5AMEA

Crystal structure of the bromodomain of human surface epitope engineered brd1a in complex with 3d consortium fragment 4-acetyl- piperazin-2-one (sgc - diamond i04-1 fragment screening)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
SMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 1
publication title Crystal Structure of the Bromodomain of Human Surface Epitope Engineered Brd1A in Complex with 3D Consortium Fragment 4-Acetyl-Piperazin-2-One
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ameA00
1WUGA 3NXBA 4O75A 3MQMA 4J0RA 5C85A 2OO1A 5CUDA 2YYNA 5DFDA 4TZ8A 4YADA 5IIDA 5ETDA 4HXNA 4UYGA 5FB1A 2F6NA 4WHUA 5HQ6A 4TT2A 5HLSA 5DYAA 4PCEA 4OGJA 5HEMA 5CUEA 4HBYA 5DW2A 4UYHA 2D82A 5FB0A 4YYNA 4KV4A 2YQDA 5ACYA 3UVXA 4N4GA 5EK9A 2L5EA 5H1VA 4NUEA 4YH3A 4Q0OA 5F3AA 4TT6A 5I7YA 5KTUA 5FH6A 3LQIA 2WP2A 5EPRA 5I83A 5LJ0A 3UV2A 4A9EA 5CTLA 4NQNA 4QSTA 1E6IA 4YBTA 4QEUA 5E9YA 5CFWA 1WUMA 4QNSA 4HXSA 5FBXA 3IU5A 4CURA 2KTBB 5LVRA 2GRCA 4GPJA 5CS8A 4NYWA 5HRVA 5EWWA 4BW1A 5D3HA 1JM4B 5HM0A 3K2JA 5EISA 3SVFA 2H60A 4TT4A 5IGMA 3LXJA 4NRAA 4PS5A 2RI7A 4LRGA 5HRXA 5A5OA 4NYXA 4Z1SA 5KTXA 4Q0NA 4NRBA 1N72A 5G4SA 4QSPA 5A82A 5FE5A 3HMHA 3RCWA 2N9GA 4N4FA 4NS5A 4XYAA 2RNWA 3Q2EA 5DX4A 5I40A 4NRCA 5F36A 5JWMA 3JVLA 4QR3A 4O7FA 5BT5A 3U5NA 2DVSA 4CUSA 5K29A 5HFQA 5FG6A 5LJ1A 4NR8A 3U5JA 4MR5A 3UVWA 5DBMA 4MENA 4O7CA 5F2PA 4A9OA 2YELA 5II2A 5C8GA 4CUUA 4QC3A 4YYIA 5HFRA 4QYDA 4BW2A 4QSRA 3P5OA 5CY9A 5F62A 4QBMA 5HRWA 4YK0A 4O7BA 2DKWA 3U5OA 4YY4A 5ENIA 2DVQA 4CUQA 3O33A 5CQ5A 5CRZA 4HXLA 4YAXA 5I29A 4NQMA 4YBMA 5DW1A 4BJXA 3QZSA 4LYWA 5CRMA 4O7EA 4TS8A 4ZC9A 4QSWA 3QZTA 5D3SA 4YYKA 5FE4A 4CL9A 4O77A 4RVRA 3HMEA 5EPBA 5F1HA 3MULA 4CFKA 4HXRA 5CU8A 4Z6HA 4NR4A 4O70A 5CZGA 2D9EA 5EP7A 3MXFA 3S91A 3SVGA 4UIZA 4N4HA 4O72A 5CQ4A 4UYEA 5D3RA 4UITA 3ZYUA 4Z6IA 5AMFA 4N4IA 4PTBA 5KU3A 4MEPA 5E3GA 5EWVA 4Z1QA 5DLXA 4O78A 2E3KA 5FFVA 5E9VA 2L84A 4NUDA 5I7XA 5LVQA 2RS9B 4QSXA 4PKLA 5AD2A 4J0SA 2F6JA 5E74A 5E73A 2E7NA 5FFWA 4NR5A 5C87A 5H1TA 5DKCA 5FE6A 3HMFA 4LC2A 4TU6A 2YEKA 5FG5A 5FH7A 5HJCA 5FE9A 5DKHA 5EV9A 5EM3A 3FKMX 5D24A 4NYVA 3SVHA 4LYSA 4ZQLA 4N3WA 4YYMA 4XUAA 5CUGA 3ONIA 4LZSA 5II1A 5FE1A 5I88A 5ENEA 2R0SA 4X2IA 3U5LA 5DY7A 5I80A 4IR3A 4LDFA 5D26A 4WHWA 4TYLA 2I7KA 5AD3A 4A9JA 2G4AA 5BT4A 2L85A 4KV1A 4WIVA 4CFLA 5CUCA 5CQ7A 4QSSA 5L8TA 5ENBA 3LQJA 2NXBA 3UVDA 5FE7A 5EA1A 5A83A 3U5MA 3MB4A 5HQ7A 4QC1A 5CQ3A 5IG6A 4A9NA 5CQTA 4QR4A 5AMEA 4IR6A 3UV5A 4HXKA 4O7AA 5DLZA 4QEVA 4YBSA 4UYDA 5D0CA 5IBNA 4A9FA 3P1DA 4A9IA 5D3LA 5I89A 4UIYA 4LYIA 2YEMA 2YDWA 3D7CA 2RNXA 5A5SA 4KCXA 4QUUA 4UIXA 5LKUA 4HBVA 3JVMA 5CQ6A 5KHMA 2OUOA 4HBWA 5HQ5A 5DKDA 4IORA 3MB3A 5TCMA 5E0RA 2DWWA 5E7DA 3DWYA 2RNYA 2R0VA 2RFJA 5CUAA 3QZVA 5LJ2A 4UYFA 3P1CA 5CQ8A 5L96A 4ZW1A 4FLPA 5J0DA 4QZSA 4O76A 4MEQA 5D7XA 5FFYA 5A5PA 3LJWA 4TU4A 5CGPA 3UW9A 1X0JA 4O71A 4MR3A 5G4RA 4QB3A 4F3IA 3UVYA 2E7OA 5E9MA 3U5KA 5D3TA 2DVRA 5A5QA 3U5PA 4NXJA 4TTEA 4YATA 5ENHA 5A5RA 5FDZA 5EGUA 5EVAA 5LKTA 5IGKA 5FE0A 4NR9A 4QUTA 5DYUA 3IU6A 3TLPA 3O37A 1JSPB 5A7CA 5ENCA 5F60A 4QSQA 5BT3A 4QSUA 4LR6A 5ENGA 5A85A 5CPEA 4YYGA 5LKZA 5A5NA 4ALHA 4YY6A 1EQFA 5IGNA 5EWDA 1F68A 5A81A 4YYDA 3AQAA 3P1EA 2DATA 4NR6A 5F63A 5DYXA 5H85A 3DAIA 4XY8A 3P1FA 5HENA 4A9HA 5E9LA 4Z93A 5F61A 5ENJA 2MJVB 5F1LA 5E9IA 4XY9A 5D3NA 5IGLA 2LSPB 4OGIA 4YH4A 4QEWA 3MUKA 4J1PA 4BW3A 5CUBA 5C7NA 4MR4A 4OUFA 5H1UA 5DFBA 4MEOA 2FSAA 4CUTA 5FG4A 4UIVA 5E3DA 4CLBA 4YABA 3LQHA 5CQAA 5E9KA 3G0LA 4IOQA 4MR6A 4ALGA 3O36A 4YYJA 4QY4A 3O35A 4QR5A 4A9MA 3S92A 5I1QA 4O74A 4C67A 5EPSA 5EICA 4NUCA 3JVKA 5TB6A 4YYHA 5ENFA 5LUUA 5HELA 3G0JA 5L97A 4QSVA 3GG3A 5EWHA 4NR7A 5FH8A 3O34A 5F5ZA 3UV4A 3JVJA 4TQNA 5KTWA 2YW5A 5JI8A 3Q2FA 4LZRA 5D25A 5FE8A 4BHWA 5FE2A 5I86A 4HBXA 4E96A 2DVVA 2RO1A 4BW4A 5EQ1A 5ETBA 2R10A 5DYCA 4PY6A 4CUPA 5L99A 4DONA 2I8NA 5KO4A 2OSSA 5FE3A 5EI4A 4UIWA 5EWCA 5F25A 5C4QA 4IR5A 4J3IA 5L8UA 4Y03A 4UYFB 3AADA 5D3JA 2WP1A 4AKNA 3I3JA 4LZ2A 5DFCA 4IR4A 4TZ2A 4A9KA 4XUBA 4HXMA 2R0YA 4PCIA 4QYLA 5CP5A 1ZS5A 5D3PA 5L98A 5C89A 4IOOA 4YC9A 4UIUA 5HCLA 4HXOA 5EU1A 5LKXA 4HXPA 4C66A 5COIA 4A9LA
chains in the Genus database with same CATH superfamily
1WUGA 3NXBA 4O75A 3MQMA 4J0RA 5C85A 2OO1A 5CUDA 2YYNA 5DFDA 4TZ8A 4YADA 5IIDA 5ETDA 4HXNA 4UYGA 5FB1A 2F6NA 4WHUA 5HQ6A 4TT2A 5HLSA 5DYAA 4PCEA 4OGJA 5HEMA 5CUEA 4HBYA 5DW2A 4UYHA 2D82A 5FB0A 4YYNA 4KV4A 2YQDA 5ACYA 3UVXA 4N4GA 5EK9A 2L5EA 5H1VA 4NUEA 4YH3A 4Q0OA 5F3AA 4TT6A 5I7YA 5KTUA 5FH6A 3LQIA 2WP2A 5EPRA 5I83A 5LJ0A 3UV2A 4A9EA 5CTLA 4NQNA 4QSTA 1E6IA 4YBTA 4QEUA 5E9YA 5CFWA 1WUMA 4QNSA 4HXSA 5FBXA 3IU5A 4CURA 2KTBB 5LVRA 2GRCA 4GPJA 5CS8A 4NYWA 5HRVA 5EWWA 4BW1A 5D3HA 1JM4B 5HM0A 3K2JA 5EISA 3SVFA 2H60A 4TT4A 1PUOA 5IGMA 3LXJA 4NRAA 4PS5A 2RI7A 4LRGA 5HRXA 5A5OA 4NYXA 4Z1SA 5KTXA 4Q0NA 4NRBA 1N72A 5G4SA 4QSPA 5A82A 5FE5A 3HMHA 3RCWA 2N9GA 4N4FA 4NS5A 4XYAA 2RNWA 3Q2EA 5DX4A 5I40A 4NRCA 5F36A 5JWMA 3JVLA 4QR3A 4O7FA 5BT5A 3U5NA 2DVSA 4CUSA 5K29A 5HFQA 5FG6A 5LJ1A 4NR8A 3U5JA 4MR5A 3UVWA 5DBMA 4MENA 4O7CA 5F2PA 4A9OA 2YELA 5II2A 5C8GA 4CUUA 4QC3A 4YYIA 5HFRA 4QYDA 4BW2A 4QSRA 3P5OA 5CY9A 5F62A 4QBMA 5HRWA 4YK0A 4O7BA 2DKWA 3U5OA 4YY4A 5ENIA 2DVQA 4CUQA 3O33A 5CQ5A 3VKHA 5CRZA 4HXLA 4YAXA 5I29A 4NQMA 4YBMA 5DW1A 4BJXA 3QZSA 4LYWA 5CRMA 4O7EA 4TS8A 3D1BA 4ZC9A 4QSWA 3QZTA 5D3SA 4YYKA 5FE4A 4CL9A 4O77A 4RVRA 3HMEA 5EPBA 5F1HA 3MULA 4CFKA 4HXRA 1ZKRA 5CU8A 4Z6HA 4NR4A 4O70A 5CZGA 2D9EA 5EP7A 3MXFA 3S91A 3SVGA 4UIZA 4N4HA 4O72A 5CQ4A 4UYEA 5D3RA 4UITA 3ZYUA 4Z6IA 5AMFA 4N4IA 4PTBA 5KU3A 4MEPA 5E3GA 5EWVA 4Z1QA 4AKIA 5DLXA 4O78A 2E3KA 5FFVA 5E9VA 2L84A 4NUDA 5I7XA 5LVQA 2RS9B 4QSXA 4PKLA 5AD2A 4J0SA 2EJNA 2F6JA 5E74A 5E73A 2E7NA 5FFWA 4NR5A 5C87A 5H1TA 5DKCA 5FE6A 3HMFA 4LC2A 4TU6A 2YEKA 5FG5A 5FH7A 5HJCA 5FE9A 5DKHA 5EV9A 5EM3A 3FKMX 5D24A 4NYVA 3SVHA 4LYSA 4ZQLA 4N3WA 4YYMA 4XUAA 5CUGA 3ONIA 4LZSA 5II1A 5FE1A 5I88A 4AKGA 5ENEA 2R0SA 4X2IA 3U5LA 5DY7A 5I80A 4IR3A 4LDFA 5D26A 4WHWA 4TYLA 2I7KA 5AD3A 4A9JA 2G4AA 5BT4A 2L85A 4KV1A 4WIVA 4CFLA 5CUCA 5CQ7A 4QSSA 5L8TA 5ENBA 3LQJA 2NXBA 3UVDA 5FE7A 5EA1A 5A83A 3U5MA 3MB4A 5HQ7A 4QC1A 5CQ3A 5IG6A 4A9NA 5CQTA 4QR4A 3VKGA 5AMEA 4IR6A 3UV5A 4HXKA 4O7AA 5DLZA 4QEVA 4YBSA 4UYDA 5D0CA 5IBNA 4A9FA 3P1DA 4A9IA 5D3LA 5I89A 4UIYA 4LYIA 2YEMA 2YDWA 3D1DA 3D7CA 2RNXA 5A5SA 4KCXA 4QUUA 4UIXA 5LKUA 4HBVA 3JVMA 5CQ6A 5KHMA 2OUOA 4HBWA 5HQ5A 5DKDA 4IORA 3MB3A 5TCMA 5E0RA 2DWWA 5E7DA 3DWYA 2RNYA 2R0VA 2RFJA 5CUAA 3QZVA 5LJ2A 4UYFA 3P1CA 5CQ8A 5L96A 4ZW1A 4FLPA 5J0DA 4QZSA 4O76A 4MEQA 5D7XA 5FFYA 5A5PA 3LJWA 4TU4A 5CGPA 3UW9A 1X0JA 4O71A 4MR3A 5G4RA 4QB3A 4F3IA 3UVYA 2E7OA 5E9MA 3U5KA 5D3TA 2DVRA 5A5QA 3U5PA 4NXJA 4TTEA 4YATA 5ENHA 5A5RA 5FDZA 5EGUA 5EVAA 5LKTA 5IGKA 5FE0A 4NR9A 4QUTA 5DYUA 3IU6A 3TLPA 3O37A 1JSPB 5A7CA 5ENCA 5F60A 4QSQA 5BT3A 4QSUA 4LR6A 5ENGA 5A85A 5CPEA 4YYGA 5LKZA 5A5NA 4ALHA 4YY6A 1EQFA 5IGNA 5EWDA 1F68A 5A81A 4YYDA 3AQAA 3P1EA 2DATA 4NR6A 5F63A 5DYXA 5H85A 3DAIA 4XY8A 3P1FA 5HENA 4A9HA 5E9LA 4Z93A 5F61A 5ENJA 2MJVB 5F1LA 5E9IA 4XY9A 5D3NA 5IGLA 2LSPB 4OGIA 4YH4A 4QEWA 3MUKA 4J1PA 4BW3A 4AKHA 5CUBA 5C7NA 4MR4A 4OUFA 5H1UA 5DFBA 4MEOA 2FSAA 4CUTA 5FG4A 4UIVA 5E3DA 4CLBA 4YABA 3LQHA 5CQAA 5E9KA 3G0LA 4IOQA 4MR6A 4ALGA 3O36A 4YYJA 4QY4A 3O35A 4QR5A 4A9MA 3S92A 5I1QA 4O74A 4C67A 5EPSA 5EICA 4NUCA 3JVKA 5TB6A 4YYHA 5ENFA 5LUUA 5HELA 3G0JA 5L97A 4QSVA 3GG3A 5EWHA 4NR7A 5FH8A 3O34A 5F5ZA 3UV4A 3JVJA 4TQNA 5KTWA 2YW5A 5JI8A 3Q2FA 4LZRA 5D25A 5FE8A 4BHWA 5FE2A 5I86A 4HBXA 4E96A 2DVVA 2RO1A 4BW4A 5EQ1A 5ETBA 2R10A 5DYCA 4PY6A 4CUPA 5L99A 4DONA 2I8NA 5KO4A 2OSSA 5FE3A 5EI4A 4UIWA 5EWCA 5F25A 5C4QA 4IR5A 4J3IA 5L8UA 3ERRA 4Y03A 4UYFB 3AADA 5D3JA 2WP1A 4AKNA 3I3JA 4LZ2A 5DFCA 4IR4A 4TZ2A 4A9KA 4XUBA 4HXMA 2R0YA 4PCIA 4QYLA 4AI6A 5CP5A 1ZS5A 5D3PA 5L98A 5C89A 4IOOA 4YC9A 4UIUA 5HCLA 4HXOA 5EU1A 5LKXA 4HXPA 4C66A 5COIA 4A9LA
chains in the Genus database with same CATH topology
1WUGA 3NXBA 4O75A 3MQMA 4J0RA 5C85A 2OO1A 5CUDA 2YYNA 5DFDA 4TZ8A 4YADA 5IIDA 5ETDA 4HXNA 4UYGA 5FB1A 2F6NA 4WHUA 5HQ6A 4TT2A 5HLSA 5DYAA 4PCEA 4OGJA 5HEMA 5CUEA 4HBYA 5DW2A 4UYHA 2D82A 5FB0A 4YYNA 4KV4A 2YQDA 5ACYA 3UVXA 4N4GA 5EK9A 2L5EA 5H1VA 4NUEA 4YH3A 4Q0OA 5F3AA 4TT6A 5I7YA 5KTUA 5FH6A 3LQIA 2WP2A 5EPRA 5I83A 5LJ0A 3UV2A 4A9EA 5CTLA 4NQNA 4QSTA 1E6IA 4YBTA 4QEUA 5E9YA 5CFWA 1WUMA 4QNSA 4HXSA 5FBXA 3IU5A 4CURA 2KTBB 5LVRA 2GRCA 4GPJA 5CS8A 4NYWA 5HRVA 5EWWA 4BW1A 5D3HA 1JM4B 5HM0A 3K2JA 5EISA 3SVFA 2H60A 4TT4A 5IGMA 3LXJA 4NRAA 4PS5A 2RI7A 4LRGA 5HRXA 5A5OA 4NYXA 4Z1SA 5KTXA 4Q0NA 4NRBA 1N72A 5G4SA 4QSPA 5A82A 5FE5A 3HMHA 3RCWA 2N9GA 4N4FA 4NS5A 4XYAA 2RNWA 3Q2EA 5DX4A 5I40A 4NRCA 5F36A 5JWMA 3JVLA 4QR3A 4O7FA 5BT5A 3U5NA 2DVSA 4CUSA 5K29A 5HFQA 5FG6A 5LJ1A 4NR8A 3U5JA 4MR5A 3UVWA 5DBMA 4MENA 4O7CA 5F2PA 4A9OA 2YELA 5II2A 5C8GA 4CUUA 4QC3A 4YYIA 5HFRA 4QYDA 4BW2A 4QSRA 3P5OA 5CY9A 5F62A 4QBMA 5HRWA 4YK0A 4O7BA 2DKWA 3U5OA 4YY4A 5ENIA 2DVQA 4CUQA 3O33A 5CQ5A 5CRZA 4HXLA 4YAXA 5I29A 4NQMA 4YBMA 5DW1A 4BJXA 3QZSA 4LYWA 5CRMA 4O7EA 4TS8A 4ZC9A 4QSWA 3QZTA 5D3SA 4YYKA 5FE4A 4CL9A 4O77A 4RVRA 3HMEA 5EPBA 5F1HA 3MULA 4CFKA 4HXRA 5CU8A 4Z6HA 4NR4A 4O70A 5CZGA 2D9EA 5EP7A 3MXFA 3S91A 3SVGA 4UIZA 4N4HA 4O72A 5CQ4A 4UYEA 5D3RA 4UITA 3ZYUA 4Z6IA 5AMFA 4N4IA 4PTBA 5KU3A 4MEPA 5E3GA 5EWVA 4Z1QA 5DLXA 4O78A 2E3KA 5FFVA 5E9VA 2L84A 4NUDA 5I7XA 5LVQA 2RS9B 4QSXA 4PKLA 5AD2A 4J0SA 2F6JA 5E74A 5E73A 2E7NA 5FFWA 4NR5A 5C87A 5H1TA 5DKCA 5FE6A 3HMFA 4LC2A 4TU6A 2YEKA 5FG5A 5FH7A 5HJCA 5FE9A 5DKHA 5EV9A 5EM3A 3FKMX 5D24A 4NYVA 3SVHA 4LYSA 4ZQLA 4N3WA 4YYMA 4XUAA 5CUGA 3ONIA 4LZSA 5II1A 5FE1A 5I88A 5ENEA 2R0SA 4X2IA 3U5LA 5DY7A 5I80A 4IR3A 4LDFA 5D26A 4WHWA 4TYLA 2I7KA 5AD3A 4A9JA 2G4AA 5BT4A 2L85A 4KV1A 4WIVA 4CFLA 5CUCA 5CQ7A 4QSSA 5L8TA 5ENBA 3LQJA 2NXBA 3UVDA 5FE7A 5EA1A 5A83A 3U5MA 3MB4A 5HQ7A 4QC1A 5CQ3A 5IG6A 4A9NA 5CQTA 4QR4A 5AMEA 4IR6A 3UV5A 4HXKA 4O7AA 5DLZA 4QEVA 4YBSA 4UYDA 5D0CA 5IBNA 4A9FA 3P1DA 4A9IA 5D3LA 5I89A 4UIYA 4LYIA 2YEMA 2YDWA 3D7CA 2RNXA 5A5SA 4KCXA 4QUUA 4UIXA 5LKUA 4HBVA 3JVMA 5CQ6A 5KHMA 2OUOA 4HBWA 5HQ5A 5DKDA 4IORA 3MB3A 5TCMA 5E0RA 2DWWA 5E7DA 3DWYA 2RNYA 2R0VA 2RFJA 5CUAA 3QZVA 5LJ2A 4UYFA 3P1CA 5CQ8A 5L96A 4ZW1A 4FLPA 5J0DA 4QZSA 4O76A 4MEQA 5D7XA 5FFYA 5A5PA 3LJWA 4TU4A 5CGPA 3UW9A 1X0JA 4O71A 4MR3A 5G4RA 4QB3A 4F3IA 3UVYA 2E7OA 5E9MA 3U5KA 5D3TA 2DVRA 5A5QA 3U5PA 4NXJA 4TTEA 4YATA 5ENHA 5A5RA 5FDZA 5EGUA 5EVAA 5LKTA 5IGKA 5FE0A 4NR9A 4QUTA 5DYUA 3IU6A 3TLPA 3O37A 1JSPB 5A7CA 5ENCA 5F60A 4QSQA 5BT3A 4QSUA 4LR6A 5ENGA 5A85A 5CPEA 4YYGA 5LKZA 5A5NA 4ALHA 4YY6A 1EQFA 5IGNA 5EWDA 1F68A 5A81A 4YYDA 3AQAA 3P1EA 2DATA 4NR6A 5F63A 5DYXA 5H85A 3DAIA 4XY8A 3P1FA 5HENA 4A9HA 5E9LA 4Z93A 5F61A 5ENJA 2MJVB 5F1LA 5E9IA 4XY9A 5D3NA 5IGLA 2LSPB 4OGIA 4YH4A 4QEWA 3MUKA 4J1PA 4BW3A 5CUBA 5C7NA 4MR4A 4OUFA 5H1UA 5DFBA 4MEOA 2FSAA 4CUTA 5FG4A 4UIVA 5E3DA 4CLBA 4YABA 3LQHA 5CQAA 5E9KA 3G0LA 4IOQA 4MR6A 4ALGA 3O36A 4YYJA 4QY4A 3O35A 4QR5A 4A9MA 3S92A 5I1QA 4O74A 4C67A 5EPSA 5EICA 4NUCA 3JVKA 5TB6A 4YYHA 5ENFA 5LUUA 5HELA 3G0JA 5L97A 4QSVA 3GG3A 5EWHA 4NR7A 5FH8A 3O34A 5F5ZA 3UV4A 3JVJA 4TQNA 5KTWA 2YW5A 5JI8A 3Q2FA 4LZRA 5D25A 5FE8A 4BHWA 5FE2A 5I86A 4HBXA 4E96A 2DVVA 2RO1A 4BW4A 5EQ1A 5ETBA 2R10A 5DYCA 4PY6A 4CUPA 5L99A 4DONA 2I8NA 5KO4A 2OSSA 5FE3A 5EI4A 4UIWA 5EWCA 5F25A 5C4QA 4IR5A 4J3IA 5L8UA 4Y03A 4UYFB 3AADA 5D3JA 2WP1A 4AKNA 3I3JA 4LZ2A 5DFCA 4IR4A 4TZ2A 4A9KA 4XUBA 4HXMA 2R0YA 4PCIA 4QYLA 5CP5A 1ZS5A 5D3PA 5L98A 5C89A 4IOOA 4YC9A 4UIUA 5HCLA 4HXOA 5EU1A 5LKXA 4HXPA 4C66A 5COIA 4A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUG A;  3NXB A;  4O75 A;  3MQM A;  4J0R A;  5C85 A;  2OO1 A;  5CUD A;  2YYN A;  5DFD A;  4TZ8 A;  4YAD A;  5IID A;  5ETD A;  4HXN A;  4UYG A;  5FB1 A;  2F6N A;  4WHU A;  5HQ6 A;  4TT2 A;  5HLS A;  5DYA A;  4PCE A;  4OGJ A;  5HEM A;  5CUE A;  4HBY A;  5DW2 A;  4UYH A;  2D82 A;  5FB0 A;  4YYN A;  4KV4 A;  2YQD A;  5ACY A;  3UVX A;  4N4G A;  5EK9 A;  2L5E A;  5H1V A;  4NUE A;  4YH3 A;  4Q0O A;  5F3A A;  4TT6 A;  5I7Y A;  5KTU A;  5FH6 A;  3LQI A;  2WP2 A;  5EPR A;  5I83 A;  5LJ0 A;  3UV2 A;  4A9E A;  5CTL A;  4NQN A;  4QST A;  1E6I A;  4YBT A;  4QEU A;  5E9Y A;  5CFW A;  1WUM A;  4QNS A;  4HXS A;  5FBX A;  3IU5 A;  4CUR A;  2KTB B;  5LVR A;  2GRC A;  4GPJ A;  5CS8 A;  4NYW A;  5HRV A;  5EWW A;  4BW1 A;  5D3H A;  1JM4 B;  5HM0 A;  3K2J A;  5EIS A;  3SVF A;  2H60 A;  4TT4 A;  5IGM A;  3LXJ A;  4NRA A;  4PS5 A;  2RI7 A;  4LRG A;  5HRX A;  5A5O A;  4NYX A;  4Z1S A;  5KTX A;  4Q0N A;  4NRB A;  1N72 A;  5G4S A;  4QSP A;  5A82 A;  5FE5 A;  3HMH A;  3RCW A;  2N9G A;  4N4F A;  4NS5 A;  4XYA A;  2RNW A;  3Q2E A;  5DX4 A;  5I40 A;  4NRC A;  5F36 A;  5JWM A;  3JVL A;  4QR3 A;  4O7F A;  5BT5 A;  3U5N A;  2DVS A;  4CUS A;  5K29 A;  5HFQ A;  5FG6 A;  5LJ1 A;  4NR8 A;  3U5J A;  4MR5 A;  3UVW A;  5DBM A;  4MEN A;  4O7C A;  5F2P A;  4A9O A;  2YEL A;  5II2 A;  5C8G A;  4CUU A;  4QC3 A;  4YYI A;  5HFR A;  4QYD A;  4BW2 A;  4QSR A;  3P5O A;  5CY9 A;  5F62 A;  4QBM A;  5HRW A;  4YK0 A;  4O7B A;  2DKW A;  3U5O A;  4YY4 A;  5ENI A;  2DVQ A;  4CUQ A;  3O33 A;  5CQ5 A;  5CRZ A;  4HXL A;  4YAX A;  5I29 A;  4NQM A;  4YBM A;  5DW1 A;  4BJX A;  3QZS A;  4LYW A;  5CRM A;  4O7E A;  4TS8 A;  4ZC9 A;  4QSW A;  3QZT A;  5D3S A;  4YYK A;  5FE4 A;  4CL9 A;  4O77 A;  4RVR A;  3HME A;  5EPB A;  5F1H A;  3MUL A;  4CFK A;  4HXR A;  5CU8 A;  4Z6H A;  4NR4 A;  4O70 A;  5CZG A;  2D9E A;  5EP7 A;  3MXF A;  3S91 A;  3SVG A;  4UIZ A;  4N4H A;  4O72 A;  5CQ4 A;  4UYE A;  5D3R A;  4UIT A;  3ZYU A;  4Z6I A;  5AMF A;  4N4I A;  4PTB A;  5KU3 A;  4MEP A;  5E3G A;  5EWV A;  4Z1Q A;  5DLX A;  4O78 A;  2E3K A;  5FFV A;  5E9V A;  2L84 A;  4NUD A;  5I7X A;  5LVQ A;  2RS9 B;  4QSX A;  4PKL A;  5AD2 A;  4J0S A;  2F6J A;  5E74 A;  5E73 A;  2E7N A;  5FFW A;  4NR5 A;  5C87 A;  5H1T A;  5DKC A;  5FE6 A;  3HMF A;  4LC2 A;  4TU6 A;  2YEK A;  5FG5 A;  5FH7 A;  5HJC A;  5FE9 A;  5DKH A;  5EV9 A;  5EM3 A;  3FKM X;  5D24 A;  4NYV A;  3SVH A;  4LYS A;  4ZQL A;  4N3W A;  4YYM A;  4XUA A;  5CUG A;  3ONI A;  4LZS A;  5II1 A;  5FE1 A;  5I88 A;  5ENE A;  2R0S A;  4X2I A;  3U5L A;  5DY7 A;  5I80 A;  4IR3 A;  4LDF A;  5D26 A;  4WHW A;  4TYL A;  2I7K A;  5AD3 A;  4A9J A;  2G4A A;  5BT4 A;  2L85 A;  4KV1 A;  4WIV A;  4CFL A;  5CUC A;  5CQ7 A;  4QSS A;  5L8T A;  5ENB A;  3LQJ A;  2NXB A;  3UVD A;  5FE7 A;  5EA1 A;  5A83 A;  3U5M A;  3MB4 A;  5HQ7 A;  4QC1 A;  5CQ3 A;  5IG6 A;  4A9N A;  5CQT A;  4QR4 A;  5AME A;  4IR6 A;  3UV5 A;  4HXK A;  4O7A A;  5DLZ A;  4QEV A;  4YBS A;  4UYD A;  5D0C A;  5IBN A;  4A9F A;  3P1D A;  4A9I A;  5D3L A;  5I89 A;  4UIY A;  4LYI A;  2YEM A;  2YDW A;  3D7C A;  2RNX A;  5A5S A;  4KCX A;  4QUU A;  4UIX A;  5LKU A;  4HBV A;  3JVM A;  5CQ6 A;  5KHM A;  2OUO A;  4HBW A;  5HQ5 A;  5DKD A;  4IOR A;  3MB3 A;  5TCM A;  5E0R A;  2DWW A;  5E7D A;  3DWY A;  2RNY A;  2R0V A;  2RFJ A;  5CUA A;  3QZV A;  5LJ2 A;  4UYF A;  3P1C A;  5CQ8 A;  5L96 A;  4ZW1 A;  4FLP A;  5J0D A;  4QZS A;  4O76 A;  4MEQ A;  5D7X A;  5FFY A;  5A5P A;  3LJW A;  4TU4 A;  5CGP A;  3UW9 A;  1X0J A;  4O71 A;  4MR3 A;  5G4R A;  4QB3 A;  4F3I A;  3UVY A;  2E7O A;  5E9M A;  3U5K A;  5D3T A;  2DVR A;  5A5Q A;  3U5P A;  4NXJ A;  4TTE A;  4YAT A;  5ENH A;  5A5R A;  5FDZ A;  5EGU A;  5EVA A;  5LKT A;  5IGK A;  5FE0 A;  4NR9 A;  4QUT A;  5DYU A;  3IU6 A;  3TLP A;  3O37 A;  1JSP B;  5A7C A;  5ENC A;  5F60 A;  4QSQ A;  5BT3 A;  4QSU A;  4LR6 A;  5ENG A;  5A85 A;  5CPE A;  4YYG A;  5LKZ A;  5A5N A;  4ALH A;  4YY6 A;  1EQF A;  5IGN A;  5EWD A;  1F68 A;  5A81 A;  4YYD A;  3AQA A;  3P1E A;  2DAT A;  4NR6 A;  5F63 A;  5DYX A;  5H85 A;  3DAI A;  4XY8 A;  3P1F A;  5HEN A;  4A9H A;  5E9L A;  4Z93 A;  5F61 A;  5ENJ A;  2MJV B;  5F1L A;  5E9I A;  4XY9 A;  5D3N A;  5IGL A;  2LSP B;  4OGI A;  4YH4 A;  4QEW A;  3MUK A;  4J1P A;  4BW3 A;  5CUB A;  5C7N A;  4MR4 A;  4OUF A;  5H1U A;  5DFB A;  4MEO A;  2FSA A;  4CUT A;  5FG4 A;  4UIV A;  5E3D A;  4CLB A;  4YAB A;  3LQH A;  5CQA A;  5E9K A;  3G0L A;  4IOQ A;  4MR6 A;  4ALG A;  3O36 A;  4YYJ A;  4QY4 A;  3O35 A;  4QR5 A;  4A9M A;  3S92 A;  5I1Q A;  4O74 A;  4C67 A;  5EPS A;  5EIC A;  4NUC A;  3JVK A;  5TB6 A;  4YYH A;  5ENF A;  5LUU A;  5HEL A;  3G0J A;  5L97 A;  4QSV A;  3GG3 A;  5EWH A;  4NR7 A;  5FH8 A;  3O34 A;  5F5Z A;  3UV4 A;  3JVJ A;  4TQN A;  5KTW A;  2YW5 A;  5JI8 A;  3Q2F A;  4LZR A;  5D25 A;  5FE8 A;  4BHW A;  5FE2 A;  5I86 A;  4HBX A;  4E96 A;  2DVV A;  2RO1 A;  4BW4 A;  5EQ1 A;  5ETB A;  2R10 A;  5DYC A;  4PY6 A;  4CUP A;  5L99 A;  4DON A;  2I8N A;  5KO4 A;  2OSS A;  5FE3 A;  5EI4 A;  4UIW A;  5EWC A;  5F25 A;  5C4Q A;  4IR5 A;  4J3I A;  5L8U A;  4Y03 A;  4UYF B;  3AAD A;  5D3J A;  2WP1 A;  4AKN A;  3I3J A;  4LZ2 A;  5DFC A;  4IR4 A;  4TZ2 A;  4A9K A;  4XUB A;  4HXM A;  2R0Y A;  4PCI A;  4QYL A;  5CP5 A;  1ZS5 A;  5D3P A;  5L98 A;  5C89 A;  4IOO A;  4YC9 A;  4UIU A;  5HCL A;  4HXO A;  5EU1 A;  5LKX A;  4HXP A;  4C66 A;  5COI A;  4A9L A; 
#chains in the Genus database with same CATH topology
 1WUG A;  3NXB A;  4O75 A;  3MQM A;  4J0R A;  5C85 A;  2OO1 A;  5CUD A;  2YYN A;  5DFD A;  4TZ8 A;  4YAD A;  5IID A;  5ETD A;  4HXN A;  4UYG A;  5FB1 A;  2F6N A;  4WHU A;  5HQ6 A;  4TT2 A;  5HLS A;  5DYA A;  4PCE A;  4OGJ A;  5HEM A;  5CUE A;  4HBY A;  5DW2 A;  4UYH A;  2D82 A;  5FB0 A;  4YYN A;  4KV4 A;  2YQD A;  5ACY A;  3UVX A;  4N4G A;  5EK9 A;  2L5E A;  5H1V A;  4NUE A;  4YH3 A;  4Q0O A;  5F3A A;  4TT6 A;  5I7Y A;  5KTU A;  5FH6 A;  3LQI A;  2WP2 A;  5EPR A;  5I83 A;  5LJ0 A;  3UV2 A;  4A9E A;  5CTL A;  4NQN A;  4QST A;  1E6I A;  4YBT A;  4QEU A;  5E9Y A;  5CFW A;  1WUM A;  4QNS A;  4HXS A;  5FBX A;  3IU5 A;  4CUR A;  2KTB B;  5LVR A;  2GRC A;  4GPJ A;  5CS8 A;  4NYW A;  5HRV A;  5EWW A;  4BW1 A;  5D3H A;  1JM4 B;  5HM0 A;  3K2J A;  5EIS A;  3SVF A;  2H60 A;  4TT4 A;  1PUO A;  5IGM A;  3LXJ A;  4NRA A;  4PS5 A;  2RI7 A;  4LRG A;  5HRX A;  5A5O A;  4NYX A;  4Z1S A;  5KTX A;  4Q0N A;  4NRB A;  1N72 A;  5G4S A;  4QSP A;  5A82 A;  5FE5 A;  3HMH A;  3RCW A;  2N9G A;  4N4F A;  4NS5 A;  4XYA A;  2RNW A;  3Q2E A;  5DX4 A;  5I40 A;  4NRC A;  5F36 A;  5JWM A;  3JVL A;  4QR3 A;  4O7F A;  5BT5 A;  3U5N A;  2DVS A;  4CUS A;  5K29 A;  5HFQ A;  5FG6 A;  5LJ1 A;  4NR8 A;  3U5J A;  4MR5 A;  3UVW A;  5DBM A;  4MEN A;  4O7C A;  5F2P A;  4A9O A;  2YEL A;  5II2 A;  5C8G A;  4CUU A;  4QC3 A;  4YYI A;  5HFR A;  4QYD A;  4BW2 A;  4QSR A;  3P5O A;  5CY9 A;  5F62 A;  4QBM A;  5HRW A;  4YK0 A;  4O7B A;  2DKW A;  3U5O A;  4YY4 A;  5ENI A;  2DVQ A;  4CUQ A;  3O33 A;  5CQ5 A;  3VKH A;  5CRZ A;  4HXL A;  4YAX A;  5I29 A;  4NQM A;  4YBM A;  5DW1 A;  4BJX A;  3QZS A;  4LYW A;  5CRM A;  4O7E A;  4TS8 A;  3D1B A;  4ZC9 A;  4QSW A;  3QZT A;  5D3S A;  4YYK A;  5FE4 A;  4CL9 A;  4O77 A;  4RVR A;  3HME A;  5EPB A;  5F1H A;  3MUL A;  4CFK A;  4HXR A;  1ZKR A;  5CU8 A;  4Z6H A;  4NR4 A;  4O70 A;  5CZG A;  2D9E A;  5EP7 A;  3MXF A;  3S91 A;  3SVG A;  4UIZ A;  4N4H A;  4O72 A;  5CQ4 A;  4UYE A;  5D3R A;  4UIT A;  3ZYU A;  4Z6I A;  5AMF A;  4N4I A;  4PTB A;  5KU3 A;  4MEP A;  5E3G A;  5EWV A;  4Z1Q A;  4AKI A;  5DLX A;  4O78 A;  2E3K A;  5FFV A;  5E9V A;  2L84 A;  4NUD A;  5I7X A;  5LVQ A;  2RS9 B;  4QSX A;  4PKL A;  5AD2 A;  4J0S A;  2EJN A;  2F6J A;  5E74 A;  5E73 A;  2E7N A;  5FFW A;  4NR5 A;  5C87 A;  5H1T A;  5DKC A;  5FE6 A;  3HMF A;  4LC2 A;  4TU6 A;  2YEK A;  5FG5 A;  5FH7 A;  5HJC A;  5FE9 A;  5DKH A;  5EV9 A;  5EM3 A;  3FKM X;  5D24 A;  4NYV A;  3SVH A;  4LYS A;  4ZQL A;  4N3W A;  4YYM A;  4XUA A;  5CUG A;  3ONI A;  4LZS A;  5II1 A;  5FE1 A;  5I88 A;  4AKG A;  5ENE A;  2R0S A;  4X2I A;  3U5L A;  5DY7 A;  5I80 A;  4IR3 A;  4LDF A;  5D26 A;  4WHW A;  4TYL A;  2I7K A;  5AD3 A;  4A9J A;  2G4A A;  5BT4 A;  2L85 A;  4KV1 A;  4WIV A;  4CFL A;  5CUC A;  5CQ7 A;  4QSS A;  5L8T A;  5ENB A;  3LQJ A;  2NXB A;  3UVD A;  5FE7 A;  5EA1 A;  5A83 A;  3U5M A;  3MB4 A;  5HQ7 A;  4QC1 A;  5CQ3 A;  5IG6 A;  4A9N A;  5CQT A;  4QR4 A;  3VKG A;  5AME A;  4IR6 A;  3UV5 A;  4HXK A;  4O7A A;  5DLZ A;  4QEV A;  4YBS A;  4UYD A;  5D0C A;  5IBN A;  4A9F A;  3P1D A;  4A9I A;  5D3L A;  5I89 A;  4UIY A;  4LYI A;  2YEM A;  2YDW A;  3D1D A;  3D7C A;  2RNX A;  5A5S A;  4KCX A;  4QUU A;  4UIX A;  5LKU A;  4HBV A;  3JVM A;  5CQ6 A;  5KHM A;  2OUO A;  4HBW A;  5HQ5 A;  5DKD A;  4IOR A;  3MB3 A;  5TCM A;  5E0R A;  2DWW A;  5E7D A;  3DWY A;  2RNY A;  2R0V A;  2RFJ A;  5CUA A;  3QZV A;  5LJ2 A;  4UYF A;  3P1C A;  5CQ8 A;  5L96 A;  4ZW1 A;  4FLP A;  5J0D A;  4QZS A;  4O76 A;  4MEQ A;  5D7X A;  5FFY A;  5A5P A;  3LJW A;  4TU4 A;  5CGP A;  3UW9 A;  1X0J A;  4O71 A;  4MR3 A;  5G4R A;  4QB3 A;  4F3I A;  3UVY A;  2E7O A;  5E9M A;  3U5K A;  5D3T A;  2DVR A;  5A5Q A;  3U5P A;  4NXJ A;  4TTE A;  4YAT A;  5ENH A;  5A5R A;  5FDZ A;  5EGU A;  5EVA A;  5LKT A;  5IGK A;  5FE0 A;  4NR9 A;  4QUT A;  5DYU A;  3IU6 A;  3TLP A;  3O37 A;  1JSP B;  5A7C A;  5ENC A;  5F60 A;  4QSQ A;  5BT3 A;  4QSU A;  4LR6 A;  5ENG A;  5A85 A;  5CPE A;  4YYG A;  5LKZ A;  5A5N A;  4ALH A;  4YY6 A;  1EQF A;  5IGN A;  5EWD A;  1F68 A;  5A81 A;  4YYD A;  3AQA A;  3P1E A;  2DAT A;  4NR6 A;  5F63 A;  5DYX A;  5H85 A;  3DAI A;  4XY8 A;  3P1F A;  5HEN A;  4A9H A;  5E9L A;  4Z93 A;  5F61 A;  5ENJ A;  2MJV B;  5F1L A;  5E9I A;  4XY9 A;  5D3N A;  5IGL A;  2LSP B;  4OGI A;  4YH4 A;  4QEW A;  3MUK A;  4J1P A;  4BW3 A;  4AKH A;  5CUB A;  5C7N A;  4MR4 A;  4OUF A;  5H1U A;  5DFB A;  4MEO A;  2FSA A;  4CUT A;  5FG4 A;  4UIV A;  5E3D A;  4CLB A;  4YAB A;  3LQH A;  5CQA A;  5E9K A;  3G0L A;  4IOQ A;  4MR6 A;  4ALG A;  3O36 A;  4YYJ A;  4QY4 A;  3O35 A;  4QR5 A;  4A9M A;  3S92 A;  5I1Q A;  4O74 A;  4C67 A;  5EPS A;  5EIC A;  4NUC A;  3JVK A;  5TB6 A;  4YYH A;  5ENF A;  5LUU A;  5HEL A;  3G0J A;  5L97 A;  4QSV A;  3GG3 A;  5EWH A;  4NR7 A;  5FH8 A;  3O34 A;  5F5Z A;  3UV4 A;  3JVJ A;  4TQN A;  5KTW A;  2YW5 A;  5JI8 A;  3Q2F A;  4LZR A;  5D25 A;  5FE8 A;  4BHW A;  5FE2 A;  5I86 A;  4HBX A;  4E96 A;  2DVV A;  2RO1 A;  4BW4 A;  5EQ1 A;  5ETB A;  2R10 A;  5DYC A;  4PY6 A;  4CUP A;  5L99 A;  4DON A;  2I8N A;  5KO4 A;  2OSS A;  5FE3 A;  5EI4 A;  4UIW A;  5EWC A;  5F25 A;  5C4Q A;  4IR5 A;  4J3I A;  5L8U A;  3ERR A;  4Y03 A;  4UYF B;  3AAD A;  5D3J A;  2WP1 A;  4AKN A;  3I3J A;  4LZ2 A;  5DFC A;  4IR4 A;  4TZ2 A;  4A9K A;  4XUB A;  4HXM A;  2R0Y A;  4PCI A;  4QYL A;  4AI6 A;  5CP5 A;  1ZS5 A;  5D3P A;  5L98 A;  5C89 A;  4IOO A;  4YC9 A;  4UIU A;  5HCL A;  4HXO A;  5EU1 A;  5LKX A;  4HXP A;  4C66 A;  5COI A;  4A9L A; 
#chains in the Genus database with same CATH homology
 1WUG A;  3NXB A;  4O75 A;  3MQM A;  4J0R A;  5C85 A;  2OO1 A;  5CUD A;  2YYN A;  5DFD A;  4TZ8 A;  4YAD A;  5IID A;  5ETD A;  4HXN A;  4UYG A;  5FB1 A;  2F6N A;  4WHU A;  5HQ6 A;  4TT2 A;  5HLS A;  5DYA A;  4PCE A;  4OGJ A;  5HEM A;  5CUE A;  4HBY A;  5DW2 A;  4UYH A;  2D82 A;  5FB0 A;  4YYN A;  4KV4 A;  2YQD A;  5ACY A;  3UVX A;  4N4G A;  5EK9 A;  2L5E A;  5H1V A;  4NUE A;  4YH3 A;  4Q0O A;  5F3A A;  4TT6 A;  5I7Y A;  5KTU A;  5FH6 A;  3LQI A;  2WP2 A;  5EPR A;  5I83 A;  5LJ0 A;  3UV2 A;  4A9E A;  5CTL A;  4NQN A;  4QST A;  1E6I A;  4YBT A;  4QEU A;  5E9Y A;  5CFW A;  1WUM A;  4QNS A;  4HXS A;  5FBX A;  3IU5 A;  4CUR A;  2KTB B;  5LVR A;  2GRC A;  4GPJ A;  5CS8 A;  4NYW A;  5HRV A;  5EWW A;  4BW1 A;  5D3H A;  1JM4 B;  5HM0 A;  3K2J A;  5EIS A;  3SVF A;  2H60 A;  4TT4 A;  5IGM A;  3LXJ A;  4NRA A;  4PS5 A;  2RI7 A;  4LRG A;  5HRX A;  5A5O A;  4NYX A;  4Z1S A;  5KTX A;  4Q0N A;  4NRB A;  1N72 A;  5G4S A;  4QSP A;  5A82 A;  5FE5 A;  3HMH A;  3RCW A;  2N9G A;  4N4F A;  4NS5 A;  4XYA A;  2RNW A;  3Q2E A;  5DX4 A;  5I40 A;  4NRC A;  5F36 A;  5JWM A;  3JVL A;  4QR3 A;  4O7F A;  5BT5 A;  3U5N A;  2DVS A;  4CUS A;  5K29 A;  5HFQ A;  5FG6 A;  5LJ1 A;  4NR8 A;  3U5J A;  4MR5 A;  3UVW A;  5DBM A;  4MEN A;  4O7C A;  5F2P A;  4A9O A;  2YEL A;  5II2 A;  5C8G A;  4CUU A;  4QC3 A;  4YYI A;  5HFR A;  4QYD A;  4BW2 A;  4QSR A;  3P5O A;  5CY9 A;  5F62 A;  4QBM A;  5HRW A;  4YK0 A;  4O7B A;  2DKW A;  3U5O A;  4YY4 A;  5ENI A;  2DVQ A;  4CUQ A;  3O33 A;  5CQ5 A;  5CRZ A;  4HXL A;  4YAX A;  5I29 A;  4NQM A;  4YBM A;  5DW1 A;  4BJX A;  3QZS A;  4LYW A;  5CRM A;  4O7E A;  4TS8 A;  4ZC9 A;  4QSW A;  3QZT A;  5D3S A;  4YYK A;  5FE4 A;  4CL9 A;  4O77 A;  4RVR A;  3HME A;  5EPB A;  5F1H A;  3MUL A;  4CFK A;  4HXR A;  5CU8 A;  4Z6H A;  4NR4 A;  4O70 A;  5CZG A;  2D9E A;  5EP7 A;  3MXF A;  3S91 A;  3SVG A;  4UIZ A;  4N4H A;  4O72 A;  5CQ4 A;  4UYE A;  5D3R A;  4UIT A;  3ZYU A;  4Z6I A;  5AMF A;  4N4I A;  4PTB A;  5KU3 A;  4MEP A;  5E3G A;  5EWV A;  4Z1Q A;  5DLX A;  4O78 A;  2E3K A;  5FFV A;  5E9V A;  2L84 A;  4NUD A;  5I7X A;  5LVQ A;  2RS9 B;  4QSX A;  4PKL A;  5AD2 A;  4J0S A;  2F6J A;  5E74 A;  5E73 A;  2E7N A;  5FFW A;  4NR5 A;  5C87 A;  5H1T A;  5DKC A;  5FE6 A;  3HMF A;  4LC2 A;  4TU6 A;  2YEK A;  5FG5 A;  5FH7 A;  5HJC A;  5FE9 A;  5DKH A;  5EV9 A;  5EM3 A;  3FKM X;  5D24 A;  4NYV A;  3SVH A;  4LYS A;  4ZQL A;  4N3W A;  4YYM A;  4XUA A;  5CUG A;  3ONI A;  4LZS A;  5II1 A;  5FE1 A;  5I88 A;  5ENE A;  2R0S A;  4X2I A;  3U5L A;  5DY7 A;  5I80 A;  4IR3 A;  4LDF A;  5D26 A;  4WHW A;  4TYL A;  2I7K A;  5AD3 A;  4A9J A;  2G4A A;  5BT4 A;  2L85 A;  4KV1 A;  4WIV A;  4CFL A;  5CUC A;  5CQ7 A;  4QSS A;  5L8T A;  5ENB A;  3LQJ A;  2NXB A;  3UVD A;  5FE7 A;  5EA1 A;  5A83 A;  3U5M A;  3MB4 A;  5HQ7 A;  4QC1 A;  5CQ3 A;  5IG6 A;  4A9N A;  5CQT A;  4QR4 A;  5AME A;  4IR6 A;  3UV5 A;  4HXK A;  4O7A A;  5DLZ A;  4QEV A;  4YBS A;  4UYD A;  5D0C A;  5IBN A;  4A9F A;  3P1D A;  4A9I A;  5D3L A;  5I89 A;  4UIY A;  4LYI A;  2YEM A;  2YDW A;  3D7C A;  2RNX A;  5A5S A;  4KCX A;  4QUU A;  4UIX A;  5LKU A;  4HBV A;  3JVM A;  5CQ6 A;  5KHM A;  2OUO A;  4HBW A;  5HQ5 A;  5DKD A;  4IOR A;  3MB3 A;  5TCM A;  5E0R A;  2DWW A;  5E7D A;  3DWY A;  2RNY A;  2R0V A;  2RFJ A;  5CUA A;  3QZV A;  5LJ2 A;  4UYF A;  3P1C A;  5CQ8 A;  5L96 A;  4ZW1 A;  4FLP A;  5J0D A;  4QZS A;  4O76 A;  4MEQ A;  5D7X A;  5FFY A;  5A5P A;  3LJW A;  4TU4 A;  5CGP A;  3UW9 A;  1X0J A;  4O71 A;  4MR3 A;  5G4R A;  4QB3 A;  4F3I A;  3UVY A;  2E7O A;  5E9M A;  3U5K A;  5D3T A;  2DVR A;  5A5Q A;  3U5P A;  4NXJ A;  4TTE A;  4YAT A;  5ENH A;  5A5R A;  5FDZ A;  5EGU A;  5EVA A;  5LKT A;  5IGK A;  5FE0 A;  4NR9 A;  4QUT A;  5DYU A;  3IU6 A;  3TLP A;  3O37 A;  1JSP B;  5A7C A;  5ENC A;  5F60 A;  4QSQ A;  5BT3 A;  4QSU A;  4LR6 A;  5ENG A;  5A85 A;  5CPE A;  4YYG A;  5LKZ A;  5A5N A;  4ALH A;  4YY6 A;  1EQF A;  5IGN A;  5EWD A;  1F68 A;  5A81 A;  4YYD A;  3AQA A;  3P1E A;  2DAT A;  4NR6 A;  5F63 A;  5DYX A;  5H85 A;  3DAI A;  4XY8 A;  3P1F A;  5HEN A;  4A9H A;  5E9L A;  4Z93 A;  5F61 A;  5ENJ A;  2MJV B;  5F1L A;  5E9I A;  4XY9 A;  5D3N A;  5IGL A;  2LSP B;  4OGI A;  4YH4 A;  4QEW A;  3MUK A;  4J1P A;  4BW3 A;  5CUB A;  5C7N A;  4MR4 A;  4OUF A;  5H1U A;  5DFB A;  4MEO A;  2FSA A;  4CUT A;  5FG4 A;  4UIV A;  5E3D A;  4CLB A;  4YAB A;  3LQH A;  5CQA A;  5E9K A;  3G0L A;  4IOQ A;  4MR6 A;  4ALG A;  3O36 A;  4YYJ A;  4QY4 A;  3O35 A;  4QR5 A;  4A9M A;  3S92 A;  5I1Q A;  4O74 A;  4C67 A;  5EPS A;  5EIC A;  4NUC A;  3JVK A;  5TB6 A;  4YYH A;  5ENF A;  5LUU A;  5HEL A;  3G0J A;  5L97 A;  4QSV A;  3GG3 A;  5EWH A;  4NR7 A;  5FH8 A;  3O34 A;  5F5Z A;  3UV4 A;  3JVJ A;  4TQN A;  5KTW A;  2YW5 A;  5JI8 A;  3Q2F A;  4LZR A;  5D25 A;  5FE8 A;  4BHW A;  5FE2 A;  5I86 A;  4HBX A;  4E96 A;  2DVV A;  2RO1 A;  4BW4 A;  5EQ1 A;  5ETB A;  2R10 A;  5DYC A;  4PY6 A;  4CUP A;  5L99 A;  4DON A;  2I8N A;  5KO4 A;  2OSS A;  5FE3 A;  5EI4 A;  4UIW A;  5EWC A;  5F25 A;  5C4Q A;  4IR5 A;  4J3I A;  5L8U A;  4Y03 A;  4UYF B;  3AAD A;  5D3J A;  2WP1 A;  4AKN A;  3I3J A;  4LZ2 A;  5DFC A;  4IR4 A;  4TZ2 A;  4A9K A;  4XUB A;  4HXM A;  2R0Y A;  4PCI A;  4QYL A;  5CP5 A;  1ZS5 A;  5D3P A;  5L98 A;  5C89 A;  4IOO A;  4YC9 A;  4UIU A;  5HCL A;  4HXO A;  5EU1 A;  5LKX A;  4HXP A;  4C66 A;  5COI A;  4A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...