5AM7A

Fgfr1 mutant with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
307
structure length
294
Chain Sequence
AGVSEYELPEDPRWELPRDRLVLGKPLGEGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIMEYASKGNLREYLQARRPPGPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBROBLAST GROWTH FACTOR RECEPTOR 1
publication title The Effect of Mutations on Drug Sensitivity and Kinase Activity of Fibroblast Growth Factor Receptors: A Combined Experimental and Theoretical Study
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 294
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5am7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5am7A01
4CYJA 3WE4A 3UVRA 5LVLA 2GS2A 3R8MA 4GU6A 4X3FC 5B7VA 1KSWA 4DC2A 4PL4A 4BDBA 4GT4A 5AP6A 4YC3A 3Q5ZA 1KOBA 5DH3A 4LGHA 3QKMA 3ZC5A 1JPAA 4M15A 3TUDA 1FPUA 4PP9A 3ZTXA 3NZ0A 3QC4A 4G6LA 4UMPA 4P7EA 4IADA 1H1WA 2YM4A 3U51A 4QMTA 5CVGA 2CCHA 2YZAA 3L8VA 4H05A 3QUPA 5E4HA 4AN3A 3A99A 3MVJA 4ITIA 4BGHA 4S31A 3NMUF 4WRGA 4EOMA 4QMXA 4CGAA 4HPTE 4JBOA 2PK9A 2IJMA 4WNOA 4N57A 3VRZA 4Y5QA 2IW9A 2KULA 2Y4IC 1DM2A 1YW2A 3SXRA 3O8TA 4XG8A 4U81A 2W96B 3W2OA 4I22A 3IK3A 4DG2E 2BRBA 4O7RA 1XHAA 5DBXA 4PNIA 2X39A 2EXEA 3G9LX 1TQPA 3S1HA 2IZRA 1J7LA 2OLCA 1YXTA 2ZYBA 3KVXA 3W55A 1OMWA 3VQUA 4PPCA 4ZJIA 2VAGA 3D4QA 3FSFA 1MQBA 1XH7A 4OGRA 4ZZMA 4ARKA 3EKNA 2CLXA 4YO6A 5H9BA 4CV8A 3DBCA 4BDDA 4QP1A 4ALUA 4C4JA 4U0IA 3FHRA 2CGVA 2R3QA 4HZSA 4UWYA 4AE6A 4O81A 2ITUA 3F3TA 3PVBA 2YACA 4GK2A 2VWYA 1PXPA 3COMA 4A4OA 4IX3A 2GNGA 4FIFA 4D1ZA 1KOAA 4AUAA 2OJFE 4EYJA 4HJOA 3GQIA 4BDCA 3I0QA 3K2LA 1OKWA 4C58A 5BUJA 4O82A 3UYSA 3GGFA 2VX1A 3KULB 2XK4A 4FKJA 3OXIA 3FKOA 2Q0NA 4OAVB 4KIPA 3HV5A 3LFQA 4LOOA 4QO9A 1PMNA 3EQGA 4JG6A 5FBOA 5C01A 3V5WA 2BIYA 3R71A 3OEFX 3QCSA 4E7WA 2ZOQA 5H8EA 4O0VA 3HDMA 4NCTC 4ZP5A 3DXQA 3O23A 4KWPA 2B9IA 5FP6A 4O83A 4L52A 3ZSHA 4E4LA 2V7OA 3FI3A 4BI0A 2YLEA 3CY2A 3U9CA 4ERKA 3WF9A 4GFOA 3GP0A 4L43A 2PMIA 4YZNA 2RFEA 2QOCA 2UZWE 1GZOA 3MN3A 1ZY5A 3BLRA 3HA8A 3QQGA 4H36A 4JLCA 2W06A 4Y46A 4D1SA 3NAYA 5EYCA 3UIUA 3LCDA 3ULIA 4AACA 4O96A 3B2WA 2JDRA 3GB2A 4EZ7A 3A7FA 2PTKA 3Q96A 3AMYA 3ZO2A 4F1MA 1UNLA 3NUSA 3LFNA 2HW6A 4TL0A 1R3CA 4JL9A 3GU7A 4FI1A 2E2BA 3NYOA 3U9NA 3GU5A 3BWFA 4IM0A 4J53A 3DGKA 4U79A 4NSTA 1JKSA 4TWPA 4DFLA 2C6KA 2WPAA 3EN7A 1P2AA 1P4FA 3G2FA 3O50A 4MK0A 5EH0A 5TOZA 4AGCA 5F1ZA 4FUXA 5CI6A 4QTDA 4FTOA 4C62A 4CRLA 4N6YA 4N70A 1PXOA 2VO6A 2XJ2A 4IWOA 4IX5A 4E8AA 3OROA 4MF0A 3BPRA 2ERZE 1IAHA 4Q5HA 5M55A 3I7CA 5AR3A 2JKMA 4C34A 4DH7A 4Z7GA 2UW8A 3QQLA 3LJ2A 1UU7A 4O0UA 4B99A 5FM3A 2HAKA 2PMOX 3NW5A 3TV4A 4WBBB 5CEMA 2PYWA 3AD6A 2R3RA 1NT2A 4AWIA 5IEXA 4HVHA 2WMRA 3VS3A 4DEBA 3NCZA 3ZBXA 4DN5A 4C3FA 4DTAA 3ZFXA 4GFGA 5EOBA 3HMIA 3TV6A 5CANA 4H39A 2JDVA 2R0UA 4NM0A 2A27A 3G6HA 1ZZ2A 3IGOA 2QOOA 3UPXA 4A07A 4AU8A 2ETMA 4D2VA 2PUNA 4UMRA 3E8CA 4F7LA 3LCKA 4FBXA 4ACMA 2YM3A 3PXZA 4BN1A 3P23A 1YWVA 3VRYA 5IA3A 5A4LA 4L00A 5DR6A 2V7AA 3B8RA 2FSOX 4C59A 4K77A 1U5RA 3G0FA 1NVRA 2HZNA 3MJ2A 2VWBA 4UWBA 4ZY6A 4K11A 3RZFA 5GZ8A 3DCVA 5KHWA 3TZ9A 1WZYA 3I5ZA 3K5VA 2OIQA 3A7IA 2BMCA 1YQJA 2QOIA 2WTVA 5KBRA 4DFUA 3SXSA 3V5LA 3UPZA 5HG8A 3Q4TA 4TXCA 4CFWA 2XNMA 1R1WA 4IC8A 3TJCA 4ANMA 1ZLTA 2B4SB 4RVLA 3EIDA 4JIKA 4BCMA 3VUDA 3ZS5A 3A4OX 2Z60A 3P1AA 4FKPA 4UYNA 3KGAA 4L67A 3EQBA 4OAUC 4B7TA 3NW6A 3UJGA 4J8MA 4MF1A 4I1ZA 4EJ7A 3CPCA 4UZHA 5CYIA 5CF5A 3L8SA 1PKGA 3Q32A 4YZDA 4ZXTA 4TZRA 4X6QC 4DGMA 2WQOA 2Y9QA 4JI9A 3GU6A 1ZOEA 4FA2A 5KKRB 4ZTHA 3PXYA 4F99A 3FEGA 4QTCA 5EYKA 5EW3A 1MRYA 2J50A 3OMVA 4X3FB 5BMMA 2VD5A 2QKRA 2ZB0A 3THBA 4LGDA 3ANQA 4HVSA 3TNPC 3AT3A 4RBLA 2XMYA 3CQEA 5A4EA 3K5UA 4DEAA 3P7AA 4FSUA 4G3DA 3ZDIA 5C8NA 1LR4A 2JKKA 2RFSA 4QYGA 1Q8UA 2BDWA 5AMNA 3GBZA 3KXMA 4IX6A 4M12A 1PXLA 3CD3A 3TKIA 3WZDA 5AP5A 5CLPA 3BBWA 3R7OA 2C5YA 5FD2A 2C1BA 4G2FA 4YPSA 1UWJA 4BY9E 1ZYLA 4O22A 4QP8A 4UALA 2XIRA 4EUTA 4IIRA 1QCFA 3V04A 4PPAA 1RJBA 4IAFA 5ACBC 3R7YA 4D1XA 5KMIA 4DYMA 3AQVA 2GQRA 4GK4A 2F2CB 4H3BA 1VR2A 2A0CX 3TL8A 3VUGA 2W4OA 5ANJA 2NPQA 4FSTA 4F7NA 3EFLA 5IQCA 4PX6A 5E8TA 2HYYA 4D5KA 2XIXA 2NNWB 4I6FA 4Y95A 5G1XA 2QCSA 4FKIA 1G8SA 3F3VA 5DE2A 1SMHA 4UMQA 2X7GA 3VN9A 2BRNA 3DKFA 4ALVA 3L9MA 2BUJA 4M69B 1IRKA 2WAJA 2WMTA 3LHJA 5CNNA 1QPDA 3DKOA 4P2KA 4CT2A 1CSNA 2UZVA 3LVPA 2NRYA 2YCRA 3A4PA 3LFDA 4FV0A 4EONA 2OIDA 1ZMWA 1JKKA 1UWHA 4FTRA 3GFWA 5HNIX 2NP8A 5CT7A 4IQ6A 5HVYA 1WCCA 2XNNA 3ZEWA 4Y8DA 2OI4X 3KVWA 4YJTA 4R3PA 2RSVA 1FGIA 1H07A 5LWNA 4MVFA 4U7ZA 1OITA 3QWKA 3ORZA 5HHWA 5HO6A 4BCQA 4TWOA 1E1XA 3SC1A 4DTKA 1UU9A 3GFEA 3A8XA 5FEDA 5KO1A 2P4IA 5L8LA 3AC8A 3AT4A 4LFIA 4H58A 4YC6A 3KXHA 5BUEA 4FKLA 2JAMA 4OBQA 5K4JA 2PULA 3BLQA 2Z7RA 5DI1A 1URWA 4MBJA 4YJNA 4I41A 3V01A 2WTDA 3HMNA 4I5MA 5BYZA 3VUIA 2C3LA 1PXIA 3G90X 2WTCA 3ZM9A 1U5QA 4S34A 3BIZA 4X21A 4K0YA 4JRNA 2PVKA 1YXVA 1YDSE 3TACA 3PPJA 2J7TA 4FG8A 4HGTA 3WZKA 3Q9WA 2Z7SA 2HW7A 3P9JA 2JEDA 2WFYA 2ITXA 2ZM4A 3ORPA 4GKHA 2QOHA 4CQGA 2QR8A 3PE2A 2XEYA 3P5KA 4O0YA 3JPVA 3CY3A 3QCXA 3E5AA 2B53A 1BL7A 5ANDA 1OB3A 3SAYA 4NUSA 4EH7A 3KCKA 4ITJA 2E9UA 1Q97A 2WTIA 5AP1A 5AV2A 4R5YA 3IONA 3UE4A 1UNHA 3KF7A 3H0ZA 2QONA 2Z7QA 2Z02A 4FKOA 3DU8A 3BEAA 4U9AA 4N6ZA 3TDVA 3QZIA 3FI8A 5AUTA 4DFZE 3ALNA 5HLWA 3BGQA 5D9HA 4ZSLA 4UWCA 3RKBA 4FKVA 2WQEA 2GTMA 3RMFA 2BZHB 2I1MA 3BEGA 4C4GA 2C5VA 4EKKA 4D9TA 4DLJA 3R04A 2YN8A 3LIJA 4RQKA 3UP7A 1XH6A 3W8LA 4AOIA 4UBAA 1Z9XA 3FSKA 2JC6A 4QP9A 4FGBA 2A4LA 3JY0A 1FOTA 1ZOGA 4QPAA 4G9CA 1T46A 2BZJA 4HOKA 4R1YA 3SKCA 4OTQA 3UVQA 5I0BA 4E6AA 2C47A 3Q9XA 3II5A 3QD2B 2QLQA 3KXXA 4EOLA 5L3AA 3QGYA 2IPXA 2OF2A 1VYZA 1XBBA 4V05A 1SNUA 5IUIA 4IB0A 4F9AA 4HVDA 2GPHA 4MXZA 2BDJA 4DINA 5AP2A 4GL9A 5IQEA 4FZ7A 4QNAA 5H3QA 4FKSA 4QP6A 4K1BA 4F0GA 1G8AA 5BVWA 2VRXA 5HORA 4X0MA 4LOQA 2R3MA 3OHTA 3AOXA 1PMUA 2H9VA 4BWKA 3BYMA 5LARA 4RJ3A 4YSMA 4PTGA 4ASZA 3TJDA 2HOGA 5DT3A 4FC0A 5ETIA 4JOAA 4AOTA 4BDFA 3HDNA 4CFUA 3I7BA 1XJDA 4I24A 3SX9A 4YTCA 2PE1A 2YM5A 2PUIA 3P4KA 5H8BA 4JS8A 3RM7A 1OGUA 3GQLA 1S9IA 4WUAA 2XK7A 3VHEA 5IQGA 3DQXA 5HNGA 5HQ0A 1M2PA 2QI8A 3C9WA 1H0VA 4A4XA 2J9MA 4BTKA 5LWMA 1JAMA 4C37A 5L2IA 5M4IA 4DT8A 5HTIA 4IWDA 2B9FA 2HZ4A 4FZFB 3ROCA 4ACHA 2FSMX 3BCEA 2O3PA 4AQCA 2W1IA 4NZWB 5KMOA 3EQRA 4PTCA 3VS1A 2RL5A 4FKQA 5AR4A 4OTRA 3QA0A 3DBQA 5FG8A 5GZ9A 3KRWA 2BZKB 4BHNA 4C7TA 4FL3A 2GCDA 3SOCA 2PVNA 3DNEA 1STCE 1M7NA 1YDTE 3FLSA 4M69A 2R3LA 2RFDA 5HNBA 1SNXA 5LMKC 4E1ZA 3BBTB 4FEUA 2XA4A 5IA4A 5GNKA 3Q6WA 3NGAA 4QQ5A 3QHRA 2SRCA 2VTIA 3T3UA 4WRSA 5E90A 2XM8A 3VAPA 4CNHA 4EH2A 3REPA 2VN9A 3MW1A 3OWJA 3JXWA 4U42A 4AA4A 2OIBA 1Q3DA 2PZYA 5AAGA 4PPBA 3P7BA 4QMUA 5CU4A 3Q53A 4BCJA 4QP4A 2AC5A 4IM2A 4I3ZA 3DQWA 3E3BX 2VTJA 4DBXA 5B2KA 4J98A 2Y7JA 2IWIA 3DZQA 3IOPA 1Y6BA 2YCSA 3D15A 4RGJA 2WELA 3W16A 2X81A 3KN5A 3K3IA 3ULZA 4EZ5A 4C4IA 4XP3A 3O71A 3EQCA 4FG7A 4G6NA 4MNFA 4A9SA 4FICA 1JQHA 4BBFA 2PMLX 3NUNA 4RVTA 4BBMA 4ACCA 5IG1A 4YU2A 1PXJA 2WOUA 3LFEA 4FSNA 5HZNA 3JYAA 4FEQA 3DJ5A 3MV5A 4IJ9A 2AYPA 3AMBA 2PE2A 3R1YA 5JGBA 1UV5A 4J97A 2PZPA 2C6OA 3D7ZA 1E9HA 3WZUA 1WVYA 3KMWA 3EZVA 3BWJA 5DOSA 3HLLA 4FKGA 4AT5A 2W1GA 5CSWA 2QOFA 4HW7A 1W83A 2EXCX 3Q5IA 4JDJA 4KINA 5CSXA 3LFFA 3EN6A 3UVPA 3ZUUA 4YPDA 4CG9A 4IZ7A 4YSJA 4I6HA 5JGDA 4A9TA 2HIWA 4IMYA 4FYNA 3PXRA 2X6DA 2ONLA 3ODYX 4RX8A 5DT4A 4F9YA 4M66A 5HVJA 2X9FA 2XKDA 4EK4A 3ORIA 5DR2A 2G2FA 4NYEA 4RQVA 3T8OA 3C5UA 4BCFA 3RAWA 4QMVA 3EFWA 2W7XA 4IBMA 3C50A 1H1SA 2QR7A 1OM1A 3IO7A 3O7LD 4MKCA 4XEYA 4ZAUA 4W4XA 4WSYA 4FEVA 2W1FA 1BMKA 3MVHA 3OCGA 1W82A 3QQKA 4DEHA 5K5NA 2FH9A 3E8EA 2W9ZB 1AD5A 3ORNA 3UNKA 5GINE 4CFVA 4C0TA 2X8IA 4APPA 4OTFA 2VTTA 4IFGA 2X4FA 3ZXZA 3DK6A 3R22A 3KY2A 1OUKA 4U5JA 2CSNA 2O65A 4XH6A 2C3JA 3BKBA 3KRLA 3EMGA 3MFSA 5C1QB 4ACDA 3O8PA 2J51A 2B0QA 1MRVA 4CMOA 4E4XA 4MHAA 2DWBA 5D1JA 2GDOA 2HY0A 4FNWA 1FBNA 2G15A 1H24A 3DXNA 4S32A 3JUHA 4KBKA 4ANSA 3R7VA 3EN9A 5CEKA 4F0FA 2R3HA 4F4PA 3AC2A 5J5SA 1JSVA 3R01A 4RIWA 3ZM4A 5A54A 3KMMA 4GH2A 4EC9A 4JJRA 2BAQA 2YABA 4FNYA 2W4JA 3IW7A 3GUBA 2VTMA 4GG7A 2EUFB 3H10A 3NCGA 4NW5A 2P0CA 4DF3A 1P4OA 4UXQA 1WAKA 5LOHA 2PSQA 4OT5A 4NM3A 5F94A 3LMHA 4WT6A 2HWOA 3UG2A 3TUCA 1NVSA 4DCAA 3ZMMA 3KA0A 4O7VA 1XQZA 3LAUA 4TYGA 3F66A 2YM8A 1QPCA 4FIJA 3W8QA 3D7TB 5I9VA 5KE0A 5K5XA 1CMKE 5K0KA 2QOKA 2ITWA 3FL4A 3G0EA 4R3RA 2YDIA 3OOMA 2YWPA 2R3OA 3KRRA 4RC4A 3V8SA 5KHXA 4NFMA 2BHEA 4G9RA 3F69A 4C57A 3SLSA 3FY0A 4N0SA 5D7VA 4XG7A 4XS2A 4FTMA 4ANOA 3UG1A 2XBJA 4EWHA 4GKIA 3ZFMA 4QQTA 1K2PA 3F5GA 4F6UA 5JFSA 3FXXA 2YAAA 3R1SA 2ITPA 2PZ5A 3FI4A 2G2IA 3QTUA 4EK3A 5CF4A 3TKHA 3PA5A 1PXNA 4FVRA 5F95A 5KZIA 1GJOA 2OW3A 4FKUA 3KU2A 1GZKA 4DEEA 4DFYA 3TM0A 1ERKA 2CHLA 5E8XA 5IQHA 3SQQA 4AE9A 5L2TA 3DKCA 4FL1A 1A9UA 3KRXA 3A8WA 2H6DA 3LXNA 4G3CA 4XV1A 3VUKA 5L6WL 1Q8TA 3IPHA 4YGAA 2UZLA 3OCBA 4FNZA 3D5UA 4O0XA 4II5A 4YP8A 3BHVA 4HZRA 3ZSIA 2UZOA 4RJ8A 2VGOA 2YM6A 1OIRA 3VS7A 3FYKX 5A6NA 1Y57A 1JNKA 4F64A 3FV8A 3GCUA 1H1RA 4FKTA 4EUUA 1PYXA 2CNQA 4KB8A 3N51A 4J95A 3D5XA 3N4TA 4QP2A 3MB6A 2YZLA 2HXLA 2YCQA 5EQEA 4QP3A 4XOZA 3OOGA 3OS3A 4AFEA 4AGWA 4BGGA 4HNFA 2B55A 3CPBA 4WSQA 4XV3A 4BC6A 3DBDA 3E7VA 4HYHA 4R8QA 5CU3A 1Y8GA 5EQPA 4CCUA 1WFCA 2XCHA 2IG7A 4UX9A 3FMLA 3ORXA 5GHVA 3FY2A 1FINA 3PE1A 3E3PA 1HCKA 4AN9A 1YOJA 2V55A 4XG3A 3UOJA 3BU6A 4FIIA 3AD4A 1GAGA 2F7EE 3NLBA 2XNOA 4D28A 4PDYA 1DI9A 1GNGA 2AC3A 5BYLA 4QNYA 2J90A 4XP0A 5CY3A 4F63A 3LMIA 2WMSA 4FV3A 4FZAB 3A61A 2QU6A 4J1RA 3CC6A 1APME 4K9YA 4F1TA 3F3WA 1OL7A 1MRUA 2RGPA 5BX0A 3BU3A 4G6OA 4WG3A 1UKIA 4KNBA 3MH0A 4PL3A 4RLKA 4F1OA 5IH4A 5A14A 3I60A 3HA6A 4I94A 1U54B 3UZTA 3SG9A 2BFXA 4FTIA 4V0GA 4FIEA 3UIMA 3M2WA 4EC8A 3HMPA 3U8WA 4ZJJA 3MSSA 4CZYB 4CMUA 4G16A 4DG3E 3HRBA 1H8FA 2BTSA 2PZIA 3ZXTA 4FE2A 1KUTA 2C5NA 1CDKA 5CENA 3S3IA 2EVAA 4BYJA 3PZHA 5CX9A 3EFKA 4IM3A 5EM6A 3EQPA 3WE8A 2IVVA 4G1WA 4BFMA 2UW7A 3E87A 3NUYA 5CXHA 5EOLA 3R7IA 2QG7A 3R7EA 2ACXA 1E1VA 1H26A 1NXKA 1NY3A 4U45A 5D7AA 3VUHA 3GI3A 3S4QA 4DEIA 2CJMA 5HKMA 5DT0A 3RM6A 3ATTA 2C1AA 3LMGA 3W32A 4R77A 3FMEA 3R9NA 4Q9SA 3ITZA 2RKUA 5KMLA 4WIHA 2RG6A 4YJVA 1HCLA 5AJQA 3VS6A 3VS5A 3IDBA 4XOYA 4WUNA 3MS9A 2PVFA 5A3XA 5JT2A 3AG9A 4YO4A 2ITTA 2OU7A 2RF9A 1SVEA 4EHEA 3RGFA 1H27A 3QTRA 3H3CA 3FPQA 1PY5A 2GFCA 4CCBA 4GV1A 2Q0BA 3GCVA 5DGZA 5EYDA 5IDPA 5M06A 3CSVA 3MFUA 4TTHB 4ZLYA 4R7HA 3ELJA 1Q5KA 1OBGA 5J7HA 2JDOA 2OJJA 1BI7A 3P79A 3A2CA 3CEKA 2X2KA 4CTCA 2BKKA 3I6UA 3F9NA 4NIFA 5GIOE 3PSBA 3EYGA 2GHGA 5FM2A 4FTUA 3O8UA 4Y83A 1NA7A 5IF1A 2E9VA 2BPMA 1NW1A 4KAOA 3TTIA 4KSPA 4YLKA 3RK7A 4D4RA 2V0DA 3L9PA 4RJ5A 2GQSA 3CLYA 3JS2A 2GS6A 3QL8A 4HYIA 3TNWA 4ANLA 4AP7A 3ENHA 4G17A 2UVXA 3V6SA 4CKJA 4C33A 1U4DA 3HV6A 4LG4A 1YOLA 3QX4A 4GUEA 4F9BA 5ACKA 5I3OA 4RA4A 4RIXB 2RIOA 4LMNA 3UZRA 4E93A 1XO2B 2XNPA 3C1XA 3S00A 3RI1A 5JZJA 3PY0A 2VX0A 4L01A 1SM2A 2IW6A 5FXSA 2OFUA 4QRCA 2XKCA 2W1HA 2YJSA 4FIGA 2LAVA 5BVKA 4X2FA 4PQNA 4RVMA 2DUVA 1M14A 2JDTA 4KKHA 4FV5A 4CLIA 3QYZA 2HY81 2QOBA 4NTSA 3QXPA 3QGWA 4JG8A 5EDRA 3VO3A 5B2LA 1RQQA 2XYNA 1H1QA 3CD8A 3B2TA 5JGAA 1Y6AA 3E8DA 3WF7A 3HAVA 3ZRKA 3IQ7A 4IB3A 5HG7A 2VTLA 3HMMA 2J0JA 1JBPE 3IGGA 4KBAA 5HX8A 5KMNA 3G5DA 3PWDA 4FV7A 3CE3A 5ETAA 4O1OA 5BNJA 4Y72A 4EQMA 4NM5A 2VWVA 1XH9A 2FB8A 2X2LA 4ZJVA 4FT9A 2C3IB 2VZ6A 2BIKB 4H3PA 3VNTA 4UMUA 4CMTA 2GHMA 4L45A 2OSCA 4BHZA 2WTKC 2WQNA 4E6CA 4D2PA 4XLIA 2JDSA 2A2AA 3FZ1A 4HVGA 3PDTA 3L9NA 4YTHA 4RG0A 2FSLX 2BFYA 4MWIA 2VTNA 4G3EA 4A9YA 4QMNA 4YJUA 4GG5A 4TYJA 4XYFA 3UTOA 3PJ1A 2GNFA 3VF8A 4IAYA 1H25A 3OW3A 4DGNA 2W17A 4EQUA 5IQFA 3RTPA 2ZM3A 5AFVA 5CQUA 2J2IB 3BYOA 2VTPA 4OTIA 1ZXEA 5I9XA 3PLSA 3RK5A 3BU5A 4C4FA 1WVXA 4CFNA 5HTCA 2GQGA 5I4NA 5LCJA 3ORLA 2XCKA 4GVAA 3F5XA 5HE3A 3AC4A 5IMXA 4CYIA 1U54A 4JRVA 5JK3A 2ZM1A 2OJ9A 5JN2A 2J0IA 4MD8E 4A7CA 3A7HA 1XH5A 5EHLA 4DA5A 3FMJA 4HCVA 4EK6A 3KREA 4IH8A 1OBDA 3MPTA 3R2YA 4BR3A 1FVTA 3WF6A 4FSQA 4BDEA 2ZVAA 5HESA 5IEYA 3MI9A 4KRCA 5FP5A 4L8MA 1CKPA 2VO7A 5E9EA 3LM5A 4GCJA 2XUUA 3B8QA 4XMOA 2ZV8A 5T68A 3D83A 3LFSA 5EFQA 3ZC6A 4EH4A 4D9UA 4IEBA 4GS6A 4KUJA 2FYSA 3P08A 3RHXA 3D2KA 2JFLA 3FZRA 5T6KA 3RCJA 3QCYA 2ITOA 4RJ4A 3SD0A 3VS4A 2CKPA 4EH3A 5JH6A 3OP5A 2WQMA 3CCNA 3LW0A 4W9XA 5I9WA 1QPJA 2BVAA 4J8NA 3C0HA 2W4KA 3F2NA 1W8CA 2XM9A 4YTIA 4RX9A 3G33A 4AZWA 2ITYA 3GC8A 4I6BA 3K54A 2C6DA 5EI8A 4PMSA 2BALA 2C30A 2R64A 3FAAA 5H2UA 3DB6A 3E7OA 4RIYB 1YHVA 5KUPA 4AZTA 5ANEA 2JIUA 3CTJA 5BMSA 4GRBA 2UV2A 4OR5A 4JAJA 4EL9A 3RNIA 3BHTA 2OFVA 3KULA 3FXZA 4BCNA 4AF3A 3UOLA 2O64A 2VTHA 2ITNA 3ZLYA 4CRSA 3MDYA 4J99A 4YC8A 4LMUA 5EM8A 2BRMA 2WEIA 4MXCA 2J4ZA 3CGFA 4TWNA 4EJNA 3NW7A 3RZBA 5ETFA 3ZRLA 2YM7A 3QTIA 3CKXA 4AW0A 3ZZEA 4U3ZA 2Y4IB 3DZOA 4I5CA 4C02A 3VBWA 1G5SA 2B7AA 4YNEA 1RW8A 4L42A 3H9OA 2X7FA 2C0IA 4I4EA 1OL5A 1DAWA 4YJQA 4BKZA 4RIXA 4AS0A 5CEOA 3LM0A 3DB8A 1KE9A 4ITHA 4XG9A 4MXXA 4O6LA 5FXRA 5JFWA 3U6HA 1WBWA 4IHPA 1M17A 3OW4A 2YHVA 1W84A 4YNOA 3C5IA 2PVYA 3CP9A 4NWMA 5AP4A 3SXFA 4CG8A 4LRJA 4O0SA 3R7GA 4FV6A 3MVLA 2Y0AA 3UO6A 5M56A 2O63A 3HP2A 2BAJA 4FG9A 3GCSA 3L9LA 4DEDA 2R3JA 4ZZNA 3QLGA 2WMAA 4KIQA 1YRPA 3MJ1A 5EW9A 4QQJA 1GZ8A 3I81A 4C4HA 3M11A 2PMNX 4D0XA 4YTFA 1FMOE 3H9RA 5CU2A 1GIHA 1OKZA 1Q62A 5B2MA 3BRBA 1V0PA 4AZEA 2OGVA 3PPKA 2ZDTA 3HKOA 3TDWA 3RCDA 3NNXA 5TR6A 4RZWA 1BLXA 5EKOA 1CKJA 3Q60A 4BBEA 1FMKA 2X4ZA 3DXPA 4O7TA 4ERWA 1XBCA 1WBNA 4U3YA 4N4SA 3F61A 3RNYA 4F0IA 4HGEA 3D14A 2OG8A 5TE0A 3EOCA 4XV9A 1H08A 3FYJX 3ZLWA 5BYYA 3UQFA 5AA9A 4RA5A 3F2RA 4RC2A 3DPKA 5J7BA 4G34A 4FTJA 4PTEA 4OTPA 4RX7A 3A60A 5TO8A 4BDJA 4RFZA 4CFFA 4O7SA 3C4FA 4BDKA 2I40A 4FSMA 2FO0A 2XKEA 4BB4A 4EOKA 4TYEA 1V0BA 4I6QA 2E9PA 3BZ3A 2WTWA 5HCYA 2O0UA 1IEPA 3PUPA 4KS7A 4QYEA 1H28A 4LYNA 1QMZA 4KIKB 4F08A 5E8VA 1ZY4A 3HVCA 4AOJA 5FTGA 1OI9A 1XWSA 5IPJA 5AP3A 3UQCA 3PVUA 4NK9A 2WXVA 4JX7A 3UP2A 3GC0A 5HICA 4IVCA 2JLDA 2W1EA 2RFNA 5HBEA 2W1CA 5DMZA 1URCA 4B6LA 4W4YA 3NUPA 2JFMA 3E64A 2UZTA 2YEXA 3Q4UA 4MXOA 5AR2A 3H0YA 4BCOA 2ITQA 2O8YA 3VF9A 3O51A 4KKGA 3LFBA 4K6ZA 3RHKA 4D4VA 3UODA 2BROA 3FQHA 4RVKA 2X2MA 5FXQA 1IA8A 4C8BA 2BHHA 4GIIA 5FWKK 2UW4A 4XHKB 3ETAA 3RWPA 3WI6A 4PNKA 3F6XA 4NW6A 4OTDA 1B39A 1P14A 5AR8A 4A4LA 5AEPA 3SOAA 2RG5A 3WF5A 2VWUA 2XIKA 3RPSA 2VTAA 5IKWA 4K33A 3R00A 3PG3A 4B4LA 4EH9A 4FTCA 2UZDA 2XNBA 3KXNA 5AM7A 2CNVA 1F5QA 4LUEA 4E73A 4JQ7A 4C38A 2XIYA 4MD9E 3W10A 2KTYA 4EI4A 4Z55A 3VIDA 4ZTRA 3VWAA 3VUTA 4X2GA 3E92A 1MP8A 3TG1A 3UGCA 4Z7HA 4NL0A 4EH6A 2R9SA 2X7OA 2YIWA 4X3FA 4BTFA 5J79A 4ID7A 2X1NA 5EM7A 3EQDA 2VUWA 4RIYA 5E1EA 5FEEA 4EOQA 3AGLA 5BVEA 4MXAA 3LQ5A 3TXOA 3U54A 4V01A 3GCQA 3EZRA 3PPZA 3LQ8A 1G3NA 3G9NA 4FR4A 4QQCA 4S33A 2P3GX 4BICA 3MYGA 1H1PA 3CTQA 5G6VA 4AG8A 3AXWA 4O7WA 3OWPA 3Q9YA 3LXPA 4U97A 3RVGA 2R2PA 4OLIA 2UUEA 5AX9A 2W0JA 2B9HA 2YFXA 3U87A 4CSVA 3EN5A 2V62A 3RPRA 1KE6A 3BQCA 4Y5HA 3DNDA 4PDPA 3ZH8A 3DOGA 4IC7A 1L3RE 5DVRA 2OBJA 5TF9A 2J0KA 3MBLA 1KV2A 2ERKA 4I93A 2PVRA 4IWQA 1J1CA 4EKLA 4UZDA 1W7HA 2VNYA 5M53A 1O9UA 2P2IA 5KMJA 5GJFA 4RLLA 5ITAA 4ZEGA 2VV9A 3E93A 4CD0A 3QZGA 5AADA 5IA5A 3E88A 3QD3A 2C4GA 3M42A 3PTGA 3V5JA 3IECA 4IAKA 4AZSA 1TKIA 3LLAA 4FV8A 4YBKA 5D41A 2PVMA 4C4EA 3DFCB 4XBUA 2UVZA 3LQ3A 4YBJA 2QURA 3W18A 2CKEA 4GYGA 4S2ZA 4BL1A 3W33A 4USEA 2H8HA 4ZY5A 3L8XA 2Y4PA 3IDPA 4B0GA 3FLQA 4EK5A 2FSTX 4JR7A 5J9LA 4BCGA 3OY1A 5KZ0A 4RFYA 3UOKA 2X8DA 4AT4A 1OPLA 2IZUA 3TI1A 1ZARA 2CPKE 2OWBA 2R7BA 3PG1A 3DY7A 4USFA 5HO7A 2XK6A 2C68A 3UOHA 4FVQA 4O91A 5DWRA 4EBWA 4E5WA 3F7WA 3W1FA 1VYWA 4YJRA 4NCTA 2GNJA 2OXDA 4QMMA 2PVHA 2C5XA 2WD1A 2DS1A 2OZAB 2QD9A 1B38A 3LE6A 4LGGA 4BWPA 4XP2A 3Q2JA 4PF4A 4QYHA 5KNJA 4TNBA 4C36A 3OZ6A 2QQ7A 4B8LA 3VULA 2PUPA 2BKZA 3R6XA 3VBVA 2VO0A 5IA1A 3EB0A 3Q04A 3N9XA 3WARA 3MVMA 2OXXA 4EBVA 3RBWA 4CZUA 3GOKA 4R7BA 4W4WA 1BI8A 4JBQA 4KIKA 3UNZA 3G51A 3QC9A 4Y85A 4DH1A 4RSSA 1ZAOA 1JWHA 4FV2A 1B6CB 2EB2A 2XH5A 3KXGA 5J9ZA 4NFNA 4MBLA 4M0ZA 2QU5A 4X2JA 3LKMA 5HIEA 5IISA 5AWMA 4JR3A 5AIRA 2YIQA 3TNIA 3WBLA 4ZTMA 1NVQA 4RMZA 3QRKA 3KN6A 4E5BA 2P55A 5IH6A 3QRTA 3RPOA 3FQEA 4UN0C 1XH4A 2PZRA 3H4JA 4ZS4A 1RDQE 3WIKA 4QMQA 4FTAA 3OWLA 1JKLA 2HWPA 4L7SA 5T3QA 3MA6A 4QMYA 1OVEA 4QYFA 3BE2A 4JAIA 5AP0A 4H1MA 4PMTA 3HV3A 4O7LA 4Q9ZA 3GT8A 4W8DA 4WA9A 1R0EA 2REIA 1V1KA 4JBPA 3GU4A 3KL8A 5LMBA 2JKQA 4DGGA 2XS0A 4ZTNA 4BCKA 3D0EA 1PRYA 4RFMA 1GY3A 3PA4A 2C0TA 3FKNA 2QO7A 4CV9A 5JZNA 2EU9A 1SZMA 1U59A 1VEBA 3R9DA 5FGKA 3VBXA 1J91A 5CXZA 3WIGA 5IEVA 5DYJA 4F6SA 3F5UA 4I4FA 2XVDA 4J52A 4O1PA 4KD1A 1YWRA 4YZCA 4DFXE 4ZTQA 4ZMEA 2XKFA 4UYAA 3AMAA 2WZJA 3TV7A 4AA0A 3R7UA 2UW5A 3NWWA 3D9VA 4ZS0A 5IUGA 4FT0A 2VTRA 4ZMFA 5C27A 2Z8CA 3NNVA 4OT6A 2PVJA 4GU9A 2B54A 3RPYA 3EL7A 5ANGA 3R8LA 1S9JA 4JT3A 5JQ5A 1ATPE 2F2UA 4YZ9A 4D55A 1Y8YA 3U6IA 1PMEA 2F57A 4LQMA 1OZ1A 3VS2A 1YHSA 5E8WA 4EWQA 3D5VA 3FXWA 4GIHA 2XRWA 3AC1A 2ZMCA 2R3NA 3HUBA 3QZFA 4FOBA 4FYOA 2ZV9A 4K18A 5FDXA 2W1ZA 3UO4A 4D0WA 4E4NA 3VJNA 3VBQA 2W5HA 4AW5A 4X2KA 2WB8A 2ZB1A 1GOLA 5CTPA 2AUHA 3ROYA 4YURA 3LCSA 3PSDA 5M51A 5C8MA 3QQFA 3A7GA 5AV0A 5AIKA 3FMHA 3Q2MA 2EXMA 5IQIA 5BUIA 4DH3A 2YCFA 5BVNA 3QF9A 5ETCA 5GIPE 4XG4A 5CZHA 4L46A 4CFMA 5JFXA 4DG0E 5C26A 3UC4A 4F7JA 3TKUA 5ICPA 2YLFA 2B1PA 4F7SA 3GC9A 1I44A 3MY5A 3ZFYA 3D5WA 3FMKA 4PDOA 4FZDB 3QTWA 4ANBA 4BVUA 3OXTA 5HGIA 4WNKA 4XX9A 3Q52A 3CTHA 4RX5A 4E6DA 4QPSA 4FX3A 4WHZA 3ANRA 3H9FA 1UNGA 2XYUA 5M44A 5J8IA 2UZBA 4YZBA 4MD7E 4TKSA 5CVHA 5HIBA 3EHAA 4AW1A 4IZYA 4J96A 1PYEA 2P2HA 4Z16A 3KEXA 3NYNA 3KMUA 1REJA 2FUMA 2VO3A 2VWXA 3PIZA 3QAME 5D11A 5L6PA 5E8ZA 1OIYA 2BR1A 3UC3A 1WBSA 1UU8A 4MCVA 5L2QA 4K2RA 1LEZA 3BYUA 5EYMA 4YJSA 5AAFA 3IS5A 5D10A 3O96A 4G5PA 1W0XC 4L53A 3BHUA 3QHWA 1UA2A 3C4CA 4ANQA 4EOJA 2C6TA 3AGMA 3PXKA 3EL8A 4FL2A 1PF8A 3LFCA 4ZSAA 5HOAA 2C6IA 4AZFA 4QMOA 4GJ3A 4YLJA 2V5QA 3HYHA 4BTJA 3CQUA 5F4NA 3LXLA 4JDIA 4K8AA 5AAEA 2IO6A 4NT4A 5CQWA 3QRJA 1XBAA 4D2SA 5K9IA 5A9UA 4FV1A 3SVVA 3SHEA 2X0GA 1DI8A 3LPBA 4EH5A 2W1DA 3R02A 2P33A 3SW4A 2CNUA 5M09A 3AT2A 4IW0A 4HPUE 4YJOA 4ZIMA 4QOXA 5HBHA 4BGQA 4TN6A 4CXAA 3Q9ZA 3U4WA 3OBJA 4YMJA 5CSPA 3OVVA 2CGWA 3VBTA 4EOOA 4QPMA 4ZSJA 4O7ZA 2QC6A 2ESMA 3PXFA 5HX6A 3D2IA 5HTBA 3SRVB 4TYHB 1OPKA 3P78A 3NVMB 3KRJA 4P4CA 2YJRA 5FTQA 5LVPA 3JVRA 2R3IA 5KKRC 1RE8A 3L8PA 4IZ5A 5TKDA 2IW8A 4BIEA 5E1SA 2BILB 4ZOGA 2O2UA 5AUXA 4MQ1A 5IMEA 5LVOA 3FWQA 3R8PA 2VTQA 4AGUA 3I79A 3SGCA 2PE0A 3FC1X 3V5QA 2YIXA 4FK6A 4XLVA 4IAIA 4RIOA 2Y8OA 4LL5A 4QMWA 3C0GA 2I6LA 3E62A 3PFQA 3PJ8A 2ZV7A 3U6JA 4GUBA 3JY9A 3AC5A 4I5PA 3LOKA 1WBTA 4BRXA 4C2WA 3PJ2A 2LGCA 4LRKA 2YA9A 5AV1A 3DJ7A 4KBCA 4PRJA 4BYIA 5IA0A 2OK1A 1H01A 2QHNA 1CM8A 2QOQA 3ERKA 3UIXA 4A9UA 1ZYJA 1Q4LA 1R78A 4FODA 1OKVA 4ZTSA 5I9YA 5LJJA 1PJKA 3KF4A 4EEVA 1PW2A 3R63A 5FDPA 2FA2A 3FMNA 2HCKA 2F7XE 1H00A 1SYKA 2OJIA 3O0GA 2WEVA 5KMKA 2R0IA 4MQ2A 4L3LA 4EOIA 4IX4A 1YI3A 3DK3A 3QFVA 1FVRA 4M68A 5L8KA 1JKTA 1YXSA 2OH4A 3AC3A 4JQEA 1JLUE 3BHHA 3ID6C 3IW5A 3D7TA 3UMWA 4AFJA 3FLYA 5DRDA 4JG7A 5F20A 1FVVA 1YXUA 3TUBA 3C4WA 2VTSA 3HEGA 3C51A 4BI1A 4CEGA 5J87A 3NRMA 1KV1A 4ALWA 2C0OA 4I0TA 4E26A 3OTVA 3ZO4A 3F88A 3QQJA 1AQ1A 2XK3A 3R2BA 2W5BA 1BYGA 2GTNA 2H96A 3PIXA 4C3RA 3QZHA 4FSWA 4P90A 4KKEA 2PWLA 2JGZA 4YHTA 3R8VA 3FLWA 4KRDA 4IXPA 5AP7A 2WMBA 1M52A 1W98A 2WU7A 4I92A 1ZYCA 5DR9A 5DA3A 4EHGA 3QA8A 4Z3VA 3DAKA 4HGLA 5BQ0A 3GNIB 2VWWA 1KE7A 2XNGA 4FMQA 5I5ZA 4YR8A 5IQAA 4P5QA 4WNMA 2WO6A 5E8UA 2PPQA 3KB7A 3GCPA 4YJPA 5BVDA 5CAOA 1PHKA 3QALE 3WYYA 5A46A 4O2PA 3CS9A 4LRMA 1LPUA 2QKWB 3ORKA 3KXZA 3K3JA 2Z7LA 4BCPA 4MNEB 2I7QA 3MY1A 4FF8A 1Z5MA 1JOWB 1FQ1B 4BTMA 5IQDA 3OFMA 3FQSA 5DFPA 1R0PA 1TQMA 4IAAA 2X6EA 3MESA 2J0LA 3FMMA 4M8TA 4LI5A 3Q3BA 2PU8A 1J3HA 4EHZA 3NAXA 4ZTLA 4OW8A 3UYTA 4M13A 5D12A 4O86A 3RINA 4Y73A 4WBOA 4KSQA 4M0YA 3JVSA 3KFAA 3DDQA 3PZEA 4QYYA 3QTSA 2QHMA 2IZSA 3GEQA 4XNEA 3TNQB 1VZOA 3NEWA 4E3CA 5IU2A 4NTTA 3C0IA 4XV2A 3COIA 3NVKI 3FZPA 3F2AA 4LV8A 3ZDUA 3ZBFA 3PVGA 4H3QA 2DYLA 4FKWA 5I9UA 4XBRA 5L8JA 5CEQA 3ZEPA 4BKYA 2I0YA 1ZOHA 1ZZLA 4IB5A 2JITA 3O2MA 4ASDA 4FSZA 3G15A 2ONLC 4IACA 4DFBA 4TRLA 3KCFA 5M08A 5LMKA 4XG6A 4ORKA 5IDNA 3FZOA 5F9EA 2ZJWA 3C4XA 3NPCA 5GJGA 3T9TA 5FQDC 3DLZA 2VX3A 4I20A 2CN8A 2R4BA 3PSCA 3R0TA 3CXWA 4JIAA 4MYGA 4X3JA 3ODZX 1XR1A 3BQRA 4QTBA 3QX2A 2X8EA 4BDHA 2HZIA 3ZSGA 3N4UA 1JVPP 3MTLA 2GHLA 1JSTA 4NKSA 5EDQA 3NDMA 1OIUA 4O0RA 2J5FA 4EORA 5CEPA 3GC7A 1VJYA 2R5TA 4IWPA 4ZSGA 3SRVA 4TYHA 1BL6A 3FDNA 3FJQE 4DHFA 2A1AB 3D94A 4ACGA 5LXMA 5C4LA 4GYIA 1YOMA 4IB1A 3I5NA 4TT7A 5CEIA 3TIZA 5LVMA 2XB7A 3PA3A 1K3AA 5H8GA 3MPMA 4P5ZA 3Q4CA 2HXQA 3RAHA 3P86A 3HGKA 5FBNC 3ZCLA 5JEBA 4IJPA 3HX4A 3PJCA 1M2QA 3PWYA 3FUPA 4I0SA 3QQUA 3GOPA 1Q41A 4BIDA 4A06A 3MH1A 3ZU7A 5CAVA 5KMMA 4GEOA 4FGRA 3MY0A 5LCKA 3S2PA 1IA9A 4RWLA 4AZVA 4L9IA 4R6VA 5AR7A 2GNHA 3LJ0A 4OBPA 4RWJA 2PY3A 3W2QA 5CASA 5J1WA 1YI6A 1MQ4A 1T45A 1SVGA 5CSHA 5JFVA 5KBQA 1K9AA 4JDHA 4AW2A 5HCZA 2WOTA 4DFNA 4QMZA 4HCUA 2YDJA 4FT5A 3EQIA 2W99B 4QMPA 4D5HA 4BWXA 4O7YA 3IW8A 3OC1A 3WILA 4YHFA 4FTQA 3MIAA 2OICA 3MWUA 2IVSA 4DITA 4QTEA 3OBGA 3DBEA 3DS6A 3KK8A 5CS6A 2WIHA 2WTJA 1ZYDA 4WO5A 3ZHPC 4AT3A 4AN2A 3MFTA 3RJCA 4G3GA 1KWPA 4PWNA 2G2HA 4BF2A 4IANA 5HE2A 3V8TA 4MXYA 5IUHA 2J0MB 5M57A 3OT3A 5M4UA 3MH2A 3MA3A 2I0VA 3DTCA 3R8ZA 4USDA 4DCEA 5FRIA 2I0HA 3I0OA 3PY1A 4UB7A 3R1QA 4RJ6A 3E8NA 3VJOA 4EK8A 3W2RA 3R30A 3CQWA 4FT7A 4GK3A 3VUMA 5JRQA 4F9CA 1UU3A 3DKGA 2CGUA 2BDFA 3CGOA 3POZA 1M2RA 2PHKA 2BTRA 3IDCA 1OL1A 3NNWA 4GW8A 4KIOA 3NUXA 4OBOA 5EG3A 4BDIA 3VQHA 5A4TA 3ENMA 2G01A 3DV3A 3E63A 3W2PA 4PY1A 5DRBA 1OL6A 4BCHA 3R9RA 2W05A 3NUUA 3ORTA 4F6WA 4R78A 3RAIA 4BZOA 1LEWA 2OKRA 3DA6A 3L1SA 1Q3WA 4EYMA 3FKLA 3ALOA 3SG8A 1A48A 3BHYA 4WNPA 4OTHA 3MTFA 3N4VA 2GS7A 5FEQA 2Q83A 2VU3A 3DLSA 5E92A 5HI2A 3UMXA 3ZUVA 4MNEA 1YXXA 3IW6A 4KABA 4M97A 5BVFA 3HAMA 4IFCA 3WZJA 1X8BA 1I09A 5EK7A 2I0EA 3PRIA 2WHBA 4E4MA 4RPVA 5I3RA 3TZ8A 3UIBA 4D4YA 1TVOA 5DIAA 3F82A 3ZRMA 2UW3A 3DJ6A 4ASXA 2BAKA 4HVIA 1BKXA 2FVDA 4M14A 3QTXA 2C6LA 1V0OA 2YISA 5CALA 1SVHA 2C5OA 1PMVA 3EYHA 2J6MA 3PRFA 4L3PA 1GZNA 5HO8A 2PL0A 4ZSEA 4APCA 3O17A 4U43A 2WMXA 4ENXA 2CN5A 4G5JA 2ZDUA 2JBOA 5HCXA 2YAKA 3EWHA 2GNLA 2E9OA 5HBJA 2QVSE 1ND4A 4QTAA 5ANKA 4O84A 3NNUA 4NKAA 3CIKA 4XUFA 5AUUA 5JKGA 4J71A 4KA3A 3EQHA 3T9IA 5ANOA 4M84A 4O27B 5K0XA 4EHVA 1PXKA 3MB7A 1ZWSA 3WF8A 3GU8A 2WU6A 3BV2A 3IG7A 4MH7A 4Q5EA 4C61A 3DT1A 3GVUA 5L2SA 2DQ7X 4AX8A 4CLJA 3QQHA 3V8WA 3C4EA 4L44A 3DBFA 5JQ8A 5IA2A 2WNTA 4FK3A 5E7RA 2F7ZE 3QBNA 3QRIA 5C03A 3U4UA 5DPVA 5EI6A 3QKKA 3RPVA 2XP2A 4DTBA 3BYVA 4EZ3A 3CJGA 3TN8A 2CGXA 2WKMA 2OH0E 5DG5A 2HENA 3NSZA 4U6RA 1PXMA 3VBYA 4M3QA 5K3YA 3VHKA 2UZEA 1A06A 2YDKA 4TYIA 5B0XA 4NJDA 3NYXA 4RT7A 3VS0A 3OD6X 3I4BA 2UZNA 4W4VA 4NH1A 4UMTA 3QYWA 4FTLA 2UZUE 2JIVA 4CT1A 4JNWA 4MX9A 1PKDA 3QKLA 4FV9A 4UY9A 2WMWA 5C4KA 4ZZOA 5LQFA 1FGKA 4WG5A 4GFMA 4FNXA 2WTKB 5AUYA 5IH5A 2PVLA 5C8KA 4DT9A 3OT8A 4EH8A 2EWAA 4MWHA 4OUCA 5FUTA 3QWJA 5J95A 3MGYA 3LZBA 3A7JA 3P0MA 3FMDA 4MEDA 5AUVA 2EB3A 3TEIA 4QT1A 3WZEA 1YVJA 2GFSA 5HE1A 4B9DA 3OTUA 4TNDA 2R3KA 2FGIA 3QD4A 3LJ1A 3WOWA 4QP7A 4F9WA 5KX8A 3ZONA 3VW8A 4CKIA 4O0WA 5CAPA 4RC3A 3KC3A 1OL2A 2O5KA 5M4FA 3DAJA 3CR0A 2XBAA 3NIZA 4HGSA 4IE9A 4JQ8A 4RRVA 3DFAA 5EI2A 2QODA 1KE8A 5EW8A 3S95A 4F70A 1Q24A 5EM5A 4W8EA 2E9NA 4LM5A 3RP9A 4L68A 2BRHA 3OUNB 4QMLA 3SV0A 4ENYA 5AA8A 3ZO3A 4G3FA 3BYSA 5GZAA 2F4JA 1ZMUA 2XK8A 3SDJA 4AXAA 2W5AA 4FKRA 3V51A 3R8UA 5AUWA 3C7QA 2UW0A 2V22A 4MTAA 5DNRA 4YUQA 1J7UA 1CTPE 3UBDA 3QD0A 5CT0A 3PLAE 4E5AX 2IVTA 4BIBA 2HELA 2JBPA 1P5EA 3TZ7A 3PY3A 2C6EA 2GNIA 4NEUA 2JIIA 3OEZA 5HEZA 4R1VA 2WGJA 2QO9A 4RIWB 3TNHA 3ZOSA 1OKYA 4AA5A 3BGZA 2WMQA 1WMKA 2YERA 4IZAA 3PVWA 5A4QA 5L2WA 1LUFA 4FT3A 5CU0A 4FTTA 4NM7A 1O6KA 1YWNA 4D2WA 4E6QA 4GMYA 5J1VA 4IDTA 1BX6A 3MFRA 2UVYA 4DAWA 3VW6A 4J7BA 3VVHA 3H30A 3MH3A 5ANIA 3HRFA 3O7LB 4U44A 1O6LA 3DK7A 3QUDA 4F09A 4CTBA 4PMPA 5CAUA 2H34A 4CQEA 1Y91A 5IZFA 5AX3A 1IASA 5HD4A 1JSUA 1UVRA 3HUCA 3NYVA 4ASEA 4B8MA 4O7NA 2BZIB 4RJ7A 2XRUA 3PYYA 1YDRE 4L7FA 2IZTA 3R83A 2XZSA 2A19B 3MIYA 3TCPA 4C2VA 4C35A 2YWVA 2IVUA 5M07A 3V5PA 1DS5A 3QUEA 2GMXA 1KE5A 4HNIA 1REKA 2C3KA 4R3CA 5HE0A 5HLPA 1J1BA 2HK5A 5EDPA 4R5SA 4C3PA 4D58A 3NS9A 3OXZA 5E8SA 3QXOA 2ZV2A 4FOCA 4JX3A 4EOPA 5M4CA 4DGLC 3DDPA 5CWZA 5L6OA 2X9EA 5CZIA 4RZVA 4TWCA 3TZMA 5TT7A 4UV0A 3IOKA 3EJ1A 4HYUA 4FEXA 3TWJA 5HG9A 3FHIA 3RAKA 1Q8ZA 4HYSA 1U46A 1YHWA 3DTWA 4U41A 2GU8A 4G31A 3ZLXA 2VGPA 4L3JA 3FZSA 2ETRA 2OZOA 2R7IA 3A62A 4GJ2A 3UDBA 4LV5A 4S30A 2B52A 2XJ1A 2Y6OA 3EH9A 3TTJA 1L8TA 4Q2AA 5DEWA 2WMVA 3UQGA 4FSYA 3LCOA 5AM6A 4CVAA 4KS8A 4Z9LA 1ZYSA 4IAZA 1J7IA 1QPEA 4PDSA 3HZTA 2Z2WA 3W2SA 1HOWA 3QU0A 2VNWA 4EOSA 3MPAA 2YIYA 5E8YA 3VC4A 3S0OA 3QRUA 4DH8A 2CCIA 3G6GA 4CZTA 2G9XA 5AV3A 4CFXA 1OPJA 5DEYA 2QG5A 4PL5A 4NJ3A 4WD5A 5CSVA 2ZMDA 3F3UA 2R3GA 3ZLSA 2F49A 3QCQA 2W9FB 4U8ZA 3KQ7A 5EQYA 3GENA 3OY3A 3ZO1A 3EQFA 5BPYA 2R3PA 4FSRA 1WVWA 5E91A 3DAEA 4ZLZA 3OF0A 3R9HA 2CKOA 5HU3A 4UEUA 5JMSA 4AGDA 2VWZA 2YIRA 3NIEA 4OTGA 4FVPA 4X6RA 3V6RA 2OO8X 4TY1A 1Q8YA 2Y6MA 4LL0A 3JR1A 3FLNC 1ZMVA 3R9OA 3ZUTA 4D4SA 4YLLA 4FEWA 2GSFA 1BUHA 3QTZA 2OF4A 2VTOA 4L6QA 4M67A 4V0GB 5C9CA 3C4ZA 3FC2A 4FTNA 4IVAA 5A6OA 3U55A 3RK9A 4ZY4A 2XF0A 4CKRA 3BX5A 1ZRZA 4BCIA 3LCTA 3I1AA 4XRJA 5HU9A 3WYXA 3FPMA 5HD7A 5J9YA 3ORMA 4O21A 3FI2A 2C6MA 4H1JA 4DLIA 4ZK5A 4DE4A 3M1SA 4I23A 2BCJA 3BE9A 3BGPA 4WOVA 4ANNA 4BKJA 5L4QA 4YZMA 3COHA 4BI2A 4BDAA 3ET7A 3EKKA 5DHJA 5AUZA 4MAOA 5GJDA 3F5PA 4O2ZA 5HVKA 4PMMA 1AGWA 2BRGA 2ETKA 2OJGA 1WBVA 4GSBA 4IVBA 2WMUA 4BZNA 4OTWA 5CAQA 1F0QA 2YITA 4DEGA 5JSMA 3GXLA 4NU1A 4XG2A 5AV4A 3PP0A 4E20A 1OECA 1EH4A 4QD6A 2JAVA 3QLFA 4TW9A 2OXYA 3IW4A 1QL6A 1WBPA 3HV4A 2XIZA 3HV7A 3RALA 2QO2A 3COKA 3PP1A 4YHJA 2QOLA 4BDGA 3QTQA 5FTOA 2PUUA 3V3VA 5EKNA 1M7QA 1XH8A 3HL7A 3HECA 2HZ0A 4X7QA 4XJ0A 5HLNA 3R1NA 2IN6A 4A9RA 4ONAA 4FIHA 1Z57A 4FZ6A 2CLQA 5EHOA 4DGOA 5A4CA 3R73A 4D2RA 5CU6A 1MUOA 5CI7A 3BV3A 4FTKA 2ITVA 3FLZA 3KK9A 5K4IA 3EFJA 3LLTA 4JVGA 3W2CA 3V5TA 1H4LA 4NIFB 4W9WA 4ZLOA 5CF8A 4PV0A 3HNGA 3HP5A 2C69A 4UXLA 3Q6UA 4I5HA 3HMOA 2UW6A 3Q4ZA 3PIYA 4RWKA 4TPTA 4XCUA 1XKKA 3FBVA 3BLHA 3IKAA 5BVOA 3LFAA 3CBLA 2NO3A 4JBVA 4EQCA 5DN3A 3OWKA 3OG7A 3ACKA 4MBIA 1F3MC 1IAJA 5JRSA 1YI4A 4BZDA 5DLSA 2F9GA 2UW9A 3R28A 3NR9A 1LP4A 4QMSA 4RWIA 3P7CA 4FUYA 3F7ZA 4U40A 2ITZA 1DAYA 3UO5A 4HCTA 5FLFA 5EHYA 2QNJA 2XK9A 2OZAA 1Q8WA 5J5TA 1Q99A 3ZYAA 4JXFA 1GIJA 2JKOA 3FZTA 4I21A 4O0TA 4F65A 3UNJA 3ZZWA 5I9ZA 2XJ0A 2WIPA 4U80A 2VWIA 2XNEA 3PJ3A 4WKQA 3TT0A 3PXQA 1TQIA 1OIQA 4FV4A 2JD5A 4R7IA 3OCSA 4DBNA 1IR3A 1Q61A 2XEZA 3OCTA 3RWQA 3KKVA 3R21A 1H0WA 2R3FA 4DH5A 1GIIA 3ACJA 3T3VA 4I0RA 1OUYA 3F3ZA 5CNOA 3SA0A 4XRLA 2CKQA 3HRCA 2NRUA 2CMWA 4O38A 2CDZA 4M7IA 3ATSA 3OUKA 4GVJA 3POOA 3BELA 4WG4A 4GT5A 1R39A 2WQBA 1YKRA 3CJFA 1CKIA 3NX8A 4GT3A 3FE3A 4AAAA 5IQBA 5HG5A 5AR5A 2B9JA 3CKWA 4PUZA 3SW7A 5LMAA 5KCVA 1O6YA 3I6WA 4D2TA 1IG1A 2G1TA 5LVNA 3NUAA 4LUDA 3BI6A 4O6EA 3EN4A 4IVDA 1UKHA 1WBOA 3FL5A 4V04A 5CF6A 2ZAZA 4X2NA 4PP7A 3C13A 3AD5A 4IDVA 3UZPA 5CVFA 4JDKA 3LXKA 2J5EA 4LOPA 2QLUA 5HIDA 3TIYA
chains in the Genus database with same CATH superfamily
4CYJA 3WE4A 3UVRA 5LVLA 2GS2A 3R8MA 4GU6A 4X3FC 5B7VA 1KSWA 4DC2A 4PL4A 4BDBA 4GT4A 5AP6A 4YC3A 3Q5ZA 1KOBA 5DH3A 4LGHA 3QKMA 3ZC5A 1JPAA 4M15A 3TUDA 1FPUA 4PP9A 3ZTXA 3NZ0A 3QC4A 4G6LA 4UMPA 4P7EA 4IADA 1H1WA 2YM4A 3U51A 4QMTA 5CVGA 2CCHA 2YZAA 3L8VA 4H05A 3QUPA 5E4HA 4AN3A 3A99A 3MVJA 4ITIA 4BGHA 4S31A 3NMUF 4WRGA 4EOMA 4QMXA 4CGAA 4HPTE 4JBOA 2PK9A 2IJMA 4WNOA 4N57A 3VRZA 4Y5QA 2IW9A 2KULA 2Y4IC 1DM2A 1YW2A 3SXRA 3O8TA 4XG8A 4U81A 2W96B 3W2OA 4I22A 3IK3A 4DG2E 2BRBA 4O7RA 1XHAA 5DBXA 4PNIA 2X39A 2EXEA 3G9LX 1TQPA 3S1HA 2IZRA 1J7LA 2OLCA 1YXTA 2ZYBA 3KVXA 3W55A 1OMWA 3VQUA 4PPCA 4ZJIA 2VAGA 3D4QA 3FSFA 4F78A 1MQBA 1XH7A 4OGRA 4ZZMA 4ARKA 3EKNA 2CLXA 4YO6A 5H9BA 4CV8A 3DBCA 4BDDA 4QP1A 4ALUA 4C4JA 4U0IA 3FHRA 2CGVA 2R3QA 4HZSA 4UWYA 4AE6A 4O81A 1W2FA 2ITUA 3F3TA 3PVBA 2YACA 4GK2A 2VWYA 1PXPA 3COMA 4A4OA 4IX3A 2GNGA 4FIFA 4D1ZA 1KOAA 4AUAA 2OJFE 4EYJA 4HJOA 3GQIA 4BDCA 3I0QA 3K2LA 1OKWA 4C58A 5BUJA 4O82A 3UYSA 3GGFA 2VX1A 3KULB 2XK4A 4FKJA 3OXIA 3FKOA 2Q0NA 4OAVB 4KIPA 3HV5A 3LFQA 4LOOA 4QO9A 1PMNA 3EQGA 4JG6A 5FBOA 5C01A 3V5WA 2BIYA 3R71A 3UDTA 3OEFX 3QCSA 4E7WA 2ZOQA 5H8EA 4O0VA 3HDMA 4NCTC 4ZP5A 3DXQA 3O23A 4KWPA 2B9IA 5FP6A 4O83A 4L52A 3ZSHA 4E4LA 2V7OA 3FI3A 4BI0A 2YLEA 2IEWA 3CY2A 3U9CA 4ERKA 3WF9A 4GFOA 3GP0A 4L43A 2PMIA 4YZNA 2RFEA 2QOCA 2UZWE 1GZOA 3MN3A 1ZY5A 3BLRA 3HA8A 3QQGA 4H36A 4JLCA 2W06A 4Y46A 4D1SA 3NAYA 5EYCA 3UIUA 3LCDA 3ULIA 4AACA 4O96A 3B2WA 2JDRA 3GB2A 4EZ7A 3A7FA 2PTKA 3Q96A 3AMYA 3ZO2A 4F1MA 1UNLA 3NUSA 3LFNA 2HW6A 4TL0A 1R3CA 4JL9A 3GU7A 4FI1A 2E2BA 3NYOA 3U9NA 3GU5A 3BWFA 4IM0A 4J53A 3DGKA 4U79A 4NSTA 1JKSA 4TWPA 4DFLA 2C6KA 2WPAA 3EN7A 1P2AA 1P4FA 3G2FA 3O50A 4MK0A 5EH0A 5TOZA 4AGCA 5F1ZA 4FUXA 5CI6A 4QTDA 4FTOA 4C62A 4CRLA 4N6YA 4N70A 1PXOA 2VO6A 2XJ2A 4IWOA 4IX5A 4E8AA 4AQKA 3OROA 4MF0A 3BPRA 2ERZE 1IAHA 4Q5HA 5M55A 3I7CA 5AR3A 2JKMA 4C34A 4DH7A 4Z7GA 2UW8A 3QQLA 3LJ2A 1UU7A 4O0UA 4B99A 5FM3A 2HAKA 2A98A 2PMOX 3NW5A 3TV4A 4WBBB 5CEMA 2PYWA 3AD6A 2R3RA 1NT2A 4AWIA 5IEXA 4HVHA 2WMRA 3VS3A 4DEBA 3NCZA 3ZBXA 4DN5A 4C3FA 4DTAA 3ZFXA 4GFGA 5EOBA 3HMIA 3TV6A 5CANA 4H39A 2JDVA 2R0UA 4NM0A 2A27A 3G6HA 1ZZ2A 3IGOA 2QOOA 3UPXA 4A07A 4AU8A 2ETMA 3W0MA 4D2VA 2PUNA 4UMRA 3E8CA 4F7LA 3LCKA 4FBXA 4ACMA 2YM3A 3PXZA 4BN1A 3P23A 1YWVA 3VRYA 5IA3A 5A4LA 4L00A 5DR6A 2V7AA 3B8RA 2FSOX 4C59A 4K77A 1U5RA 3G0FA 1NVRA 2HZNA 3MJ2A 2VWBA 4UWBA 4ZY6A 4K11A 3RZFA 5GZ8A 3DCVA 5KHWA 3TZ9A 1WZYA 3I5ZA 3K5VA 2OIQA 3A7IA 2BMCA 1YQJA 2QOIA 2WTVA 5KBRA 4DFUA 3SXSA 3V5LA 3UPZA 5HG8A 3Q4TA 4TXCA 4CFWA 2XNMA 1R1WA 4IC8A 3TJCA 4ANMA 1ZLTA 2B4SB 4RVLA 3EIDA 4JIKA 4BCMA 3VUDA 3ZS5A 3A4OX 2Z60A 3P1AA 4FKPA 4UYNA 3KGAA 4L67A 3EQBA 4OAUC 4B7TA 3NW6A 3UJGA 4J8MA 4MF1A 4I1ZA 4EJ7A 3CPCA 4UZHA 5CYIA 5CF5A 3O5AA 3L8SA 1PKGA 3Q32A 4YZDA 4ZXTA 4TZRA 4X6QC 4DGMA 2WQOA 3AKLA 2Y9QA 4JMQA 4JI9A 3GU6A 1ZOEA 4FA2A 5KKRB 4ZTHA 3PXYA 4F99A 3FEGA 4QTCA 5EYKA 4QDVA 5EW3A 1MRYA 2J50A 3OMVA 4X3FB 5BMMA 2VD5A 2QKRA 2ZB0A 3THBA 4LGDA 3ANQA 4HVSA 3TNPC 3AT3A 4RBLA 2XMYA 3CQEA 5A4EA 3K5UA 4DEAA 3P7AA 4FSUA 4G3DA 3ZDIA 5C8NA 1LR4A 2JKKA 2RFSA 4QYGA 1Q8UA 2BDWA 5AMNA 3GBZA 3KXMA 4IX6A 4M12A 1PXLA 3CD3A 3TKIA 3WZDA 4O4EA 5AP5A 5CLPA 3BBWA 3R7OA 2C5YA 5FD2A 2C1BA 4G2FA 4YPSA 1UWJA 4BY9E 1ZYLA 4O22A 4QP8A 4UALA 2XIRA 4EUTA 4IIRA 1QCFA 3V04A 4PPAA 1RJBA 4IAFA 5ACBC 3R7YA 4D1XA 5KMIA 4DYMA 3AQVA 2GQRA 4GK4A 2F2CB 4H3BA 1VR2A 2A0CX 3TL8A 3VUGA 2W4OA 5ANJA 2NPQA 4FSTA 4F7NA 3EFLA 5IQCA 4PX6A 5E8TA 2HYYA 4D5KA 2XIXA 2NNWB 4I6FA 4Y95A 5G1XA 2QCSA 4FKIA 1G8SA 3F3VA 5DE2A 1SMHA 4UMQA 4I6LA 2X7GA 3VN9A 2BRNA 3DKFA 4ALVA 3L9MA 2BUJA 4M69B 3TMOA 1IRKA 2WAJA 2WMTA 3LHJA 5CNNA 1QPDA 3DKOA 4P2KA 4CT2A 1CSNA 2UZVA 3LVPA 2NRYA 2YCRA 3A4PA 3LFDA 4FV0A 4EONA 2OIDA 1ZMWA 1JKKA 1UWHA 4FTRA 3GFWA 5HNIX 2NP8A 5CT7A 4IQ6A 5HVYA 1WCCA 2XNNA 3ZEWA 4Y8DA 2OI4X 3KVWA 4YJTA 4R3PA 2RSVA 1FGIA 1H07A 5LWNA 4MVFA 4U7ZA 1OITA 3QWKA 3ORZA 5HHWA 5HO6A 4BCQA 4TWOA 1E1XA 3SC1A 4DTKA 1UU9A 3GFEA 3A8XA 5FEDA 5KO1A 2P4IA 5L8LA 3AC8A 3AT4A 4LFIA 4H58A 4YC6A 3KXHA 5BUEA 4FKLA 2JAMA 4OBQA 5K4JA 2PULA 3BLQA 2Z7RA 5DI1A 1URWA 4MBJA 4YJNA 4I41A 3V01A 2WTDA 3HMNA 4I5MA 5BYZA 3VUIA 2C3LA 1PXIA 3G90X 2WTCA 3ZM9A 1U5QA 4S34A 3BIZA 4X21A 4K0YA 4JRNA 2PVKA 1YXVA 1YDSE 3TACA 3PPJA 2J7TA 4FG8A 4HGTA 3WZKA 3Q9WA 2Z7SA 2HW7A 3P9JA 2JEDA 2WFYA 2ITXA 2ZM4A 3ORPA 4GKHA 2QOHA 4CQGA 2QR8A 3PE2A 2XEYA 3P5KA 4O0YA 3JPVA 3CY3A 3QCXA 3E5AA 2B53A 1BL7A 5ANDA 1OB3A 3SAYA 4NUSA 4EH7A 3KCKA 4ITJA 2E9UA 1Q97A 2WTIA 5AP1A 5AV2A 4R5YA 3IONA 3UE4A 1UNHA 3KF7A 3H0ZA 2QONA 2Z7QA 2Z02A 4FKOA 3DU8A 3BEAA 4U9AA 4N6ZA 3TDVA 3QZIA 3FI8A 5AUTA 4DFZE 3ALNA 5HLWA 3BGQA 5D9HA 4ZSLA 4UWCA 3RKBA 4FKVA 2WQEA 2GTMA 3RMFA 2BZHB 2I1MA 3BEGA 4C4GA 2C5VA 4EKKA 4D9TA 4DLJA 3R04A 2YN8A 3LIJA 4RQKA 3UP7A 1XH6A 3W8LA 4AOIA 4UBAA 1Z9XA 1ST4A 3FSKA 2JC6A 4QP9A 4FGBA 2A4LA 3JY0A 1FOTA 1ZOGA 4QPAA 4G9CA 1T46A 2BZJA 4HOKA 4R1YA 3SKCA 4OTQA 3UVQA 5I0BA 4E6AA 2C47A 3Q9XA 3II5A 3QD2B 2QLQA 3KXXA 4EOLA 5L3AA 3QGYA 2IPXA 2OF2A 1VYZA 1XBBA 4V05A 1SNUA 5IUIA 4IB0A 4F9AA 4HVDA 2GPHA 4MXZA 2BDJA 4DINA 5AP2A 4GL9A 5IQEA 4FZ7A 4QNAA 5H3QA 4FKSA 4QP6A 4K1BA 4F0GA 1G8AA 5BVWA 2VRXA 5HORA 4X0MA 4LOQA 2R3MA 3OHTA 3AOXA 1PMUA 2H9VA 4BWKA 3BYMA 5LARA 4RJ3A 4YSMA 4PTGA 4ASZA 3TJDA 2HOGA 5DT3A 4FC0A 5ETIA 4JOAA 4AOTA 4BDFA 3HDNA 4CFUA 3I7BA 1XJDA 4I24A 3SX9A 4YTCA 2PE1A 2YM5A 2PUIA 3P4KA 5H8BA 4JS8A 3RM7A 1OGUA 3GQLA 1S9IA 4WUAA 2XK7A 3VHEA 5IQGA 3DQXA 5HNGA 5HQ0A 1M2PA 2QI8A 3C9WA 1H0VA 4A4XA 2J9MA 4BTKA 5LWMA 1JAMA 4C37A 5L2IA 5M4IA 4DT8A 5HTIA 4IWDA 2B9FA 2HZ4A 4FZFB 3ROCA 4ACHA 2FSMX 3BCEA 2O3PA 4AQCA 2W1IA 4NZWB 5KMOA 3EQRA 4PTCA 3VS1A 2RL5A 4FKQA 5AR4A 4OTRA 3QA0A 3DBQA 5FG8A 5GZ9A 3KRWA 2BZKB 4BHNA 4C7TA 4FL3A 2GCDA 3SOCA 4O4DA 2PVNA 3DNEA 1STCE 1M7NA 1YDTE 3FLSA 4M69A 2R3LA 2RFDA 5HNBA 1SNXA 5LMKC 4E1ZA 3BBTB 4FEUA 2XA4A 5IA4A 5GNKA 3Q6WA 3NGAA 4QQ5A 3QHRA 2SRCA 2VTIA 3T3UA 4WRSA 5E90A 2XM8A 3VAPA 4CNHA 4EH2A 3REPA 2VN9A 3MW1A 3OWJA 3JXWA 4U42A 4AA4A 2OIBA 1Q3DA 2PZYA 5AAGA 4PPBA 3P7BA 4QMUA 5CU4A 3Q53A 4BCJA 4QP4A 2AC5A 4IM2A 4I3ZA 3DQWA 3E3BX 2VTJA 4DBXA 5B2KA 4J98A 2Y7JA 2IWIA 3DZQA 3IOPA 1Y6BA 2YCSA 3D15A 4RGJA 2WELA 3W16A 2X81A 3KN5A 3K3IA 3ULZA 4AXFA 4EZ5A 4C4IA 4XP3A 3O71A 3EQCA 4FG7A 4G6NA 4MNFA 4A9SA 4FICA 1JQHA 4BBFA 2PMLX 3NUNA 4RVTA 4BBMA 4ACCA 5IG1A 4YU2A 1PXJA 2WOUA 3LFEA 4FSNA 5HZNA 3JYAA 4FEQA 3DJ5A 3MV5A 4IJ9A 2AYPA 3AMBA 2PE2A 3R1YA 5JGBA 1UV5A 4J97A 2PZPA 2C6OA 3D7ZA 1E9HA 3WZUA 4AXDA 1WVYA 3KMWA 3EZVA 3BWJA 5DOSA 3HLLA 4FKGA 4AT5A 2W1GA 5CSWA 2QOFA 4HW7A 1W83A 2EXCX 3Q5IA 4JDJA 4KINA 5CSXA 3LFFA 3EN6A 3UVPA 3ZUUA 4YPDA 4CG9A 4IZ7A 4YSJA 4I6HA 5JGDA 4A9TA 2HIWA 4IMYA 4FYNA 3PXRA 2X6DA 2ONLA 3ODYX 4RX8A 5DT4A 4F9YA 4M66A 5HVJA 2X9FA 2XKDA 4EK4A 3ORIA 5DR2A 2G2FA 4NYEA 4RQVA 3T8OA 3C5UA 4BCFA 3RAWA 4QMVA 3EFWA 2W7XA 4IBMA 3C50A 1H1SA 2QR7A 1OM1A 3IO7A 3O7LD 4MKCA 4XEYA 4ZAUA 4W4XA 4WSYA 4FEVA 2W1FA 1BMKA 3MVHA 3OCGA 1W82A 3QQKA 4DEHA 5K5NA 2FH9A 3E8EA 2W9ZB 1AD5A 3ORNA 3UNKA 5GINE 4CFVA 4C0TA 2X8IA 4APPA 4OTFA 2VTTA 4IFGA 2X4FA 3ZXZA 3DK6A 3R22A 3KY2A 1OUKA 4U5JA 2CSNA 2O65A 4XH6A 2C3JA 3PFYA 3BKBA 3KRLA 3EMGA 2XAOA 3MFSA 3UDSA 5C1QB 4ACDA 3O8PA 2J51A 2B0QA 1MRVA 4CMOA 4E4XA 4MHAA 2DWBA 5D1JA 2GDOA 2HY0A 4FNWA 1FBNA 2G15A 1H24A 3DXNA 4S32A 3JUHA 4KBKA 4ANSA 3R7VA 3EN9A 5CEKA 4F0FA 2R3HA 4F4PA 3AC2A 5J5SA 1JSVA 3R01A 4RIWA 3ZM4A 5A54A 3KMMA 4GH2A 4EC9A 4JJRA 2BAQA 2YABA 4FNYA 2W4JA 3IW7A 3GUBA 2VTMA 4GG7A 2EUFB 3H10A 3NCGA 4NW5A 2P0CA 4DF3A 1P4OA 4UXQA 1WAKA 5LOHA 2PSQA 4OT5A 4NM3A 5F94A 3LMHA 4WT6A 2HWOA 3UG2A 3TUCA 1NVSA 4DCAA 3ZMMA 3KA0A 4O7VA 1XQZA 3LAUA 4TYGA 3F66A 2YM8A 1QPCA 4FIJA 3W8QA 3D7TB 5I9VA 5KE0A 5K5XA 1CMKE 5K0KA 2QOKA 2ITWA 3FL4A 3G0EA 4R3RA 2YDIA 3OOMA 2YWPA 2R3OA 3KRRA 4RC4A 3V8SA 5KHXA 4NFMA 2BHEA 4G9RA 3F69A 4C57A 3SLSA 3FY0A 4N0SA 5D7VA 4XG7A 4XS2A 4FTMA 4ANOA 3UG1A 2XBJA 4EWHA 4GKIA 3ZFMA 4QQTA 1K2PA 3F5GA 4F6UA 5JFSA 3FXXA 2YAAA 3R1SA 2ITPA 2PZ5A 3FI4A 2G2IA 3QTUA 4EK3A 5CF4A 3TKHA 3PA5A 1PXNA 4FVRA 3BL7A 5F95A 5KZIA 1GJOA 2OW3A 4FKUA 3KU2A 1GZKA 4DEEA 4DFYA 3TM0A 1ERKA 2CHLA 5E8XA 5IQHA 3SQQA 4AE9A 5L2TA 3DKCA 4FL1A 1A9UA 3KRXA 3A8WA 2H6DA 3LXNA 4G3CA 4XV1A 3VUKA 5L6WL 1Q8TA 3IPHA 4YGAA 2UZLA 3OCBA 4FNZA 3D5UA 4O0XA 4II5A 4YP8A 3BHVA 4HZRA 3ZSIA 2UZOA 4RJ8A 2VGOA 2YM6A 1OIRA 3VS7A 3FYKX 5A6NA 1Y57A 1JNKA 4F64A 3FV8A 3GCUA 1H1RA 4FKTA 4EUUA 1PYXA 2CNQA 4KB8A 3N51A 4J95A 3D5XA 3N4TA 3P5JC 4QP2A 3MB6A 2YZLA 2HXLA 2YCQA 5EQEA 4QP3A 4XOZA 3OOGA 3OS3A 4AFEA 4AGWA 4BGGA 4HNFA 2B55A 3CPBA 4WSQA 4XV3A 4BC6A 3DBDA 3E7VA 4HYHA 4R8QA 5CU3A 1Y8GA 5EQPA 4CCUA 1WFCA 2XCHA 2IG7A 4UX9A 3FMLA 3ORXA 5GHVA 3FY2A 1FINA 3PE1A 3E3PA 1HCKA 4AN9A 5BV3A 1YOJA 2V55A 4XG3A 3UOJA 3BU6A 4FIIA 3AD4A 1GAGA 2F7EE 3NLBA 2XNOA 4D28A 4PDYA 1DI9A 1GNGA 2AC3A 5BYLA 4QNYA 2J90A 4XP0A 5CY3A 4F63A 3AKKA 3LMIA 2WMSA 4FV3A 4FZAB 4DHZA 3A61A 2QU6A 4J1RA 3CC6A 1APME 4K9YA 4F1TA 3F3WA 1OL7A 1MRUA 2RGPA 5BX0A 3BU3A 4G6OA 4WG3A 1UKIA 4KNBA 3MH0A 4PL3A 4RLKA 4F1OA 5IH4A 3PUFC 5A14A 3I60A 3HA6A 4I94A 1U54B 3UZTA 3SG9A 2BFXA 4FTIA 4V0GA 4FIEA 3UIMA 3M2WA 4EC8A 3HMPA 1W2CA 3U8WA 4ZJJA 3MSSA 4CZYB 4CMUA 4G16A 4DG3E 3HRBA 1H8FA 2BTSA 2PZIA 3ZXTA 4FE2A 1KUTA 2C5NA 1CDKA 5CENA 3S3IA 2EVAA 4BYJA 3PZHA 5CX9A 3EFKA 4IM3A 5EM6A 3EQPA 3WE8A 2XANA 2IVVA 4G1WA 4BFMA 2UW7A 3E87A 3NUYA 5CXHA 5EOLA 3R7IA 2QG7A 3R7EA 2ACXA 1E1VA 1H26A 1NXKA 1NY3A 4U45A 5D7AA 3VUHA 3GI3A 3S4QA 4DEIA 2CJMA 5HKMA 5DT0A 3RM6A 3ATTA 2C1AA 3LMGA 3W32A 4R77A 3FMEA 3R9NA 4Q9SA 3ITZA 2RKUA 5KMLA 4WIHA 2RG6A 4YJVA 1HCLA 5AJQA 3VS6A 3VS5A 3IDBA 4XOYA 4WUNA 3MS9A 2PVFA 5A3XA 5JT2A 3AG9A 4YO4A 2ITTA 2OU7A 2RF9A 1SVEA 4EHEA 3RGFA 1H27A 3QTRA 3H3CA 3FPQA 1PY5A 2GFCA 2AEGA 4CCBA 4O4BB 4GV1A 2Q0BA 3GCVA 5DGZA 5EYDA 5IDPA 5M06A 3CSVA 3MFUA 4TTHB 4O4FA 4ZLYA 4R7HA 3ELJA 1Q5KA 1OBGA 5J7HA 2JDOA 2OJJA 1BI7A 3P79A 3A2CA 3CEKA 2X2KA 4CTCA 2BKKA 3I6UA 3F9NA 4NIFA 5GIOE 3PSBA 3EYGA 2GHGA 5FM2A 4FTUA 3O8UA 4Y83A 1NA7A 5IF1A 2E9VA 2BPMA 1NW1A 4KAOA 3TTIA 4KSPA 4YLKA 3RK7A 4D4RA 2V0DA 3L9PA 4RJ5A 2GQSA 3CLYA 3JS2A 2GS6A 3QL8A 4HYIA 3TNWA 4ANLA 4AP7A 3ENHA 4G17A 2UVXA 3V6SA 4CKJA 4C33A 1U4DA 3HV6A 4LG4A 1YOLA 3QX4A 4GUEA 4F9BA 5ACKA 5I3OA 4RA4A 4RIXB 2RIOA 4LMNA 3UZRA 4E93A 1XO2B 2XNPA 3C1XA 3S00A 3RI1A 5JZJA 3PY0A 2VX0A 4L01A 1SM2A 2IW6A 5FXSA 2OFUA 4QRCA 2XKCA 2W1HA 2YJSA 4FIGA 2LAVA 5BVKA 4X2FA 4PQNA 4RVMA 2DUVA 1M14A 2JDTA 4KKHA 4FV5A 4CLIA 3QYZA 2HY81 2QOBA 4NTSA 3QXPA 3QGWA 4JG8A 5EDRA 3VO3A 5B2LA 1RQQA 2XYNA 1H1QA 3CD8A 3B2TA 5JGAA 1Y6AA 3E8DA 3WF7A 3HAVA 3ZRKA 3IQ7A 4IB3A 5HG7A 2VTLA 3HMMA 2J0JA 1JBPE 3IGGA 4KBAA 5HX8A 5KMNA 3G5DA 3PWDA 4FV7A 3CE3A 5ETAA 4O1OA 5BNJA 4Y72A 4EQMA 4NM5A 2VWVA 1XH9A 2FB8A 2X2LA 4ZJVA 4FT9A 2C3IB 2VZ6A 2BIKB 4H3PA 3VNTA 4UMUA 4CMTA 2GHMA 4L45A 2OSCA 4BHZA 2WTKC 4DDIA 2WQNA 4E6CA 4D2PA 4XLIA 2JDSA 2A2AA 3FZ1A 4HVGA 3PDTA 3L9NA 4YTHA 4RG0A 2FSLX 2BFYA 4MWIA 2VTNA 4G3EA 4A9YA 4QMNA 4YJUA 4GG5A 4TYJA 4XYFA 3UTOA 3PJ1A 2GNFA 3VF8A 4IAYA 1H25A 3OW3A 4DGNA 2W17A 4EQUA 5IQFA 3RTPA 2ZM3A 5AFVA 5CQUA 2J2IB 3BYOA 2VTPA 4OTIA 1ZXEA 5I9XA 3PLSA 3RK5A 3BU5A 4C4FA 1WVXA 4CFNA 5HTCA 2GQGA 5I4NA 5LCJA 3ORLA 2XCKA 4GVAA 3F5XA 5HE3A 3AC4A 5IMXA 4CYIA 1U54A 4JRVA 5JK3A 2ZM1A 2OJ9A 5JN2A 2J0IA 4MD8E 4A7CA 3A7HA 1XH5A 5EHLA 4DA5A 3FMJA 4HCVA 4EK6A 3KREA 4IH8A 3NFFB 1OBDA 3MPTA 3R2YA 4BR3A 1FVTA 3WF6A 4FSQA 4BDEA 2ZVAA 5HESA 5IEYA 3MI9A 4KRCA 5FP5A 4L8MA 1CKPA 2VO7A 5E9EA 3LM5A 4GCJA 2XUUA 3B8QA 4XMOA 2ZV8A 5T68A 3D83A 3LFSA 5EFQA 3ZC6A 4EH4A 4D9UA 4IEBA 4GS6A 4KUJA 2FYSA 3P08A 3RHXA 3D2KA 2JFLA 3FZRA 5T6KA 3RCJA 3QCYA 2ITOA 4RJ4A 3SD0A 3VS4A 2CKPA 4EH3A 5JH6A 3OP5A 2WQMA 3CCNA 3LW0A 4W9XA 5I9WA 1QPJA 2BVAA 4J8NA 3C0HA 2W4KA 3F2NA 1W8CA 2XM9A 4YTIA 4RX9A 3G33A 4AZWA 2ITYA 3GC8A 4I6BA 3K54A 2C6DA 5EI8A 4PMSA 2BALA 2C30A 2R64A 3FAAA 5H2UA 3DB6A 3E7OA 4RIYB 1YHVA 5KUPA 4AZTA 5ANEA 2JIUA 3CTJA 5BMSA 4GRBA 2UV2A 4OR5A 4JAJA 4EL9A 3RNIA 3BHTA 2OFVA 3KULA 3FXZA 4BCNA 4AF3A 3UOLA 2O64A 2VTHA 2ITNA 3ZLYA 4CRSA 3MDYA 4J99A 4YC8A 4LMUA 5EM8A 2BRMA 2WEIA 4MXCA 2J4ZA 3CGFA 4TWNA 4EJNA 3NW7A 3RZBA 5ETFA 3ZRLA 2YM7A 3QTIA 3CKXA 4AW0A 3ZZEA 4U3ZA 2Y4IB 3DZOA 4I5CA 4C02A 3VBWA 1G5SA 3AKJA 2B7AA 4YNEA 1RW8A 4L42A 3H9OA 2X7FA 2C0IA 4I4EA 1OL5A 1DAWA 4YJQA 4BKZA 4RIXA 4AS0A 4O4CA 5CEOA 3LM0A 3DB8A 1KE9A 4ITHA 4XG9A 4MXXA 4O6LA 5FXRA 5JFWA 3U6HA 1WBWA 4IHPA 1M17A 3OW4A 2YHVA 1W84A 4YNOA 3C5IA 2PVYA 3CP9A 4NWMA 5AP4A 3SXFA 4CG8A 4LRJA 4O0SA 3R7GA 4FV6A 3MVLA 2Y0AA 3UO6A 5M56A 2O63A 3HP2A 2BAJA 4FG9A 3GCSA 3L9LA 4DEDA 2R3JA 4ZZNA 3QLGA 2WMAA 4KIQA 1YRPA 3MJ1A 5EW9A 4QQJA 1GZ8A 3I81A 4C4HA 3M11A 3NUAA 2PMNX 4D0XA 4YTFA 1FMOE 3H9RA 5CU2A 1GIHA 1OKZA 1Q62A 5B2MA 3BRBA 1V0PA 4AZEA 2OGVA 3PPKA 2ZDTA 3HKOA 3TDWA 3RCDA 3NNXA 5TR6A 4RZWA 1BLXA 5EKOA 1CKJA 3Q60A 4BBEA 1FMKA 2X4ZA 3DXPA 4O7TA 4ERWA 1XBCA 1WBNA 4U3YA 4N4SA 3F61A 3RNYA 4F0IA 4HGEA 3D14A 2OG8A 5TE0A 3EOCA 4XV9A 1H08A 3FYJX 3ZLWA 5BYYA 3UQFA 5AA9A 4RA5A 3F2RA 2X0PA 4RC2A 3DPKA 5J7BA 4G34A 4FTJA 4PTEA 4OTPA 4RX7A 3A60A 5TO8A 4BDJA 4RFZA 4CFFA 4O7SA 3C4FA 4BDKA 2I40A 4FSMA 2FO0A 2XKEA 4BB4A 4EOKA 4TYEA 1V0BA 4I6QA 2E9PA 3BZ3A 2WTWA 5HCYA 2O0UA 3W0QA 1IEPA 3PUPA 4KS7A 4QYEA 1H28A 4LYNA 1QMZA 4KIKB 4F08A 5E8VA 1ZY4A 3HVCA 4AOJA 5FTGA 3KIOC 1OI9A 1XWSA 5IPJA 5AP3A 3UQCA 3PVUA 4NK9A 2WXVA 4JX7A 3UP2A 3GC0A 5HICA 2ZFYA 4IVCA 2JLDA 2W1EA 2RFNA 5HBEA 2W1CA 5DMZA 1URCA 4B6LA 4W4YA 3NUPA 2JFMA 3E64A 2UZTA 2YEXA 3Q4UA 4MXOA 5AR2A 3H0YA 4BCOA 2ITQA 2O8YA 3VF9A 3O51A 4KKGA 3LFBA 4K6ZA 3RHKA 4D4VA 3UODA 2BROA 3FQHA 4RVKA 2X2MA 5FXQA 1IA8A 4C8BA 2BHHA 4GIIA 5FWKK 2UW4A 4XHKB 3ETAA 3RWPA 3WI6A 4PNKA 3F6XA 4NW6A 4OTDA 1B39A 1P14A 5AR8A 4A4LA 5AEPA 3SOAA 2RG5A 3WF5A