5AM7A

Fgfr1 mutant with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
307
structure length
294
Chain Sequence
b'AGVSEYELPEDPRWELPRDRLVLGKPLGEGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIMEYASKGNLREYLQARRPPGPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBROBLAST GROWTH FACTOR RECEPTOR 1
publication title The Effect of Mutations on Drug Sensitivity and Kinase Activity of Fibroblast Growth Factor Receptors: A Combined Experimental and Theoretical Study
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 294
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5am7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5am7A01
4I20A 3VHKA 3QRKA 4TXCA 4BCFA 1LUFA 1G3NA 2CGXA 2YIYA 3SG8A 2WD1A 3Q53A 5JRQA 2G9XA 5EI8A 3QX2A 5HIEA 3QD3A 3UYSA 3LJ1A 3QYWA 3FI4A 3ZLWA 4ALUA 5DR6A 2PY3A 5CF4A 3GBZA 5KKRC 3B8RA 2VWWA 4KIPA 3S1HA 4BVUA 1FINA 3H0YA 1MQBA 4FZ6A 4TRLA 4FTQA 3RPVA 3UO5A 2NNWB 1PKDA 1Q3DA 4TT7A 3RPYA 4P90A 5IDNA 4ZSGA 4TN6A 1MRVA 4RFYA 4RWKA 5IUHA 3D7TB 4N0SA 2A19B 3OS3A 4RJ3A 4F1TA 4H3PA 3OROA 4DEAA 4FTMA 5FDPA 3GCPA 3WOWA 3KA0A 5CQUA 2UZOA 3ZBXA 4AZWA 2W0JA 4GK2A 4KBAA 5CY3A 2OZOA 4FKOA 4ID7A 3GGFA 2R3JA 4FV0A 2GS2A 4FZ7A 4PL5A 3EKKA 2BKZA 3F3UA 5EHOA 4Z7GA 3MVJA 4E6DA 2W1IA 3QA0A 1UWHA 2W1EA 5HLPA 2R3QA 3NYOA 5I9UA 1H01A 4QTEA 4JR3A 5JGBA 2HELA 3TL8A 4YLJA 4FGRA 5BVKA 5HNIX 3ORNA 3R8ZA 4WUNA 4E8AA 5AADA 3OY1A 5DOSA 1Y6AA 2PMOX 5DN3A 5ANGA 4E20A 3SG9A 5E4HA 3VAPA 2GHGA 1BX6A 3AMYA 4NTSA 2PE1A 3ET7A 3C50A 4AOJA 3VRZA 4XLVA 3QA8A 4AN2A 3SLSA 3QGWA 5M51A 4FTCA 5BX0A 2YJSA 3SRVB 3O2MA 3ID6C 3UPXA 5B7VA 4HYIA 2HK5A 3R83A 5IPJA 1H0WA 5LQFA 2BHHA 2F2CB 4PDYA 2B55A 3NLBA 1YHSA 3IG7A 4UZHA 1W7HA 3KREA 4Y46A 3KULA 4X6RA 2W1ZA 3LCSA 2PVJA 2XEZA 2XCHA 2J51A 3DBEA 4Q9SA 4RLLA 3PRFA 4FSQA 4AN9A 4CTBA 3DFCB 1U54B 4KS8A 3ZUVA 4TTHB 5L2TA 2QKWB 2WHBA 5HEZA 5T68A 4Y5QA 3OCTA 3ZDUA 4ITHA 4ZK5A 4U80A 2KTYA 3RP9A 3DQWA 2IG7A 2QD9A 3LXPA 3LM5A 5IQAA 2PMLX 3HUBA 3NW6A 3R01A 3R8UA 2V55A 2XCKA 4WNOA 4X2NA 1H1SA 2IVTA 3R02A 2IW9A 2FB8A 5HE1A 2BROA 4ZSAA 2A4LA 4QMOA 4IZ7A 3D7TA 3M42A 5LVLA 5AIKA 5GJDA 3NYNA 5I9YA 4YSJA 4FVQA 2PWLA 5HZNA 2CSNA 2YIQA 2XNGA 3PE2A 4L9IA 2ERKA 4YUQA 3F2RA 3A62A 3ZBFA 1WZYA 3LM0A 4B9DA 4XV2A 2R0UA 1WBSA 3WILA 3V6SA 3EOCA 3E7OA 3K5UA 1QPJA 4CT2A 3MDYA 3PJ1A 2UZNA 1Y6BA 3PLSA 2WMVA 1IA9A 2AC5A 2X4FA 2H8HA 3OUNB 3PJ2A 1DS5A 2JFMA 4KBCA 4XNEA 4EH7A 1I44A 2BKKA 3ZUUA 4GIIA 2J9MA 3QTXA 4WNKA 3PPKA 4EKLA 1B39A 2GHMA 5EQYA 3OBGA 3EQIA 4TWNA 4I21A 4RJ7A 2C5NA 3CTJA 5AV3A 3HAMA 5AR8A 4CKJA 2QOFA 4K1BA 4CFWA 2XK9A 3UNJA 4DAWA 4DEBA 4GVJA 2WQNA 3W32A 3HV7A 5IA4A 3FMJA 3HKOA 5DHJA 3LFEA 4I6FA 5JN2A 3F7WA 3P0MA 4MD7E 4EZ5A 3ERKA 3HL7A 1M14A 3C4WA 4DEEA 3VS1A 3N4TA 4NH1A 2X8DA 4HJOA 4DGNA 4G5PA 3ZRKA 4AXAA 3Q2MA 3OXZA 3AT4A 3MVHA 2QG5A 1UWJA 4GUEA 2GPHA 2B9JA 4FIEA 4LL5A 5CEQA 3REPA 4A4LA 3W8QA 4UMPA 3UYTA 4PP9A 1U54A 3OWLA 4L53A 3MFSA 1IRKA 5HCXA 3BEAA 3QHWA 4YJTA 4NK9A 4ZMEA 1JOWB 3MPTA 5I3OA 3ZFYA 4KBKA 3S4QA 2UW9A 3KB7A 1FVVA 5AA9A 2XKDA 3V8WA 5EQPA 1E9HA 4MAOA 4AZSA 2CNUA 3R1NA 4EL9A 4J95A 3SXSA 5JZNA 1YDTE 2A27A 2FSLX 2VTAA 4EBWA 3RWQA 2VTIA 5HG5A 1A9UA 5J1WA 3JYAA 2OF4A 3Q60A 1B38A 2E9PA 2QG7A 3DB6A 3PVGA 3IDCA 3VULA 3A7HA 3FLZA 4LV5A 2IZSA 4OTQA 4O7ZA 5GZ8A 4ZY6A 1RJBA 3CPBA 3FMMA 4YURA 3THBA 3QTWA 5F1ZA 2FYSA 3KGAA 4H58A 3V5PA 5BVFA 3LKMA 1DM2A 5KMIA 3SDJA 3HMMA 2R3NA 2YAAA 5KKRB 4YMJA 3BGPA 3ZLSA 4Z3VA 1SNXA 2OSCA 5IA1A 1OKYA 3QD4A 3T3UA 2B7AA 3CR0A 2V7OA 5M4CA 3FSKA 2HCKA 4I5CA 3TKIA 2E9UA 3TTIA 5LVOA 3DBCA 4D1ZA 4DT9A 2UVZA 5E91A 1CTPE 4L46A 3BQCA 4D0WA 3DY7A 3O71A 4FNZA 3BHYA 1Q24A 2CLXA 3GI3A 3IONA 1GZNA 3PYYA 3QQKA 4L43A 4BCHA 5A54A 4DTAA 2FO0A 1VYZA 2UW7A 4PPBA 3K5VA 1IASA 2W4OA 4OTWA 4PDPA 1BL6A 4RIWA 1BI7A 3H9FA 3RCJA 5BMMA 3WZKA 3ZLYA 2J6MA 1W83A 2WAJA 4I4EA 2B54A 3JXWA 4NYEA 4RVMA 4XBRA 2FVDA 2VO3A 4DG3E 3MIAA 3EJ1A 3KVWA 2QHMA 2IZTA 3PUPA 4O2PA 2YN8A 4U5JA 5BVDA 5BYYA 5IQCA 3NVKI 5DMZA 1ZARA 1XH8A 2PVLA 3QUEA 4IHPA 3PY3A 2YITA 2HW6A 5CAPA 2F7EE 3VN9A 3EFKA 2Y4IC 3NUUA 4BDFA 4E5BA 4PRJA 4ZS4A 4FKRA 4R7HA 2WMAA 4C8BA 3V5QA 4A9RA 4BCIA 2IVSA 5LXMA 3QBNA 4DLJA 4XOZA 2G2FA 2BRNA 2ZJWA 3OMVA 1ZOHA 2GMXA 2W1HA 4WSQA 4HNFA 4X2KA 2X39A 4U3YA 3EL7A 4FTLA 2BHEA 3RAIA 4CFFA 4D2RA 2ZV2A 5AUUA 2QO9A 5BVOA 1R78A 4HPUE 4KKEA 4L3PA 3I6WA 5ETCA 3SKCA 1U59A 5CQWA 3TTJA 4ACDA 3RAWA 3TI1A 2V7AA 5LWMA 4FX3A 2CNQA 2WEIA 4Y8DA 4P4CA 2YHVA 4M97A 4EEVA 4E26A 1ATPE 3KU2A 4F9AA 4FTAA 2PE0A 4JBOA 3LMHA 4NCTC 3A8WA 4DH1A 3GVUA 1FGIA 5HTCA 3U6HA 2AC3A 4WNMA 2HZIA 2QONA 3ZMMA 4JX7A 4C4GA 4LQMA 4KRDA 3GU6A 4LOPA 4O0YA 3UC4A 3FE3A 4QP8A 3PY0A 4S32A 2R3KA 4TYEA 3VS4A 4L00A 2W05A 2PYWA 1PW2A 3EFWA 4MD9E 4QQ5A 4KKHA 4MF1A 1PXJA 5DBXA 3ZOSA 1Q62A 4EK5A 3BU3A 1PKGA 2YERA 1YOJA 4EZ3A 2J2IB 2ONLC 3NIZA 2ZM3A 4CD0A 3FC2A 3F66A 2Y8OA 4C3FA 4IB5A 4IACA 1PXKA 2O65A 3Q4ZA 4I5PA 4DGGA 4GYIA 4QYHA 4XG8A 4BDGA 4E73A 2JGZA 2WOUA 3MH3A 4XX9A 2QOCA 4BIDA 2J0JA 5DEWA 4XS2A 2IN6A 2XIKA 1F3MC 4R3CA 5LJJA 2W1FA 1MP8A 1H08A 1IR3A 4CGAA 2WU7A 4FNXA 5CX9A 2ITUA 2ZYBA 4PUZA 1JSVA 3GP0A 5H8GA 3MBLA 3UVPA 4IVCA 2YZLA 2R9SA 2I1MA 5IQEA 3UZTA 4IWDA 4RVLA 3VW8A 2J4ZA 3MJ2A 1PXMA 4FKJA 2OBJA 5F20A 3Q4UA 4NFMA 3DDPA 1KV1A 2Q0BA 2YEXA 1YHVA 5JMSA 3SA0A 2UZDA 5HESA 5ETFA 3RM7A 1O6YA 3ZFMA 4BDBA 3R9DA 2CN8A 3P23A 4DTKA 3TG1A 4WG3A 3GOPA 3MH0A 4CG8A 3LFAA 4IFCA 4OR5A 4XH6A 1P5EA 2OIQA 2P2HA 3LVPA 4JBQA 4M68A 2I7QA 3TM0A 4CFMA 4RC2A 1YI4A 5J9YA 4NTTA 5AEPA 4GV1A 3LFDA 3POZA 4AT4A 3W1FA 1XWSA 5KHXA 4CT1A 4G6OA 4J7BA 4ALWA 4DBNA 4C4IA 3ITZA 4FEQA 4QMPA 3UDBA 1H1QA 4RJ6A 5KMMA 3HRCA 1MRUA 3H30A 1PMEA 4K77A 3AD6A 2W7XA 4ZLOA 2VTNA 4R5YA 5AX3A 2X0GA 4UMQA 1JKTA 2QU6A 4PMMA 1B6CB 1Z5MA 3TKUA 1OECA 2B9FA 3NW5A 3R6XA 2CN5A 1XH5A 2FH9A 4HNIA 4QYEA 4BZNA 3VS0A 5IQIA 3WYYA 2CKQA 3QXOA 2A2AA 2BAJA 3RK9A 3FZRA 4O27B 3ZO4A 4FSTA 3CY3A 2UZLA 4ZZOA 4AUAA 3C7QA 5CSPA 1YWNA 3ZHPC 4J8NA 3I79A 3LMIA 2I40A 4G6LA 2QO7A 4IX3A 3DB8A 5TOZA 4EZ7A 3ACJA 4ZEGA 1Q97A 3A2CA 4CRLA 3LQ5A 1YDRE 3QFVA 2RSVA 4FUXA 2OWBA 4FT3A 3WF8A 4QTBA 4TWPA 4NIFB 5BUEA 4JAIA 3UOKA 2PVRA 1OL7A 4AW5A 5BNJA 4IVBA 5BVNA 4ASDA 3G33A 2JFLA 3NNUA 3EN6A 3FQSA 4ASZA 1KSWA 5D9HA 1STCE 4BTJA 4O1OA 4F63A 4RC4A 2VWXA 4CYIA 4ANLA 2QOOA 5DGZA 1M52A 4O82A 3ATSA 3IGGA 3C4CA 3PIXA 4D28A 1H4LA 2I0VA 2JBOA 4QP7A 5KO1A 3SQQA 3F5XA 3JPVA 4GT4A 3BE9A 3KXMA 4O0XA 3AC4A 4PNIA 4HGEA 3RCDA 1ZYSA 3WE8A 4D9TA 1UU7A 2EUFB 3FKNA 3IW5A 4GYGA 4AWIA 4AU8A 4DFZE 1J7LA 4LUDA 1FBNA 3VS3A 3FAAA 3ORMA 3VUMA 1DI8A 3UODA 4DFYA 4CTCA 4FT7A 3OOGA 4U41A 1J1BA 4I94A 1YVJA 2YCQA 3KXHA 3OBJA 3PG3A 3SOAA 2GQGA 3BWJA 4FTNA 2Y4IB 4F65A 2BIKB 4XG6A 4QMXA 4KA3A 4Y85A 3ZDIA 5HLNA 1LEWA 4U40A 3ALNA 4F9WA 5DI1A 3ORTA 3R7EA 3Q9ZA 5K5NA 4Y95A 2C0OA 4O0WA 4ASXA 3LAUA 3U4WA 3P08A 4Z9LA 5CWZA 5IZFA 4G2FA 4IWPA 2CCIA 4FKWA 4FV9A 3W2SA 4YJNA 4DLIA 2JAMA 2JKQA 2BILB 2E9NA 4CMUA 4ZSJA 2XUUA 4JR7A 2IVUA 3AQVA 3VBQA 4FK3A 3U8WA 4RIYB 3I1AA 1Z9XA 3R7YA 2X6DA 4V05A 4MK0A 2WQEA 3FI3A 2QOLA 3V8TA 4R7BA 5E8WA 2I0EA 1CKJA 3HA8A 4D2SA 3GC0A 2HY81 2Z7RA 4BRXA 3CC6A 4OTFA 5TT7A 3UP7A 4DFXE 3OTVA 4PPCA 5FP6A 4YPDA 3CP9A 4QP9A 2UV2A 4AA0A 1GOLA 4K11A 4RIXA 5I0BA 1JNKA 3RMFA 1H8FA 1XO2B 2YM5A 4GFGA 5C9CA 3DNEA 4FTKA 4NIFA 3U6IA 3RPSA 1FVRA 1Q4LA 3CTHA 3VF9A 4O0UA 5DH3A 5K9IA 5AUYA 4XG4A 4P5ZA 1ZXEA 3I7BA 4W4VA 4QMSA 3TZ7A 3S95A 3COMA 4FIHA 4O6EA 4RVTA 5F4NA 1PHKA 4YJSA 4HGLA 5L2IA 5M55A 4BCPA 5CF6A 3ZLXA 2XA4A 5DFPA 5EYDA 1OGUA 2WTKC 4EOSA 2ZMCA 3UZRA 1R1WA 3Q96A 2BAQA 3KCFA 3L8XA 3PSDA 3FMKA 3Q6WA 5DIAA 4AGCA 4F9CA 3COIA 3HNGA 3PPJA 4WD5A 2V62A 5ETIA 4C61A 2UZVA 3V5LA 1J3HA 3C4EA 3GNIB 2CLQA 3FMHA 4YLLA 5CU2A 4YTIA 4UMRA 5D7AA 1P4FA 1Q8TA 5AP7A 2NPQA 2Y4PA 2PZIA 1UNLA 2BR1A 5EM6A 2X2LA 3IKAA 4ZS0A 2IZUA 4BIBA 5GZAA 3BYMA 4V0GA 5JSMA 4J99A 5CLPA 3LE6A 1U5RA 4BWKA 3H9RA 1BMKA 2WMTA 5JK3A 2ITPA 4FEUA 1KOAA 4F99A 3ATTA 4NKAA 1WFCA 4USDA 3R9NA 1BL7A 5AV2A 4A9SA 4DFLA 4Q5HA 3DS6A 5J79A 3BU5A 3ODYX 3PIZA 2LAVA 5M44A 1UVRA 4FTOA 4W4XA 4O22A 4QTDA 1NVRA 5M07A 4M13A 1W8CA 3MTLA 4RFMA 4GT3A 3SW4A 5AIRA 4DE4A 4QMYA 2CJMA 4IJ9A 2NO3A 2RFEA 2RL5A 4EH8A 3QLFA 3PA3A 4IDVA 5A6OA 5CANA 3CLYA 5EYKA 2XYUA 4I22A 3E3PA 4HYSA 3ZSGA 3Q2JA 4L52A 4ZXTA 2REIA 4M15A 3SXFA 2XJ0A 1Y8GA 2UZWE 3F61A 2WNTA 4FVRA 2C3LA 3S0OA 3V01A 4H39A 4QQCA 4FG7A 4IW0A 2VTHA 1PMVA 4E4XA 4JIKA 5BVEA 4USEA 2W99B 4BICA 3LJ2A 3RAHA 2JDVA 3KXNA 3UG1A 1OUYA 4WO5A 3SX9A 3Q9YA 3R00A 2F7XE 4M14A 4U43A 4EI4A 5K4JA 1URCA 1XR1A 3PJ3A 2ONLA 4BKYA 2J0KA 3ROYA 4C36A 5FD2A 4LG4A 3TUBA 2W17A 3LFNA 4I23A 4WHZA 3DJ7A 2J5EA 4HYHA 4I5MA 4EQMA 3FLWA 3KK8A 1LPUA 3FLYA 3DBQA 5F94A 3VUDA 4IWQA 2FSTX 4YP8A 3GU4A 3KC3A 3HRFA 5K4IA 3GT8A 4ZTHA 4AACA 4DINA 3D5XA 1FGKA 3ORXA 2XIYA 4F0FA 5FTOA 4W4YA 1YWRA 4TWOA 2BZHB 5HQ0A 1OBDA 4LFIA 3EQFA 3AC5A 5CASA 1OKWA 4G16A 4XV1A 3C51A 2JIIA 4QMZA 5LARA 2PMNX 3ZUTA 1V0PA 2E2BA 2WMQA 3KCKA 3C0IA 3CBLA 3CEKA 3PP1A 3DOGA 1OKZA 3G9LX 2YM7A 3QTQA 1G5SA 2BUJA 4CZYB 4QMVA 3LLTA 4XV3A 2HYYA 3BV3A 2WTCA 4FV1A 4I1ZA 5CNOA 3LOKA 2BZIB 1PF8A 4USFA 1PXPA 3O0GA 3DKCA 3NYXA 3ORZA 4PY1A 4L45A 2PUNA 4EOJA 4ZY5A 5E8TA 2EXEA 4PTCA 3E8EA 3SGCA 3EQPA 5L2WA 5B2MA 3MIYA 4OBPA 4FNWA 2X6EA 2I0YA 3KULB 2OJGA 3KMWA 5IKWA 3ETAA 4NZWB 1URWA 4KUJA 4U79A 3C5UA 5HOAA 1HCKA 4IDTA 1ZYDA 2BTRA 5C8NA 1PRYA 3QALE 4IZAA 1YI3A 4D4SA 3IO7A 4F6SA 2J90A 3IGOA 1WBPA 3TIZA 4KS7A 3ZTXA 1ZMWA 4ZJIA 3QD0A 3FPQA 3COHA 2ITNA 5FDXA 2JC6A 5J7HA 4LGHA 4FEVA 4LUEA 3VUGA 4EH9A 4GU9A 3R28A 1JLUE 2CDZA 4JRVA 5E1SA 5AP4A 5CEOA 4ZJJA 3UMXA 5IA0A 2UW0A 4FKPA 4I6BA 3RK7A 2PL0A 4WG4A 2OJFE 2C6OA 5K3YA 1H07A 1OB3A 2VTQA 3OWPA 4AA4A 1ZY4A 3PSCA 4JXFA 3VUKA 3UQCA 4FE2A 4YJPA 4MXOA 4L7SA 4EK8A 4YSMA 5HNGA 4OBQA 3QUPA 3ZEWA 2WMXA 4ZTRA 4RQKA 3Q4TA 4JLCA 3LFQA 4D1SA 1GZOA 4ZLYA 5CEMA 4MH7A 2X7FA 4MKCA 4RPVA 1ZYCA 3KQ7A 4RIOA 3P7AA 5EFQA 3H10A 4ENYA 5A4TA 4EOMA 4JIAA 3FL4A 4GT5A 4RMZA 2JITA 2UW5A 3P7BA 4RRVA 5CZHA 5HO8A 3PSBA 3QCQA 2C3KA 4KNBA 3LCOA 4QTCA 4BDJA 3Q32A 3ZSIA 2RFSA 5CAOA 2WTKB 3WIGA 3DFAA 3BE2A 3HAVA 5BYLA 4RVKA 3EH9A 2XIZA 2XK7A 3VBTA 4AA5A 5FTGA 2YWPA 5LCKA 3OXTA 1ZOEA 4QYFA 2UVXA 2XJ2A 4C02A 3DBDA 3RPRA 3W55A 4WBOA 3OEFX 3FHIA 3OHTA 3VUHA 3ZH8A 4L3LA 2XK4A 4RBLA 4IBMA 4XP0A 2GNFA 2W1DA 4QNYA 2VRXA 2HOGA 3LJ0A 4EC8A 3QRTA 2PE2A 4G31A 4V01A 4UWBA 5DPVA 4ACMA 4FG9A 3BBWA 5CNNA 4DEIA 4YTFA 2UZBA 2XNMA 4AZTA 4EBVA 4E4MA 4UEUA 2PHKA 3D0EA 4M12A 2YM3A 3VNTA 1APME 3HUCA 4KINA 4A9UA 3BLQA 4KIQA 5IQFA 5DEYA 4GK3A 4RG0A 3CY2A 3BU6A 4WRSA 3FHRA 4CEGA 1YXTA 4CG9A 4IQ6A 5AP1A 3R7OA 2ITVA 4GJ2A 4FKIA 3OFMA 5J87A 4IZ5A 2OO8X 2C47A 1Q8ZA 4FMQA 4A4XA 1XBAA 3FEGA 4L8MA 2XRUA 1JAMA 3MY0A 3O7LB 4C4HA 5F9EA 5IMXA 2IPXA 5M4FA 4RQVA 3R71A 5J1VA 3P78A 5IQGA 5K0KA 5CU6A 3ORIA 4WSYA 3DXPA 2O0UA 2OG8A 2RKUA 4E5WA 2OXXA 3TWJA 4ZSEA 4FZFB 4AQCA 2VTLA 3QAME 5JGAA 3P9JA 4QD6A 4FKSA 5AR4A 5TE0A 2PU8A 4F09A 4DCEA 4X3JA 5D11A 3QWKA 3NMUF 4XOYA 5F95A 3U9CA 2R7IA 4GK4A 5L2QA 2PZYA 5A4EA 1XH4A 5CEPA 1QPDA 4FGBA 3A7FA 4C35A 3OUKA 3FXXA 5C01A 1UU9A 2OICA 4Q5EA 5KZ0A 2O63A 2XNNA 4YJQA 4HOKA 3BBTB 3V5TA 1XBBA 3FZTA 3RINA 3ZO2A 4XLIA 2BDJA 3UC3A 3QD2B 3ZU7A 4BC6A 3IW4A 1TVOA 3KMUA 3TZ8A 2BALA 5K0XA 3AG9A 2PZPA 4B7TA 4FEWA 4O7YA 5LVPA 4QNAA 1H1PA 2VO6A 3KXZA 1CKIA 4XJ0A 4E6QA 5FM3A 1IG1A 2R64A 4RIWB 3QX4A 2PULA 1YRPA 3WARA 5A6NA 2OGVA 3VWAA 2JKMA 4X2JA 5A14A 4EOKA 3N4VA 3OW3A 3KN5A 3MTFA 4OT6A 3PFQA 3MH1A 1DAYA 3SW7A 2V5QA 3NSZA 3E92A 3NW7A 4E4LA 4QPAA 3QTSA 3VUTA 5A4LA 2F9GA 4NM0A 4M66A 2CKOA 1J91A 5J5TA 2WFYA 2B9IA 2XKEA 3WF7A 3I4BA 5M56A 3FZPA 3GFEA 3RKBA 5CXHA 2OZAA 4C38A 1Q5KA 1W98A 2BRBA 2WMUA 4EH5A 2ZOQA 3EYGA 4WBBB 2BPMA 1GJOA 3AMBA 4U97A 2J7TA 2XJ1A 3DKGA 3JY9A 3EQGA 5AAEA 4FSRA 1XJDA 1K9AA 1KV2A 3IOKA 2R5TA 5LMAA 4U0IA 4PQNA 3RZBA 2HAKA 3NAXA 3NRMA 5EOLA 4MWHA 3IW7A 4BWPA 3FJQE 4GKHA 4UBAA 2G15A 4OBOA 3QRIA 3DTWA 1WBTA 5AP2A 3ZXZA 3MY5A 1GIJA 3VRYA 3KN6A 4BL1A 1FPUA 4RA5A 4EH6A 3PG1A 3OD6X 4Y73A 3UOHA 3FKLA 4LRMA 3UG2A 4C33A 3KMMA 4YZDA 3I0OA 4PNKA 5GIPE 1K2PA 4KD1A 5C26A 3MA6A 4M7IA 4DGMA 5FUTA 4IAFA 1WBOA 3M1SA 4X0MA 4YZMA 4BCMA 3W2OA 4GKIA 5CAQA 4MXCA 3OT8A 2OH0E 4XYFA 3QQFA 5TKDA 3UO6A 3PDTA 2ZV7A 3QZGA 5IQHA 4PPAA 2YA9A 4JNWA 3RI1A 5I5ZA 5EM5A 2OF2A 4OAUC 2J5FA 4EK4A 3Q04A 3PTGA 4XCUA 4PL4A 4EQCA 5AM7A 2F57A 2I6LA 4AGDA 3WYXA 3W10A 3EQHA 3PA4A 2W5AA 4ORKA 2VTTA 4RX9A 1OMWA 3ULZA 1NVSA 3NVMB 3FQHA 3L9NA 1Q8YA 4FIJA 4FNYA 5ANDA 3DJ6A 4AZFA 4R1YA 5E8ZA 5EI2A 5A46A 4X3FA 1OIYA 4MXAA 4AFEA 1I09A 1NVQA 3AXWA 2BAKA 2FUMA 3Q5ZA 4D55A 4G9RA 4HCVA 2VNWA 3GEQA 2QOHA 2YWVA 4ZP5A 4MNFA 3ZONA 4S34A 4MQ1A 3DK3A 5IH4A 4EORA 4FZAB 4KKGA 4CVAA 4HCUA 3BHHA 3E88A 2PPQA 3IS5A 4TYJA 5I9ZA 3TNQB 3IDBA 5GJGA 2X8EA 2J0LA 1BI8A 4IAYA 2P55A 4IAZA 5DVRA 3G0EA 4I6QA 3NUAA 3QCSA 2VO7A 3JVSA 5FXRA 2WMRA 3QQLA 3DLSA 2XIXA 2JKKA 3D5WA 3BLHA 4NM3A 5FBOA 2C0TA 1SMHA 3AC2A 3E62A 4F6WA 4U8ZA 4GUBA 4PV0A 4ZOGA 3NUPA 4G3CA 4MEDA 4O0VA 4CV8A 4YJOA 3O8TA 5J9ZA 2JD5A 3VF8A 4EH3A 1XH6A 4O0RA 4HCTA 3DQXA 4IANA 2J0MB 4F0GA 3JR1A 4MNEB 5AUWA 2BMCA 4MD8E 4W8EA 4BTMA 5HU3A 1V1KA 4QP4A 4DC2A 4I4FA 4RFZA 2WTDA 3DJ5A 4FV4A 1L3RE 4JDIA 2OJ9A 2P3GX 4IEBA 2QOBA 5ICPA 4BYJA 3MA3A 3PE1A 3PIYA 4XBUA 5L8JA 1Q8WA 4F7LA 3R9RA 4JDHA 3AOXA 2C6LA 4H36A 5AR2A 5CSWA 1MQ4A 3VS7A 5LMBA 3CD3A 1OL5A 2YIWA 2XH5A 3DDQA 4QPSA 3CSVA 1JPAA 4IMYA 2ZVAA 3FSFA 5KHWA 3ORPA 4AW0A 2QOIA 2QNJA 4AT3A 3G0FA 2VGOA 4YR8A 1REKA 4WG5A 1U4DA 2OLCA 3W2RA 4QQTA 4IXPA 5AV4A 4AGWA 1OKVA 1QPCA 1YW2A 1O6KA 5CSXA 3D2KA 5T3QA 4BCJA 4OTRA 4XG9A 5HO6A 3KRXA 1FMKA 2VWBA 2JDSA 4FV7A 5JFXA 4MX9A 4ENXA 3T3VA 2WGJA 2NRUA 3NWWA 4WOVA 3R7VA 4A7CA 3KXXA 2VX1A 4J97A 4P2KA 2YDKA 3BX5A 4ZZMA 3D5VA 4C59A 5EDQA 1WCCA 2VV9A 4GVAA 5CAUA 2VTJA 3BCEA 2OH4A 3ORKA 3DK6A 5HI2A 2IW8A 2WMWA 4CFVA 1O6LA 2YLFA 4F08A 4IAKA 4RZWA 5E8UA 2DYLA 2BDWA 3HV4A 2B9HA 1DI9A 4IIRA 2C1AA 4J8MA 4BZOA 3IOPA 3G9NA 3OCSA 4M3QA 4Z7HA 4GRBA 2ZB0A 5JFVA 5EYMA 3CQUA 2XP2A 5J8IA 4DCAA 1W82A 5AP3A 4JQEA 2P0CA 4FTRA 1YQJA 1R0PA 4AS0A 2GFCA 3Q3BA 4IVDA 4BDEA 3EQBA 1PYXA 4O2ZA 5AUZA 4ANMA 2C5VA 4MNEA 3RAKA 3TV7A 2B52A 4O7RA 4XV9A 2Z8CA 3FZSA 2VTRA 4DH3A 4CSVA 4O83A 4I0TA 4CQEA 4OTPA 3TV6A 4XMOA 2C3JA 3AT2A 2BZKB 3HMIA 3PVBA 2QOQA 3MYGA 3NX8A 2KULA 5JT2A 4ZLZA 3RPOA 2BFYA 3D4QA 2W4JA 3R1QA 5GHVA 2JKOA 4QTAA 4MQ2A 4U3ZA 5EYCA 5BYZA 3VHEA 3QTIA 4IC8A 1KE5A 3BEGA 3T9TA 1OPLA 1TQMA 3ZO3A 4C4JA 3VS5A 1H1WA 4B6LA 4A4OA 4D2WA 1OPKA 2R0IA 3D7ZA 3GB2A 5C4KA 3G5DA 4JJRA 2BFXA 3E8DA 5HE3A 1ZLTA 5FM2A 3COKA 4E7WA 1Z57A 5IF1A 1PMUA 3LLAA 4G34A 2GFSA 2WTJA 3V8SA 4RIXB 5DRBA 3FXZA 4BTKA 2DS1A 4ITJA 4RSSA 1K3AA 1Q3WA 3KXGA 3C13A 3QTRA 3R7UA 4CFNA 4EC9A 3KRRA 4R3PA 3G51A 3L8SA 4EYMA 3VBXA 3QU0A 4QQJA 4YO4A 3FYKX 5CTPA 4G5JA 5DT4A 2WTVA 4QMMA 5E1EA 1ZMVA 2CNVA 1XBCA 5DWRA 3LQ3A 3GCUA 1PXLA 4RZVA 2PUUA 3H3CA 4BDIA 5LMKA 4O91A 4FSMA 4IWOA 4Y83A 5M09A 2XK8A 3F88A 3MVMA 4TWCA 3U55A 2C6MA 2W1GA 4C4EA 3D94A 4BDKA 2QURA 5FQDC 5CS6A 4BHZA 5EW3A 2RGPA 4DG2E 5IG1A 5JQ8A 5TO8A 5H2UA 1YXVA 2XRWA 5M06A 3E63A 1T46A 4D9UA 2C6EA 3SXRA 5AJQA 1J7UA 4FKTA 3N51A 1R0EA 3KKVA 4UY9A 4CCBA 3ZM9A 1YOLA 3DCVA 3OTUA 3VS6A 3ZSHA 3E93A 4R1VA 2JIVA 1E1VA 1AD5A 2Y9QA 4KWPA 2ZMDA 4L67A 3QZHA 4FOBA 3HMOA 4BGGA 4PMSA 5ACBC 1W0XC 3ENMA 4FSYA 4ZTNA 4ERWA 4NJDA 4M67A 4V0GB 2VNYA 3RGFA 2B53A 4JL9A 4BBMA 3QF9A 1V0OA 5TF9A 5CZIA 4EHGA 1OITA 4C2VA 3A99A 4Y5HA 5CI6A 5C27A 3E8CA 2ITZA 3NR9A 3EWHA 2UVYA 3ZRLA 3FY0A 4JBVA 5HVYA 2HIWA 4EJNA 5AM6A 1P14A 3B8QA 3TKHA 4BKJA 4OLIA 5FRIA 2WMSA 3P5KA 2O2UA 1TQIA 3MH2A 5CSHA 3BHUA 3QZFA 4AE6A 1OI9A 3HP2A 3KEXA 3A7JA 3SC1A 2GDOA 5DNRA 5M08A 3DKOA 5BQ0A 4QMQA 3VIDA 2GHLA 3K3JA 2ZV9A 5AP5A 3DLZA 2DUVA 2C1BA 2ETRA 2WO6A 2X81A 3DAJA 3NUXA 3Q4CA 4I3ZA 4U42A 2EU9A 2YM8A 3HZTA 3N9XA 2ZB1A 4NJ3A 2X4ZA 4QMNA 3I5NA 4K2RA 4XRLA 1NA7A 3H4JA 4Y72A 3L8VA 5KZIA 1CM8A 1OL6A 4MF0A 2IO6A 2IVVA 2Z7LA 3UNZA 3HEGA 3LW0A 2PMIA 1WVYA 2OW3A 4H1MA 4C34A 4IM0A 4JT3A 4FK6A 4RX7A 5HD7A 3UOJA 3NIEA 5L6OA 4IVAA 3T9IA 3KF4A 4JDJA 4KABA 3GENA 3I5ZA 3LCDA 3LFFA 3UVQA 3C0GA 5LOHA 4FTUA 2YCSA 4O86A 2XIRA 4Q9ZA 1R3CA 2R3HA 4CMTA 4FF8A 4RGJA 4EJ7A 2RFNA 4JX3A 4DF3A 2AYPA 5IDPA 3VO3A 4TYHB 2JAVA 3PWDA 2DWBA 2X2KA 2UZUE 1XH7A 4TYIA 5CEKA 2YISA 3I7CA 3GC8A 4JDKA 4BTFA 2QR8A 2O8YA 4FV6A 4F7NA 2YABA 4FKLA 5KMJA 2XM9A 2XNPA 3PZEA 2HXQA 2R3RA 4HVDA 1M2RA 4D4YA 4NUSA 3DTCA 3EYHA 4EQUA 1QPEA 3U87A 2OXYA 5HICA 3R1YA 1JKLA 5BUJA 4TPTA 5JH6A 3QKLA 3DK7A 3DXNA 3LXKA 2GSFA 4IE9A 5JRSA 4AE9A 4B8MA 4JI9A 4X2GA 3I81A 2UW6A 3L1SA 2SRCA 2W5HA 4F9YA 4H3QA 4NKSA 4EOQA 4E3CA 2GTMA 2ITXA 4ACCA 2PZRA 3IW6A 3PXRA 4B8LA 4YJRA 2B0QA 1UKHA 4BBFA 5E8SA 4O38A 4GS6A 3ZZEA 2WZJA 3M2WA 2X7OA 4O96A 1YKRA 2QLUA 1WVXA 3R21A 3O50A 5DYJA 3ACKA 3FL5A 5C1QB 2R3LA 2YIXA 4W9XA 2E9OA 3NNVA 1Q61A 3DBFA 1YOMA 4HVHA 4OT5A 1LP4A 5KX8A 4NW5A 4HVGA 4BDDA 3FI8A 4EOPA 2HENA 1RE8A 4AP7A 2VX3A 2CHLA 3TIYA 4TNBA 2FSOX 4G17A 4L7FA 3U9NA 5TR6A 4NW6A 4C2WA 3WZJA 3K3IA 3LXLA 1H24A 3BWFA 4CRSA 5M57A 4D1XA 3D15A 3UQGA 2B4SB 3FUPA 5KBRA 5HG7A 4O7WA 3I0QA 4EOLA 1XQZA 3UBDA 5JFWA 3GOKA 2R7BA 4NM7A 4OTGA 5ANOA 2UW8A 4YPSA 4EHVA 1AQ1A 2GTNA 4C62A 3DU8A 2OU7A 4YHTA 4QYYA 4AOIA 3RHKA 1Y8YA 1ZZ2A 1HCLA 2GNHA 1VZOA 2ITQA 3EL8A 4D5KA 2GNLA 4YBJA 3PLAE 3CGFA 4JVGA 1F0QA 3L9PA 4PL3A 1H28A 2B1PA 1M17A 4DYMA 5A4QA 2W4KA 4DEGA 3H0ZA 2QCSA 3EHAA 2HWOA 3PXFA 4N70A 2H9VA 4PMTA 4QP6A 4DEDA 4TYHA 4DEHA 3TT0A 3BHVA 4FTTA 1RDQE 3BYVA 3GU8A 3QZIA 5H8EA 3U54A 4PP7A 2WIPA 2BRGA 3R04A 3L8PA 4MBLA 3TZMA 2IWIA 4ASEA 3AD5A 5HTIA 1JSUA 4A9YA 3BGZA 3KFAA 3IPHA 3SHEA 3A7GA 3EZVA 3PP0A 4B4LA 2Z7QA 1T45A 5ANEA 4BKZA 4X3FC 4ZY4A 3VS2A 3WZDA 4GFMA 4OTHA 1YXSA 4AOTA 2CMWA 3JUHA 1ZYJA 3MSSA 4KIKB 4UZDA 4GJ3A 4FT9A 2Y0AA 1SZMA 3UOLA 2QO2A 2Y6OA 2XNEA 4CXAA 2WKMA 3OC1A 3A61A 4DH5A 2WQMA 5K5XA 1GY3A 3SD0A 3ZC6A 1SVGA 4DFNA 4N57A 4MHAA 4F7JA 3VC4A 3QL8A 3WIKA 3K54A 3BYSA 4NL0A 1A06A 4RWJA 4H05A 4FKUA 2VX0A 2NP8A 2EWAA 4DTBA 3LPBA 4XUFA 3DA6A 1S9JA 3DKFA 3ZC5A 1Q41A 1SNUA 3D5UA 4MVFA 5HCYA 5IEVA 1G8SA 3HV3A 5H8BA 4OTDA 4ZTQA 4YGAA 4KIOA 1S9IA 3NCZA 1BKXA 4UWYA 5ANIA 5FEDA 1OL2A 3T8OA 3HGKA 3F6XA 4L44A 4GW8A 1OUKA 1OM1A 3CD8A 3MW1A 4O6LA 1E1XA 3KY2A 4L3JA 4EUUA 4UMUA 3ENHA 3GQLA 4QOXA 3KF7A 4GIHA 4FSNA 1VEBA 1PJKA 3OXIA 5EH0A 4QMTA 1VJYA 2V0DA 4C37A 5B2KA 1OIRA 3LIJA 4MCVA 2FSMX 4KSPA 5IA5A 4WUAA 3TUDA 4JRNA 5HCZA 4WIHA 4UMTA 2QR7A 3TNHA 4YJUA 1SVEA 1YHWA 2UUEA 4BBEA 4D2VA 3E8NA 2LGCA 5EHLA 3V6RA 4IM2A 3UP2A 3HV6A 5HORA 5ACKA 5DR9A 4DGOA 4LI5A 5FP5A 3DGKA 4A9TA 4FTJA 5CF5A 2XK3A 4C3PA 4EHEA 1FMOE 3LHJA 5D1JA 1WBVA 4WT6A 4J1RA 3ZRMA 1KE9A 3EN4A 3B2WA 3F3VA 2XBAA 3LZBA 4J98A 3WZEA 5ITAA 2VTMA 3P7CA 4BFMA 5IH5A 4BCNA 4CQGA 3HRBA 4KIKA 4R5SA 3ZCLA 4QMWA 1UNHA 2CGWA 5I9XA 2YACA 2OIDA 3AD4A 4LMNA 4O0TA 5ETAA 3ZS5A 3R73A 4I0RA 2QLQA 4W8DA 1PXOA 4QT1A 3B2TA 3MGYA 3PVUA 4D0XA 4C57A 2OKRA 4GCJA 1UV5A 2R3FA 2F49A 4YC8A 3MV5A 3E5AA 4IFGA 4GH2A 3O96A 4FIFA 5FXQA 4RX5A 1DAWA 3CIKA 4IZYA 5AP0A 3DPKA 1JBPE 5L6PA 2VZ6A 3F5GA 3BZ3A 2IW6A 1Q8UA 3KVXA 3QCYA 4CFUA 5EDPA 3PY1A 1YXXA 1ZRZA 2ETMA 2X9FA 4YBKA 2QODA 1J1CA 2ERZE 2EXCX 2NRYA 3MFRA 2F7ZE 4RWIA 3Q52A 1SYKA 2HY0A 2YDIA 3I60A 4UALA 4UWCA 3N4UA 4X6QC 3F3WA 3MPMA 2RFDA 4G6NA 5M4UA 4CLIA 1H00A 2WB8A 4Z55A 3V5JA 1KE8A 3FPMA 4BN1A 2OZAB 4YNEA 1TKIA 3R2BA 2ETKA 2XKCA 4DITA 1L8TA 3BV2A 3DZOA 5BUIA 4FVPA 3RALA 3IECA 2ZV8A 2CGUA 4ZIMA 3O51A 2W96B 4WKQA 4J96A 5FLFA 1H25A 5J95A 3RM6A 4BF2A 2VWIA 3CXWA 1IAJA 2CKPA 3OCGA 1Y57A 3VBVA 2XB7A 5HX8A 2VUWA 2G2IA 3NYVA 4OGRA 4U45A 5E8VA 5HTBA 4AX8A 4FOCA 4ITIA 4D4RA 2WQOA 4OUCA 4I0SA 4IAAA 4ONAA 4HZRA 4AFJA 4BCQA 1GZ8A 3ELJA 3M11A 5ANKA 5M4IA 4LV8A 2HW7A 3KRJA 4PTEA 4BYIA 1ZWSA 4O7SA 2ITOA 2OI4X 4I41A 1UNGA 1WBNA 3IDPA 5EG3A 3ZZWA 4FEXA 3EQCA 1YXUA 4M69B 3WZUA 3EIDA 4FV5A 3VBWA 4E6AA 3CE3A 5IA2A 3DXQA 3FZ1A 2VWUA 3C1XA 3MI9A 5H3QA 4XG2A 4YLKA 3ORLA 4F4PA 1A48A 3EMGA 5IEYA 4M8TA 3PA5A 4YO6A 1M2QA 2QC6A 4RJ8A 3CTQA 3UNKA 5AA8A 2VWYA 4XG7A 4DH7A 3PXZA 4F9BA 4L42A 4IADA 3TDVA 4FL3A 5JGDA 5KBQA 3EQRA 4RJ4A 2UZTA 5EW9A 2I0HA 3FMDA 4DG0E 3VVHA 3QQHA 3AGLA 4QMLA 2VO0A 4K9YA 3CJGA 5CVGA 2X1NA 3FKOA 1OZ1A 2GCDA 2ZM4A 2RG5A 4AGUA 3PPZA 4EH2A 4N6YA 5HE0A 2R3GA 5LMKC 4DT8A 4JG6A 3HECA 3TDWA 3DT1A 2RG6A 3CKWA 3QKKA 4X3FB 4OW8A 5IUGA 3QUDA 2RF9A 4BHNA 3BHTA 3HLLA 4R77A 2AUHA 4YZCA 4FL2A 1GAGA 2GNJA 3R30A 3QGYA 2F4JA 1YWVA 4FV3A 1YDSE 2OJIA 4LM5A 3TJDA 4APCA 4BDCA 4TY1A 5E9EA 3LFBA 2P2IA 3LFSA 1SVHA 3SRVA 3KK9A 1UU3A 2OXDA 1O9UA 3NCGA 2ZM1A 4YZNA 2CCHA 2EVAA 4R8QA 5AR5A 3FMNA 4QMUA 5ANJA 2BIYA 5A3XA 2QOKA 3CS9A 4MBIA 3V04A 3HA6A 5J5SA 3Q5IA 1RW8A 5GIOE 4BI2A 4C7TA 3AT3A 2VTPA 3HV5A 4ZAUA 4K8AA 3HX4A 3MJ1A 4HVSA 4F70A 5DE2A 4ZTSA 3HVCA 4F64A 3GCVA 4TNDA 3R9HA 4II5A 4HZSA 4OTIA 4TZRA 1JSTA 5M53A 3WI6A 4XG3A 1ZZLA 3EN9A 3HDNA 5EQEA 3FDNA 5FGKA 4EK3A 4M69A 5KMNA 1NY3A 1GIHA 2WTWA 3NNXA 3RTPA 3SOCA 3OW4A 5L3AA 5I9WA 2XK6A 2WELA 3IK3A 1BYGA 1JQHA 5BVWA 2EXMA 3OVVA 1FVTA 1LEZA 2CKEA 2VU3A 4FIIA 4KAOA 4C58A 4L6QA 1MRYA 2JIUA 3OZ6A 4XRJA 2C6IA 4QP1A 2QKRA 5CT7A 5C4LA 4GG7A 1QL6A 3PXKA 3AC1A 3UIXA 4CKIA 5L2SA 2WIHA 2XVDA 3C9WA 4G3FA 2WU6A 2O3PA 3R7IA 3GC9A 5AWMA 3Q9XA 4IH8A 3F5UA 4A06A 3R22A 3UZPA 4R3RA 3FLSA 4WNPA 5EKOA 4R78A 3EFJA 1RQQA 4E1ZA 2PVNA 4H3BA 4YZBA 4AN3A 3CQWA 3FMLA 5IMEA 1NW1A 3MWUA 3BI6A 3ANQA 2VAGA 3CGOA 4U81A 3MPAA 4E93A 5JQ5A 3PXYA 5DRDA 4JOAA 2PVHA 4LRJA 4WA9A 5EM7A 4F6UA 5AUTA 3WBLA 3DNDA 4UXLA 3DV3A 4YTHA 4FA2A 2XEYA 3A4PA 3D83A 4YTCA 5AV0A 4F1OA 4ZZNA 3SVVA 1QMZA 4FKVA 2UW4A 4JG7A 3GUBA 4RLKA 3Q6UA 2J0IA 2GQRA 2VTOA 2UZEA 1WMKA 1Y91A 2R3MA 4WRGA 4XHKB 5DT0A 4AW1A 4PDOA 5CVFA 2PTKA 4ANSA 4CV9A 4FT5A 4M0ZA 4M84A 3AC8A 1REJA 3D2IA 3EZRA 2GS6A 2QI8A 3H9OA 2YJRA 3OF0A 1NXKA 2PSQA 3UIMA 4MTAA 2C69A 2WEVA 3TXOA 4HVIA 4NFNA 3MVLA 5AP6A 3GQIA 2R3IA 4UV0A 5HX6A 3F82A 1MUOA 3BQRA 3VUIA 1NT2A 3QXPA 2PVFA 3ROCA 4EK6A 3II5A 2GNIA 4X7QA 1U5QA 2W9FB 3TNIA 3ULIA 1KOBA 3E87A 4ACHA 3IQ7A 5AUXA 3E64A 3MS9A 2YAKA 4GEOA 3BRBA 3VW6A 4RA4A 1OPJA 2RIOA 3NPCA 4UYNA 4EKKA 3VQHA 3PJ8A 3BKBA 3OWKA 4I24A 4XP3A 2E9VA 4AG8A 5L4QA 3PRIA 3UMWA 3PWYA 3LFCA 4A07A 1YI6A 3QLGA 3PZHA 2FA2A 4FSZA 3QQJA 5DG5A 5HNBA 2X7GA 2ESMA 3BIZA 4I5HA 5C8KA 4CKRA 4CZTA 1FQ1B 2BCJA 4YHJA 4AAAA 4FC0A 4RJ5A 3C0HA 3HMNA 4L68A 5AR3A 5AUVA 3TEIA 4BCKA 4PMPA 5IISA 2XKFA 4IAIA 4JBPA 4FUYA 3F5PA 3F7ZA 5CT0A 1LR4A 4KB8A 2XYNA 3PVWA 3W8LA 2C6KA 4J52A 5AV1A 5A9UA 4LOQA 2Z02A 3ZM4A 5IU2A 5DLSA 5L8LA 3FC1X 4IB1A 1H1RA 2YZAA 4ARKA 5I4NA 3MFUA 4ANOA 3A4OX 3QTZA 4MBJA 3FWQA 4EWHA 2H96A 5D7VA 3TJCA 3UTOA 4PTGA 3MB6A 2P4IA 2C0IA 3RNYA 4AW2A 2PVMA 4LGDA 4GL9A 3UQFA 2JDRA 4FZDB 5LCJA 5IQBA 4DFUA 3O17A 2ACXA 5IUIA 5T6KA 1KUTA 1CSNA 3NS9A 4ANQA 4G3GA 4GMYA 2Y7JA 3A8XA 3E3BX 5JZJA 1GZKA 1CMKE 3FYJX 5GZ9A 5GINE 4BCOA 4TL0A 3G15A 1AGWA 5FG8A 4GFOA 2HWPA 4IC7A 4FYOA 5H9BA 3EFLA 3RWPA 3DAKA 3RNIA 4AF3A 2YFXA 3CJFA 2Y6MA 5DA3A 4LMUA 5BPYA 2GS7A 4YU2A 5IQDA 5G1XA 4FR4A 4HGTA 4ANNA 1J7IA 2XS0A 2YCRA 4O84A 3JS2A 2X2MA 3UVRA 1XKKA 2OFVA 1WBWA 3TCPA 4G9CA 5HVKA 5KCVA 5CU3A 4CNHA 3R63A 4I92A 4XEYA 2PZ5A 2R2PA 4F7SA 5LVMA 1PY5A 3S00A 2HZNA 4OAVB 3EQDA 3BGQA 3NDMA 3ZYAA 4O7VA 2YIRA 3ODZX 3TNPC 3FY2A 4NM5A 2R3OA 5DT3A 2C4GA 3OG7A 3OT3A 4DFBA 2EB2A 4CFXA 1W84A 2WOTA 1SM2A 4Z16A 3JVRA 2ITWA 2XNBA 3W2PA 5AAFA 1ZAOA 4MXZA 5CI7A 5L6WL 3DAEA 3U4UA 5BMSA 2VWZA 5FEEA 2QVSE 4UX9A 4U9AA 4BIEA 4EOOA 4PX6A 4RT7A 3GU7A 2YM6A 3TN8A 5AAGA 3GCQA 3E7VA 5DR2A 2HZ4A 3L9MA 4QPMA 5FEQA 3QRJA 4U6RA 4FV8A 3CCNA 4FL1A 4G1WA 1WAKA 4N6ZA 3R9OA 1P2AA 3VQUA 4BGQA 2BRHA 1KE7A 4MXYA 4RC3A 3POOA 4W9WA 5EW8A 2WXVA 4C0TA 4YZ9A 3UJGA 2DQ7X 3FQEA 3CPCA 1WVWA 3HDMA 4BCGA 4MXXA 2PUIA 1PXNA 2CGVA 1GNGA 4G3DA 4IB0A 2OIBA 4NEUA 4HYUA 5HD4A 1G8AA 3EN5A 4BDAA 4S30A 5HO7A 4ERKA 1GIIA 4E4NA 4CLJA 2J50A 4K33A 2WPAA 5KNJA 3WF6A 5EM8A 1KWPA 2BDFA 1OVEA 1UU8A 2UW3A 3EKNA 3F3TA 3JY0A 4Q2AA 4UN0C 2PVKA 2H34A 3NUSA 2QHNA 3HMPA 5HG9A 3GFWA 3QKMA 5HG8A 1U46A 5KMKA 2G2HA 2VGPA 3UO4A 4U44A 2C3IB 3O8UA 4DN5A 4K18A 1IA8A 4B99A 4AZEA 4MYGA 3MB7A 2EB3A 5AR7A 5CU0A 5HGIA 3P4KA 4F0IA 4JAJA 2OJJA 3TV4A 2ITYA 3KRWA 3OP5A 2Z2WA 3LQ8A 4K6ZA 3WE4A 3P1AA 3MESA 4NU1A 4CYJA 2G01A 3P86A 2VD5A 4P7EA 1XHAA 2R4BA 5KMOA 4C3RA 4TYGA 3C4XA 3G2FA 4BR3A 3SV0A 4FG8A 3ALOA 4X21A 2YDJA 3WF5A 2XBJA 3EB0A 4CMOA 5EHYA 1ZYLA 3QRUA 1JVPP 4M0YA 2A0CX 3FV8A 3NNWA 5FBNC 4MWIA 2WMBA 4IX4A 3NUYA 3O8PA 2YLEA 3OOMA 4LRKA 2CPKE 3MN3A 5HE2A 4BGHA 3C4ZA 4BB4A 4E5AX 4S2ZA 2YCFA 3L9LA 4IX6A 4QYGA 2QQ7A 3IW8A 3RHXA 4UB7A 1VR2A 3AC3A 3OCBA 3ZFXA 3ZEPA 5EI6A 5B2LA 2F2UA 2XMYA 3F2NA 2P33A 3FI2A 1X8BA 1UKIA 4YC3A 1ZOGA 4D2PA 3W33A 2BTSA 2XF0A 1BUHA 3HP5A 3QCXA 3RK5A 2GU8A 2ZDUA 4PF4A 2ZDTA 1PYEA 3FBVA 2C5OA 5E92A 3W16A 1H26A 4JG8A 3GCSA 3QC4A 4YHFA 2W06A 4NSTA 4YNOA 5EK7A 2BRMA 4J71A 2HZ0A 1VYWA 2X9EA 3QYZA 3MY1A 3D14A 3OWJA 4TKSA 5CVHA 3A60A 5CYIA 4D5HA 3NZ0A 3QWJA 4TW9A 3V3VA 1ZY5A 2GNGA 2VN9A 4FKQA 5HLWA 2Z7SA 4EHZA 2XNOA 2Z60A 4JQ7A 3V51A 4F1MA 5GNKA 2C5YA 3BELA 4FICA 3G90X 5LVNA 1H0VA 5E8XA 3WF9A 3K2LA 5KUPA 1CKPA 1HOWA 4FBXA 4ZTLA 5JFSA 4DA5A 3TACA 5J9LA 4FI1A 4BI0A 3BPRA 5HIDA 5EKNA 4O21A 1M2PA 2WQBA 3QHRA 3GU5A 2VWVA 5G6VA 4L01A 5CF8A 5CXZA 4ACGA 5FXSA 4IJPA 2PUPA 3LCTA 4QRCA 3SAYA 3U6JA 4O7LA 4RWLA 2R3PA 4UXQA 4IM3A 4KSQA 1XH9A 3MFTA 4O1PA 5AFVA 4PWNA 4AZVA 1JKSA 2ZAZA 2XZSA 4HGSA 5B0XA 3KL8A 5I9VA 4BDHA 3RVGA 4V04A 3VJOA 4DBXA 3KRLA 1V0BA 3R7GA 4FIGA 4JS8A 4P5QA 2PVYA 5CSVA 4D2TA 2FGIA 5CALA 5HHWA 4NT4A 2W1CA 3DZQA 3W2QA 1F5QA 5CEIA 4D4VA 2QU5A 1PMNA 1ND4A 4B0GA 5C8MA 2VTSA 4O7NA 5CU4A 4EWQA 3G6HA 1OIUA 4R6VA 5EOBA 4BY9E 3PXQA 4K0YA 3A7IA 4D58A 3QQGA 4LYNA 4S31A 5HKMA 1QCFA 4LGGA 4FODA 3OEZA 1TQPA 3UIUA 3QQUA 4DHFA 2JLDA 1CDKA 1M7QA 2C6DA 3HYHA 3ZO1A 4ZSLA 3R1SA 4IB3A 4FSUA 4FTIA 3D9VA 5L8KA 3FXWA 1EH4A 2V22A 3EN7A 4APPA 3AGMA 1JKKA 2IZRA 4PDSA 3QC9A 3UE4A 4BI1A 2BVAA 3LMGA 1OBGA 3FMEA 2C5XA 4RIYA 1FOTA 4XP2A 5IH6A 2XM8A 3O23A 3R0TA 3BYOA 4N4SA 3V5WA 3Q9WA 2W5BA 3GXLA 3VJNA 4QP3A 4G3EA 4NCTA 2Q83A 4H1JA 3F2AA 3NAYA 4O7TA 4I93A 4EH4A 1UA2A 5D10A 2JEDA 2JBPA 4NWMA 3R8VA 1PXIA 4ALVA 4FKGA 4ZMFA 4GSBA 1ERKA 5HBJA 3R2YA 4DH8A 1IEPA 2BZJA 4FYNA 4J53A 3UIBA 4LOOA 4EYJA 4JQ8A 4S33A 3LCKA 3W18A 2WTIA 3FLQA 5JEBA 3NEWA 4C4FA 4E6CA 1BLXA 3S2PA 2Q0NA 2JDOA 3ZXTA 3BYUA 3O7LD 5HBHA 3CQEA 4ZTMA 5HIBA 4U7ZA 3VBYA 2G1TA 4EUTA 3TZ9A 3ANRA 2ITTA 3I6UA 2X8IA 5GJFA 3R8MA 4CCUA 5I3RA 2GQSA 5AX9A 1JWHA 3OY3A 5J7BA 5KMLA 2C68A 4O81A 5D41A 3RBWA 5HVJA 5C03A 5CAVA 5CENA 4O0SA 1KE6A 4GG5A 4YC6A 4FSWA 4LL0A 5D12A 3TNWA 3UGCA 4KRCA 4ANBA 3AMAA 3R8PA 5AMNA 5KE0A 4W4WA 3BLRA 2OFUA 5JKGA 3S3IA 4RX8A 4QP2A 5HU9A 2C6TA 1H27A 4FT0A 4AT5A 2O5KA 3P79A 4I6HA 4CZUA 4DGLC 5E90A 2A1AB 4UYAA 4BWXA 2YM4A 3PJCA 3RJCA 4YJVA 5EDRA 1OL1A 2OK1A 3R8LA 2IJMA 4IX5A 5HBEA 2C30A 3U51A 5IA3A 3NGAA 4FV2A 3LXNA 5FTQA 5LWNA 3TUCA 3C5IA 4QO9A 2HXLA 4R7IA 5E7RA 3W2CA 2W9ZB 2JDTA 3GC7A 1OIQA 3NUNA 1IAHA 2PK9A 5A4CA 4EONA 3QTUA 5E8YA 5FWKK 4HW7A 4ZJVA 4GU6A 3FZOA 1P4OA 3F3ZA 3UPZA 3C4FA 3CKXA 3F69A 4X2FA 3RZFA 4EOIA 2O64A 1ZMUA 3G6GA 4BZDA 3FLNC 3F9NA 1R39A 1Q99A 2H6DA 5IEXA 4HPTE 1M7NA
chains in the Genus database with same CATH superfamily
4I20A 3VHKA 3QRKA 4TXCA 4BCFA 1LUFA 1G3NA 2CGXA 2YIYA 3SG8A 2WD1A 3Q53A 5JRQA 2G9XA 5EI8A 3QX2A 5HIEA 3QD3A 3UYSA 3LJ1A 3QYWA 3FI4A 3ZLWA 4ALUA 5DR6A 2PY3A 5CF4A 3GBZA 5KKRC 3B8RA 2VWWA 4KIPA 3S1HA 4BVUA 2X0PA 1FINA 3H0YA 1MQBA 4FZ6A 4TRLA 4FTQA 3RPVA 3UO5A 2NNWB 1PKDA 1Q3DA 4TT7A 3RPYA 4P90A 5IDNA 4ZSGA 4TN6A 1MRVA 4RFYA 4RWKA 5IUHA 3D7TB 4N0SA 2A19B 3OS3A 4RJ3A 4F1TA 4H3PA 3OROA 4DEAA 4FTMA 5FDPA 3GCPA 3WOWA 3KA0A 5CQUA 2UZOA 3ZBXA 4AZWA 2W0JA 4GK2A 4KBAA 5CY3A 2OZOA 4FKOA 4ID7A 3GGFA 2R3JA 4FV0A 2GS2A 3TMOA 4FZ7A 4PL5A 3EKKA 2BKZA 3F3UA 5EHOA 4Z7GA 3MVJA 4E6DA 2W1IA 3QA0A 1UWHA 2W1EA 5HLPA 2R3QA 3NYOA 5I9UA 1H01A 4QTEA 4O4BB 4JR3A 5JGBA 2HELA 3TL8A 4YLJA 4FGRA 5BVKA 5HNIX 3ORNA 3R8ZA 4WUNA 4E8AA 5AADA 3OY1A 5DOSA 1Y6AA 2PMOX 5DN3A 5ANGA 4E20A 3SG9A 5E4HA 3VAPA 2GHGA 1BX6A 3AMYA 4NTSA 2PE1A 3ET7A 3C50A 4AOJA 3VRZA 4XLVA 3QA8A 4AN2A 3SLSA 3QGWA 5M51A 4FTCA 5BX0A 2YJSA 3SRVB 3O2MA 3ID6C 3UPXA 5B7VA 4HYIA 2HK5A 3R83A 5IPJA 1H0WA 5LQFA 2BHHA 2F2CB 4PDYA 2B55A 3NLBA 1YHSA 3IG7A 4UZHA 1W7HA 3KREA 4Y46A 3KULA 4X6RA 2W1ZA 3LCSA 2PVJA 2XEZA 2XCHA 2J51A 3DBEA 4Q9SA 4RLLA 3PRFA 4FSQA 4AN9A 4CTBA 3DFCB 1U54B 4KS8A 3ZUVA 4TTHB 5L2TA 2QKWB 2WHBA 5HEZA 5T68A 4Y5QA 3OCTA 3ZDUA 4ITHA 4ZK5A 4U80A 2KTYA 3RP9A 3DQWA 2IG7A 2QD9A 3LXPA 3LM5A 5IQAA 4FRFA 2PMLX 3HUBA 3NW6A 3R01A 3R8UA 2V55A 2XCKA 4WNOA 4X2NA 1H1SA 2IVTA 3R02A 2IW9A 2FB8A 5HE1A 2BROA 4ZSAA 2A4LA 4QMOA 4IZ7A 3D7TA 3M42A 5LVLA 5AIKA 5GJDA 3NYNA 5I9YA 4YSJA 4FVQA 2PWLA 5HZNA 2CSNA 2YIQA 2XNGA 3PE2A 4L9IA 2ERKA 4YUQA 3F2RA 3A62A 3ZBFA 1WZYA 3LM0A 4B9DA 4XV2A 2R0UA 1WBSA 3WILA 3V6SA 3EOCA 3E7OA 3K5UA 1QPJA 4CT2A 3MDYA 3PJ1A 2UZNA 1Y6BA 3PLSA 2WMVA 1IA9A 2AC5A 2X4FA 2H8HA 3OUNB 3PJ2A 1DS5A 2JFMA 4KBCA 4XNEA 4EH7A 1I44A 2BKKA 3ZUUA 4GIIA 2J9MA 3QTXA 4WNKA 3PPKA 4EKLA 1B39A 2GHMA 5EQYA 3OBGA 3EQIA 4TWNA 4I21A 4RJ7A 2C5NA 3CTJA 5AV3A 3HAMA 5AR8A 4CKJA 2QOFA 4K1BA 4CFWA 2XK9A 4AXDA 3UNJA 4DAWA 4DEBA 4GVJA 2WQNA 3W32A 3HV7A 5IA4A 3FMJA 3HKOA 5DHJA 3LFEA 4I6FA 5JN2A 3F7WA 3P0MA 4MD7E 4EZ5A 3ERKA 3HL7A 1M14A 3C4WA 4DEEA 3VS1A 3N4TA 4NH1A 2X8DA 4HJOA 4DGNA 4G5PA 3ZRKA 4AXAA 3Q2MA 3OXZA 3AT4A 3MVHA 2QG5A 1UWJA 4GUEA 2GPHA 2B9JA 4FIEA 4LL5A 5CEQA 3REPA 4A4LA 3W8QA 4UMPA 3UYTA 4PP9A 1U54A 3OWLA 4I6LA 4L53A 3MFSA 1IRKA 5HCXA 3BEAA 3QHWA 4YJTA 4NK9A 4ZMEA 1JOWB 3MPTA 5I3OA 3ZFYA 4KBKA 3S4QA 2UW9A 3KB7A 1FVVA 4O4CA 5AA9A 2XKDA 3V8WA 5EQPA 3UDZA 1E9HA 4MAOA 4AZSA 2CNUA 3R1NA 4EL9A 3PUFC 4J95A 3SXSA 5JZNA 4DDIA 1YDTE 2A27A 2FSLX 2VTAA 4EBWA 3RWQA 2VTIA 5HG5A 1A9UA 5J1WA 3JYAA 2OF4A 3Q60A 1B38A 2E9PA 2QG7A 3DB6A 3PVGA 3IDCA 3VULA 3A7HA 3FLZA 4LV5A 2IZSA 4OTQA 4O7ZA 5GZ8A 4ZY6A 1ST0A 1RJBA 3CPBA 3FMMA 4YURA 3THBA 3QTWA 5F1ZA 2FYSA 3KGAA 4H58A 3V5PA 5BVFA 3LKMA 1DM2A 5KMIA 3SDJA 3HMMA 2R3NA 2YAAA 5KKRB 4YMJA 3BGPA 3ZLSA 4Z3VA 1SNXA 3ML1A 2OSCA 5IA1A 1OKYA 3QD4A 3T3UA 2B7AA 3CR0A 2V7OA 5M4CA 3FSKA 2HCKA 4I5CA 3TKIA 2E9UA 3TTIA 5LVOA 3DBCA 4D1ZA 4DT9A 1ST4A 2UVZA 5E91A 1CTPE 4L46A 3BQCA 4D0WA 3DY7A 3O71A 4FNZA 3BHYA 1Q24A 2CLXA 3GI3A 3IONA 1GZNA 3PYYA 3QQKA 4L43A 4BCHA 5A54A 4DTAA 2FO0A 1VYZA 2UW7A 4PPBA 3K5VA 1IASA 2W4OA 4OTWA 4PDPA 1BL6A 4RIWA 1BI7A 3H9FA 3RCJA 5BMMA 3WZKA 3ZLYA 2J6MA 1W83A 2WAJA 4I4EA 2B54A 3JXWA 4NYEA 4RVMA 4XBRA 2FVDA 2VO3A 4DG3E 3MIAA 3EJ1A 3KVWA 2QHMA 2IZTA 3PUPA 4O2PA 2YN8A 4U5JA 5BVDA 5BYYA 5IQCA 3NVKI 5DMZA 1ZARA 1XH8A 2PVLA 3QUEA 4IHPA 3PY3A 2YITA 2HW6A 5CAPA 2F7EE 3VN9A 3EFKA 2Y4IC 3NUUA 4BDFA 4E5BA 4PRJA 4ZS4A 4FKRA 4R7HA 2WMAA 4C8BA 3V5QA 4A9RA 4BCIA 2IVSA 5LXMA 3QBNA 4DLJA 4XOZA 2G2FA 2BRNA 2ZJWA 3OMVA 1ZOHA 2GMXA 2W1HA 4WSQA 4HNFA 4X2KA 2X39A 4U3YA 3EL7A 4FTLA 2BHEA 3RAIA 4CFFA 4D2RA 2ZV2A 5AUUA 2QO9A 5BVOA 1R78A 4HPUE 4KKEA 4L3PA 1G8KA 3W0RA 3I6WA 5ETCA 3SKCA 1U59A 5CQWA 3TTJA 4ACDA 3RAWA 3TI1A 2V7AA 5LWMA 4FX3A 2CNQA 2WEIA 4Y8DA 4P4CA 2YHVA 4M97A 4EEVA 4E26A 1ATPE 3KU2A 4F9AA 4FTAA 2PE0A 4JBOA 3LMHA 4NCTC 3A8WA 4DH1A 3GVUA 1FGIA 5HTCA 3U6HA 2AC3A 4WNMA 2HZIA 2QONA 3ZMMA 4JX7A 4C4GA 4LQMA 4KRDA 3GU6A 4LOPA 4O0YA 3UC4A 3FE3A 4QP8A 3PY0A 4S32A 2R3KA 4TYEA 3VS4A 4L00A 2W05A 2PYWA 1PW2A 3EFWA 4MD9E 4QQ5A 4KKHA 4MF1A 1PXJA 5DBXA 3ZOSA 1Q62A 4EK5A 3BU3A 1PKGA 2YERA 1YOJA 4EZ3A 2J2IB 2ONLC 3NIZA 2ZM3A 4CD0A 3FC2A 3F66A 2Y8OA 4C3FA 4IB5A 4IACA 1PXKA 2O65A 3Q4ZA 4I5PA 4DGGA 4GYIA 4QYHA 4XG8A 4BDGA 4E73A 3NFFB 2JGZA 2WOUA 3MH3A 4XX9A 2QOCA 4BIDA 4DBXA 2J0JA 5DEWA 4XS2A 2IN6A 2XIKA 1F3MC 4R3CA 5LJJA 2W1FA 1MP8A 1H08A 1IR3A 4CGAA 2WU7A 4FNXA 5CX9A 2ITUA 2ZYBA 4PUZA 1JSVA 3GP0A 5H8GA 3MBLA 3UVPA 4IVCA 2YZLA 2R9SA 2I1MA 5IQEA 3UZTA 4IWDA 4RVLA 3VW8A 2J4ZA 3MJ2A 1PXMA 4FKJA 2OBJA 5F20A 3Q4UA 4NFMA 3DDPA 1KV1A 2Q0BA 2YEXA 1YHVA 5JMSA 3SA0A 2UZDA 5HESA 5ETFA 3RM7A 1O6YA 3ZFMA 4BDBA 3R9DA 2CN8A 3P23A 4DTKA 3TG1A 4WG3A 3GOPA 3MH0A 4CG8A 3LFAA 4IFCA 4OR5A 4XH6A 1P5EA 2OIQA 2P2HA 3LVPA 4JBQA 4M68A 2I7QA 3TM0A 4CFMA 4RC2A 1YI4A 5J9YA 4NTTA 5AEPA 4GV1A 3LFDA 3P5JC 3POZA 4AT4A 3W1FA 1XWSA 5KHXA 4CT1A 4G6OA 3O5AA 4J7BA 4ALWA 4DBNA 4C4IA 3ITZA 4FEQA 4QMPA 3UDBA 1H1QA 4RJ6A 5KMMA 3HRCA 1MRUA 3H30A 1PMEA 4QDEA 4K77A 3AD6A 2W7XA 4ZLOA 3W0PA 2VTNA 4R5YA 5AX3A 2X0GA 4UMQA 1JKTA 2QU6A 4PMMA 4O4EA 1B6CB 1Z5MA 3TKUA 1OECA 2B9FA 3NW5A 3R6XA 2CN5A 1XH5A 2FH9A 4HNIA 4QYEA 4BZNA 3VS0A 5IQIA 3WYYA 2CKQA 3QXOA 2A2AA 2BAJA 3RK9A 3FZRA 4O27B 3ZO4A 4FSTA 3CY3A 2UZLA 4ZZOA 4AUAA 3C7QA 5CSPA 1YWNA 3ZHPC 4J8NA 3I79A 3LMIA 2I40A 4G6LA 2QO7A 4IX3A 3DB8A 5TOZA 4EZ7A 3ACJA 4ZEGA 1Q97A 3A2CA 4CRLA 3LQ5A 1YDRE 3QFVA 2RSVA 4FUXA 2OWBA 4FT3A 3WF8A 4QTBA 4TWPA 4NIFB 5BUEA 4JAIA 3UOKA 2PVRA 1OL7A 4AW5A 5BNJA 4IVBA 5BVNA 4ASDA 3G33A 2JFLA 3NNUA 3EN6A 3FQSA 4ASZA 1KSWA 5D9HA 1STCE 4BTJA 4O1OA 4F63A 4RC4A 2VWXA 4CYIA 4ANLA 2QOOA 5DGZA 1M52A 4O82A 3ATSA 3IGGA 3C4CA 3PIXA 4D28A 1H4LA 2I0VA 2JBOA 4QP7A 5KO1A 3SQQA 3F5XA 3JPVA 4GT4A 3BE9A 3KXMA 4O0XA 3AC4A 4PNIA 4HGEA 3RCDA 1ZYSA 3WE8A 4D9TA 1UU7A 2EUFB 3FKNA 3IW5A 4GYGA 4AWIA 4AU8A 4DFZE 1J7LA 4LUDA 1FBNA 3VS3A 3FAAA 3ORMA 3VUMA 1DI8A 3UODA 4DFYA 4CTCA 4FT7A 3OOGA 4U41A 1J1BA 4I94A 1YVJA 2YCQA 3KXHA 3OBJA 3PG3A 3SOAA 2GQGA 3BWJA 4FTNA 2Y4IB 4F65A 2BIKB 4XG6A 4QMXA 4KA3A 4Y85A 3ZDIA 5HLNA 4MUQA 1LEWA 1G8JA 4U40A 3ALNA 4F9WA 5DI1A 3ORTA 3R7EA 3Q9ZA 5K5NA 4Y95A 2C0OA 4O0WA 4ASXA 3LAUA 3U4WA 3P08A 4Z9LA 5CWZA 5IZFA 4G2FA 4IWPA 2CCIA 4FKWA 4FV9A 3W2SA 4YJNA 4DLIA 2JAMA 2JKQA 2BILB 2E9NA 4CMUA 4ZSJA 2XUUA 4JR7A 2IVUA 3AQVA 3VBQA 4FK3A 3U8WA 4RIYB 3I1AA 1Z9XA 3R7YA 2X6DA 4V05A 4MK0A 2WQEA 3FI3A 2QOLA 3V8TA 4R7BA 5E8WA 2I0EA 1CKJA 3HA8A 4D2SA 3GC0A 2HY81 2Z7RA 4BRXA 3CC6A 4OTFA 5TT7A 3UP7A 4DFXE 3OTVA 4PPCA 5FP6A 4YPDA 3CP9A 4QP9A 2UV2A 4AA0A 1GOLA 4K11A 4RIXA 5I0BA 1JNKA 3RMFA 1H8FA 1XO2B 2YM5A 4GFGA 5C9CA 3DNEA 4FTKA 4NIFA 3U6IA 3RPSA 1FVRA 1Q4LA 3CTHA 3VF9A 4O0UA 5DH3A 5K9IA 5AUYA 4XG4A 4P5ZA 1ZXEA 3I7BA 4W4VA 4QMSA 3TZ7A 3S95A 3COMA 4FIHA 4O6EA 4RVTA 5F4NA 1PHKA 4YJSA 4HGLA 5L2IA 5M55A 4BCPA 5CF6A 3ZLXA 2XA4A 5DFPA 5EYDA 1OGUA 2WTKC 4EOSA 2ZMCA 3UZRA 1R1WA 3Q96A 2BAQA 3KCFA 3L8XA 3PSDA 3FMKA 3Q6WA 5DIAA 4AGCA 4F9CA 3COIA 3HNGA 3PPJA 4WD5A 2V62A 5ETIA 4C61A 2UZVA 3V5LA 1J3HA 3C4EA 3GNIB 2CLQA 2XAOA 3FMHA 4YLLA 5CU2A 4YTIA 4UMRA 5D7AA 1P4FA 1Q8TA 5AP7A 2NPQA 2Y4PA 5BV3A 2PZIA 1UNLA 2BR1A 5EM6A 2X2LA 3IKAA 4ZS0A 2IZUA 4BIBA 5GZAA 3BYMA 4V0GA 5JSMA 4J99A 5CLPA 3LE6A 1U5RA 4BWKA 3H9RA 1BMKA 2WMTA 5JK3A 2ITPA 4FEUA 1KOAA 4F99A 3ATTA 4NKAA 1WFCA 4USDA 3R9NA 1BL7A 5AV2A 4A9SA 4DFLA 4Q5HA 3DS6A 5J79A 3BU5A 3ODYX 3PIZA 2LAVA 5M44A 1UVRA 4FTOA 4W4XA 4O22A 4QTDA 1NVRA 5M07A 4M13A 1W8CA 3MTLA 4RFMA 4GT3A 3SW4A 5AIRA 4DE4A 1W2CA 4QMYA 2CJMA 4IJ9A 2NO3A 2RFEA 2RL5A 4EH8A 3QLFA 3PA3A 4IDVA 5A6OA 5CANA 3CLYA 5EYKA 2XYUA 4I22A 3E3PA 4HYSA 3ZSGA 3Q2JA 4L52A 4ZXTA 2REIA 4M15A 3SXFA 2XJ0A 1Y8GA 2UZWE 3F61A 2WNTA 4FVRA 2C3LA 3S0OA 3V01A 4H39A 4QQCA 4FG7A 4IW0A 2VTHA 1PMVA 4E4XA 4JIKA 5BVEA 4USEA 2W99B 4BICA 3LJ2A 3RAHA 2JDVA 3KXNA 3UG1A 1OUYA 4WO5A 3SX9A 3Q9YA 3R00A 2F7XE 4M14A 4U43A 4EI4A 5K4JA 1URCA 3PFYA 1XR1A 3PJ3A 2ONLA 4BKYA 2J0KA 3ROYA 4C36A 5FD2A 4LG4A 3TUBA 2W17A 3LFNA 4I23A 4WHZA 3DJ7A 2J5EA 4HYHA 4I5MA 4EQMA 3FLWA 3KK8A 1LPUA 3FLYA 3DBQA 5F94A 3VUDA 3AKLA 4IWQA 2FSTX 4YP8A 3GU4A 3KC3A 3HRFA 5K4IA 3GT8A 4ZTHA 4AACA 4DINA 3D5XA 1FGKA 3ORXA 4LV7A 2XIYA 4F0FA 5FTOA 4W4YA 1YWRA 4TWOA 2BZHB 5HQ0A 1OBDA 4LFIA 3EQFA 3AC5A 5CASA 1OKWA 4G16A 4XV1A 3C51A 2JIIA 4QMZA 5LARA 2PMNX 3ZUTA 1V0PA 2E2BA 2WMQA 3KCKA 3C0IA 3CBLA 3CEKA 3PP1A 3DOGA 1OKZA 3G9LX 2YM7A 3QTQA 1G5SA 2BUJA 4CZYB 4QMVA 3LLTA 4XV3A 2HYYA 3BV3A 2WTCA 4FV1A 4I1ZA 5CNOA 3LOKA 2BZIB 1PF8A 4USFA 1PXPA 3O0GA 3DKCA 3NYXA 3ORZA 4PY1A 4L45A 2PUNA 4EOJA 4ZY5A 5E8TA 2EXEA 4PTCA 3E8EA 3SGCA 3EQPA 5L2WA 5B2MA 3MIYA 4OBPA 4FNWA 2X6EA 2I0YA 3KULB 2OJGA 3KMWA 5IKWA 3ETAA 4NZWB 1URWA 4KUJA 4U79A 3C5UA 5HOAA 1HCKA 4IDTA 1ZYDA 2BTRA 5C8NA 1PRYA 3QALE 4IZAA 1YI3A 4D4SA 3IO7A 4F6SA 2J90A 3IGOA 1WBPA 3TIZA 3UDTA 4KS7A 3ZTXA 1ZMWA 4ZJIA 3QD0A 3FPQA 3COHA 2ITNA 5FDXA 2JC6A 5J7HA 4LGHA 4FEVA 3BLAA 4LUEA 3VUGA 4EH9A 4GU9A 3R28A 1JLUE 2CDZA 4JRVA 5E1SA 5AP4A 5CEOA 4ZJJA 3UMXA 5IA0A 2UW0A 4FKPA 4I6BA 3RK7A 2PL0A 3BL9A 4WG4A 2OJFE 2C6OA 5K3YA 1H07A 1OB3A 2VTQA 3OWPA 4AA4A 1ZY4A 3PSCA 4JXFA 3VUKA 3UQCA 4FE2A 4YJPA 4MXOA 4L7SA 4EK8A 4YSMA 5HNGA 4OBQA 3QUPA 3ZEWA 2WMXA 4ZTRA 4RQKA 3Q4TA 4JLCA 3LFQA 4D1SA 1GZOA 4ZLYA 5CEMA 4MH7A 2X7FA 4MKCA 4RPVA 1ZYCA 3KQ7A 3KIOC 4RIOA 3P7AA 5EFQA 3H10A 4ENYA 5A4TA 4EOMA 4JIAA 3FL4A 4GT5A 4RMZA 2JITA 2UW5A 3P7BA 4RRVA 5CZHA 5HO8A 3PSBA 3QCQA 2C3KA 4KNBA 3LCOA 4QTCA 4BDJA 2XANA 3Q32A 3ZSIA 2RFSA 5CAOA 2WTKB 3WIGA 3DFAA 3BE2A 3HAVA 5BYLA 4RVKA 3EH9A 2XIZA 2XK7A 3VBTA 4AA5A 5FTGA 2YWPA 5LCKA 3OXTA 1ZOEA 4QYFA 2UVXA 2XJ2A 4C02A 3DBDA 3RPRA 3W55A 4WBOA 3OEFX 3FHIA 3OHTA 3VUHA 3ZH8A 4L3LA 2XK4A 4RBLA 4IBMA 4XP0A 2GNFA 2W1DA 4QNYA 2VRXA 2HOGA 3LJ0A 4EC8A 3QRTA 2PE2A 4G31A 4V01A 4UWBA 5DPVA 4ACMA 4FG9A 3BBWA 5CNNA 4DEIA 4YTFA 2UZBA 2XNMA 4AZTA 4EBVA 4E4MA 4UEUA 2PHKA 3D0EA 4M12A 2YM3A 3VNTA 1APME 3HUCA 4KINA 4A9UA 3BLQA 4KIQA 5IQFA 5DEYA 4GK3A 4RG0A 3CY2A 3BU6A 4WRSA 3FHRA 4CEGA 1YXTA 4CG9A 4IQ6A 5AP1A 3R7OA 2ITVA 4GJ2A 4FKIA 3OFMA 5J87A 4IZ5A 2OO8X 2C47A 1Q8ZA 4FMQA 4A4XA 1XBAA 3FEGA 4L8MA 2XRUA 1JAMA 3MY0A 3O7LB 4C4HA 5F9EA 5IMXA 2IPXA 5M4FA 4RQVA 3R71A 5J1VA 3P78A 5IQGA 5K0KA 5CU6A 3ORIA 4WSYA 3DXPA 2O0UA 2OG8A 2RKUA 4E5WA 2OXXA 3TWJA 4ZSEA 4FZFB 4AQCA 2VTLA 3QAME 5JGAA 3P9JA 4QD6A 4FKSA 5AR4A 5TE0A 2PU8A 4F09A 4DCEA 4X3JA 5D11A 3QWKA 3NMUF 4XOYA 5F95A 3U9CA 2R7IA 4GK4A 5L2QA 2PZYA 5A4EA 1XH4A 5CEPA 1QPDA 4FGBA 3A7FA 4C35A 3OUKA 3FXXA 5C01A 1UU9A 2OICA 4Q5EA 5KZ0A 2O63A 2XNNA 4YJQA 4HOKA 3BBTB 3V5TA 1XBBA 3FZTA 3RINA 3ZO2A 4XLIA 2BDJA 3UC3A 3QD2B 3ZU7A 4BC6A 3IW4A 1TVOA 3KMUA 3TZ8A 2BALA 5K0XA 3AG9A 2PZPA 1TZDA 4B7TA 4FEWA 4O7YA 5LVPA 4QNAA 1H1PA 2VO6A 3KXZA 1CKIA 4XJ0A 4E6QA 5FM3A 2IF8A 1IG1A 2R64A 4RIWB 3QX4A 2PULA 1YRPA 3WARA 5A6NA 2OGVA 3VWAA 2JKMA 4X2JA 5A14A 4EOKA 3N4VA 3OW3A 3KN5A 3MTFA 4OT6A 3PFQA 3MH1A 1DAYA 3SW7A 2V5QA 3NSZA 3E92A 2X0QA 3NW7A 4E4LA 4QPAA 3QTSA 3VUTA 5A4LA 2F9GA 4NM0A 4M66A 2CKOA 1J91A 5J5TA 2WFYA 2B9IA 2XKEA 3WF7A 3I4BA 5M56A 3FZPA 3GFEA 3RKBA 5CXHA 2OZAA 4C38A 1Q5KA 1W98A 2BRBA 2WMUA 4EH5A 1TFFA 2ZOQA 3EYGA 4WBBB 2BPMA 1GJOA 3AMBA 4U97A 2J7TA 2XJ1A 3DKGA 3JY9A 3EQGA 5AAEA 4FSRA 3W0QA 1XJDA 1K9AA 1KV2A 3IOKA 2R5TA 5LMAA 4U0IA 4PQNA 3RZBA 2HAKA 3NAXA 3NRMA 5EOLA 4MWHA 3IW7A 4BWPA 3FJQE 4GKHA 4UBAA 2G15A 4OBOA 3QRIA 3DTWA 1WBTA 5AP2A 3ZXZA 3MY5A 1GIJA 3VRYA 3KN6A 4BL1A 1FPUA 4RA5A 4LDTA 1W2DA 4EH6A 1XMLA 3PG1A 3OD6X 4Y73A 3UOHA 3FKLA 4LRMA 3UG2A 4C33A 3KMMA 4YZDA 3I0OA 4PNKA 5GIPE 1K2PA 4KD1A 5C26A 3MA6A 4M7IA 4DGMA 5FUTA 4IAFA 1WBOA 3M1SA 4X0MA 4YZMA 4BCMA 3W2OA 4GKIA 5CAQA 4MXCA 3OT8A 2OH0E 4XYFA 3QQFA 5TKDA 3UO6A 3PDTA 2ZV7A 3QZGA 5IQHA 4PPAA 2YA9A 4JNWA 3RI1A 5I5ZA 5EM5A 2OF2A 4OAUC 2J5FA 4EK4A 3Q04A 3PTGA 4XCUA 4PL4A 4EQCA 5AM7A 2F57A 2I6LA 4AGDA 3WYXA 3W10A 3EQHA 3PA4A 2W5AA 4ORKA 2VTTA 4RX9A 1OMWA 3ULZA 1NVSA 3NVMB 3FQHA 3L9NA 3NFGB 1Q8YA 4FIJA 4FNYA 5ANDA 3DJ6A 4AZFA 4R1YA 5E8ZA 5EI2A 5A46A 4X3FA 4BJJB 1OIYA 4MXAA 4AFEA 1I09A 1NVQA 3AXWA 2BAKA 2FUMA 3Q5ZA 3UDSA 4D55A 4G9RA 4HCVA 2VNWA 3GEQA 2QOHA 2YWVA 4ZP5A 4MNFA 3ZONA 4S34A 4MQ1A 3DK3A 5IH4A 4EORA 4FZAB 4KKGA 4CVAA 4HCUA 3BHHA 3E88A 2PPQA 3IS5A 4TYJA 5I9ZA 3TNQB 3IDBA 5GJGA 2X8EA 2J0LA 1BI8A 4IAYA 2P55A 4IAZA 5DVRA 3G0EA 4I6QA 3NUAA 3QCSA 2VO7A 3JVSA 5FXRA 2WMRA 3QQLA 4FJVA 3DLSA 2XIXA 2JKKA 3D5WA 3BLHA 4NM3A 5FBOA 2C0TA 1SMHA 3AC2A 3E62A 4F6WA 4U8ZA 4GUBA 4PV0A 4ZOGA 3NUPA 4G3CA 4MEDA 4O0VA 4CV8A 4YJOA 3O8TA 5J9ZA 2JD5A 3VF8A 4EH3A 1XH6A 4O0RA 4HCTA 3DQXA 4IANA 2J0MB 4F0GA 3JR1A 4MNEB 5AUWA 2BMCA 2X0OA 4MD8E 4W8EA 4BTMA 5HU3A 1V1KA 4QP4A 4DC2A 4I4FA 4RFZA 2WTDA 3DJ5A 4FV4A 1L3RE 4JDIA 2OJ9A 2P3GX 4IEBA 2QOBA 5ICPA 4BYJA 3MA3A 3PE1A 3PIYA 4XBUA 5L8JA 1Q8WA 4F7LA 3R9RA 4JDHA 3AOXA 2C6LA 4H36A 5AR2A 5CSWA 1MQ4A 3VS7A 5LMBA 3CD3A 1OL5A 2YIWA 2XH5A 3DDQA 4QPSA 3CSVA 1JPAA 4IMYA 2ZVAA 3FSFA 5KHWA 3ORPA 4AW0A 2QOIA 2QNJA 4AT3A 3G0FA 2VGOA 4YR8A 1REKA 4WG5A 1U4DA 2OLCA 3W2RA 4QQTA 4BJJA 4IXPA 5AV4A 4AGWA 1OKVA 1QPCA 1YW2A 1O6KA 5CSXA 3D2KA 5T3QA 4BCJA 4OTRA 4XG9A 5HO6A 3KRXA 1FMKA 2VWBA 2JDSA 4FV7A 5JFXA 4MX9A 4ENXA 3T3VA 2WGJA 2NRUA 3NWWA 4WOVA 3R7VA 4A7CA 3KXXA 2VX1A 4J97A 4P2KA 2YDKA 3BX5A 4ZZMA 3D5VA 4C59A 5EDQA 1WCCA 2VV9A 4GVAA 5CAUA 2VTJA 3BCEA 2OH4A 3ORKA 3DK6A 5HI2A 2IW8A 3W0NA 2WMWA 4CFVA 1O6LA 2YLFA 4F08A 4IAKA 4RZWA 5E8UA 2DYLA 2BDWA 3HV4A 2B9HA 1DI9A 4IIRA 2C1AA 4J8MA 4BZOA 3IOPA 3G9NA 3OCSA 4M3QA 4Z7HA 4GRBA 2ZB0A 5JFVA 5EYMA 3CQUA 2XP2A 5J8IA 4DCAA 1W82A 5AP3A 4JQEA 2P0CA 4FTRA 1YQJA 1R0PA 4AS0A 2GFCA 3Q3BA 4IVDA 4BDEA 3EQBA 1PYXA 4O2ZA 5AUZA 4ANMA 2C5VA 4MNEA 3RAKA 3TV7A 2B52A 4O7RA 4XV9A 2Z8CA 3FZSA