5AM7A

Fgfr1 mutant with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
307
structure length
294
Chain Sequence
AGVSEYELPEDPRWELPRDRLVLGKPLGEGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIMEYASKGNLREYLQARRPPGPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBROBLAST GROWTH FACTOR RECEPTOR 1
publication title The Effect of Mutations on Drug Sensitivity and Kinase Activity of Fibroblast Growth Factor Receptors: A Combined Experimental and Theoretical Study
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 294
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5am7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5am7A01
4GG5A 4CFFA 5EDQA 3HAVA 2WO6A 4EBVA 3I0OA 4QMWA 2PWLA 3MB6A 4RA5A 5HO8A 3UMWA 3ZBXA 2IWIA 4BIDA 4B99A 4D2RA 2E9UA 1IEPA 4E6CA 4PDSA 4LRMA 3WZDA 5IEYA 3O0GA 2QOBA 5DLSA 4KINA 3WZEA 5TR6A 1FMKA 4PMMA 3HL7A 5J7HA 2IO6A 4I3ZA 4BCHA 3A4PA 4N0SA 2OZAA 4AOTA 5LMBA 4IVBA 4IAFA 4GKHA 4R7IA 3QQHA 2EVAA 3MPTA 5M56A 4IX3A 4MBLA 5ANEA 3H3CA 2OIQA 5ETFA 3CPCA 4CZYB 1QL6A 1H1RA 1OUYA 3D2KA 2XNGA 2GQGA 3HV4A 3R8VA 5BPYA 2CGXA 1H4LA 4FT7A 3F9NA 1BX6A 3A61A 4U5JA 1S9IA 3RALA 1XQZA 5I5ZA 4O86A 5AUZA 5CTPA 4EJNA 3CEKA 3MS9A 5LXMA 4IM3A 3RCDA 3A2CA 2B4SB 4C02A 2W1CA 3U9NA 4BHZA 3KRRA 4B8LA 4QQCA 4C4IA 2BRBA 4IWPA 3IDCA 3TN8A 2OJ9A 4BY9E 2JGZA 3HV3A 1MRUA 1WVWA 4IVCA 4RC2A 2G9XA 4N6YA 4DG2E 5J9YA 2O0UA 3FXXA 1KE9A 4O0WA 5J95A 4D2VA 4QTCA 5H8BA 2VWUA 3R7YA 1IA9A 5IA1A 3SV0A 4ACDA 4JDJA 4BCGA 1AD5A 3GNIB 2W06A 4B7TA 1OKVA 3TNHA 4BGGA 4G31A 2YIWA 1O9UA 3NZ0A 3ZLSA 3R8UA 2I0VA 3ORXA 3VF9A 5KZ0A 1B6CB 1PXKA 3BYSA 3EFKA 5DPVA 1URCA 4FSMA 4BDIA 3D15A 3QQGA 3GCSA 5D10A 4M7IA 5C26A 4ZZNA 4LL5A 4O0TA 2PVJA 3MIAA 5FDPA 3LXPA 3EQPA 3VAPA 4NEUA 1PW2A 5IUHA 3QXOA 4QOXA 3MWUA 4KNBA 5E92A 3ZONA 2IZUA 4PPBA 3RHKA 4BIBA 4DG0E 3FLWA 3Q60A 4BWKA 4D9UA 1JAMA 1PKGA 3TUDA 2YN8A 3A60A 2ZM3A 4YLKA 2BMCA 5A4LA 3SVVA 3DFCB 5JFXA 2RG6A 2WTWA 2OXXA 3PJCA 4Y83A 5HI2A 3REPA 3RAWA 4FG9A 3KMUA 1ZXEA 2OJJA 4I6BA 4USFA 5AUUA 3QBNA 4FTNA 5JGAA 4DCEA 2QO2A 4EH8A 5HNIX 2JKMA 2XK4A 5LWNA 2IW9A 5DOSA 5IQHA 4BWPA 3AD6A 3E3BX 5HTIA 2R7BA 1SNUA 1PXPA 3GQLA 4BC6A 4JG7A 2X81A 2HZ0A 2C3IB 2UW6A 3UVQA 3ZH8A 3DKOA 4YURA 4R8QA 4ZS0A 4QMMA 3DFAA 1YI4A 3QTZA 3ZC6A 5FTGA 3AC1A 4E6DA 3CKWA 3E8EA 4I6FA 4MTAA 3C5IA 3GC9A 4QQJA 4OTHA 4ACGA 4D5HA 4FKWA 3NX8A 4DBXA 1ZYDA 2XMYA 3WF6A 3QUEA 3F3WA 5DIAA 3FC1X 5ETCA 4DH5A 1DI9A 3PSCA 3RP9A 2JIUA 2PVKA 4BVUA 3PG3A 5A3XA 5AIRA 1VJYA 4LG4A 3O50A 3DNEA 5IQCA 1XR1A 2QOLA 2XK7A 4GYIA 3QTQA 5CVHA 3AC8A 2R0IA 2PPQA 3TTIA 4BDEA 2I6LA 3MA6A 3R21A 3R22A 2P4IA 1OPLA 3V5TA 5A54A 2G2IA 3T9IA 5CAVA 1OECA 3MGYA 3P86A 3MPAA 4U7ZA 3SX9A 1B38A 3UODA 1RQQA 3Q4ZA 2HOGA 3W2SA 4C61A 2W9FB 3QQLA 4A06A 1Q8UA 4FIJA 4GUBA 4AZSA 4XV2A 2FO0A 1RDQE 2HIWA 4XBRA 2CDZA 5L8JA 4JX3A 4NIFA 4L53A 4JBPA 3IW7A 2IZSA 1PF8A 4QYFA 4CKRA 4ZTLA 2PVYA 2GQSA 5AM6A 4BKZA 3TKHA 3COHA 4OTDA 5IMXA 2VX1A 2VTLA 2XK6A 3QKMA 3OC1A 4JIAA 4U9AA 2WB8A 4EZ3A 3TM0A 4UZDA 5CF6A 3L9LA 3R1SA 2PSQA 2VGOA 3KK9A 4JG6A 2XF0A 2ZB1A 4OTRA 4RIYB 4FVRA 1PXOA 3KF4A 4HNIA 4EOPA 3WOWA 3FYKX 1IA8A 2Y9QA 4RWJA 5EHYA 4BI1A 3VBYA 2WTKB 2XNEA 3E8DA 2R3RA 4FV7A 4G3DA 3VVHA 5FBNC 3FI8A 2ZV9A 3S95A 3PE1A 5JQ5A 3F82A 4BBEA 3ZZWA 3ANQA 2R3LA 3I60A 3II5A 4QTDA 1NVSA 4QYYA 4C4JA 1OZ1A 3HZTA 5TKDA 4RWLA 4WKQA 2PVLA 4X7QA 3R28A 4KIKB 4O81A 4BZOA 4FOBA 1G8AA 4GVJA 3UYSA 4H58A 5GNKA 3G15A 3HRFA 1F5QA 2XB7A 3N51A 4JG8A 4M0YA 5FEDA 4UYAA 4QQTA 4RLLA 2P0CA 3O23A 3G5DA 3AT4A 5FTOA 4BDKA 4CYJA 2RFNA 2JEDA 2LGCA 4O2ZA 3UTOA 4E4MA 4E26A 3I5NA 5AUWA 4WNOA 4Z55A 3QU0A 5AV3A 3RPOA 3ENHA 5AA9A 1YOMA 2W05A 3QQUA 1ATPE 4HGSA 2FUMA 2WZJA 4JDIA 4XH6A 5E90A 5IEVA 4U97A 3ZLXA 5JKGA 3V5LA 2VWYA 5E8SA 2W1DA 2YAKA 4EYMA 2YM6A 1T46A 2XIYA 3MPMA 3QTWA 3CTQA 1YXTA 2FVDA 3PWYA 4J52A 5HHWA 3IO7A 4ZTQA 4GUEA 3C13A 2IN6A 4TWCA 2X4ZA 3CR0A 3CCNA 4F65A 4QYEA 4L67A 3BI6A 4HCVA 1GY3A 5EI6A 4V0GA 4BDGA 4F63A 4IC8A 4TTHB 1ZMUA 3NCZA 4C4FA 2C68A 4FYNA 3CJFA 3KA0A 3LMHA 4FL3A 3FDNA 4XS2A 4A4LA 4RPVA 4CTBA 5IDPA 1QCFA 3GVUA 2ITWA 3WZKA 4DINA 2DWBA 3VS2A 3KXGA 2C3JA 3F7WA 2I0EA 3MY1A 4PL3A 4IWQA 3V8WA 4EI4A 5JH6A 4X3FC 1FVTA 1YDRE 4OT6A 3FXWA 4WD5A 5FM2A 4BCJA 2VGPA 2XVDA 4OTPA 4GKIA 2VTNA 3NUYA 4YJUA 3OHTA 3V01A 4FGBA 3MYGA 3ZO2A 4QTEA 1PY5A 3COMA 3UE4A 4JLCA 2AC5A 4D4RA 2HY0A 4QD6A 3TDVA 3VJOA 3E88A 1OPKA 3OT3A 4IVDA 3L9MA 2HWPA 4E7WA 3THBA 4QP9A 2C1BA 4UWCA 3A8WA 2B9HA 5ITAA 1PYXA 1YXVA 3S3IA 5HQ0A 3OZ6A 4R3CA 4OTFA 4XP3A 4YLLA 3UZTA 2AYPA 3BHVA 1WBOA 3CD8A 3AD5A 3FSFA 4ANMA 2RFDA 1OMWA 4TY1A 4C2WA 4FIEA 4QMTA 4O7WA 2CNQA 1JPAA 4FTCA 3TV7A 4C38A 3COKA 2X4FA 3TDWA 1YRPA 2HZNA 4FL2A 2CKEA 2J0LA 3QCSA 5HU9A 2R4BA 1XH7A 4QPSA 2VX3A 2FSTX 3AT3A 3WF8A 5CALA 3N4TA 2PYWA 4BTJA 4AZWA 2CCHA 3D7TA 4JR7A 3RK7A 2QQ7A 2F49A 3C5UA 3QZFA 5J1WA 5DT3A 4NUSA 3PA5A 2Y6MA 2XNPA 3ORPA 2Z7SA 1XH4A 3ZSGA 3DLZA 4C4GA 3QHRA 1R39A 5IQDA 1A9UA 4BTMA 3DKFA 2V62A 1Q5KA 4A9TA 3G6HA 1APME 4IHPA 4JL9A 4L52A 2JBOA 4S31A 1YXSA 2V7AA 3BYMA 4EK4A 2FH9A 5HLNA 3CQUA 4FZDB 1REJA 1P2AA 1RW8A 3OWPA 3RM7A 1FGIA 1OL5A 4MXXA 4BDFA 4IM0A 3LCDA 4II5A 4HPTE 4BTKA 5CASA 5HICA 3MTFA 4EEVA 1URWA 3ZZEA 4RQVA 3PE2A 3EQGA 3Q6WA 3BCEA 1KV2A 2B54A 4UV0A 5H8EA 2VWZA 4DEIA 3EYGA 4OBPA 5HESA 4HW7A 5HORA 5EQEA 3UG1A 1SVEA 3DBFA 3ORIA 5AV4A 2BRHA 3JVSA 2Y4IB 5L6PA 3SAYA 4I94A 1WVXA 4M14A 4EK3A 2VZ6A 1TKIA 2OIDA 3BGQA 2C6OA 2PULA 4S32A 1Y57A 5KZIA 3CIKA 1OB3A 1IAJA 4ZTHA 5EQPA 3QTSA 3CY2A 3AC2A 2UVYA 4QMSA 4HVIA 2Q83A 4TPTA 4ZZMA 4RFZA 3G51A 4EH7A 3F61A 3CTJA 4C0TA 4MHAA 4ZTRA 3MFUA 4FTIA 3SC1A 4AU8A 4YC8A 3LQ8A 5J5TA 4F7LA 5LWMA 1F0QA 3OOGA 3SLSA 1QPJA 3NWWA 2VTJA 4PDYA 1CSNA 3F5PA 4GIIA 5HIDA 3VN9A 3AC4A 5ETIA 3ZMMA 4EOSA 1OITA 4RLKA 2R3HA 4KIQA 4EZ7A 1R1WA 4U3ZA 4I41A 2PVHA 3U4UA 1YI3A 3H4JA 4FSNA 4ZSGA 4FTMA 3C0HA 1H1QA 5EYCA 5KKRC 2CNVA 4FEXA 4QPMA 5I9WA 3ZEPA 4I0SA 3VBXA 4YBJA 3OWJA 3SA0A 3CTHA 3HMMA 4LOPA 5CS6A 1DAWA 3PJ1A 3LE6A 3MH2A 2XEZA 4FI1A 3FI4A 4O7ZA 3R0TA 3TNQB 4PQNA 3ORKA 5EOBA 1V0BA 4L42A 2C5XA 2HELA 3F6XA 3UGCA 2ITXA 1QPDA 4YZDA 2WMSA 4OTWA 4DEDA 4FV3A 5FXQA 4I6QA 4I21A 2F7XE 5CI6A 3R7UA 4D4VA 4RIWA 3OBJA 5AR5A 3GB2A 2OF2A 2QOKA 4LYNA 3BQCA 3VJNA 4QMVA 3ZO4A 5HD4A 4DT9A 3HX4A 1YVJA 3WARA 2YM3A 2OIBA 3I6UA 3MDYA 5CU0A 4DTAA 3Q96A 5J9LA 1KSWA 4LGGA 2WTDA 2B1PA 2EXMA 4TYGA 4EC8A 2BRNA 4GK2A 3GC8A 4WNPA 2PZRA 4P5ZA 4UMRA 4DCAA 5IQFA 3ROCA 4N6ZA 4M84A 3W16A 5KX8A 2RFEA 2C69A 5FP6A 1G5SA 4FSQA 3FHRA 3GXLA 4FT3A 3NVKI 3AG9A 3AQVA 3PY1A 4FUXA 4B6LA 5L4QA 2C47A 3OCBA 2J9MA 1YWNA 4AWIA 5L2QA 4I20A 4A4XA 4ZJJA 4YHTA 2W5AA 1H1WA 2C6KA 1ZZ2A 3F5UA 1ZYLA 5T6KA 4CV8A 4FVPA 3UMXA 3DB6A 4U6RA 3QCYA 5E8VA 2WELA 3HMIA 1ZMVA 5AAFA 3MY5A 1LEWA 3K5UA 4F0IA 3U54A 1M14A 3ZRLA 1ND4A 4YJTA 2WOUA 1Q62A 1XKKA 3COIA 4FTOA 4IZ7A 4F0FA 2VAGA 4X0MA 3PJ8A 3P7AA 5DT4A 4R78A 1OL7A 4DF3A 4DFZE 4FNXA 2R3KA 5HIEA 1TQPA 2LAVA 3WF5A 3FLZA 1UKHA 4IAZA 4E3CA 3MFSA 3NCGA 4LQMA 5HVJA 5F4NA 4EH2A 1PMNA 5ANGA 3C51A 5ANIA 5L2SA 5DFPA 3BV3A 2QKRA 3FMKA 3ULIA 3SXFA 3HVCA 4O6EA 2ZVAA 2OW3A 5IH4A 4QMLA 4EKLA 4PTCA 2RL5A 3VS6A 4UXQA 4BCNA 2Y8OA 2QG7A 4W4YA 3FZ1A 1OGUA 4MH7A 4R5YA 1U54B 3UPZA 2YIRA 2WEIA 4I0RA 3FY0A 4QT1A 2I1MA 2J0KA 5FGKA 2E9VA 4BYIA 3I7CA 4F09A 4AW1A 4F9BA 3C4FA 3OTUA 4D9TA 3R83A 4DLJA 1U46A 5DEYA 5ICPA 3S0OA 1XJDA 4IB0A 1H24A 4U45A 1J1BA 1WBVA 3O8TA 2J90A 5B7VA 5IH5A 4JAJA 5JGBA 5M4FA 3N4UA 2OK1A 2XCHA 4IJ9A 4WUAA 3SXSA 5HCXA 5IUGA 1FVRA 3NNXA 1OM1A 3HKOA 5HX8A 1UWHA 3DT1A 3RZFA 1FVVA 3DJ7A 3UIUA 3BU5A 4XV3A 4I1ZA 2ITUA 3A62A 3GOKA 2QD9A 3PG1A 5D11A 4R1YA 3UC4A 4LV5A 2PZ5A 4BZNA 5E8WA 4RX5A 1J7UA 3BHUA 5D12A 3WE8A 4KS7A 2VUWA 5DI1A 2UZTA 3EMGA 5IG1A 3IONA 4LI5A 2R3JA 5CEKA 4HYSA 4EK5A 4GCJA 3R8LA 3UNKA 4BDAA 5C8MA 3MI9A 2C0IA 2JC6A 2PK9A 4EQCA 4Z7GA 4F9CA 4CGAA 3ZHPC 1B39A 2OH4A 2DS1A 2BAKA 4TNDA 4PPAA 2BZJA 5IKWA 3BIZA 2CN5A 2WU7A 5TT7A 5GZ8A 3BYVA 3DK7A 5C03A 2PHKA 2BDWA 4UZHA 1Y91A 3PA3A 4AT5A 2QCSA 5M4IA 3QX2A 3FPQA 5J9ZA 3TI1A 4F4PA 2WXVA 3S2PA 5AR7A 5F20A 3R9OA 4IJPA 5A46A 4MKCA 5E1SA 5EM5A 2OG8A 4NM5A 1PJKA 3E64A 3G9LX 4NW6A 1U5RA 4FGRA 3PUPA 1Z5MA 3HV5A 5IQIA 4CG9A 1H01A 3L8XA 5EHLA 2WAJA 4KRDA 5HBEA 2GPHA 4XOZA 2YM7A 3D83A 4GEOA 5CT7A 3RMFA 5M4UA 5ANKA 4AZTA 4WBOA 4BICA 3QD3A 1K9AA 3R1NA 1W7HA 3R7VA 4YSMA 4ZS4A 2WTVA 1ZWSA 5DN3A 3MA3A 4HGTA 4RMZA 3AD4A 5EYKA 4R5SA 3S00A 1JKKA 4OTQA 5DGZA 1BL6A 1PHKA 3FKNA 3TNIA 4CLIA 3FZSA 4FKTA 4FTUA 4IIRA 3BQRA 4YZMA 5JZJA 3QRTA 1AGWA 4TWNA 3QUPA 2I40A 3GCPA 3OY1A 5KMKA 2JFMA 2UZEA 2QR8A 1LP4A 4JVGA 1Q3WA 4PP7A 2C5VA 3R01A 3TCPA 4MEDA 5CNNA 4AE6A 3VS3A 4AP7A 3OCTA 1KE6A 4AN9A 4MF0A 5K5XA 5HZNA 4HZSA 4M69A 4C8BA 2ACXA 1K2PA 4FUYA 3LLAA 4BCFA 3LM5A 2Z2WA 5ANJA 2FSOX 4RFYA 3VS1A 2VD5A 5BYYA 4K77A 4APPA 3FQEA 4MD8E 3HYHA 5C01A 2V0DA 3RWPA 1Q99A 2VN9A 4I24A 5JFWA 3OUKA 4QP3A 2JDVA 2CKPA 3ETAA 5CEQA 4PMPA 1M7NA 1NXKA 3LFEA 1YQJA 3MH3A 3QTIA 5JZNA 3UG2A 1W84A 4L44A 3RPVA 5HO6A 3RVGA 3IDBA 3F2AA 5K0KA 3A7GA 4Y73A 4M66A 3DXPA 2C6TA 1SNXA 2OZAB 4AF3A 4W8EA 5E91A 4FL1A 4E6QA 4UMTA 3UNJA 2P2HA 5EW3A 4TWPA 2Q0BA 4F6SA 2JDRA 2X6DA 3GCQA 3Q4CA 3QA0A 4JT3A 5K0XA 4CLJA 5DH3A 4W4WA 4HNFA 5JRSA 1LUFA 3SKCA 2QLQA 4LOOA 1FMOE 4AA5A 4D5KA 4TYHA 5AX9A 4ENXA 2BZKB 4WNMA 3DY7A 1PKDA 2P33A 1BLXA 4MQ2A 3HP5A 4DGMA 3SOAA 3LKMA 1PRYA 3B2WA 3KFAA 4QP2A 4FSUA 4XCUA 5AP0A 3E7OA 2ZM1A 3F7ZA 1BMKA 2VTOA 2UW4A 4UEUA 4EUTA 4XMOA 3HV6A 4IAAA 5AUVA 3ZEWA 4PWNA 2BAQA 3DNDA 3DLSA 5B0XA 4QP4A 5HCZA 4BRXA 4DYMA 4ENYA 5JK3A 3OXTA 4C4HA 5L2TA 4P90A 4EHZA 4H05A 4ITIA 2QU5A 3PSDA 3VQHA 2PVNA 4ASDA 4X6RA 4DN5A 5JEBA 5BYZA 1GZNA 3P9JA 2E9OA 4J95A 5HE3A 5IDNA 2XRUA 4FKRA 5DR6A 2I0YA 4BYJA 2XNMA 2UZVA 2BDFA 5BVEA 3UO6A 2CSNA 3H9FA 4KKHA 5FXSA 4D2SA 3FMNA 4EC9A 2PZYA 5AP3A 4XG9A 4GT3A 2C0TA 2XH5A 5FWKK 4QMQA 1DAYA 3K54A 4GU9A 3QQJA 2R3PA 5EKNA 3FKLA 3KC3A 1QPCA 2JKOA 3KEXA 4O21A 1Z9XA 5IEXA 1J7LA 3EOCA 3V5JA 4CXAA 1CKIA 2A2AA 4BDDA 4QNAA 2OLCA 2W1IA 3L8VA 3ALNA 4FZFB 2OFUA 4PRJA 4FV2A 4NTTA 1UU7A 4U8ZA 3VUTA 3ZDUA 4CFUA 3H0YA 4QP8A 1GIIA 4O2PA 5D1JA 3ZUUA 3VBWA 5IA2A 5L8KA 4C35A 4F7SA 3QD4A 2XNNA 3V8SA 4DGLC 4DT8A 4MWIA 5KE0A 3LFNA 2ZM4A 3E8NA 2VO0A 2HXQA 4K11A 4RX7A 1Q24A 4P7EA 4O1PA 4ITJA 5CSXA 4ZMEA 2VWXA 2WU6A 2CKOA 3VUHA 4USDA 4DTBA 1QPEA 1SYKA 1KUTA 4B4LA 3OD6X 2BALA 4UBAA 2BVAA 1JKLA 2Z7QA 3PVUA 5IQAA 4QMZA 5AAEA 4X2JA 5FLFA 2JKQA 5CEMA 3RWQA 4I0TA 1W83A 1OIUA 2OU7A 3W55A 4E5AX 5IA0A 3F2RA 5DHJA 4A9SA 2PE0A 4ANSA 4YZ9A 3KB7A 2BAJA 2Y0AA 3LXNA 2V5QA 4YJPA 3EQDA 4FTJA 4C62A 1UV5A 4ASXA 5IPJA 4O7YA 5LCKA 4DG3E 1PXIA 3ENMA 3L8SA 1H08A 4IB5A 4BCOA 4DEHA 2B52A 2X8IA 4UXLA 2UW8A 4V05A 1GIJA 2R3OA 3HRCA 4F1MA 1MUOA 4C3FA 4ZIMA 4D2TA 3SW7A 4O82A 3HAMA 3U9CA 1E9HA 5D41A 1J91A 5CXZA 4FV4A 3ZC5A 1YI6A 3OEZA 4YTHA 4AW2A 3LJ1A 1WBWA 4OGRA 1ZMWA 2WMAA 5AR2A 3R6XA 4G16A 3WI6A 4TYIA 3S1HA 5B2MA 2XA4A 4KBKA 3P0MA 3Q9ZA 1JVPP 3A99A 3OCSA 2QHMA 2GHMA 3V6RA 4DGGA 2PU8A 1Y6BA 4BGQA 2C3LA 4ALUA 3MFRA 4CMUA 4ZTNA 3F5GA 2YM4A 4XX9A 2V55A 3PXQA 4YZNA 4PY1A 5M07A 4JXFA 2OJFE 1M2RA 4NIFB 2WGJA 3ZXZA 1LR4A 3SHEA 3VRZA 3JS2A 2GFCA 4YJOA 4F08A 2UV2A 3E8CA 4FTLA 5TOZA 5A4CA 1QMZA 4ZLZA 2VRXA 3FL4A 2X2KA 3QTRA 2VTMA 4IAYA 4XUFA 5AV1A 4PV0A 3BHTA 4G6OA 4KBCA 4EH9A 5FP5A 4ZLYA 5M53A 2WMXA 3KN6A 4QYHA 4ERWA 5AFVA 2VTTA 4K0YA 2R64A 4WG3A 3AMAA 3DXNA 4HPUE 3R30A 4FKQA 4XNEA 4FIHA 3D5XA 5CNOA 4BI0A 2CKQA 4CFMA 2ERKA 4HYHA 1W82A 1KE7A 4XV1A 5JSMA 4MWHA 1ZRZA 4ZLOA 4XBUA 5HCYA 5F94A 3EQIA 4O0UA 4RBLA 2C6DA 1GZOA 2EXEA 5D9HA 5BMSA 3MB7A 4B8MA 2XCKA 2YM8A 4X6QC 2FA2A 3MV5A 3QHWA 4FKLA 4MBJA 4H1JA 4YHJA 3KQ7A 5TE0A 4CKIA 4J71A 3DDPA 2A4LA 3BHHA 4G3EA 3RZBA 2YFXA 1FINA 3DBCA 3OCGA 3RI1A 4CMOA 1IRKA 3GQIA 4MBIA 3DZOA 1J1CA 2X8DA 5FRIA 2J6MA 4DFBA 5CENA 2BFXA 2WTKC 4IH8A 2ITOA 5I4NA 2QLUA 3NUPA 4L46A 3G90X 3MTLA 4J1RA 4GFMA 2UZNA 3QZHA 4RT7A 3Q9XA 2E2BA 3EN4A 2ETRA 4KBAA 2ZB0A 4XG2A 3Q4TA 4U80A 4YJSA 3IW8A 4EZ5A 2QOQA 4LMUA 3BE2A 4YR8A 5KBRA 1CKPA 3K3IA 4OTGA 2B0QA 1R78A 3FMDA 5HO7A 3LFSA 5I3RA 4ANLA 4FKGA 4F7JA 4P4CA 5CF5A 1I44A 2GNGA 4JNWA 3SRVB 5EHOA 2UW9A 4D55A 5BNJA 3MSSA 3ZSIA 3ZSHA 2ZV8A 2VX0A 3QKKA 2HZIA 2V22A 2W1GA 4A4OA 3OS3A 4I93A 2QOFA 1RJBA 4XG6A 2IZTA 5IMEA 3C4CA 3F2NA 3TV6A 1L3RE 4O1OA 5K3YA 3RPYA 3PA4A 5J7BA 3PIYA 4FZAB 1REKA 4G9CA 5BUEA 5EYDA 2C6LA 2O63A 3QF9A 5CU3A 2HXLA 2J0IA 3R2YA 1U59A 4CZTA 2NNWB 2JFLA 3OXZA 5E8YA 1JOWB 5BVKA 2YITA 5KBQA 4GRBA 2E9PA 4GSBA 5G6VA 1YDSE 3SQQA 5AR8A 4MNEA 4KIOA 5I9VA 1V0PA 5KCVA 5FUTA 1Q8ZA 2QOIA 4W4XA 4DITA 3FEGA 4KIPA 4PL5A 5GJDA 5C27A 4AT3A 4Z7HA 3QTXA 3P08A 4K1BA 1UU8A 2OF4A 4KD1A 2REIA 2GS7A 4RIYA 2DYLA 4UYNA 3V5WA 2XNBA 3EFLA 4WO5A 3F66A 4BDJA 4CKJA 2JD5A 3CS9A 3W2RA 4IDVA 4LUDA 4YSJA 1PXMA 3EJ1A 3ERKA 3H10A 5DR2A 4I22A 3DZQA 3R9HA 3BU6A 3VUGA 5CY3A 3EL7A 3HMNA 5HVYA 4AAAA 2R2PA 3GCUA 3QC9A 4UX9A 5M06A 4LRKA 3RTPA 4O7VA 3UVRA 2ZMCA 4G9RA 1HCLA 4QMYA 5FBOA 2ZV2A 2C30A 2WMRA 4EOLA 1BKXA 3PY3A 1OKWA 5DT0A 3R9NA 4KIKA 1M7QA 3MW1A 2XK9A 4L7SA 2QC6A 2XKFA 2OH0E 3C4EA 4ZJVA 4FEWA 3M2WA 2YLFA 3NIEA 4GYGA 5BMMA 4ZSAA 1V0OA 4AOJA 5HLPA 2H9VA 1WMKA 4Q9SA 1GOLA 5BYLA 4OAUC 4LUEA 4RX8A 2EB2A 3LQ5A 5JN2A 3CPBA 4HVGA 3D7TB 1STCE 1YOLA 4X2GA 3CLYA 3WZJA 3PXFA 4FA2A 4YPDA 4O0VA 2BUJA 2YDKA 5EDRA 4GIHA 3SGCA 4RC3A 3EH9A 1P4OA 4TN6A 1ZOGA 3VBQA 4EOQA 3VNTA 3R8MA 3IW6A 4GH2A 3MVJA 3PWDA 4QMXA 3C1XA 4U42A 3UPXA 2BZHB 4ZZOA 4KKGA 4RZWA 4NZWB 3O7LD 1BL7A 4AACA 3PY0A 3FMEA 4YHFA 4B9DA 2XYNA 3FZOA 4UWYA 1XWSA 3DBDA 5M08A 4BFMA 2Z60A 4YGAA 4NT4A 1H0WA 1OKYA 4ACHA 5K9IA 5TF9A 1NT2A 3VUIA 2ERZE 3POOA 5C9CA 3IK3A 2NO3A 3I1AA 4ZEGA 4C36A 1PXNA 4FEVA 4E93A 3M11A 3DPKA 4HGEA 5CF4A 3D9VA 4A9UA 2VWVA 3DXQA 3I79A 2X9FA 3MJ2A 4FSZA 2GS2A 3P23A 1DS5A 4U41A 4AFEA 2C4GA 4BCMA 3UQCA 5I9ZA 2HYYA 3FZRA 4O91A 5AR4A 4HVSA 4X3FA 5D7AA 2R9SA 3F3ZA 5HNGA 1SM2A 2H6DA 2OKRA 3K2LA 5HEZA 2P55A 2HZ4A 3LVPA 1M52A 4Z9LA 1ZAOA 3ZXTA 5AADA 3HDNA 2IW8A 5EW9A 1JWHA 2GMXA 2J5EA 5A14A 1KV1A 3QTUA 3Q53A 2FB8A 2IZRA 2YZAA 3G33A 5DEWA 2Y4IC 4AUAA 3ATTA 3DOGA 4XRJA 5E7RA 1NY3A 4FODA 3UO4A 2JIIA 3PSBA 3Q3BA 3PLSA 4KSQA 4LV8A 4ZP5A 5DWRA 2WNTA 4XOYA 4AN2A 1A48A 2CNUA 4MXCA 4N70A 5AWMA 3ZO1A 3BKBA 2XRWA 1O6LA 3UOLA 1GIHA 5IQGA 2WIPA 3R9RA 1ZY5A 2RGPA 3ROYA 4EOKA 4MK0A 4G5JA 5H8GA 2WQBA 4RIOA 2UZWE 3WF7A 4EOOA 3IPHA 3NAXA 3QLGA 2HW7A 4M97A 2YZLA 2VTIA 1BI7A 3CXWA 4ZY5A 4R3PA 1MQ4A 4UY9A 5AUXA 4G34A 3BYUA 5BVDA 3B8QA 3DAKA 4IAIA 4ANQA 5CT0A 4Y85A 3QRJA 2VNYA 2CGUA 3CQWA 4Q5EA 3BGPA 3LFFA 5T3QA 2GFSA 5C8NA 4YJVA 1GZ8A 3ZDIA 3MBLA 4FV1A 4RIWB 5GZ9A 2XIXA 4O38A 5EYMA 1XBCA 1FPUA 1PXLA 3GU8A 4NU1A 5CXHA 2CGWA 5EI8A 3RPSA 5E8XA 3WE4A 4TWOA 2XJ2A 1LPUA 1R3CA 1NVQA 2JKKA 1PMEA 3NS9A 3V5QA 3RINA 4DGOA 2C1AA 3TG1A 3NUXA 5EDPA 5GIOE 4QMNA 1ZY4A 2QODA 4YTIA 4ACMA 5GZAA 4FR4A 1OIRA 4B0GA 3A7IA 2XS0A 3UP2A 3VS7A 2QO9A 4AG8A 5DR9A 3DTWA 4DEEA 1YXUA 4XG8A 5CAOA 4M67A 2O65A 2YCRA 2X6EA 3LOKA 1WBPA 5AJQA 4I5HA 3AGMA 4EWQA 4G6LA 3NRMA 5CYIA 3ZCLA 1IASA 2QURA 3L1SA 2OICA 3V3VA 4H3BA 4FV8A 2X9EA 3PP0A 3C4ZA 2RF9A 2JLDA 5F95A 4U40A 5IU2A 3IW4A 4PL4A 4J7BA 3KK8A 2WQOA 4NL0A 3FQSA 3QGYA 4K18A 2R7IA 3FHIA 2ETMA 2QHNA 3ZTXA 4DHFA 5KKRB 2ITZA 5BVFA 4ZK5A 3DQXA 3VUDA 4YP8A 4O7LA 2C6IA 2YA9A 3VRYA 4DFLA 3LXLA 4XRLA 3UZPA 1UNLA 2PUPA 5LARA 4BIEA 1S9JA 1KOAA 1G3NA 3R2BA 4L6QA 3RK5A 4JIKA 3KF7A 1WCCA 4YNOA 4AZEA 4U81A 4FC0A 4EH4A 4GJ3A 1OL6A 3O8PA 3Q2MA 2ITPA 3PVGA 3PJ2A 4PX6A 3VUMA 5C4LA 3OXIA 5FDXA 4BKJA 2GHLA 2ESMA 4YZBA 3VW6A 4BZDA 2YERA 3BU3A 4FF8A 5GHVA 4RX9A 5EKOA 5E8UA 4YMJA 3BV2A 3DJ6A 3NSZA 3R71A 4FKUA 1YDTE 3GFWA 4S30A 5ANOA 5IA4A 3GU5A 4YC6A 4EWHA 1ZYSA 3A7JA 2OJIA 3JVRA 4NH1A 4O6LA 2R0UA 4L8MA 3R7OA 1JSTA 2A27A 3DJ5A 3FJQE 4G1WA 3CE3A 1LEZA 2X8EA 5FD2A 4FE2A 1FQ1B 4IW0A 4CG8A 4D1XA 3ZU7A 4ORKA 1H26A 4Q5HA 2QG5A 3EZVA 5HIBA 4CYIA 4EH3A 3DGKA 3RCJA 3TKUA 2VWWA 2EWAA 4CFXA 2KTYA 1UU3A 4BDHA 4XG4A 3KXHA 4C3RA 5HU3A 4TRLA 2W99B 3H9OA 3EN7A 4NCTC 4IWDA 3TZ7A 5CANA 5AEPA 2UW3A 3FY2A 3ORZA 5I0BA 5I9XA 1UKIA 4UMUA 4C4EA 2PZPA 4BHNA 3VHEA 2RFSA 4H36A 4DC2A 3DK6A 3PP1A 2W1EA 1UVRA 4EJ7A 5J8IA 4M3QA 4EOIA 3U87A 4P2KA 4O0SA 4FVQA 1YWRA 4ALWA 3E92A 4YJRA 2QONA 4QRCA 3JYAA 3LAUA 2VU3A 3QC4A 2IVUA 4XG7A 5AP4A 4S34A 4QPAA 5CQUA 4IFCA 4BKYA 4FKIA 1UWJA 5HOAA 2PVFA 2YCQA 4QNYA 2XBJA 3GI3A 3OWKA 4FNWA 4IZYA 5IA5A 1H0VA 3Q04A 2B9JA 3UOHA 4EHEA 4YTCA 3FBVA 3B8RA 4IXPA 1IG1A 1W0XC 4YBKA 4BR3A 2W1HA 3CJGA 5EW8A 4C3PA 3QALE 4HVHA 4EQMA 5AUYA 5BVOA 2YDJA 4XG3A 5F1ZA 3ZYAA 1Q8TA 5EOLA 2JDSA 3GGFA 1OL2A 3OFMA 3OW4A 3O71A 4DEAA 2ZDTA 3PIZA 5CI7A 3VUKA 2JDTA 3KVWA 3EN5A 4R3RA 4A07A 2WMBA 4RJ5A 2OZOA 5IZFA 2BFYA 3ELJA 2WPAA 3PXZA 4IQ6A 4K2RA 4X2KA 4BTFA 3GBZA 5L2IA 4E5WA 4FT5A 3EQBA 4TW9A 2I7QA 4AOIA 3Q4UA 4J8NA 4ZMFA 3AOXA 3PXYA 2SRCA 3RPRA 3ULZA 3OOMA 3OY3A 1U54A 3Q52A 4WIHA 3LMIA 4UMQA 2CN8A 3PRFA 4F70A 3NW5A 4NKAA 5M09A 3MESA 2ONLC 4BCQA 1FBNA 4NCTA 4GU6A 5GIPE 2YIQA 4MXZA 5HG9A 2YLEA 2WOTA 1OKZA 3EFWA 3ZFXA 4Y72A 2PTKA 3AGLA 5M51A 2FSLX 1Y6AA 4FV5A 4RIXB 3F5XA 2BHEA 4A7CA 3DAJA 4BL1A 5CAUA 4K33A 2WTJA 4ALVA 3PPJA 3E62A 2HWOA 3C0IA 2Y6OA 3TJCA 1CTPE 2Z7RA 1UA2A 3VBVA 1SMHA 1XH8A 4FKVA 4X2NA 2O8YA 4JQ8A 3FSKA 1H00A 2QNJA 5HLWA 4BBFA 3TKIA 2B9FA 4PUZA 4ID7A 3A8XA 4PNIA 1Q61A 4GT5A 5LMAA 2Q0NA 4CMTA 4R7BA 2GSFA 2VTPA 3NGAA 5CU4A 1P5EA 3VW8A 3QXPA 4ASZA 4ZY4A 3R1YA 3QQKA 5E9EA 4GMYA 3IGOA 4XLVA 3R1QA 3OG7A 5HVKA 3V51A 2G2HA 2H96A 4FEQA 4K9YA 4DE4A 1GAGA 1AQ1A 1JKSA 4GS6A 5FQDC 3QGWA 4C33A 4PMTA 5AP7A 4M69B 4MQ1A 1XBBA 3L8PA 3BLHA 2VO3A 3LCTA 4WG4A 4MCVA 4K8AA 5IISA 3SD0A 5LOHA 1Q8YA 2Z8CA 3W33A 2X7FA 3KRWA 3LFDA 1Q4LA 2NPQA 2C6MA 3ZFMA 4DTKA 5A4EA 3VS0A 3UDBA 3NYOA 3ORMA 4RQKA 4IBMA 1H8FA 2WHBA 5CSPA 2ONLA 5CF8A 3AMBA 3Q6UA 5DA3A 3LXKA 2XJ1A 4R6VA 5AX3A 2GQRA 2YWVA 4TZRA 4XHKB 4AGDA 4E6AA 4YO6A 4AQCA 5GJGA 4FZ7A 3ZM9A 2EUFB 3F3TA 3QZIA 4QMUA 2VTHA 2X2LA 1ZLTA 5FM3A 5A6NA 4NM0A 4IZ5A 2I0HA 2F2CB 5EH0A 2WIHA 5LVLA 3QA8A 3VS5A 3MIYA 1Y8GA 4ZXTA 2WMWA 4BI2A 4FSYA 2VTQA 3EQHA 4R1VA 3NPCA 4Z3VA 3VQUA 4DAWA 3NMUF 1TQIA 2F7EE 3G6GA 4E73A 3ACKA 3ITZA 4ANOA 3EFJA 4FG8A 3UIBA 2VWIA 2PVMA 3IGGA 4W4VA 4WRSA 3VF8A 4OAVB 1T45A 1JQHA 4GFOA 3UOKA 3AC5A 4AW0A 4R7HA 4Y8DA 3RBWA 1ZYJA 2PMIA 1X8BA 4NKSA 2FYSA 2OSCA 2JIVA 3C50A 4FMQA 4H3QA 5EM7A 2WMQA 1Q97A 4FTRA 5I9UA 3FUPA 3GU4A 4ANBA 3LFAA 5HD7A 3FI3A 3M42A 1J3HA 5CLPA 3PYYA 3WILA 4BCPA 3BWJA 4CCBA 1VYWA 3R7IA 3W10A 4L45A 1XO2B 3WF9A 4NW5A 2ZMDA 4QYGA 4UN0C 4WG5A 4FBXA 3HUCA 3PZHA 3MFTA 2IJMA 1W8CA 4O7RA 2UZOA 1M2PA 3HEGA 3LZBA 3KY2A 2O5KA 4FSRA 3W8LA 2XYUA 3KULA 5ETAA 4U79A 4PMSA 3EQRA 3W2PA 2R3MA 3CKXA 1MQBA 4XLIA 4DH8A 3C4WA 3ALOA 3TZMA 1ZOHA 4OTIA 4G3CA 3KXZA 2W4KA 2YAAA 2IW6A 4C57A 3DAEA 2WTCA 3CQEA 3TWJA 3P78A 3VHKA 4GVAA 4ITHA 3JXWA 4WNKA 4G3GA 5DVRA 4MD7E 4PDPA 4FG7A 4D4SA 2NP8A 5FTQA 2V7OA 1L8TA 1NVRA 2G01A 3IOKA 4G6NA 4I5PA 1CM8A 4WRGA 1EH4A 3IW5A 3EWHA 3R73A 4J8MA 3W18A 1ZZLA 2Z7LA 5BVWA 3FMMA 3MVHA 3WBLA 4WT6A 3NUUA 1YW2A 3NEWA 4L7FA 4AS0A 2HAKA 2F57A 3BRBA 4X3JA 3V6SA 3VS4A 5AP5A 2PZIA 1TVOA 3R7GA 4GJ2A 3ZRMA 5HBHA 4CSVA 3DS6A 2BTSA 4G5PA 5A4QA 4FTTA 2BPMA 1O6YA 4FTAA 2VO7A 3OROA 5HE1A 4AE9A 4N4SA 3QYZA 3QD0A 4RVMA 3QRIA 3P7CA 4QMOA 3TIYA 1H27A 4DH3A 2RG5A 5K4IA 3UJGA 4I23A 4XP2A 2B9IA 3U8WA 4YU2A 1OPJA 4JBOA 5BQ0A 4O7NA 2HCKA 3SOCA 3HA6A 4GK3A 4F1OA 4IX4A 4JDKA 2F7ZE 4LRJA 4Q9ZA 2Y4PA 4DEGA 3EIDA 3D5VA 3LCKA 2IPXA 2F2UA 2UVZA 1I09A 4D2WA 3H30A 2PUIA 2CLXA 2XBAA 3HECA 2R3FA 2C6EA 2VWBA 3FV8A 4AX8A 4CFNA 3P5KA 4ZTSA 5AV0A 3TZ9A 3LJ2A 2XKEA 5HBJA 5LVMA 4E20A 5CZIA 4KSPA 4EORA 2XM9A 1GNGA 4GG7A 3GU6A 2UVXA 4KWPA 2JAVA 2BR1A 4V01A 4RRVA 4JDHA 5LVNA 5AAGA 2WQEA 3U6HA 4DLIA 4BDCA 1KE8A 4AGUA 3KCKA 4AGCA 4YPSA 2W4JA 3ODYX 4NFMA 2J5FA 1E1XA 4APCA 3Q5ZA 2VTAA 3QLFA 4W9WA 4LFIA 3ZOSA 4IC7A 1F3MC 4FK3A 2CCIA 2OI4X 3PPZA 5EK7A 4CT2A 3ODZX 3G0EA 3NNWA 3OEFX 3PZEA 3D5UA 5C1QB 5ACKA 4PNKA 3OVVA 2ETKA 2PE1A 4AA4A 2XIRA 2BDJA 2W1FA 3T8OA 5E4HA 3FLQA 5HX6A 2UW5A 1WVYA 4ONAA 1KOBA 2HENA 4UWBA 4ZJIA 3OWLA 5A6OA 4DFUA 3BEAA 1PMUA 4V04A 3PJ3A 1WBTA 1FGKA 4IEBA 4TT7A 4L3JA 5DE2A 4I92A 4ASEA 4JR3A 1U4DA 4UB7A 4RWKA 3QCXA 2WQMA 3H0ZA 3ZLYA 3BX5A 1R0EA 3AMYA 1WFCA 5EG3A 2JDOA 5J87A 3QD2B 1ZOEA 3Q9YA 3ZFYA 2NRYA 1Z57A 1M17A 2PVRA 3FMLA 3JY9A 4PP9A 3W2OA 2XEYA 4EH5A 3LFCA 3ACJA 3BBWA 4Y5QA 1YHVA 3DA6A 4NM3A 3F88A 4JQEA 4QO9A 2O3PA 5KMIA 4MVFA 4DGNA 4KABA 2RSVA 4IADA 5C4KA 4QP1A 4XP0A 1JSUA 3DV3A 4MD9E 1WBSA 5LVPA 4FICA 4FKSA 1TQMA 3KU2A 4PF4A 3QX4A 4RFMA 3KCFA 4JBVA 5AIKA 2JITA 2ZDUA 3DKGA 3TV4A 2XK3A 3UIXA 2X7GA 1JLUE 4YTFA 5DMZA 3I4BA 1YXXA 4G2FA 4FV9A 3HGKA 4F99A 1YKRA 1ERKA 4R77A 3ZLWA 3OBGA 2F9GA 4CRSA 4CFWA 3DQWA 4KAOA 3D94A 4NWMA 1XHAA 5AP6A 3TIZA 3RHXA 3QRUA 4C58A 5DRBA 3BWFA 5FXRA 5GINE 5KMLA 4M0ZA 3EKNA 4FTQA 4D0XA 1OIYA 3NR9A 4MNEB 4BN1A 2PMNX 2OBJA 4OR5A 3I81A 5KMNA 5HTCA 2CLQA 4TYEA 5CWZA 4AGWA 1Q41A 4AW5A 3KL8A 1HOWA 4CEGA 1XBAA 3HNGA 3TL8A 5J5SA 5DBXA 3W1FA 3BELA 4AFJA 2WFYA 3CGOA 3LJ0A 3NYVA 2UUEA 3QZGA 4V0GB 3NW6A 4TL0A 3OP5A 4H39A 3F3UA 4F6UA 1MP8A 2P2IA 4LL0A 2WTIA 2ITYA 5AV2A 5BUIA 2W4OA 2W96B 2FGIA 3JY0A 4ANNA 2H8HA 2G2FA 4YJQA 5FG8A 2VNWA 3MH0A 5JT2A 1IR3A 5FEEA 3UP7A 4AT4A 3Q5IA 2IG7A 3BLQA 2X7OA 3OT8A 3UZRA 4PTEA 3LPBA 4E4NA 5LCJA 1BUHA 3IDPA 3PRIA 4QTAA 1MRYA 3IG7A 5E8ZA 4RJ8A 3RAIA 3WYYA 1SVGA 3GT8A 3MH1A 3IKAA 2OO8X 2X1NA 2YIYA 3KMWA 4EHGA 4XV9A 3GUBA 4E8AA 4KA3A 1CKJA 1DM2A 2PL0A 3P4KA 3DU8A 3BGZA 3DTCA 4EONA 4L00A 4KRCA 2EU9A 3GOPA 4IFGA 4U0IA 1XH6A 5CQWA 4EOJA 4NJ3A 2ITTA 5T68A 1MRVA 2W5BA 3SRVA 3TJDA 5LQFA 5ACBC 4ZSJA 1W98A 4CCUA 4RVKA 4ERKA 4JJRA 5CSWA 2H34A 4FZ6A 2ZYBA 3FL5A 3KRJA 2VV9A 3LCOA 5EQYA 1K3AA 3NW7A 3HRBA 3FLSA 5C8KA 4EKKA 3TTJA 4IX5A 3NVMB 4C2VA 2XM8A 4M68A 4X21A 2F4JA 3VIDA 3U6IA 2X39A 3QFVA 2YJSA 3C9WA 3EKKA 3HA8A 4M12A 4Y46A 3VO3A 4HYIA 5BX0A 3FYJX 4PDOA 3D7ZA 2PY3A 3H9RA 4YLJA 3MVMA 2QKWB 2RIOA 3I6WA 4F1TA 3EQCA 3P7BA 2XZSA 3R63A 4EQUA 4GV1A 4S33A 2J4ZA 4BGHA 3G0FA 5CAQA 3WYXA 4AZFA 4N57A 3B2TA 3W2QA 4O83A 1DI8A 1H1SA 2A19B 2BTRA 5CEOA 3JR1A 4WBBB 2Y7JA 1JNKA 2UZBA 3IECA 4JOAA 4JRNA 1PYEA 4X3FB 2XK8A 3ZBFA 4TXCA 4MNFA 4NFNA 4OBOA 3OTVA 4MYGA 4GL9A 3ORLA 5EM8A 5BUJA 3KKVA 2G15A 5BVNA 5K5NA 2R3GA 4FT0A 4Q2AA 3UOJA 3FPMA 3UQFA 2QOOA 3KRXA 5DG5A 4UMPA 3Q2JA 3O17A 4NK9A 3TXOA 3O7LB 2ZOQA 4W9XA 5M44A 4O84A 4JRVA 3TZ8A 4L01A 5M55A 3FMJA 4FIIA 5AMNA 3M1SA 2QR7A 3NYNA 4NSTA 4C37A 2YACA 2DQ7X 3QYWA 5HKMA 1UNHA 3JPVA 3LFQA 3O51A 3ORTA 5HG8A 1IAHA 3K3JA 2QOHA 3QUDA 4AZVA 4W8DA 3BZ3A 1P4FA 3DCVA 2RKUA 3I7BA 3NUSA 1YWVA 5IH6A 4CQGA 4EBWA 4JAIA 5HNBA 4ZAUA 3FWQA 3LFBA 4IE9A 2JAMA 4IANA 4J98A 4HJOA 3Q9WA 1U5QA 3R04A 5L6WL 1R0PA 1G8SA 2EXCX 3FAAA 2DUVA 3PVWA 3QKLA 3UYTA 4D0WA 4ZY6A 2ZAZA 5JFVA 3E87A 5E8TA 5JMSA 1V1KA 3EB0A 5ANDA 5CVGA 1WAKA 3A7FA 3FXZA 3CP9A 4FEUA 5IF1A 2O64A 5DYJA 4WSYA 1OUKA 3CY3A 3GCVA 3U55A 3DBQA 1JBPE 2X2MA 4A9YA 4ACCA 3CSVA 5CEIA 5DRDA 5IUIA 4OLIA 4EL9A 5L3AA 1BI8A 3E5AA 4O0XA 1CMKE 2E9NA 4RJ6A 4EUUA 5IQBA 2W9ZB 4RC4A 3AT2A 1H25A 3D4QA 2VTSA 3LM0A 2W17A 4RZVA 2YHVA 5H3QA 3RNYA 1PXJA 3KN5A 2UW0A 3NNVA 4FIGA 3DBEA 3FE3A 4MXYA 3EL8A 5CVFA 2WMTA 3TNPC 3LCSA 3D0EA 4QQ5A 4FT9A 4D58A 3ATSA 2R3IA 2WEVA 4QP6A 2O2UA 3RAHA 2OJGA 3PLAE 1OL1A 3R02A 1E1VA 3R7EA 3OW3A 4FKJA 5L6OA 2NRUA 4EOMA 4CRLA 3ANRA 2BHHA 4RJ4A 2XIZA 1ZYCA 4F9AA 2VTRA 3HLLA 4AA0A 4LGDA 3WIGA 2B7AA 3OF0A 4CVAA 3EHAA 1RE8A 2BCJA 2YDIA 3NNUA 4IX6A 4O7SA 4Y95A 4IAKA 3PVBA 4I4FA 3SG8A 1GJOA 3FQHA 4RVLA 2OFVA 3VULA 5KHXA 3W32A 5H2UA 3C7QA 2GNHA 5AUTA 3E63A 3F3VA 5CZHA 2GNFA 1KWPA 3Q32A 4HGLA 2W5HA 3SXRA 3F69A 2YWPA 2XP2A 4FK6A 4FTKA 3AC3A 4OW8A 5J79A 2XIKA 2UZUE 4OBQA 3V5PA 4BCIA 4IACA 4FKOA 4WSQA 3QWKA 5CX9A 3HV7A 5L2WA 4M13A 3MVLA 4DH7A 3FI2A 2BIKB 4CFVA 3NUNA 3MY0A 5LMKC 4Z16A 3VBTA 5IA3A 5AP1A 4KS8A 1WZYA 3BYOA 4GW8A 2YEXA 3NAYA 3E7VA 4F6WA 2W1ZA 4FIFA 4YO4A 4KUJA 3P79A 5JQ8A 5TO8A 3IOPA 3T3VA 3UC3A 1NW1A 3G9NA 3PXRA 2R3NA 4CZUA 2ZJWA 2YISA 3VC4A 4JS8A 3UVPA 4AN3A 5E1EA 4IMYA 4UALA 3L9PA 3RAKA 3HMOA 1CDKA 1XH9A 5EM6A 4DBNA 2BKKA 3FKOA 2YCFA 4BWXA 4TYJA 3ZO3A 4YUQA 2ZV7A 4FV6A 2GDOA 3EZRA 4IVAA 4HVDA 3POZA 1GZKA 3NUAA 4FOCA 3SDJA 4CQEA 3UQGA 3LMGA 2C3KA 4U44A 3ID6C 2J7TA 4O22A 4YNEA 1Y8YA 2YCSA 5I3OA 2PUUA 3I5ZA 4E1ZA 2BRMA 5KO1A 5IQEA 3D5WA 4DFYA 3RM6A 3WIKA 2UZDA 3NIZA 4E4XA 4J99A 4RWIA 3NDMA 5HTBA 3SG9A 3TUBA 2HY81 4WA9A 4YZCA 3O96A 1H07A 4O96A 3UNZA 2CMWA 5AP2A 2IVSA 3U6JA 4JQ7A 2UW7A 3LLTA 3MN3A 4F64A 5KUPA 5AM7A 5M57A 1A06A 4OT5A 4F7NA 4ZSLA 4USEA 3GENA 3EN6A 4WOVA 3DB8A 4RG0A 2W0JA 2BROA 3IQ7A 3ZUVA 5D7VA 1FOTA 4IM2A 4U43A 3FZTA 3LIJA 2GS6A 3BEGA 4G17A 4QP7A 5HE2A 5LMKA 5GJFA 2XKDA 4L3LA 2HK5A 3BE9A 5HGIA 4XEYA 4NM7A 4MXOA 5HG7A 3FLNC 4JX7A 4EK6A 3KRLA 1M2QA 3HMPA 3ORNA 3CC6A 3GFEA 4L68A 1WBNA 2B55A 3QCQA 4GT4A 4JBQA 5EI2A 2PUNA 3RJCA 2GNJA 4MAOA 1Q3DA 2J50A 4DA5A 5CSVA 4H3PA 5LJJA 3PTGA 2XJ0A 3QAME 2UZLA 4EYJA 3EQFA 3MJ1A 4BBMA 3G2FA 3PPKA 4L3PA 4D1ZA 3R9DA 5L8LA 1Q8WA 5JRQA 4C7TA 5KMOA 2GCDA 3UBDA 4CT1A 4RVTA 4DEBA 4J96A 5CAPA 4I6HA 4X2FA 4A9RA 1NA7A 4L43A 2XUUA 4Y5HA 4BB4A 2GNIA 3VWAA 1OBDA 4HCUA 5M4CA 2C5OA 1YOJA 1OVEA 2QO7A 3BLRA 2AC3A 4F0GA 3N4VA 1O6KA 3SW4A 5FEQA 2ITNA 2IVTA 4M8TA 2X0GA 4WHZA 1XH5A 4PPCA 4U3YA 3L9NA 4WUNA 2QOCA 3GU7A 4M15A 5HG5A 5B2LA 3KMMA 5I9YA 3PDTA 4O7TA 4RJ7A 3WZUA 4FKPA 3TUCA 3ZS5A 2VO6A 1UU9A 3UIMA 4IB1A 1HCKA 3NYXA 3P1AA 5CSHA 4DFXE 4RGJA 2CJMA 3ET7A 2AUHA 5A9UA 4FV0A 3C0GA 5AA8A 4D28A 5K4JA 4EH6A 3TACA 2BILB 4K6ZA 2C5NA 3OMVA 5HE0A 4IZAA 5B2KA 3U51A 1OIQA 2CPKE 4RA4A 4ARKA 3T9TA 3FC2A 1BYGA 4LM5A 5J1VA 3BBTB 2PMOX 3ZM4A 4TKSA 3FLYA 2QVSE 2JBPA 4NTSA 2GTNA 3KVXA 3ZRKA 4IDTA 5EFQA 1SVHA 5G1XA 3QRKA 4YJNA 3RNIA 1YHWA 3I0QA 2GTMA 4HYUA 4OUCA 4E4LA 4EHVA 4GFGA 4XJ0A 1OBGA 2YM5A 3EYHA 2W7XA 4DFNA 5KMJA 4L9IA 2C5YA 3N9XA 4FSTA 4LMNA 4S2ZA 5A4TA 4BF2A 3KGAA 4IB3A 4F9WA 2WQNA 4G3FA 4J97A 4O0RA 3TT0A 3A4OX 4JI9A 2HW6A 1PMVA 4FNYA 3UO5A 2KULA 5AR3A 3U4WA 2R5TA 2EB3A 2ITQA 1VR2A 1J7IA 5JFSA 1H1PA 1ZARA 3HUBA 5JGDA 3D14A 2A1AB 3JUHA 3QL8A 2IVVA 4ZTMA 2OGVA 2YABA 3TNWA 3O2MA 4FNZA 4RSSA 3DDQA 2OXDA 2BKZA 4MF1A 2OXYA 4J53A 1P14A 3BHYA 2YIXA 1H28A 3DK3A 3W2CA 2BIYA 3FMHA 2CHLA 4I5CA 3OUNB 3RKBA 3GC0A 2J0MB 4RIXA 2J51A 3S4QA 4RJ3A 2ITVA 2FSMX 1JKTA 3W8QA 2BRGA 3D2IA 4GK4A 3GEQA 4CNHA 1SZMA 2B53A 3ZUTA 4TNBA 4HOKA 2R3QA 3HP2A 3LQ3A 3A7HA 4FX3A 3V04A 3QQFA 1OI9A 4NYEA 4AXAA 2C0OA 2PMLX 4KB8A 4BCKA 4QTBA 3CGFA 4LOQA 2WMUA 2GHGA 4D1SA 3BPRA 3K5VA 4FYOA 3O8UA 4F9YA 1KE5A 4LGHA 4TYHB 4CV9A 2QI8A 4HZRA 3R8PA 3PIXA 4D4YA 2G1TA 4IWOA 5KHWA 4CTCA 4DH1A 1UNGA 3QWJA 3HDMA 3RGFA 2J2IB 3E93A 2XKCA 2PE2A 4MX9A 2XNOA 4E5BA 5KNJA 4O27B 3KULB 1VZOA 4FSWA 5H9BA 4I4EA 2QU6A 1YHSA 2A0CX 3AXWA 3DKCA 3EN9A 2CGVA 4YC3A 3T3UA 4C59A 3KREA 2P3GX 3TEIA 3KXNA 4EK8A 3LHJA 3CD3A 5CEPA 2WMVA 2GNLA 3FZPA 3GC7A 4KKEA 3IS5A 4MXAA 4I5MA 4ZSEA 2J0JA 5CU2A 4H1MA 5KMMA 1JSVA 4D2PA 2WKMA 3LW0A 3V8TA 2Z02A 4PTGA 3CBLA 2GU8A 3C4XA 3KXXA 3KXMA 4HCTA 4XYFA 3RK9A 1VYZA 5DNRA 4C34A 1VEBA 5LVOA 4P5QA 3E3PA 4ZOGA 4NJDA 5F9EA 2YJRA 3GP0A 3NLBA 4O0YA 2BZIB 4QMPA 2WD1A 3R8ZA 4CD0A 2OWBA 3PXKA 4BDBA 5CU6A 3R00A 3PFQA
chains in the Genus database with same CATH superfamily
4GG5A 4CFFA 5EDQA 3HAVA 2WO6A 4EBVA 3I0OA 4QMWA 2PWLA 3MB6A 4RA5A 5HO8A 3UMWA 3ZBXA 2IWIA 4BIDA 4B99A 4D2RA 2E9UA 1IEPA 3KIOC 4E6CA 4PDSA 4LRMA 3WZDA 5IEYA 3O0GA 2QOBA 5DLSA 4KINA 3WZEA 5TR6A 1FMKA 4PMMA 3HL7A 5J7HA 2IO6A 4I3ZA 4BCHA 3A4PA 4N0SA 2OZAA 4AOTA 5LMBA 4IVBA 3BL7A 4IAFA 4GKHA 4R7IA 3QQHA 2EVAA 3MPTA 5M56A 4IX3A 4MBLA 5ANEA 3H3CA 2OIQA 5ETFA 3CPCA 4CZYB 1QL6A 1H1RA 1OUYA 3D2KA 2XNGA 2GQGA 3HV4A 3R8VA 5BPYA 2CGXA 1H4LA 4FT7A 3F9NA 1BX6A 3A61A 4U5JA 1S9IA 3RALA 1XQZA 5I5ZA 4O86A 5AUZA 5CTPA 4EJNA 3CEKA 3MS9A 5LXMA 4IM3A 3RCDA 3A2CA 2B4SB 4C02A 2W1CA 3U9NA 4BHZA 3KRRA 4B8LA 4QQCA 4C4IA 2BRBA 4IWPA 3IDCA 3TN8A 2OJ9A 4BY9E 2JGZA 3HV3A 1MRUA 1WVWA 4IVCA 4RC2A 2G9XA 4N6YA 4DG2E 5J9YA 2O0UA 3FXXA 1KE9A 4O0WA 5J95A 4D2VA 4QTCA 5H8BA 2VWUA 3R7YA 1IA9A 5IA1A 3SV0A 4ACDA 4JDJA 4BCGA 1AD5A 3GNIB 2W06A 4B7TA 1OKVA 3TNHA 4BGGA 4DDIA 4G31A 2YIWA 1O9UA 3NZ0A 3ZLSA 3R8UA 2I0VA 3ORXA 3VF9A 5KZ0A 1B6CB 1PXKA 3BYSA 3EFKA 5DPVA 1URCA 4FSMA 4BDIA 3D15A 3QQGA 3GCSA 5D10A 4M7IA 5C26A 4ZZNA 4LL5A 4O0TA 2PVJA 3MIAA 5FDPA 3LXPA 3EQPA 3VAPA 4NEUA 1PW2A 5IUHA 3QXOA 4QOXA 3MWUA 4KNBA 5E92A 3ZONA 2IZUA 4PPBA 3RHKA 4BIBA 4DG0E 3FLWA 3Q60A 4BWKA 4D9UA 1JAMA 1PKGA 3TUDA 2YN8A 3A60A 2ZM3A 4YLKA 2BMCA 5A4LA 3SVVA 3DFCB 5JFXA 2RG6A 2WTWA 2OXXA 2XARA 3W0QA 3PJCA 4Y83A 5HI2A 3REPA 3RAWA 4FG9A 3KMUA 1ZXEA 2OJJA 4I6BA 4USFA 5AUUA 3QBNA 4FTNA 4MUQA 5JGAA 4DCEA 2QO2A 4EH8A 5HNIX 2JKMA 2XK4A 5LWNA 2IW9A 5DOSA 5IQHA 4BWPA 3AD6A 3E3BX 5HTIA 2R7BA 1SNUA 1PXPA 3GQLA 4BC6A 4JG7A 2X81A 2HZ0A 2C3IB 2UW6A 3UVQA 3ZH8A 3DKOA 4YURA 4R8QA 4ZS0A 4QMMA 3DFAA 1YI4A 3QTZA 3ZC6A 5FTGA 3AC1A 4E6DA 3CKWA 3E8EA 4I6FA 4MTAA 3C5IA 3GC9A 4QQJA 4OTHA 4ACGA 4D5HA 4FKWA 3NX8A 4DBXA 1ZYDA 2XMYA 3WF6A 3QUEA 3F3WA 5DIAA 3FC1X 5ETCA 4DH5A 1G8JA 4QDEA 1DI9A 3PSCA 3RP9A 2JIUA 2PVKA 4BVUA 3PG3A 5A3XA 5AIRA 1VJYA 4LG4A 3O50A 3DNEA 5IQCA 1XR1A 2QOLA 2XK7A 4GYIA 3QTQA 5CVHA 3AC8A 2R0IA 2PPQA 3TTIA 4BDEA 2I6LA 3MA6A 3R21A 3R22A 2P4IA 1OPLA 3V5TA 5A54A 2G2IA 3T9IA 5CAVA 1OECA 3MGYA 3P86A 3MPAA 4U7ZA 3SX9A 1B38A 3UODA 1RQQA 3Q4ZA 2HOGA 3W2SA 4C61A 2W9FB 3QQLA 4A06A 1Q8UA 4FIJA 4GUBA 4AZSA 4XV2A 2FO0A 1RDQE 2HIWA 4XBRA 2CDZA 5L8JA 4JX3A 4NIFA 4L53A 4JBPA 3IW7A 2IZSA 1PF8A 4QYFA 4CKRA 4ZTLA 2PVYA 2GQSA 5AM6A 4BKZA 3TKHA 3COHA 4OTDA 5IMXA 2VX1A 2VTLA 2XK6A 3QKMA 3OC1A 4JIAA 4U9AA 2WB8A 4EZ3A 3TM0A 4UZDA 5CF6A 3L9LA 3R1SA 2PSQA 2VGOA 3KK9A 4JG6A 2XF0A 2ZB1A 4OTRA 4RIYB 4FVRA 1PXOA 4AXCA 3KF4A 4HNIA 4EOPA 3WOWA 3FYKX 1IA8A 2Y9QA 4RWJA 5EHYA 4BI1A 3VBYA 2WTKB 2XNEA 3E8DA 2R3RA 4FV7A 4G3DA 3VVHA 5FBNC 3FI8A 2ZV9A 3S95A 3PE1A 5JQ5A 3F82A 4BBEA 3ZZWA 3ANQA 2R3LA 3I60A 3II5A 4QTDA 1NVSA 4QYYA 4C4JA 1OZ1A 3HZTA 5TKDA 4RWLA 4WKQA 2PVLA 4X7QA 3R28A 4KIKB 4O81A 4BZOA 4FOBA 1G8AA 4GVJA 3UYSA 4H58A 5GNKA 3G15A 3HRFA 1F5QA 2XB7A 3N51A 4JG8A 4M0YA 5FEDA 4UYAA 4QQTA 4FRFA 2P0CA 3O23A 3G5DA 3AT4A 4RLLA 5FTOA 4BDKA 2RFNA 4CYJA 2JEDA 2LGCA 4O2ZA 3UTOA 4E4MA 4E26A 3I5NA 5AUWA 4WNOA 4Z55A 3QU0A 5AV3A 3RPOA 3ENHA 5AA9A 1YOMA 2W05A 3QQUA 1ATPE 4HGSA 2FUMA 2WZJA 4JDIA 4XH6A 5E90A 5IEVA 4U97A 3ZLXA 5JKGA 3V5LA 2VWYA 5E8SA 2W1DA 2YAKA 4EYMA 2YM6A 1T46A 2XIYA 3MPMA 3QTWA 3CTQA 1YXTA 2FVDA 3PWYA 4J52A 5HHWA 3IO7A 4ZTQA 4GUEA 3C13A 2IN6A 4TWCA 2X4ZA 3CR0A 3CCNA 4F65A 4QYEA 4L67A 3BI6A 4HCVA 1GY3A 5EI6A 4V0GA 4BDGA 4F63A 4IC8A 4TTHB 1ZMUA 3NCZA 4C4FA 2C68A 4FYNA 3CJFA 3KA0A 3LMHA 4FL3A 3FDNA 4XS2A 4A4LA 4RPVA 4CTBA 1ST0A 5IDPA 1QCFA 3GVUA 2ITWA 3WZKA 4DINA 2DWBA 3VS2A 3KXGA 2C3JA 3F7WA 2I0EA 3MY1A 4PL3A 1W2CA 4IWQA 3V8WA 4EI4A 5JH6A 4X3FC 1FVTA 4DHIB 1YDRE 4OT6A 3FXWA 4WD5A 5FM2A 4BCJA 2VGPA 2XVDA 4OTPA 4GKIA 2VTNA 3NUYA 4YJUA 3OHTA 3V01A 4FGBA 3MYGA 3ZO2A 4QTEA 1PY5A 3COMA 3UE4A 4JLCA 2AC5A 4D4RA 2HY0A 4QD6A 3TDVA 3VJOA 3E88A 1OPKA 3OT3A 4IVDA 3L9MA 2HWPA 4E7WA 3THBA 4QP9A 2C1BA 4UWCA 3A8WA 2B9HA 5ITAA 1PYXA 1YXVA 3S3IA 5HQ0A 3OZ6A 4R3CA 4OTFA 4XP3A 4YLLA 3UZTA 2AYPA 3BHVA 1WBOA 3CD8A 3AD5A 3FSFA 4ANMA 2RFDA 1OMWA 4TY1A 4C2WA 4FIEA 4QMTA 1XMMA 4O7WA 2CNQA 4LV7A 1JPAA 4FTCA 3TV7A 4C38A 3COKA 2X4FA 3TDWA 1YRPA 2HZNA 4FL2A 2CKEA 2J0LA 3QCSA 5HU9A 2R4BA 1XH7A 4QPSA 2VX3A 2FSTX 3AT3A 3WF8A 5CALA 3N4TA 2PYWA 4BTJA 4AZWA 2CCHA 3D7TA 4JR7A 3RK7A 2QQ7A 2F49A 3C5UA 3QZFA 5J1WA 5DT3A 4NUSA 3PA5A 2Y6MA 2XNPA 3ORPA 2Z7SA 1XH4A 3ZSGA 3DLZA 4C4GA 3QHRA 1R39A 5IQDA 1A9UA 4BTMA 3DKFA 2V62A 1Q5KA 4A9TA 3G6HA 1APME 4IHPA 4JL9A 4L52A 2JBOA 4S31A 1YXSA 2V7AA 3BYMA 4EK4A 2FH9A 5HLNA 3CQUA 4FZDB 1REJA 1P2AA 1RW8A 3OWPA 3RM7A 1FGIA 1OL5A 4MXXA 4BDFA 4IM0A 3LCDA 2X0QA 4II5A 4HPTE 4F78A 4BTKA 5CASA 5HICA 3MTFA 4EEVA 5BV3A 1URWA 3ZZEA 4RQVA 3PE2A 3EQGA 3Q6WA 3W0RA 2AQXA 3BCEA 1KV2A 2B54A 4UV0A 5H8EA 2VWZA 4DEIA 3EYGA 4OBPA 5HESA 4HW7A 5HORA 5EQEA 3UG1A 1SVEA 3DBFA 3ORIA 5AV4A 2BRHA 3JVSA 2Y4IB 5L6PA 3SAYA 4I94A 1WVXA 4M14A 4EK3A 2VZ6A 1TKIA 2OIDA 3BGQA 2C6OA 2PULA 4S32A 1Y57A 5KZIA 3CIKA 1OB3A 1IAJA 4ZTHA 5EQPA 3QTSA 3CY2A 3AC2A 2UVYA 4QMSA 4HVIA 2Q83A 4TPTA 4ZZMA 4RFZA 3G51A 4EH7A 3F61A 3CTJA 4C0TA 4MHAA 4ZTRA 3MFUA 4FTIA 3SC1A 4AU8A 4YC8A 3LQ8A 5J5TA 4F7LA 5LWMA 1F0QA 3OOGA 3SLSA 1QPJA 3NWWA 2VTJA 4PDYA 1CSNA 3F5PA 4GIIA 5HIDA 3VN9A 3AC4A 5ETIA 3ZMMA 4EOSA 1OITA 4RLKA 2R3HA 4KIQA 4EZ7A 1R1WA 4U3ZA 4I41A 2PVHA 3U4UA 1YI3A 3H4JA 4FSNA 4ZSGA 4FTMA 3C0HA 1H1QA 5EYCA 5KKRC 2CNVA 4FEXA 4QPMA 5I9WA 3ZEPA 4I0SA 3VBXA 4YBJA 3OWJA 3SA0A 3CTHA 3HMMA 4LOPA 5CS6A 1DAWA 3PJ1A 3LE6A 3MH2A 2XEZA 4FI1A 3FI4A 4O7ZA 3R0TA 3TNQB 4PQNA 3ORKA 5EOBA 1V0BA 4L42A 2C5XA 2HELA 3F6XA 3UGCA 2ITXA 1QPDA 4YZDA 2WMSA 4OTWA 4DEDA 4FV3A 5FXQA 4I6QA 4I21A 2F7XE 5CI6A 3R7UA 4D4VA 4RIWA 3OBJA 5AR5A 3GB2A 2OF2A 2QOKA 4LYNA 3BQCA 3VJNA 4QMVA 3ZO4A 5HD4A 4DT9A 3HX4A 1YVJA 3WARA 2YM3A 2OIBA 3I6UA 3MDYA 5CU0A 4DTAA 3Q96A 5J9LA 1KSWA 1TZDA 4LGGA 2WTDA 2B1PA 2EXMA 4TYGA 4EC8A 2BRNA 4GK2A 3GC8A 4WNPA 2PZRA 4P5ZA 4UMRA 4DCAA 5IQFA 2X0PA 4N6ZA 4M84A 3ROCA 3W16A 5KX8A 2RFEA 2C69A 5FP6A 4DHJA 1G5SA 4FSQA 3FHRA 3GXLA 4FT3A 3NVKI 3AG9A 3AQVA 3PY1A 4FUXA 4B6LA 5L4QA 2C47A 3OCBA 2J9MA 1YWNA 4AWIA 4BJJA 5L2QA 4I20A 4A4XA 4ZJJA 4YHTA 2W5AA 1H1WA 2C6KA 1ZZ2A 3F5UA 1ZYLA 5T6KA 4CV8A 4FVPA 3UMXA 3DB6A 4U6RA 3QCYA 5E8VA 2WELA 3HMIA 1ZMVA 5AAFA 3MY5A 1LEWA 3K5UA 4F0IA 3U54A 1M14A 3ZRLA 1ND4A 4YJTA 2WOUA 1Q62A 1XKKA 3COIA 4FTOA 4IZ7A 4F0FA 2VAGA 4X0MA 3PJ8A 3P7AA 5DT4A 4R78A 1OL7A 4DF3A 4O4EA 4DFZE 4FNXA 2R3KA 5HIEA 1TQPA 2LAVA 3WF5A 3FLZA 1UKHA 4IAZA 4E3CA 3MFSA 3NCGA 4LQMA 5HVJA 5F4NA 4EH2A 1PMNA 5ANGA 3C51A 5ANIA 5L2SA 5DFPA 3BV3A 2QKRA 3FMKA 3ULIA 3SXFA 3HVCA 4O6EA 2ZVAA 2OW3A 5IH4A 4QMLA 4EKLA 4PTCA 2RL5A 3VS6A 4UXQA 4BCNA 4AXEA 2Y8OA 2QG7A 4W4YA 3FZ1A 1OGUA 4MH7A 4R5YA 1U54B 3UPZA 2YIRA 2WEIA 4I0RA 3FY0A 4QT1A 1OGYA 2I1MA 2J0KA 5FGKA 2E9VA 4BYIA 3I7CA 4F09A 4AW1A 4F9BA 3C4FA 3OTUA 4D9TA 3R83A 4DLJA 1U46A 5DEYA 5ICPA 3S0OA 1XJDA 4IB0A 1H24A 4U45A 1J1BA 1WBVA 3O8TA 2J90A 5B7VA 5IH5A 4JAJA 5JGBA 5M4FA 3N4UA 2OK1A 2XCHA 4IJ9A 4WUAA 3SXSA 5HCXA 5IUGA 1FVRA 3NNXA 1OM1A 3HKOA 5HX8A 1UWHA 3DT1A 3RZFA 1FVVA 3DJ7A 3UIUA 3BU5A 4XV3A 4I1ZA 2ITUA 3A62A 3GOKA 2QD9A 3PG1A 5D11A 4R1YA 3UC4A 4LV5A 2PZ5A 4BZNA 5E8WA 4RX5A 1J7UA 3BHUA 5D12A 3WE8A 4KS7A 2VUWA 5DI1A 2UZTA 3EMGA 5IG1A 3IONA 4LI5A 2R3JA 5CEKA 4HYSA 4EK5A 4GCJA 3R8LA 3UNKA 4BDAA 5C8MA 3MI9A 2C0IA 2JC6A 2PK9A 4EQCA 4Z7GA 4F9CA 4CGAA 3ZHPC 1B39A 2OH4A 4QEBA 2DS1A 2BAKA 4TNDA 4PPAA 2BZJA 5IKWA 3BIZA 2CN5A 2WU7A 5TT7A 5GZ8A 3BYVA 3DK7A 5C03A 2PHKA 2BDWA 4UZHA 1Y91A 3PA3A 4AT5A 2QCSA 5M4IA 3UDSA 3QX2A 3FPQA 5J9ZA 3TI1A 4F4PA 2WXVA 3S2PA 5AR7A 5F20A 3R9OA 4IJPA 5A46A 4MKCA 5E1SA 5EM5A 2OG8A 4NM5A 1PJKA 3E64A 3G9LX 4NW6A 1U5RA 4FGRA 3PUPA 1Z5MA 3BL9A 3HV5A 5IQIA 4CG9A 1H01A 3L8XA 5EHLA 2WAJA 4KRDA 5HBEA 2GPHA 4XOZA 2YM7A 3D83A 4GEOA 5CT7A 3RMFA 5M4UA 5ANKA 4AZTA 4WBOA 4BICA 3QD3A 1K9AA 3R1NA 1W7HA 3R7VA 4YSMA 4ZS4A 2WTVA 1ZWSA 5DN3A 3MA3A 4HGTA 4RMZA 3AD4A 5EYKA 2AEGA 4R5SA 3S00A 1JKKA 4OTQA 5DGZA 1BL6A 1PHKA 3FKNA 3TNIA 4CLIA 3FZSA 4FKTA 4FTUA 4IIRA 3BQRA 4YZMA 5JZJA 3TMOA 3QRTA 1AGWA 4TWNA 3QUPA 2I40A 3GCPA 3OY1A 5KMKA 2JFMA 2UZEA 2QR8A 1LP4A 4JVGA 1Q3WA 4PP7A 2C5VA 3R01A 3TCPA 4MEDA 5CNNA 4AE6A 3VS3A 4AP7A 3OCTA 1KE6A 4AN9A 4MF0A 5K5XA 5HZNA 4HZSA 4M69A 4C8BA 2ACXA 1K2PA 4JMQA 4FUYA 3LLAA 4BCFA 3LM5A 2Z2WA 5ANJA 2FSOX 4RFYA 3VS1A 2VD5A 5BYYA 4K77A 4APPA 3FQEA 4MD8E 3HYHA 5C01A 2V0DA 3RWPA 1Q99A 2VN9A 2XAOA 4I24A 5JFWA 3OUKA 4QP3A 2JDVA 2CKPA 3ETAA 5CEQA 4PMPA 1M7NA 1NXKA 3LFEA 1YQJA 3MH3A 3QTIA 5JZNA 3UG2A 1W84A 4L44A 3RPVA 5HO6A 3RVGA 3IDBA 3F2AA 5K0KA 3A7GA 4Y73A 4M66A 3DXPA 2C6TA 1SNXA 2OZAB 4AF3A 4W8EA 5E91A 4FL1A 4E6QA 4UMTA 3UNJA 4FJVA 2P2HA 5EW3A 3AKJA 4TWPA 2Q0BA 4F6SA 2JDRA 2X6DA 3GCQA 3Q4CA 3QA0A 4JT3A 5K0XA 4CLJA 5DH3A 4W4WA 4HNFA 5JRSA 1LUFA 3SKCA 2QLQA 4LOOA 1FMOE 4AA5A 4D5KA 4TYHA 5AX9A 4ENXA 2BZKB 4WNMA 3DY7A 1PKDA 2P33A 1BLXA 4MQ2A 3HP5A 4DGMA 3SOAA 3LKMA 1PRYA 3B2WA 3KFAA 4QP2A 4FSUA 4XCUA 5AP0A 3E7OA 2ZM1A 3F7ZA 1BMKA 2VTOA 2UW4A 4UEUA 4EUTA 4XMOA 3HV6A 4IAAA 5AUVA 3ZEWA 4PWNA 2BAQA 3DNDA 3DLSA 5B0XA 4QP4A 5HCZA 4BRXA 4DYMA 4ENYA 5JK3A 3OXTA 4C4HA 5L2TA 4P90A 4EHZA 4H05A 4ITIA 2QU5A 3PSDA 3VQHA 2PVNA 4ASDA 4X6RA 4DN5A 5JEBA 5BYZA 1GZNA 3P9JA 2E9OA 4J95A 5HE3A 1W2DA 2XRUA 5IDNA 4FKRA 5DR6A 2I0YA 4BYJA 2XNMA 2UZVA 2BDFA 5BVEA 3UO6A 2CSNA 3H9FA 4KKHA 5FXSA 4D2SA 3FMNA 4EC9A 2PZYA 5AP3A 1G8KA 4XG9A 4GT3A 2C0TA 2XH5A 5FWKK 4QMQA 1DAYA 3K54A 4GU9A 3QQJA 2R3PA 5EKNA 3FKLA 3KC3A 1QPCA 2JKOA 3KEXA 4O21A 1Z9XA 5IEXA 1J7LA 3EOCA 3V5JA 4CXAA 1CKIA 2A2AA 4BDDA 4QNAA 2OLCA 2W1IA 3L8VA 3ALNA 4FZFB 2OFUA 4PRJA 4FV2A 4NTTA 1UU7A 4U8ZA 3VUTA 3ZDUA 4CFUA 3H0YA 4QP8A 1GIIA 4O2PA 5D1JA 3ZUUA 3VBWA 5IA2A 5L8KA 4C35A 4F7SA 3QD4A 2XNNA 3V8SA 4DGLC 4DT8A 4MWIA 5KE0A 3LFNA 2ZM4A 3E8NA 2VO0A 2HXQA 4K11A 4RX7A 1Q24A 4P7EA 4O1PA 4ITJA 5CSXA 4ZMEA 2VWXA 2WU6A 2CKOA 3VUHA 4USDA 4DTBA 1QPEA 1SYKA 1KUTA 4B4LA 3OD6X 2BALA 4UBAA 2BVAA 1JKLA 2Z7QA 3PVUA 5IQAA 4QMZA 5AAEA 4X2JA 5FLFA 2JKQA 5CEMA 3RWQA 4I0TA 1W83A 1OIUA 2OU7A 3W55A 4E5AX 5IA0A 3F2RA 5DHJA 4DHZA 4A9SA 2PE0A 4ANSA 4YZ9A 3KB7A 2BAJA 2Y0AA 3LXNA 2V5QA 4YJPA 3EQDA 4FTJA 4C62A 1UV5A 4ASXA 5IPJA 4O7YA 5LCKA 4DG3E 1PXIA 3ENMA 3L8SA 1H08A 4IB5A 4BCOA 4DEHA 2B52A 2X8IA 4UXLA 2UW8A 4V05A 1GIJA 2R3OA 3HRCA 4F1MA 1MUOA 4C3FA 4ZIMA 4D2TA 3SW7A 4O82A 3HAMA 3U9CA 1E9HA 5D41A 1J91A 5CXZA 4FV4A 3ZC5A 1YI6A 3OEZA 4YTHA 4AW2A 3LJ1A 1WBWA 4OGRA 1ZMWA 2WMAA 5AR2A 3R6XA 4G16A 3WI6A 3BLAA 4TYIA 3S1HA 5B2MA 2XA4A 4KBKA 3P0MA 3Q9ZA 1JVPP 3A99A 3OCSA 2QHMA 2GHMA 3V6RA 4DGGA 2PU8A 1Y6BA 4BGQA 2C3LA 4ALUA 3MFRA 4CMUA 4ZTNA 3F5GA 2YM4A 4XX9A 2V55A 3PXQA 4YZNA 4PY1A 5M07A 4JXFA 2OJFE 1M2RA 4NIFB 2WGJA 3ZXZA 1LR4A 3SHEA 3VRZA 3JS2A 2GFCA 4YJOA 4F08A 2UV2A 3E8CA 4FTLA 5TOZA 5A4CA 1QMZA 4ZLZA 2VRXA 3FL4A 2NYAA 2X2KA 3QTRA 2VTMA 4IAYA 4XUFA 5AV1A 4PV0A 3BHTA 4G6OA 4KBCA 4EH9A 5FP5A 4ZLYA 5M53A 2WMXA 3KN6A 4QYHA 4ERWA 5AFVA 2VTTA 4K0YA 2R64A 4WG3A 3AMAA 3DXNA 4HPUE 3R30A 4FKQA 4XNEA 4FIHA 3D5XA 5CNOA 4BI0A 2CKQA 4CFMA 2ERKA 4HYHA 1W82A 1KE7A 4XV1A 5JSMA 4MWHA 1ZRZA 4ZLOA 4XBUA 5HCYA 5F94A 3EQIA 4O0UA 4RBLA 2C6DA 1GZOA 2EXEA 5D9HA 5BMSA 3MB7A 4B8MA 2XCKA 2YM8A 4X6QC 4AQKA 2FA2A 3MV5A 3QHWA 4FKLA 4MBJA 4H1JA 4YHJA 3KQ7A 5TE0A 4CKIA 4J71A 3DDPA 2A4LA 3BHHA 4G3EA 3RZBA 2YFXA 1FINA 3DBCA 3OCGA 3RI1A 4CMOA 1IRKA 3GQIA 4MBIA 3DZOA 1J1CA 2X8DA 5FRIA 2J6MA 4DFBA 5CENA 2BFXA 2WTKC 4IH8A 2ITOA 5I4NA 2QLUA 3NUPA 4L46A 3G90X 3MTLA 4J1RA 4GFMA 2UZNA 3QZHA 4RT7A 3Q9XA 2E2BA 3EN4A 2ETRA 4KBAA 2ZB0A 4XG2A 3Q4TA 4U80A 4YJSA 3IW8A 4EZ5A 2QOQA 4LMUA 3BE2A 4YR8A 5KBRA 1CKPA 3K3IA 4OTGA 2B0QA 1R78A 3FMDA 5HO7A 3LFSA 5I3RA 4ANLA 4FKGA 4F7JA 4P4CA 5CF5A 1I44A 2GNGA 4JNWA 3SRVB 5EHOA 2UW9A 4D55A 5BNJA 3MSSA 3ZSIA 3ZSHA 2ZV8A 2VX0A 3QKKA 2HZIA 2V22A 2W1GA 4A4OA 3OS3A 4I93A 2QOFA 1RJBA 4XG6A 2IZTA 5IMEA 3C4CA 3F2NA 3TV6A 1L3RE 2XANA 4O1OA 5K3YA 3RPYA 3PA4A 5J7BA 3PIYA 4FZAB 1REKA 4G9CA 5BUEA 5EYDA 2C6LA 2O63A 3QF9A 5CU3A 2HXLA 2J0IA 3R2YA 1U59A 4CZTA 2NNWB 2JFLA 3OXZA 5E8YA 1JOWB 5BVKA 2YITA 5KBQA 4GRBA 2E9PA 4GSBA 5G6VA 1YDSE 3SQQA 5AR8A 4MNEA 4KIOA 5I9VA 1V0PA 5KCVA 5FUTA 4AXFA 1Q8ZA 2QOIA 4W4XA 4DITA 3FEGA 4KIPA 4PL5A 5GJDA 5C27A 4AT3A 4Z7HA 3QTXA 3P08A 4K1BA 1UU8A 2OF4A 4KD1A 2REIA 2GS7A 4RIYA 2DYLA 4UYNA 3V5WA 2XNBA 3EFLA 4WO5A 3F66A 4O4BB 4BDJA 4CKJA 2JD5A 3CS9A 3W2RA 4IDVA 4LUDA 4YSJA 1PXMA 3EJ1A 3ERKA 3H10A 5DR2A 1W2FA 4I22A 3DZQA 3R9HA 3BU6A 3VUGA 5CY3A 3EL7A 3HMNA 5HVYA 4AAAA 2R2PA 3GCUA 3QC9A 4UX9A 5M06A 4LRKA 3RTPA 4O7VA 3UVRA 2ZMCA 4G9RA 1HCLA 4QMYA 5FBOA 2ZV2A 2C30A 2WMRA 4EOLA 1BKXA 3PY3A 1OKWA 5DT0A 3R9NA 4KIKA 1M7QA 3MW1A 2XK9A 4L7SA 2QC6A 2XKFA 2OH0E 3C4EA 4ZJVA 4FEWA 3M2WA 2YLFA 3NIEA 4GYGA 5BMMA 4ZSAA 1V0OA 4AOJA 5HLPA 2H9VA 1WMKA 4Q9SA 1GOLA 5BYLA 4OAUC 4LUEA 4RX8A 2EB2A 3LQ5A 5JN2A 3CPBA 4HVGA 3D7TB 1STCE 1YOLA 4X2GA 3CLYA 3WZJA 3PXFA 4FA2A 4YPDA 4O0VA 2BUJA 2YDKA 5EDRA 4GIHA 3SGCA 4RC3A 3EH9A 1P4OA 4TN6A 1ZOGA 3VBQA 4EOQA 3VNTA 3R8MA 3IW6A 4GH2A 3MVJA 3PWDA 4QMXA 3C1XA 4U42A 3UPXA 2BZHB 4ZZOA 4KKGA 4RZWA 4NZWB 3O7LD 1BL7A 4AACA 3PY0A 3FMEA 4YHFA 4B9DA 2XYNA 3FZOA 4UWYA 1XWSA 3DBDA 5M08A 4BFMA 2Z60A 4YGAA 4NT4A 1H0WA 1OKYA 4ACHA 5K9IA 5TF9A 1NT2A 3VUIA 2ERZE 3POOA 5C9CA 3IK3A 2NO3A 3I1AA 4ZEGA 4C36A 1PXNA 4FEVA 4E93A 3M11A 3DPKA 4HGEA 5CF4A 3D9VA 4A9UA 2VWVA 3DXQA 3I79A 2X9FA 3MJ2A 4FSZA 2GS2A 4I6LA 3P23A 1DS5A 4U41A 4AFEA 2C4GA 4BCMA 3UQCA 5I9ZA 2HYYA 3FZRA 4O91A 5AR4A 4HVSA 4X3FA 5D7AA 2R9SA 3F3ZA 5HNGA 1SM2A 2H6DA 2OKRA 3K2LA 5HEZA 2P55A 2HZ4A 3LVPA 1M52A 4Z9LA 1ZAOA 3ZXTA 5AADA 3HDNA 2IW8A 2ZFYA 5EW9A 1JWHA 2GMXA 2J5EA 5A14A 1KV1A 3QTUA 3Q53A 2FB8A 2IZRA 2YZAA 3G33A 5DEWA 2Y4IC 4AUAA 3ATTA 3DOGA 4XRJA 5E7RA 1NY3A 4FODA 3UO4A 2JIIA 3PSBA 3Q3BA 3PLSA 4KSQA 4LV8A 4ZP5A 5DWRA 2WNTA 4XOYA 4AN2A 1A48A 2CNUA