2BVEA 4WHYH 3MV7E 2X4TA 3P0YH 1QO3B 2CKNA 5T5FH 2A1WL 3E6HB 3D87B 4U1HB 2A77L 3QXWA 3I85A 2AVGA 4YBQC 3DROA 5H37G 1DBML 4Z7WA 4BZ2L 1TCMA 1WWAX 3GK8H 1X5GA 3BWAA 4K55A 1F3JA 1JHTB 3RNKB 1IC7H 5BQ7B 3BW9A 3HAEG 2PXYB 2W65A 1I7ZA 4PGBA 4X4MA 4KUCF 4J8RA 5GGQL 4JQIL 3SCMC 3MRPA 3R8QA 1TJGH 5F7FA 3OZ9H 4EQ2A 3BDYH 1XGPB 1K9TA 3V4PH 4QRTB 2D0GA 3W0WB 4KVCL 3T2QA 1N6QL 1RSFA 2EH8L 4PP1D 3AM8C 1F58L 1KEML 2CIIB 4LASL 3MV9B 3ARDC 3M1BA 2AAVA 4LVOC 5IW6A 4FS0A 3LQAL 5IF0A 1U8HA 3GMQA 4ODHL 3IFNH 1FFOB 5EORL 1HZHH 2FGWL 4KMTH 1MRCH 3ARFB 3F7YA 4MYWB 2IQAB 1TQCB 2GTZA 1Q38A 4HHAA 2Y5TB 2NY3D 4LEXL 5LGKA 4H88H 3CLFH 2OR9L 2Q8AH 1MSPA 5EU5A 4MQ7A 4LSVL 5DFWH 2AJUH 4TPRL 2OTWA 4XBGB 3IXTA 4KKNA 1DVFD 4KQ3H 3U6RA 5DZNA 5GGSB 1B0GB 4P4RA 4JHWH 4NRXB 3TH4T 5KVGH 2R0ZH 2ZSWB 4J3TA 4LCYA 4HWZA 4Y1AD 4LK4A 3LPWA 4NN5B 4YFEA 4L5FL 3TIEB 4JPVL 4UB0H 3V8OA 4J6RL 5I0DA 2VLJE 5DYOB 1D5MA 3O2DL 1R5WA 1FVEB 3MRDA 2VH5H 2AJSL 4ELME 5JW3H 4I48A 4YC2C 4MD0A 5C07A 2APWA 5BCAA 1AGDB 1JWMA 4K07A 3GRWH 2PYEB 1H5BA 1NCTA 1BAFL 5FGRA 1KB5H 1CDUA 3BT2L 1AO7D 3B9KB 4O4YH 1NDGA 1T7VA 1T66D 5JLZB 3T0DA 4JFDB 5JA8B 2IALB 3S5LG 3KPPA 5HHMB 4HLJA 3RUGF 2NY7L 1KB5B 1ZHLB 2DLHA 4K94H 4ODBD 5ESVA 4Z7NF 1FFPA 2CRYA 4UQ2B 1L0QA 5FOJA 3L3KB 2AJZB 1XCQA 3ZHDA 1ZEAL 3DX7B 4ONGH 1QRNA 3I3EA 1BBDL 3G5VA 4M43L 2OS7A 2YR3A 4M6AA 1INDL 2QADC 3VDCA 4UU9A 1BLNA 3WO3B 5ADPL 4KZEL 5GZND 1DFBH 1UXWA 4NKDB 1CT8B 2DLGA 3ZL4L 1HWGB 4OFYA 3T4AB 1UH3A 1X5HA 3SO5A 1BMGA 4GUPA 1A7QL 5H8DA 2W0FA 5IJKC 4D3CL 5HD8D 4Y4HC 1DQLH 3E6FA 3V7MA 3D0LB 3OKOB 5IOPB 4I1NB 4QXGL 3KPNA 3T3MF 2ZOLA 2VXUH 3HHRB 1OGAE 2NLJA 1C5CH 2R2EA 1AE6L 2V9RA 4X6DF 1FV1B 1OAKH 1UWXH 4RNRB 4EN3A 1J12A 4N0RA 3JV6A 4PJDB 1HXMA 3CCHA 4ZDHA 4J23A 4F58L 1RJCA 1A6ZB 1A6AB 1D9KC 5HHVL 3T2PA 2R69L 3H0TB 4O5LH 2R1WB 1LO2H 3LZFH 3U83A 4FTVD 1I3RB 4RISL 1OP9A 1IAIH 2O26U 3BPLC 5C09E 2RGSA 4NO2B 5CFHA 5SWSE 3VFRB 4P46A 1F3DH 3EAKA 1E6OH 4Y2DC 5T1DL 2RB8A 2C1OA 2HAZA 1MFCH 4KKAD 3PV7A 2WSKA 4U31A 1L7TL 2P8PB 1SMAA 4XP4H 2DN7A 5F7LB 5FDWB 3EOBA 5FB8B 1MF2L 1QFUL 4M1CC 2DTMH 4WEBL 2HP4A 2HFEA 2HJLA 4M6MH 1N5YL 2E6JA 3MV8D 4J2XA 2P44B 3CFJB 4X9FA 1DBBL 3ARED 4PV8B 4BSJA 4G9DB 1XEDA 1JK8B 2FWOA 4JFPA 1RUMH 4K3GA 4X6BA 1UM4H 2WQRA 1MIEH 1BVKA 3CVIL 4QHMA 1JHKH 5IVZA 1JUFB 2YPVL 2I9TA 5HPOA 3IJSB 4S1SH 4QOKE 1ZXQA 3EDKA 4D9RE 3G5XA 5TDPB 3TA3B 3DECA 5F1OB 4MNGB 4GRMB 2QQQA 3MR9A 4X7FC 3U82B 4OV5B 4EBQL 3FO0H 2NY0B 3S9DB 3GSRA 4B5EA 1P6AB 5T5NF 1TCRB 1NGYB 5CWSA 5JXEA 2UWEB 3VXUB 1YEEL 1G1CA 1EFXB 1QUNA 3H42H 3IJYA 4NQUA 5EZJB 5EBWA 1YEIH 2VDRH 5E95B 3WHXA 3GIVB 2X1QA 1BBJB 5CP7B 5T1MA 1FL6B 1NEZB 2H3NB 2DQJH 3IRZA 4U1MB 3Q6GL 2JIXA 4NQDA 4XPGL 4Y19B 3MLZH 1A6UH 3BPOB 3KNBB 3LQMA 4ERSL 5C0BE 3LRSA 1H8SA 3NVQA 2FHFA 3DURA 1V3LA 5CJBA 2AJVH 1M7IA 4PR5B 1VDGA 2D7MA 2BVYA 1F42A 2NY6B 1KENH 5J3HC 3MNVA 3MTRA 4O2FB 3BH9A 5GS1C 3TJEL 3P77B 3MBED 4MZ2A 2Q76B 2R0KL 4HIJB 4X5WB 1T2QL 4N5UA 3T2NH 1EMTL 1WISA 5BXFA 1UEMA 4I0PC 4AEIL 4UTAH 3NACH 3ZHKA 4W6WB 5HHPB 5BO1L 5J06A 5D7LD 4M62H 3SOBL 1KC5H 1KPUB 5GS0D 1QNZH 1FGVH 2HA1A 1NH6A 2B1HL 5HI5C 4MA3B 1IC4H 4HXBH 3VD7A 1A22B 5FK9A 4TVPH 3DX6A 3UPRB 3PIQB 1HHGB 5HHXL 3VH8B 3VWKB 3MRRA 4XCYB 5D7IE 1C12B 5L6YL 4TSBH 1HINL 4QY8A 1RZFH 5I15L 4MA7H 3MJ6A 4NQSA 3BH8B 5IB1A 1S7UB 3QQ4A 4H25B 4OLWH 1T03L 3QEUB 1CICA 2NZ9D 1DE4B 3PQYD 1UGNA 4FQIH 3U9PH 5ADOH 4HFUH 3MA9H 1J8HE 1I4FA 4I13B 2AABL 4FFZL 2PW2A 1KCRH 4U1KA 1OCWL 4PJHA 4K9EH 1U36A 3V6FA 4MXWL 3U0WL 1JTPA 1T1ZB 4WWKB 2XV6B 3KPQA 1KJ3L 4JJ5A 2B1AL 3ECBA 2WNGA 5IHLB 1MCJA 3SY0B 1OW0C 5I1HH 1RU9L 1A9EB 1OQOA 1DBJH 3C8DA 1CD1A 1MH5B 5HI3D 1D6EA 1OAXL 1ITBB 2X4NB 3R8BB 5TDNB 3ALXA 4ZSOB 4K7FA 3OXSB 1CG9B 3VH8G 2EXYC 2APTA 3C5ZD 3VRJA 3P4OA 3MUGA 1YEDA 3TWCL 3BGMA 5FCUH 4I3RL 2DI9A 3C9NA 4KTEL 1R3JB 3EDDA 1OLZA 4F37F 4R96A 2QSVA 2AXJA 2CLRB 1CGXA 1JGUH 5D70H 5F7EH 1CF8H 1P7QA 2BHZA 4WU7B 3GI8L 5E6IC 2D4DA 2GUOA 1IKNC 2O5YL 4IEFB 1FVDB 2IFFH 3KR3L 3QDHA 4X6CA 5EO1B 1NC2A 4HXAH 4NWTL 4Q7DA 1RZ7L 4ZMAT 4OFDA 4KC3B 3OKEB 1RUKL 2DI7A 3ARYA 2OJEA 4RZCB 2DBLH 1M6OB 4QXWA 3ESUF 1JTTA 4JHZA 3HNTL 1LEGA 3C6LB 1MCQA 1N0XH 4P3DB 2BOCA 4MS8D 1NQBA 2G5BA 3O2WL 5DEZA 4AEEA 4BQ9A 1YNTB 2R8SL 1KGCD 2PXYC 5DRWB 3HPLB 2DI8A 3I75A 3ZDZE 3IFLH 3DXAA 1KB9J 5JR1H 5E99H 3WDJA 4H8WH 2GT9B 1MQ8A 3MRKA 2DS4A 5GGVY 2C3VA 4LVHB 1OF2B 4C56E 1ACZA 2BP3A 4Y2OA 1C1EL 2R39A 2YEZA 4YDVA 5I75C 4OGZA 3ISWA 2G2RA 3FRPA 1QBMH 2H26B 1T20B 2VXTH 2WBWB 3T2OA 1U8PB 3QZWG 3ARFC 4R90H 1X4YA 3VFTB 5T33H 1MY5A 1LO3L 2P5WA 4LEOB 5HVFB 3RHWK 3FOMA 4YHNA 1SEQH 1OQXA 2A6DB 4XMPL 4X80H 5KSAA 5EULV 1KIPA 5IB2B 2FJHB 2F54E 2NYYC 1A7RL 3S88H 2HRPH 1IKFH 4K3JL 4N5ED 5LG1A 3HZYA 2F8OA 2X4TB 2OYPA 2OZ4A 1FAIL 4WEUD 4NN5C 1NMBL 1G1YA 2AI0L 3TBWA 1CL7L 1YEHL 1KTRL 3PL6D 1MHPL 4WCYH 2FATH 3WFHA 1D5IL 4PY7A 2XN9A 4PJIF 3DROB 3W11C 3K8MA 2ADGB 1F3JB 1RMFL 3V0VA 1T89A 1RUAH 5CJOL 3MYZA 4RMQA 3BW9B 2W65B 3O9WD 4PG2A 4K7PY 1KCUL 1I7ZB 4PGBB 4C55A 4J8RB 2X2YA 3SDXE 3ZE1E 2ZUVA 3LMJH 4U6YB 3AC0A 3CDYA 3KXFE 1DN2A 4JAMB 4HPOL 2DQGL 3V5KB 3T0EA 1BVZA 4K94C 1KJ2L 1IQWL 4IRZL 3C8HA 3M1BB 5IW6B 5ISZE 4MB3A 5IF0B 1U8HB 3QR2A 3GMQB 3OGCA 4F7TB 4L4TD 5DD1L 2C3GA 4M1DH 1BZ7A 5D5MA 3UZVB 3F7YB 1I1AD 5F97E 4YFLI 2EYRA 5DLML 4NO0D 2CJUH 1Q0XH 1KCSH 2GTZB 4GQPH 4HHAB 5E5MA 5CEZD 3HB3C 3I6LD 2ORBL 3TNMA 1NKOA 5EU5B 3P3YA 4U7SA 3L3HA 4HJJL 1DVFA 5HJ3A 4GKSA 5F8RC 3LS5L 1A02N 2OTWB 5ERWA 3KPSD 2ZJSL 3IXTB 1OT1A 1MCIA 2VXQH 3WYRA 3U6RB 1U8NA 4Y1AA 4P4RB 4R7NA 4QRPE 5EOQH 2LV4A 4J3OC 4LCYB 4HWZB 2A6IA 2J8UE 4FQ2L 2QKIA 1D5MB 1RY7B 4LSTL 3TZVD 5HYIA 1R5WB 3MNWA 1SVZA 4O9HH 5EH1A 1YYLH 1K2DA 3NN8A 4I48B 4H1LA 5C1MB 4MD0B 1XF3A 5E1HB 1JWMB 4IRJD 3WSQL 1AO7A 1H5BB 4I0CC 2YD5A 1QVOA 2PCPA 3CUPA 4GLRH 3RVXC 4OLUL 1NDGB 3OAZH 3CDCA 4XPFH 3KPPB 4BQBA 1QG3A 1H15A 2NCMA 3OHXA 5TE6H 2QJDA 1QPXA 4OCXH 5F8QC 1TFHA 3N1MC 1BM3H 1XCQB 3ZDXE 1QRNB 4JFHD 1A6WL 3QSKB 1JWUA 1AXSA 1TNNA 3B2VH 3G5VB 3IDNA 1FH5L 3BO8A 3AAZB 1UWXK 3MPCA 4UU9B 1BLNB 4PJCE 1UXWB 1CDJA 3T08A 3HR5A 4MJIE 2OJZL 2EDNA 4NC1E 1N64L 5BVJA 4GUPB 2M8XA 1T22A 2W0FB 4DCQA 5DMGD 2ZG2A 2F15A 3E6FB 1EHLH 3UTSD 2R0LL 1BD2D 3KPNB 3VXTA 2ZOLB 2NLJB 5IEKA 4C4KO 2R2EB 2E7LA 2EEBA 4PS4L 3TEUA 1VERA 4EN3B 3QUML 1QFWI 4KY1H 3JV6B 3ZMRA 1HXMB 3CCHB 4ZDHB 4Z7QE 3DTXA 1EFQA 3MRQA 4M48H 4TYUA 4XPBL 2NXYC 2FD6H 4FTVA 4U0QB 2YZ1A 1T21A 3MLXL 4JQXA 2O61A 1LK2A 4G6AC 4FQLL 1HKLL 1VGKA 1WWWX 3BPOC 4JPWH 4P46B 3GBNH 2FEEI 1CDHA 2H9GA 2C1OB 1RD6A 4MQXD 3JBG7 4A6YA 4PG9A 1RVFL 3EOBB 2NY6C 4MDJA 2HFEB 3MV8A 3OKNA 2HJLB 4XNYL 2UUDH 3HMXA 3AREA 3BVNA 4NUJA 5FXCH 4YXHH 4OD1H 3C2AL 2RHEA 3LOWA 1FNGA 1MI5D 1G7LA 3M45A 4JFPB 5L2KE 3ELAT 4X6BB 1KFAH 3OJMB 4QXUL 1ZT1B 5EU6E 1BVKB 5BV7C 2W0LA 1IILE 5IVZB 2OTUA 2WBJC 4LCWE 5DFVC 2I9TB 5I1JH 2CRMA 1FPTH 4YHLH 2ENSA 2QEJA 3ULUL 1LDPH 1H3GA 3G5XB 4M5YL 1ZK9A 1GRWA 3MR9B 2XG4A 3GSRB 2J5LB 5I1KL 4P2RD 5CWSB 5IESH 1OAUH 4LDEB 4DTGL 4Y16D 2ZKHL 2HKHH 2DLIA 2NMSA 3IJYB 4FFVD 4AH2A 3WHXB 3QRGL 4PJFA 1CXHA 1VGEL 5T1MB 4GG8B 3S7GA 4NQDB 2JIXB 4KROC 3GMRA 2PO6D 2YD9A 3LRSB 3GHEL 1QA9A 2IPKA 3IF1A 2OK0L 4HJ0D 1ORSA 1AFVL 4WWKC 3PJSA 3DURB 4HKXA 5GJSH 1QOKA 1QSFE 2Y72A 4ALAL 1M7IB 4K9EC 5MP6H 3PP4H 3MNVB 3BH9B 2BCKA 1S7TB 3P9WB 5C0JA 5DZLA 2Z8SA 2V5YA 3QIUD 3MRMA 5ICXA 4XBEL 2J88H 5EBMA 2IANE 4LAJH 3UYRL 2HJFB 3OGOE 4XAWH 3ZKXC 2MOVA 4ZPTA 2ATPA 1JMXA 5D7LA 5ALCH 4R0LA 5KW9H 4NJAH 1UADC 3B5TA 4IRSD 1KUMA 3MV7D 2W1NA 4ZO7A 2GEEA 1J1XL 2DM7A 3GI9L 1G0DA 1D3CA 3LN5A 1WWBX 2HFFB 2GK0A 3E2HB 5BW7A 1YPZF 5FK9B 2QHRL 3DX6B 3L6FB 3E1F1 1S9VA 4XXDA 1NANI 3WNNA 5JORA 1FQ9C 2YSSA 3DYMA 3NA9L 4PBXA 1GC1L 3MRRB 3LKRA 3HMWL 4BK5A 1BJ1J 1TMCB 1PFCA 3JWDH 4TOYL 3E0GA 1MRDH 1KULA 3QB7C 1U2CA 3M8OL 4QY8B 3PWUA 4NQSB 5IB1B 3QQ4B 4OLXL 1X5IA 1QFPA 2JELL 4XNZB 1CICB 3C6LC 3BKML 5LQBH 1SM3H 2DM4A 2VQUA 1I4FB 4XHQA 2PW2B 3LIZH 4NBYB 4U1KB 4O2EA 3QCVL 4PJHB 4HBCH 3EYSL 2A9NH 3V6FB 3PNWA 3JVGA 4KH2A 3KPQB 3VXSB 3T1WA 1U6AH 4JJ5B 4LSSH 3ECBB 1NLDH 3BZDA 1NSNH 1CD1B 6FABL 1D6EB 1K8IA 4H8WC 2R0WL 1MIML 3C5ZA 4DN3H 2UVEA 4K7FB 4JO2L 4KAQH 4FFWD 1LHZA 4MZ3A 4XCEA 3VRJB 3P4OB 3MUGB 1YEDB 3BGMB 4H26A 2P5EE 3HE6D 3C9NB 4EI5C 3KWWB 3RUGE 1U41A 3B9DA 5DEGA 4Z7NE 1XMWA 1RZKH 3K2MC 2JB6A 5CGMA 2AEQL 3BP6A 2D03H 5HVWA 3D9AL 1WWCA 2MCG1 4YXKL 1P7QB 3QUYC 3NZHH 3D18A 4FFYL 2GUOB 3S3JA 2LU4A 4LPTA 4X6CB 2VLJD 1NC2B 3QFJE 5DJ0A 5E1AA 1IQDA 3GBLA 4NP4H 4P99A 4IIQA 3QHFL 3WLBA 2OJEB 4BFBD 5CS7A 3BKYH 5DQDH 2WINA 5IV2A 4M02A 1TJIH 3T3ME 2HT3D 1LEGB 3G08A 4LCUA 4X6DE 2VR4A 2BOCB 5HYJE 5E4EC 3OAYH 2G5BB 5LAXA 4FQCH 1JZ3A 4XBPA 4ZQKA 4OB5H 1B0WA 2EZ0C 3AS3A 1PEZA 1WBZA 3EO1A 1I7RA 2BJMH 3I75B 9CGTA 1BREA 3DXAB 1NUGA 5KJRH 4K2UH 4KZDH 3MRKB 4D9LL 1FO0L 3FN3A 2C3VB 5ESQA 1A5FH 4UT6H 2KPNA 3P30H 5EUOA 5I2IA 5L8KB 15C8L 1DLHA 3C60D 2YEZB 4YDVB 5E70A 4UV4L 2G2RB 3KYNA 3K46A 4I2XE 1MJ8L 5A2KH 1RIUH 3HRZA 1F4HA 4GS7B 1WAAF 4FA8A 1EGJA 4WENB 2P5WB 5E7BA 3W2DL 1FCCA 3FOMB 4YHNB 4KTYA 1FFRA 4NM4H 2GAZA 4U1IA 5IVOA 1OGAD 3DV4A 5KSAB 2ATKA 1KIPB 1GGTA 2QQNL 2ARWA 2F5BL 2YPLA 2DQEH 1CBVH 3NPZB 5DO2C 5TF1H 1U8IA 2OZ4H 1LK3H 5K9JL 1CIUA 5GGRY 4JZNB 5AWNH 2Z31D 3HZYB 1Y6KR 5C9KA 3PL6A 5C09D 5ILTH 3TBWB 1F00I 5SWSD 4ZG1A 5FIEA 3UTTE 1UM5H 2OP4L 4PJBF 2MPAH 3WFHB 4PY7B 1FVCA 4N8VB 4YH6A 5E4IA 4YHPA 4PREA 1G0XA 3OKYA 1X7QA 4LIQL 2BY3A 3V0VB 3O9WA 5JZ7D 3REWA 2V17H 1G7JA 2ID5A 4NQXA 5IFHH 4OCWL 5GGTA 3BXNA 5DHXB 4KXZI 4DVRL 3VXQB 1HNGA 5HTSA 1DANT 1UEYA 1ZGLM 4X6FA 4RMRA 1RFDL 3HI6H 3BZEA 4N0UE 4WFFE 2VZOA 4OSUL 5EZOH 4KKLC 3U7WL 4PV9A 1BQLL 3G6JF 2Y1VA 4LARL 1AGEA 4HLZH 5ID1A 1OAQH 3NTCH 1I1AA 3OGCB 3RL1A 5D2NA 5D5MB 4NO0A 1BZ7B 3SKJH 5HPMA 2EYRB 2NY3B 4QOKD 1DLFL 4N8VG 1T0NA 1KTKE 4D9RD 5E5MB 3P0YL 5T5FL 3V4UH 3TNMB 5FYKU 2Z35A 4D2NA 4Q97A 3HC3H 3L3HB 1DVFB 5HJ3B 5ERWB 1U95A 4BK4A 4ZPVA 2E9JA 1U8NB 5FYLH 4Y1AB 4DFIA 2KZWA 4R7NB 2ZOKA 2UVFA 3GK8L 4KI1A 4CN4A 1QSEA 3MRHA 1IC7L 2QKIB 2Y9RT 2VDMH 3TZVA 3MLRH 3OAZK 1U92A 1IVLA 3KLSA 1TJGL 2XFXA 4H1LH 5C0BD 3OZ9L 4PIRF 1W0WB 3MNWB 4Y8AA 4TUKH 1MAKA 3BDYL 3V4PL 1K2DB 3NN8B 4BKLA 4BSWA 4P46C 4IRJA 1OTUC 4H1LB 4KK6C 3L9RA 3FT2A 4Y4FC 1IAKA 5C0NC 1BVLA 2XT1B 3L3DA 4CMHB 4GG6B 1EO8L 5HHOB 1AO7B 4RMWA 4RCAA 1QVOB 2PCPB 3CUPB 4JM2D 2HT2D 5C3TA 5CJ8A 3QIWC 3VXRE 3IFNL 4XAKE 1YY9C 2X9XA 1HZHL 4KMTL 1WZ1H 1MRCL 1H15B 3OHXB 2EDRA 4V2BA 1SJEA 4K8RC 1Z3GL 4H88L 3S97C 1GXEA 3CLFL 2J2ZA 3DUSA 2Q8AL 5ICZA 4AM0A 1CIDA 3LV3A 4BUHA 1JWUB 1AXSB 1K6QH 1I3UA 3IDNB 3BO8B 4KQ3L 1T3FA 2J6EA 4JHWL 5KVGL 2R0ZL 1CYGA 3TYGH 5JMRA 3HR5B 5BVJB 5ID0A 1IGTA 1PKQA 4QRUA 1T22B 4NFCA 4YO0B 1P4LA 3UTSA 1BD2A 3GMPA 3PXHA 1FJ1B 4FQQA 3LN4A 3VXTB 1KPVA 1PG7H 2PNDA 5IT2H 5IEKB 5IW1A 1A7BA 2VH5L 3OX8A 5DD5H 2A2QT 5JW3L 2J5LC 1A14H 4XVSL 5C9JA 3DTXB 5TPWH 3MRQB 3GRWL 5HGDB 5D1XC 2JCCA 1J8HD 4FTVB 1KB5L 3BYYA 1T21B 4FQ1H 3WXWH 4OM0L 2O61B 1LK2B 1YECH 3RVTC 1UZ8A 3KHQA 1FIGH 2UUDK 1CXIA 4KDTC 1VGKB 4K94L 4A6YH 3PP3H 2NNAA 2E8ZA 3IDYB 1IGCH 4L1HA 1KN4L 2H9GB 2G9HA 1WFTA 3LS4H 3SGJC 3MBXH 3IETA 3KS0J 2R2CA 3OXRA 4A6YB 4PG9B 4HMEA 2B0SH 4TNVF 3W5MA 3HMXH 4RAUA 4MDJB 1J0JA 5DR5H 4PRAA 2ED8A 4IMKA 3VMOA 3OKNB 3MV8B 1CLOH 3BHBA 4UNVA 5C3LD 1DFBL 3AREB 1FN4A 3BVNB 4NUJB 5BRZD 1MI5A 2X4UA 1KF9B 2ITCA 1FNGB 4XPHH 1A3LL 1G7LB 4YNYA 2VXUL 1C5CL 1DTUA 1OAKL 3ZDYF 2R4RH 4NNPH 5I17A 4QHKJ 2OTUB 3CLEH 4RBPH 4RA3A 4RFNB 3DWTA 3BGFB 1CN4A 3DGGA 4O5LL 1LO2L 3LZFL 1IAIL 4FP8H 5ALBL 2WZPD 4D94A 2Z8WC 4P2RA 1FLRH 5LJYH 1VEOA 4B7LA 3L7FA 4Y16A 1E6OL 2CMRH 3MC0A 4WTZA 3JWDC 4QHUA 1MFCL 2CKBA 1CICC 4PRNA 4JRXE 4AH2B 2Z91A 4PJ8A 4XP4L 3IGAA 4PJFB 3V7AG 1OM3H 3QPQC 4ONOA 4Z76A 2PO6A 2DTML 1X3DA 3QUXD 2YD3A 3MUJA 4OGAD 2F58H 3WIFA 2X09A 3GMRB 1HEZA 5IVXF 4C83A 1JYWA 3UYOD 4C56D 4JO4H 4PGDA 1T80A 1QA9B 2IPKB 3IF1B 5DFTA 1ORSB 5C6TH 2YC1A 1LP9F 3V0AC 2OR7A 4HKXB 4PJIE 4Q9BA 2DQFA 4QRRE 1GAFH 3A6CL 1RUML 2FX8H 2X9YA 3HE7D 4HW6A 4Y5XA 3MBEB 3BZFB 2BCKB 1MIEL 3QIUA 2BNQA 2I60H 3RHWF 5C0JB 2HWZH 4YDIH 1CR9H 1IAMA 3MRMB 5ICXB 5EBMB 5GS0H 4S1SL 4Y5VB 2F54D 2P47B 1FZJA 4ZPTB 3QDJE 2P8MA 5D7LB 4IRSA 4R0LB 3MV7A 4LKXB 3FO0L 1SJXA 2OBGA 3HRPA 2EO9A 1RZKC 4W70A 4Y0GA 3WXVH 2DLEA 1ONQA 1UH2A 2CO7B 3LN5B 7CGTA 1ZMYA 4OBRA 2GK0B 4WHDA 3H42L 1CK0H 1YEIL 4LNRA 2VDRL 3O3BA 1S9VB 4G80A 4OF5A 5JORB 2YSSB 3QJFA 3LKRB 2F19H 3WFEL 1QLFA 2DQJL 5L7XH 3MLZL 4U05A 1A6UL 4Q2ZA 4M3JA 3PWUB 3MLTA 4H20H 2VSCA 1TVDA 3D5OF 4BA8A 3PQYB 4YDJA 3WFBH 3T65A 1S5IH 2H2PD 4HWUA 1JF6A 2AJVL 3SGKA 1HK6A 4JG0H 2NY1D 1KENL 3EOTH 3NCYP 5HHNA 2E6QA 1DN0B 4O2EB 5EA0H 3KXFD 4PJEF 3PNWB 4OZIF 5F9JA 4APQA 1OTSD 3IRPX 3T2NL 1MCKA 5ISZD 4RDQG 4UTAL 4IJ3B 1K8IB 3NACL 1BZ9A 5GHWH 4JDTH 2WM0A 4OCYH 3K2UL 3MV01 3C5ZB 4LQ1A 5A2LH 2KH2B 1KC5L 4XCEB 1QNZL 4MJ5A 3HE6A 1FGVL 1P2CA 4E9LA 5AYUH 4GS7C 4H26B 4NIKB 5KANG 1IT9H 1IC4L 4HXBL 5DEGB 5J13B 4TVPL 1JPFB 2JB6B 4GRWF 4S1DD 3F8UB 5E9DE 4OLZH 1JYNA 3BP6B 4YDKH 5KSAC 3IDMB 4I3GA 1HDMA 4WUUE 4TSBL 4JGUA 4QRPD 1RZFL 3HZVA 4D9QE 1NBZA 4MMZC 4MA7L 3O6FC 4D0CA 4KJPC 1A6VL 4OLWL 3BN3B 4PLJD 2VLJA 3OAYK 4ZFFA 4DVBA 4LVNB 5DJ0B 5E1AB 1IQDB 4FQIL 3U9PL 5ADOL 4IIQB 4HFUL 4ELMA 3MA9L 3FB8A 3WLBB 2H8PA 4HWNA 5J12C 1GGIH 4K9EL 5IV2B 3GFUA 2JJVA 3ARVA 1MJUH 4LCUB 1JF5A 4Z7VF 1CDGA 4OI8A 5LAXB 4KU1A 5HYFA 1OTTD 4XBPB 4ZQKB 4U1NA 3TPUA 3OV6A 1CLZH 3WJLA 1WBZB 4PG2C 3EO1B 1I7RB 1I1RA 4LRIA 3I6GA 2A73A 4W4NA 5LBSH 4JKWA 5IJVA 2Y25A 5FCUL 2HTLD 5ESQB 4KK8C 1IM9D 3BX7C 2E9IA 3C60A 5EUOB 5I2IB 2O5XL 1U3YA 2JJUA 4R4ND 5ACLA 1DLHB 4JHAH 1JGUL 4EIGB 5D70L 2YRZA 25C8H 5F7EL 1CF8L 3MXVH 2ADFH 4YPJA 1EGJH 3KYNB 4CGTA 5D7JC 4OF0A 4HDIA 3HRZB 4MJID 4I8DA 4IHOB 1T7WA 2NY3C 1IAOA 4M7LH 2IFFL 4ISVA 1JPST 1K4CA 2DLTA 4FZ8H 1OGAA 4HXAL 2VNCA 2F8VA 5ENWA 3H9HA 2GAZB 3CFEA 4PYHA 3DARA 3DV4B 3RAJH 2ATKB 1EZVX 2DBLL 4GKNA 4UTBH 4POYA 3OR6A 4PTUA 5IMMA 1UACH 2Z31A 4G8GE 2W9LA 4XI5D 3GUTA 1CS6A 1N0XL 1L7IH 4HAGA 2ZPKH 5C09A 4G5ZL 1ZHKA 5SWSA 3PL6B 5IQ9B 1QZ1A 4K3DH 3X12A 4JO3H 4MHHG 3IFLL 5D7SH 3S37L 5JR1L 2XZQL 4HCRA 3MOBH 1FVCB 5E99L 1JGVH 4PLKC 4KI5F 1FBIH 4KDWA 4PREB 5ACMA 2IAMC 1X7QB 4PJAB 3WE6A 3RNQB 1NAKH 3O9WB 3H8NA 5GGTH 1YMME 1GIGH 3REWB 1T66C 5E08H 1G7JB 4NQXB 5B8CC 1QBML 5FGCE 3TT3L 5C08E 2VXTL 3BXNB 3KLDA 4LHUG 4R90L 4X6FB 3WFDH 2JB5H 2X1WL 3FAXA 4OBSA 4F9PA 3BZEB 4HGWA 4PLNC 5L2KD 3L3JA 4PV9B 4X80L 4L4TB 1AGEB 5ID1B 5EU6D 1I1AB 4AZ8A 5CEZH 3S88L 3OKMA 3RL1B 1IKFL 5D2NB 1TZHA 4NO0B 3BPNB 4QOKA 4LCWD 4HUUA 2DMCA 1ZLWK 5HPMB 4F57H 1T0NB 1YEJH 4AMKH 4KJQD 3WDIA 1QP1A 4W81A 4WO4D 3VG0H 2AJXH 3KPSB 3ZTJG 4ENED 4WCYL 4DQOH 3TCLB 3D48R 2FATL 1U95B 3C2SA 4LSDA 2HTKD 4ZPVB 5FYKE 5KSBF 2VISA 3O2VH 4R26H 3MRHB 2OMBA 5F71A 1KJMA 3RJQB 1RUAL 3X14A 4U7MA 3TZVB 1U92B 5C0BA 1XGUA 1YPZE 2XFXB 1QHOA 1UH4A 2DQUH 4XVJH 4ZXBD 5D6DA 3LMJL 1J5OL 3AS1A 4BKLB 3B8SA 3P11H 4IRJB 3L9RB 1S9WA 3IDYC 5CSGA 5B4MD 3FT2B 4HK3J 1IAKB 4KKAC 1BVLB 3L3DB 4BM7A 2DB8A 4JRYD 4YGAB 3U2SA 5MI0C 1PDKA 5DJ2B 2FNBA 1X5XA 4KUCD 2OSLA 3OKLA 5GGVH 4M1DL 2GW5A 2VLRE 2KKQA 4OM1H 4CVWA 4PGEA 5L2JA 1H3XA 2CJUL 2EICA 1Q0XL 2IAND 1KCSL 1SJEB 5DGRA 2XZAH 3KPLA 2GYSA 1KXTB 2J4WH 5DVKA 3WHE1 3DUSB 4AM0B 1FYTE 3LV3B 2J6EH 2P49B 3SKUD 1F8TH 1MAJA 4PRDB 5CUSH 5J1AA 4OGXH 2VXQL 1T3FB 2L0DA 1QQDA 4PJGF 5EOQL 2K7QA 4XPAH 3RIAK 4NDMA 3QP3A 5FFLA 5D7IA 2YD1A 4KMQA 5ID0B 1IGTB 4QRUB 4NKMA 1P4LB 3UTSB 1BD2B 4RFNC 3MX0A 2AV1A 2YZ8A 3GMPB 4FQQB 5CIPA 3LN4B 4WV1C 4R6UA 1KPVB 1QD0A 4V1DE 1CDIA 4O9HL 1AJ7L 5IW1B 1ZWIA 3GEWB 4CADA 3OX8B 3SQOH 1YYLL 3CGTA 1OY3B 3L1OH 3SDAD 5ITFA 5GGRA 1J8HA 5C9JB 3N9GH 5FYJU 2GK2A 1J0KA 2JCCB 2H45A 4PBVC 4UOJA 2WIMA 4EEEA 1JTOA 5FM5O 1UZ8B 4WFEE 4XVTH 4NQED 4UINH 1PG7W 5TE6L 2DQDH 2NNAB 3S35H 4OCXL 2G9HB 1RIHH 1BM3L 3IETB 5HVHC 1X6NA 4K7PH 3OXRB 1KLGA 4RAUB 3B2VL 4U2YA 3QWOA 3MBEC 4PRAB 3Q0HA 2B4CL 2JJSA 1Z9MA 4ORZC 2P5ED 3BHBB 3TLRA 5CJXA 2J12B 4RBPK 8CGTA 3B83A 1FN4B 2ZCLH 5AEAA 2ZUXA 2I07A 5IBUB 1MI5B 2X4UB 2EE2A 2ITCB 4PJ7F 3CFCH 3N1FC 4Y5VC 3IJHA 4YNYB 5ICYA 2NXZC 3QXDA 2EH7H 3K4ZA 2XQBL 2EDDA 5HBBA 3TO4C 5I17B 4H0HB 1ZGLA 3S4SA 3QFJD 1RZJH 2XICA 2XNAA 4KRLB 4M48L 4XWGH 2C4FU 5BW7C 3B5GA 2FD6L 1WAAE 1TPXB 3VI3F 4DUWA 3DGGB 3GSUA 1TDQA 1NCBH 3QQ9D 4UILH 3ARWA 3RP1A 1N6QH 2LTQC 4P2RB 3QXUA 2CKBH 3LB6D 4JPWL 3GBNL 3L7FB 3KPOA 4Y16B 5HYJD 3NIGF 1F3RB 4XHJC 1P7KA 4QHUB 5LXGH 3ULVC 3C09B 4NKOA 1JGLH 3LKSB 4PRNB 3LQAH 3HPJA 3BEVA 5JDSA 2NX5E 1FSKB 2Z91B 4GAGH 3QUXA 3IGAB 4Z76B 2IEPA 2PO6B 3I2CL 3RWJA 4C56A 3BI9X 3C87A 1HEZB 2GY7B 4C83B 2C4FT 4L29A 4UOW0 4PGDB 2VLME 4PJBE 4WY7H 5DD6A 3EYUH 4YXHL 4OD1L 2OR9H 5HI3C 3WNPA 3RGVB 3QNYA 2XXCB 4TPRH 3SGEH 4IJ3C 3SE4A 1CD0A 4Y5XB 1KFAL 2IMNA 4HGKC 2HFGL 2Q20A 3QIUB 2BVQA 3RWFA 1CXFA 2KQMA 4JR9H 2I9LA 3QXAA 4JPVH 2F54A 5I1JL 4DK3A 4DW2H 1FPTL 2QR0A 1VFBA 3RWGA 3VXNA 5IBLD 5J13C 4YHLL 1ZKAA 1OPGL 2EE9A 1FZJB 1LDPL 2OLDA 3UAJD 5IEHA 2R23A 2P8MB 1JF1A 4IRSB 4JFEE 2IFGA 4Z7UF 2AJSH 2B2XL 3MV7B 5EWIH 1RURL 3G6JE 5C2UB 3KYOA 1ONQB 5C0CE 1E4JA 3N1GC 1N8ZB 3O41A 1OAUL 4PP2A 4XXCA 2CUHA 2HKHL 1I75A 4LNRB 3O3BB 3UTTD 4G80B 4YX2H 3PXJA 1DQQA 3QJFB 1IC1A 4LLWB 4IIQC 5C0EA 1MLCA 4Q2ZB 3WNKA 1ITCA 3MLTB 2ICWA 1PZUB 3DX9A 1G9MC 4YDJB 3H2WA 4MS8C 3T65B 3SDXA 3WUWA 4PB0L 2EDLA 5MP6L 3G04A 4FXGA 1U93A 1INDH 3PP4L 5L9DL 4OQ1A 3MRJA 3KXFA 4MNHA 5HGHA 5HHNB 1Q94A 4LSQH 3ZL4H 3VW3H 4TTDD 5DRZA 4KVNL 5F9JB 4WFFD 5DHYA 1S7QA 4JY4A 5ISZA 3JV5A 2YPKA 4XAWL 5SWZE 5JPNA 1BZ9B 1AE6H 1LO5A 1KLFA 5ALCL 3D3VE 4NJAL 1JVKA 3HNSL 4L1DA 4MJ5B 3HTLX 3BAEH 3HE6B 1P2CB 3QUMA 4EQ3A 5J0BA 1ADQA 5L8LB 3LY6A 2J3SA 2BOBA 3ZT6A 1ZTXH 4NO3A 4X7TA 1F4WH 1DQMH 4RWYH 3JWDL 4QRPA 3RX5A 1MRDL 5EC2A 1HDMB 4M7JH 2DRUA 4N5EC 4L9LC 2J8UA 3B9VA 3HZVB 2H6PA 1NBZB 2YS4A 4RAVA 4D0CB 2Y36H 1DJSA 3H9ZA 1AGCB 1OSPH 4J3UA 1U8QA 4ZFFB 4DVBB 5LQBL 4P5KA 1SM3L 4EVNA 4M7ZC 5FEBA 2IBZY 2VR5A 5DF0A 3X17A 4ELMB 3FB8B 4ZS6D 1J05A 3LIZL 2H8PB 1KTDA 1CDCA 4HBCL 2A9NL 1HSBA 5FM8A 3S6CA 4IM8A 1U6AL 2BNRE 1NLDL 2APVA 1NSNL 5F7MC 4Y89A 1P5VA 1EUUA 2DKSA 2HVJA 3MUZ1 3GNMH 5EZLA 3O9WC 3VXRD 4U1NB 4XAKD 4S1RH 5B22A 3TPUB 4DN3L 4OFIA 4KAQL 2X70A 3I6GB 2A73B 4ZOAA 5AZ2L 4AG4H 4HS6A 2ESVE 5E2TH 5MENE 5IJVB 1IM9A 2BSSA 2VQTA 3U79A 2P43B 2RIKA 4I9WE 1KEGH 1RZKL 3C60B 2XA3A 4PJXF 5DJ8A 5DTFA 4M6NH 1OWWA 4EBQH 1GOFA 3ILQD 5IK3A 4PJCA 3UZQA 4WI2A 1OL0A 5DJYB 4MJIA 1QBLH 3W9DA 1I1AC 4F33A 4HDIB 2AERT 4RWHA 3BPNC 2BVOA 1FYHB 1EDQA 3B3IA 4JCMA 4WIQA 1IAOB 4ISVB 1K4CB 2YK1H 1OGAB 3H6JA 5ENWB 4NP4L 5F6HI 3H9HB 5DA0B 5I8CA 3CFEB 1T5WA 4OKVA 4DGYH 1MCWM 4NRZA 2VAAA 4K3EH 3BKYL 5DQDL 4GKNB 5IMMB 3OR6B 4PTUB 1TJIL 2Z31B 3GUTB 1II4E 1BF2A 4L3EE 2Q3ZA 4NFBA 4MLSA 3ME0A 2E7CA 2XZCH 4N0CC 5C09B 3ZDYE 3EW3B 1ZHKB 4FQCL 5SWSB 2R2BA 4HD9A 3WLWD 4HCRH 4OB5L 5AZEH 3TZVC 4W6XB 2L4OA 3X12B 2BJML 4XT1C 3RVWD 3M07A 1JZ4A 1T2QH 2OXHA 5KJRL 3UBXG 3OF6D 4K2UL 4KZDL 4P3CH 1CXKA 3MACL 1A5FL 4UT6L 3OG6B 5DT1H 1HE7A 5D2LF 2CXKA 5HI4C 2GTWB 1RIUL 1PD6A 5EOTB 4DFHA 3SEPA 5L2KA 5IVXE 3O45A 4HGWB 2LU7A 4BZ1H 3L3JB 4NM4L 5GSRA 1LP9E 5EU6A 3RBSA 4JKKA 4LCWA 5B3JF 1YJDH 2DQEL 2A83A 2Y7QA 1CBVL 3AUVA 5TF1L 3OKMB 2ERJB 1T03H 1WUNT 2OZ4L 1LK3L 2FX7H 4QOKB 4C59B 3PWVA 4HG4K 4HUUB 4FZEL 2X6MA 1U8OA 4FG6D 5AWNL 5HHQA 1EHNA 4WO4A 4E41E 2ZUQB 5ILTL 3FT3A 2FB4H 1X5ZA 2QLVB 3U0WH 2MPAL 3QQNA 2R1XA 1BOYA 1KJ3H 3CXHK 5EB9A 2E6PA 1OAXH 2VISB 4JRXD 4ODXA 2ZP0T 2R1YB 1KJMB 3X14B 1LE5B 3RZCD 2D0HA 3TM6A 5C0BB 2V17L 4U6VH 1XGUB 4ZXBA 4TRPL 3QHZL 1KLUA 5IFHL 4WHCA 3LD8B 5F7DB 1QSFA 2QL1A 5T1KD 1FE8H 1I8LA 3VJ6A 4Z6AT 4FQXC 3RWEA 4MQXC 3HI6L 4QRRD 2RAMA 4JM2B 1R5IA 1MFDH 1SYVA 4POZD 1Z9OA 3PG2A 4QWWC 3U2SB 1NGZA 4I18C 3GMOA 1OAQL 2DMKA 4HUNB 3GI8H 3L3IA 3NTCL 4RQQA 3QEQE 3OKLB 3SKJL 4YEFA 3QJHA 1INQA 2IANA 4KTDH 4O02L 4PGEB 12E8L 5L2JB 5TH2A 2LQRA 5ETUA 1QFWM 4PJEE 4HH8A 3QDJD 3KPLB 4OZIE 1V3MA 2DQIH 4OCNC 3CVHA 1FFNA 4XH2A 4OV6F 2X4SA 5IROC 3HC3L 2D7TL 3J7HA 5J1AB 4D0DA 1T7ZA 5FYLL 2LAAA 1QQDB 3O2WH 3N0PB 3SDCA 5CIPH 1MRFH 5D7IB 5JIHA 3UTPE 3O4OB 4NKMB 5EOCL 2VDML 2AV1B 3MLRL 2HG5A 1CZ8H 5CIPB 4EI6B 4NGHL 4AIOA 1RZJC 5F89A 4X83A 4GRWE 3REVA 5F96L 5L88H 2X05A 3SDAA 4CADB 1R3KA 4LPXA 1UB5A 5I76A 4R4BB 2V2WA 5ITFB 1K3IA 5GGRB 1J8HB 1CGYA 4CVXA 3CAFA 3VXPA 4GT7A 3RBGA 4OIAA 1JNJA 4YUEH 3C09C 4YJZL 2K7PA 4ZUUA 3ABZA 1AQDA 3ZKSD 2WWMD 2PO6C 4LGSB 1VCAA 1WZ1L 5DD0H 5IWLC 3UJJL 1T7XA 5FYJE 3LQAC 1WCBA 2VLKE 4S0TD 4HJ0C 1U0QA 1BQHA 4DN4H 1T0PB 1XF2A 4IDJH 4ZTOL 1DL7H 4PGJA 2YUZA 1FL5B 1KLGB 3RGVC 3T4YA 3KJ4C 4G6MH 1G9NH 4Z7VE 1K6QL 1RZ8A 2VTFA 3QWOB 2P5EA 1MAMH 2GITA 3RUGA 1EERB 2NY4D 3R0MA 1GSMA 5BRZB 1F45A 3CH8A 3GJEA 3Q3GA 1MREH 4MD4A 4P2QE 2X5PA 4JKPH 1WIOA 3LH2H 3TYGL 2I07B 3WIIL 5I71B 2AI0H 5E9DD 4PJ5E 3IJHB 4WUUD 3QXDB 1DQDH 4D9QD 5JOPE 1PG7L 3BMWA 1FIEA 2CLZA 3V5HA 5HYQA 5DD5L 3QFJA 2PETA 5DK3A 3VWJC 3S4SB 4GBXD 2XNAB 2W59A 4PRHE 4FQ1L 4LSRH 2A0LD 4YDLC 5C0FA 1YECL 3DVFA 1FIGL 3P9LA 4X6DA 1ZHNA 3BRGC 5HYJA 2XKSA 1MCPH 4A6YL 4IS6A 3L7EA 1GHFH 2B5IB 4TNWK 3KPOB 4NPYA 1G6RA 1I8KA 1IGCL 3UX9B 3F7VA 3LS4L 5T1LD 3MBXL 1IQWH 1P7KB 4NKOB 4YXLH 3HPJB 3BEVB 5JDSB 5BVPL 2B0SL 4N1CA 3HMXL 3NA4A 4PTTA 2MJWA 2VZTA 5DR5L 3RWJB 4C56B 1VKXA 1CLOL 6CGTA 1EJOH 1C8PA 3ARGD 3JWOL 4G8IA 4L29B 4KK5C 5DD6B 3OJ2C 4G6FD 1V3KA 4I2XA 3QNYB 3HE7B 4KI5E 2PTVA 3JV0A 4XPHL 3BQUD 1F6LL 1RJLA 2ZJSH 1MCLA 2WK2A 1GGBH 3EJZD 4XP1H 2BVQB 4FNLH 2X1OA 2CRIA 3RWFB 2R4RL 4NNPL 4YFDB 3HE6C 3CLEL 1GH7A 3DO7A 5DWUH 3IT8D 2I9LB 3QXAB 2F54B 2ZZUT 3SJVE 1I85C 2QR0B 4R2GD 1VFBB 3RWGB 3VXNB 1UJ3A 4F7MA 5IEHB 2R23B 2IPTH 1BECA 1JF1B 5I1GH 4FP8L 4G8GD 1Q0YL 3TJHD 4LLAA 1FLRL 4U1SA 3MRLA 3KYOB 3B4NA 4PGCB 3O41B 2CMRL 3PHOA 4PP2B 3NCJH 3UTTA 4UIMA 1DQQB 1OM3L 3BOVA 4RMUA 5C0EB 2F58L 5T3XE 1MLCB 3IKCA 1MCHA 3DX9B 4OI7A 1IBGH 3MROA 3SDXB 3BMVA 2NY1B 1EJ6A 1N4XL 5KSBE 3G04B 1GAFL 4FXGB 2FX8L 1U93B 3CFBA 1RAMA 5C08D 3MRJB 3KXFB 4MNHB 3DIFA 5HGHB 1Q94B 2FH6A 4N0UA 5I73B 4LRIC 2LVEA 1JZ6A 2HWZL 1N64H 5DRZB 4YDIL 1G7IB 1CR9L 3WL9A 5DHYB 1S7QB 3ZKNC 4JY4B 5ISZB 2YA0A 1FLTX 5GS0L 5DJ6A 2R0LH 3D69A 2YPKB 3TBVB 1XIWA 5FUCC 2YD4A 4QT5A 5JPNB 3S34H 1WIPA 1I9EA 2M1KA 2AQ1A 3QUMH 1ADQH 3WXVL 3HCVA 1CGVA 3MOQA 4NNXA 4NC0B 3FMGH 3QUMB 4OUUA 4WDIA 1CK0L 2E27L 4GG6F 2UY6A 3HFMH 2BOBB 4OCRH 5CILH 1WF5A 4NO3B 5JUEL 2GIYA 2ICEA 4X7TB 4LFHG 2F19L 1BP3B 4QRPB 3K81A 5EC2B 3QDGE 4W4OA 5L7XL 5F7KC 4E42A 1LILA 2H6PB 2VZ3A 3GJFB 2OR8A 4RAVB 4H20L 3CIQA 3WFBL 1S5IL 1U8QB 2BERA 4P5KB 4EVNB 3C6SA 4KQ4H 1MHCA 4PJGE 4JG0L 3EOTL 1KSRA 5DVNA 1W72A 3NCEB 1J05B 3FL7A 1KTDB 5EA0L 3T77A 1LD9B 1P6FA 4P2CG 3RI5F 3C2AH 3FRUA 1WT5C 4GW1A 5KG9A 1KBGH 3VXRA 5JZ7C 1MLBA 2WW8A 2HVJB 4B50A 5EZLB 4HKJA 1BWWA 2EIZA 4OCYL 2FIRT 2VLRD 4OLEA 2X70B 4DOHE 4HS6B 1QSZA 3HZMA 2VDPH 1EEZA 1IM9B 2BSSB 2X4RA 4OIBA 5DD3H 3SGDI 5AYUL 4U1LA 1XH3A 4L8SB 4JVWA 1IT9L 4M5YH 5DJ8B 1QSVA 5DTFB 1G7MA 5IK3B 4OFKA 4OLZL 4PJCB 4YDKL 4WI4A 2HMIC 1WBYA 4MJIB 1UZ6F 3Q1SH 3DRQA 2VUOA 3W9DB 4F33B 2ERJC 3DO3A 1SEBA 2BVOB 1FC1A 2CK0H 3B3IB 5FKAA 1V7MH 1MCCA 2BXZA 4V1DD 1CLYH 4NUGH 1T5WB 3EFFA 4NRZB 2VO5A 4PJ7E 5IG7B 1GGIL 5GIRA