5AN1A

Crystallographic structure of the glutathione s-transferase from litopenaeus vannamei complexed with glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
b'MLPVLGYWKTRALCQPIRLMLGYTGTEFEEKNYPVGDAPDYDKSEWLAVKFKLGLAFPNLPYYIDGDVKITQSKAIMRYLARKHGLCGTTPEELVRTDMIECQLTDMHEAFFTVTYEHYEQKDAYTASLPAKLRQYSDFLGSRPWFAGDKLTYIDFLAYEIFDQHLSLDRTCLDGFKNLQAFQKRFEDLEAIKKYMASPKFLKKPICNKYAQFTIIEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a class-mu glutathione S-transferase from whiteleg shrimp Litopenaeus vannamei: structural changes in the xenobiotic binding H-site may alter the spectra of molecules bound.
pubmed doi rcsb
molecule keywords GLUTATHIONE S-TRANSFERASE
source organism Litopenaeus vannamei
molecule tags Transferase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5an1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5an1A01
5B8BA 2M46A 3D22A 3VLNA 1R26A 3GKXA 4ML6A 1SK1A 3H1NA 2NDOA 3GKMA 1S3DA 2CAQA 2VCTA 4PNGA 3BCIA 1TTZA 1H75A 2R6KA 4OCEA 3FR6A 2CX3A 5IM9A 2C8UA 3AY8A 5ID2A 1Z3EA 1PSQA 1SJIA 2B5EA 2LUSA 1EV4A 4LLRA 4TW5A 2XHFA 4OD7A 2NTOA 4HZ4A 2OE3A 1ZCPA 5GSSA 3EMXA 1ERVA 1HQOA 2HI7A 2VD0A 5COHA 3EMPA 3C7MA 5D9WA 3D4MA 2VAFA 1AQXA 5KN0A 4HU9A 5C00A 3LFLA 1KEBA 3J7Yk 3LSZA 4YQUA 3LXTA 2DJ0A 2EIRA 4IS0A 1SKRB 2CAIA 3UARA 4TXOA 4Q5NA 2FNOA 4RI6A 4PURA 5EVOA 3TKRA 2PVQA 2QSIA 3VFIA 1B9XC 4CHSA 6GSSA 4EKZA 1M7TA 2YJHA 4GSSA 4YAPA 4WEYA 2V6KA 1VF3A 1GTAA 1SYRA 4MZWA 2IFQA 1VRSD 2EIOA 4G9HA 4NAXA 4KE3A 2M72A 2CVDA 2I3YA 4Q5FA 4POBA 3GMFA 5ELGA 3SWLA 1X5CA 1T3BA 4N30A 4F2IA 1DBYA 1N8JA 1GSFA 4IGJA 2P5QA 6GSYA 4TR1B 2R4VA 3F9UA 2F8FA 5F06A 4XS6A 1K3LA 2HSNB 1E2YA 1NHYA 3LGCA 2OBKA 5F07A 1TK5B 3ZYWA 2PU9C 3KP8A 2LNSA 4MF5A 3R2QA 3I6AA 3WGXA 1M2AA 1TRSA 3DWVA 3FKFA 2LS5A 5FWGA 4J56E 4OWYA 2WS2A 1F37A 4FYBA 2WGRA 3TJBA 3CTFA 3HVXA 2H1AA 2LQOA 3GIXA 1TRVA 2C3QA 1U87A 4IP6A 1Z5YE 2AV4A 1U3IA 1QFNA 2B6MA 4JRRA 3GTUB 1JLWA 4OCFA 2FA8A 5KEJA 4KGIA 4I5QA 1TU8A 5JCGA 2H1GA 2N5BA 2B3SA 2C1YA 2F3MA 4XCSA 1Z6NA 1G6WA 3D0ZA 2HLSA 2GT6A 1OYJA 2Z9SA 3BD2A 5KN2A 1GSEA 5ECHB 4LL1B 4HS1A 2AAWA 3CSJA 2QKEA 5ECKB 1K0CA 5ABRA 4K9ZA 1SD8A 5IO2A 4IP1A 1F3AA 1HNAA 2YPMA 2K8SA 1MD4A 2B5YA 1K0MA 1JFUA 3P2AA 2CX4A 2L5OA 1OC9B 5IOWA 3TKSE 2YWMA 5ECMB 1TI1A 3H79A 1Y6EA 1ON4A 1I5GA 2GSQA 1PX7A 2FGXA 1GULA 3VI5A 2GT5A 1FOVA 4ZXGA 1V58A 3ME8A 3EC3A 2HZEB 2VCVA 3LJRA 4L5OA 2VM1A 4N0ZA 1PA3A 2DMLA 3HZ4A 2ON5A 5A4UA 3HZ8A 1B4QA 4NMUA 2IN3A 3A5WA 2H0GA 3RHCA 5AN1A 3RHBA 2ALBA 3UAPA 5INYA 5IMZA 4ZL7A 4V2LA 6GSTA 3M1GA 2DIYA 1EGOA 2REMA 1VF2A 3GHAA 4CW9A 5G1LA 3HXSA 3WD6A 1DSBA 4WKWA 5LNKe 4L8EA 1PQNA 1F6MC 4HJ2A 4ML1A 4BVYA 1OVNA 3E0UA 3WT2A 2I4AA 5EY6A 4BL7A 4QL7A 5G5FA 2JL4A 4GQCA 3O6TA 4KCAA 3GH9A 4EF0A 1XOAA 1A24A 2JZTA 1S3AA 5E59A 4KAEA 2MMAA 6GSXA 1QUWA 2VCXA 3GYKA 1YEPA 1GUKA 4K6XA 2DMMA 2AJQB 4F82A 3EE2A 4KW6A 2OKAA 1HNBA 1XWCA 1OKDA 1XW5A 3MAKA 3G7IA 2DJ2A 3QAGA 4XRAA 5IO0A 4POKA 3H8QA 2WJUA 2HYXA 3SBCA 3OR5A 1KBNA 1GSSA 1LJRA 3HVVA 4LA1A 1MDKA 5ECQB 2P5RA 2VIMA 2B1KA 1YJ6A 5IMVA 5IMDA 4N0VA 2X64A 2P0GA 4NHWA 5HQPA 2MBSA 3F3QA 4USSA 4WBJA 2IMIA 2X99A 1BAYA 5J9BA 4AF2A 1W4VA 2YP6A 5DQYA 1GNWA 2XBIA 3GL5A 3CBUA 1X9WB 4NV5A 2PERA 3QD9A 2H74A 3QFBC 9GSSA 5JCWA 6GSWA 3QAWA 4NXIA 4MLYA 2K9FA 3UVHA 3GFKA 3HJMA 5CAXA 2N5AA 4N11A 3ZMLA 2PN8A 3PINA 2RM5A 4V2NA 4O7HA 2HRNA 1ACVA 5D9VA 2IWTA 1ZZYA 2YV7A 2LRNA 3N9JA 1WPIA 2V6OA 4MF7A 1IYHA 4O92A 2H1DA 1ZOFA 4MA9A 2PPTA 4BWQA 3EU3A 1A23A 2I81A 1AC1A 1XWGA 3TB2A 3IC4A 1AAZA 4EE0A 4K0NA 1J08A 3LXZA 2GVPA 4TKYA 3IR4A 1DUGA 2A2RA 1OE7A 4K1FA 3UJ1A 5DALB 1C72A 3LWAA 1A2MA 1OC8A 3G7JA 1O73A 5B6MA 1Y25A 3KEBA 1QMVA 1M9AA 3M9JA 4EDZA 1WWJA 1N2AA 3IXRA 4AGSA 4PNFA 4J2FA 5B6NA 1GUHA 3IA1A 2GLRA 2VLVA 4XRDA 1EEJA 2R5GA 3U5RE 3UL3A 3ZMKA 2PWJA 1YKAA 1F9MA 5DDLA 3GNJA 4MCUA 4TR1A 1YKCA 3BJ5A 3GL3A 3EINA 6GSUA 1PX6A 17GSA 3ERGA 4KB3A 3KMNA 2XC2A 3FZ5A 4G19A 4WXTA 3F4SA 2IMDA 3DXBA 3DVXA 1USBA 3HJPA 5HFKA 4WBRD 3RPPA 1I9DA 4EL1A 4MH3A 4PQ1A 5CYYA 2K18A 3DGQA 3EYTA 2EIQA 1J9BA 4G0KA 4DEJA 1EOGA 1A8LA 1M2DA 3W6GA 5DQSA 4V2MA 2DJJA 3ZFBA 3WGDA 2PBJA 3NOFA 4ID0A 3GTUA 4HOJA 1ST9A 2LTKA 3QR6A 1UVZA 5CNWA 5FT3A 3L78A 1GLPA 1A2LA 3I43A 1XWKA 1TW9A 1O81A 3E3EA 3VWWA 2F51A 2PUKC 2L57A 3EVIA 4MJCA 3VURA 2LKUA 1TI3A 3GSTA 2O85A 5AIXA 4IHUA 4G10A 2BTOT 1GSQA 5J3RA 2KLXA 2YWOA 4ZBAA 2HSMB 3E9JB 1OC9A 3VPTA 1XFLA 1XBSA 1F3BA 4IBPA 3TJJA 4PGTA 3C73A 1XWBA 4BVXB 5G5EA 2VO4A 3F63A 2H19A 3DIEA 2JZSA 1ERWA 4JZQA 4EVMA 2FWGA 1G7EA 5G31A 5IMCA 2OACA 13GSA 3L9VA 3UOMA 4OO4A 2HZEA 3D5JA 5KN1A 11GSA 4V1Ag 2FY6A 2X8CA 2LRCA 5DAKB 3HY2A 4YAVA 3TKSC 3DEXA 1SL0B 1OKTA 2FHEA 4TRXA 2H72A 3VWVA 3VI7A 1V9WA 2B5XA 4L5LA 2DJKA 5E4WA 4WF4A 3JCML 5HR3A 2LJAA 2VUPA 4MPGA 2XPDA 2JZRA 3IDVA 3H4KA 3RAZA 2KUCA 3CSIA 1BQ7A 2DBCA 4JBBA 1JZRA 4EC0A 2GQLA 3DKSA 3FZAA 3L4NA 3O76A 1XWAA 3S9FA 3A2WA 4YQMA 1WIKA 3QCPA 2HRFA 5D93A 5ECIB 2NPBA 1DE1A 1LBKA 3GX8A 2ZUPA 1X5DA 2WB9A 3IOSA 4XS4B 3KGKA 3TJGA 4WR4A 5CRDA 1PGTA 1SL2B 1X9MB 5DVBA 1M2BA 1URMA 2YJ7A 3MDKA 2LSTA 2FWHA 4AJ7A 2HRKB 1ERTA 5ECOB 1YDKA 1FW1A 1SKSB 2KOKA 4G0IA 4F03A 4FIWA 3KZQA 5ECLB 1M9BA 2DIZA 2MZCA 4GLTA 2VM2A 2WRTA 5H5SA 3L9SA 3MWHA 3IPZA 1OC3A 3IAM2 4MMMA 4KH7A 4GRFA 3DRNA 4GF0A 1S3CA 3CRUA 5CO3A 2C3TA 1ZMAA 2HSYA 3DMLA 2YN1A 2NVLA 1WJKA 4RUVA 1F2EA 2OA7A 3TRXA 5H5RA 2OJLA 1KNGA 5CREA 1CQHA 4XS1A 3QDNA 2MMNA 1EV9A 4ISDA 2I1UA 3ZFLA 4IKHA 1UN2A 1A2JA 3RPNA 1SU9A 2XPEA 4BWSA 4I2UA 5HR0A 2HE3A 19GSA 3FR3A 4TXOB 4IQ1A 1TRUA 1WMJA 1GRXA 1XCCA 3IC8A 2H66A 2C4JA 4TR3A 3HJOA 4HQSA 4ZL8A 4Q5QA 1T4YA 3HVSA 4NHZA 5D8IA 4BPYA 5JWOB 5A5KA 2OADA 1A0FA 1IYIA 3RBTA 5ECNB 3GH6A 2H0HA 2H6XA 2ZNMA 2YWNA 1YF1A 2HFDA 2IFQB 4GTUA 2WFCA 3A3TA 3KM6A 3UBKA 2JU5A 4ZBBA 2L6CA 3P90A 3F3RA 4HEA2 2GS3A 2FCHA 4H86A 2FD3A 1FHEA 3IRAA 1EGRA 1R5AA 1RW1A 2LJKA 1AQVA 4PQHA 1U88A 2CV4A 2G2QA 4ECIA 4L0WA 2H76A 5D96A 3ZTLA 4EO3A 2GSTA 1EWXA 4Z7XA 3U6VA 3GKNA 3WT1A 2BJXA 3UBLA 1LU4A 3ZL5A 2E7PA 1PRXA 4DSRA 1ZL9A 2V32A 2YV9A 2OBIA 2J9HA 2IMFA 2P31A 4DSSA 3MNGA 3FYGA 5GSTA 2JSYA 1GSDA 4J57E 4D73B 4MDCA 3H93A 2CZ2A 1FVJA 3KIJA 2VOCA 2MMZA 2K6VA 1T1VA 2RLIA 5HR2A 2GDRA 2FA4A 3KTLA 2FWFA 4HDEA 3FZ9A 2VCQA 1A0RP 1BJXA 1K0NA 1NM3A 1VGLA 4HI7A 2KP2A 3HCZA 3TRPA 3TUEA 5JWQB 1J0FA 2DSAA 1VF4A 4I6XA 1YY7A 1X5EA 3QPMA 4K8MA 1AW9A 2LJRA 2GZYA 1GTBA 3C1SA 3Q74A 4K0GA 3F8UA 3MSZA 2HSMA 3A2XA 1JHBA 1T4ZA 2YCDA 1MDIA 4WF5A 3I69A 4MP4A 1FB6A 5LD0A 4JEDA 3FZ4A 1GSUA 4KUNA 1V57A 1G0TA 2O89A 1PMTA 1G7OA 4KDUA 8GSSA 3LYPA 1R4WA 4BVXA 3RDWA 18GSA 4XTSA 4JR4A 3F6FA 5ECRB 3GRXA 1XOBA 1OE8A 1K0OA 1GWCA 4MJBA 1T8EB 3ZLPA 1WE0A 2CT6A 3LEFA 7GSSA 4E8EA 1GLQA 2VL9A 1MD3A 4TOPA 2YNXA 2E2MA 2AUVA 2JADA 4PQIA 3TOUA 4TN8A 1NHOA 3PR8A 5DAKA 2VL3A 2PVOC 4L0UA 4NWYA 1V98A 1ML6A 1MTCA 5AIVA 2HT9A 3GN3A 1O7UA 1THOA 2AHEA 1X0RA 3N5OA 1HD2A 3VK9A 3VPQA 4ZB8A 3L9UA 4YQVA 3F6DA 1ZGNA 1W89A 4EDYA 2H75A 1SJ6A 3QOUA 3P8WA 3GV1A 1GL8A 5AGYA 4TVEA 4IELA 5B7CA 1XIYA 3D6IA 4QL9A 4HJMA 4MABA 1QQ2A 2ZCTA 3IK9A 1R7HA 4FYUA 5L71A 4LMVA 3WYWA 2X8HA 2C80A 3CSHA 4HZ2A 4GSNA 5GZZB 2WULA 3APQA 12GSA 3TOTA 4JR6A 1SK2A 3G9BA 3UMAA 1SKWB 3IBHA 3C71A 2TRCP 4GCIA 4XS4A 4X1UA 4HQZA 1XW9A 3GA4A 1PKWA 3KH9A 3O3TA 2YZUA 4WETA 3ZITA 3VWUA 3M0FA 1QXHA 5IPGA 4TXVA 3G7YA 1B48A 2HRKA 4KF9A 3LG6A 2RM6A 1SYXA 1CQGA 3GURA 2B1LA 2R37A 2LEGA 4IJIA 2DJ1A 2YANA 5JWRB 4KNDA 1BYEA 5A4VA 4RQXA 1XXUA 5ECSA 5D9TA 2VL2A 3ERFA 2VD1A 3FHKA 3F0IA 3APOA 3IV4A 4ZL9A 4MJEA 3GKKA 3CXGA 4KCEA 1NSWA 1Q98A 3ZIJA 1WP0A 1YEXA 2R3XA 1K0BA 3DVWA 2F9SA 3D4TA 1JLVA 3KP9A 2YOIA 1B4PA 4DSQA 3LYKA 5J9CA 5DCGA 5DJMA 1EOHA 2IPAA 4XHMA 1PKZA 2PGTA 3CRTA 2B7KA 2H70A 3ZVJD 3M9KA 4K2DA 1ZYQB 2ES7A 1SJZA 1B8XA 1T00A 2MBTA 3IAS2 1EEMA 1XVWA 1GTIA 3NZNA 2GTUA 1GNEA 2H73A 2FWEA 2GGTA 1PL2A 3KCMA 4I2TA 4KX4A 2C0DA 1M0UA 3FRCA 1AUCA 3ZZXA 3KJYA 4OMVA 2X8GA 1TU7A 2TRXA 2MYGA 3R3EA 4KDYA 2C3NA 4DVCA 1SD9A 2GQMA 4P3YB 1TDIA 2FUG2 1TP9A 3HD5A 4F0BA 2N5FA 3W8JA 3US3A 1PN9A 2JSZA 1V2AA 2V41A 3VWXA 5ELAA 4KSOA 1KTEA 1Z9HA 2C0FA 4X43A 2RUEA 3P7XA 4OFTA 2O87A 3TKSA 6GSVA 1GH2A 3QAVA 5ENUA 3TRQA 3IK7A 1RK4A 4ZIJA 5G2ZA 2QGVA 3IE3A 4MZCA 1G6YA 2L6DA 4O32A 1M99A 1HYUA 5AISA 4PXOA 2O8VB 3Q19A 4CDOA 5GAPD 2C0GA 2VLTA 1ABAA 4IQAA 5IQYA 4I8BA 1YF0A 3K8NA 3PGTA 2V1MA 1EZKA 3GX0A 1EP7A 3TKPA 3FW2A 2M80A 3GUSA 2HQTA 2R2JA 3UIWA 2I9HA 4RQRA 3M8NA 3PPUA 2HXKA 3FY7A 4D73A 3GSSA 3IHQA 3HA9A 1NW2A 4LL4B 1JZOA 3TKQA 1WOUA 4TR0A 2ON7A 1ILOA 2LQQA 2HSHA 3BOAA 5A4WA 10GSA 1O8XA 2H01A 22GSA 1O8WA 3F4TA 4ZBDA 3KH7A 4EUYA 4F0CA 4MF6A 4IJ3A 4FYCA 4IN0A 1QGVA 1MEKA 4WR5A 2CVKA 1H4OA 3LORA 2K8VA 5ID2B 5JCUA 2H6ZA 5G1KA 1OAZA 4POLA 2FLSA 2NBSA 3HDCA 1UA5A 1Z7PA 1AQWA 2GQKA 1A8YA 1MDJA 4TR4A 3TDGA 3EU4A 2E2GA 3FK8A 3CTGA 1JZDA 3PH9A 20GSA 4FQUA 2IMEA 4RI7A 4MJAA 2OE1A 4KSMA 4ECBA 4QQ7A 2LV3A 5F8BA 1K3OA 1XW6A 1XZOA 1BX9A 4EXJA 5GAND 5HFIA 5DALA 3NIVA 3QFAC 4BA7A 1U3AA 2VLUA 5H5QA 5IOXA 3M3MA 4Q5RA 3UVTA 3TJKA 3ZIVA 2CVBA 5HR1A 1XPVA 3Q6OA 2XBQA 1THXA 5J4UA 2RIIA 4X0XA 4IVFA 2PMTA 1R5PA 1TRWA 3FEUA 4V1Ap 2YZHA 2H0IA 2CA8A 4PX1A 2AB6A 1SK0A 2OE0A 2HZFA 4GWRA 4I97A 1FG4A 5G30A 3A2VA 1U6TA 2UZ8A 3EURA 3ISOA 5DCHA 2V2GA 1K0AA 2DJ3A 5B8AA 2H8LA 5F0GA 2JACA 4GQFA 3C8EA 2GZPA 2KHPA 4MK3A 1Z7RA 1PD21 5DJLA 1XVQA 3HYPA 1FVKA 5J41A 3W8SA 4ZB9A 2B7JA 2CQ9A 2GZZA 1RQMA 2LNTA 5BMUA 4IW9A 1K0DA 4OFNA 4PUFC 3CYNA 5FHIA 1VF1A 3BBYA 1JZWA 2IJYA 5LCZA 4F9ZA 1TK0B 5EL8A 5F05A 4N10A 5ECPB 2WCIA 4MPFA 1GP1A 1WRYA 3KTBA 2CZ3A 2YWIA 16GSA 1O6JA 2HNLA 4GSTA 4FO5A 5IIZA 2VCZA 1AXDA 3J7Yb 4MZBA 1QK8A 2LRTA 2L4QA 4POMA 4ECJA 3DYRA 4ACSA 5CP1A 1YQ1A 3UEMA 3ERWA 1GUMA 2L5LA 3DD3A 4OO5A 2J23A 3APSA 3F4RA 1B9YC 1Z6MA 1ZYEA 5D9XA 2WZ9A 5CRHA 3D21A 3L0HA 4G2EA 3I9V2 1O85A 1FAAA 4ILFA 2BMXA 2L59A 1TJDA 3BCKA 3ZVJA 5J5NA 2H71A 4YH2A 4FH8A 1AIUA 1V40A 4HUAA 4JU5A 2C0EA 4KDXA 1K3YA 2DLXA 1BEDA 5CRWA 3TJFA 2KP1A 2G0FA 1Q4JA 3FR9A 3WGEA 4XIHA 1YZXA 3ED3A 5CRGA 1GSYA 2D2ZA 2IMKA 4AJ6A 14GSA 3KD0A 4E8HA 1UC7A 2L4CA 4K7NA 3QMXA 4NPBA 2AYTA 1HNCA 3LQ7A 5DBQA 1SENA 5D73A 2RUFA 1EP8A 4MH2A 3ZREA 2GSRA 4OFMA 1E6BA 4GXZA 3TCOA 3TGZA 1ERUA 5C04A 2F8AA 2WDUA 4KA0A 1FO5A 2HRAA 2IIYA 4JE1A 1FB0A 3CMIA 4O5RA 2E0QA 1BG5A 2MMOA 4PTSA 4BVYB 5IMAA 4PUAA 3HKRA 3KXOA 2GSSA 1TXXA 2VCWA 2H1BA 1PL1A 3Q18A 1X9SB 3C1RA 2QC7A 3EWLA 4BL7B 2A2SA 4HU7A 1GTUA 2IL3A 2A4VA 1SL1B 5IPHA 1DE2A 4K7IA 3ME7A 2H6YA 4K7OA 1TKDB 2TIRA 4ZB6A 1T7PB 4LMWA 4G0LA 5KN3A 4AJ8A 4ULXA 2DC5A 4ECCA 2EC4A 5HFGA 4ZILA 3ZRDA 3V1WA 1TK8B 1TOFA 3HHVA 4DSSB 2H30A 5IMFA 4NV2A 5EPFA 3KMOA 2VL2C 2O7KA
chains in the Genus database with same CATH superfamily
5B8BA 2M46A 3D22A 3VLNA 1R26A 3GKXA 4ML6A 1SK1A 3H1NA 2NDOA 3GKMA 1S3DA 2CAQA 2VCTA 4PNGA 3BCIA 1TTZA 1H75A 2R6KA 4OCEA 3FR6A 2CX3A 4PHZC 5IM9A 2C8UA 3AY8A 5ID2A 3FMWA 1Z3EA 1PSQA 1SJIA 2B5EA 2LUSA 1EV4A 4LLRA 4TW5A 2XHFA 4OD7A 2NTOA 4HZ4A 2OE3A 1ZCPA 5GSSA 3EMXA 1ERVA 1HQOA 2HI7A 2VD0A 5COHA 3EMPA 3C7MA 5D9WA 3D4MA 2VAFA 1AQXA 5KN0A 3IHGA 4HU9A 5C00A 3LFLA 1KEBA 3J7Yk 3LSZA 4YQUA 3LXTA 2DJ0A 2EIRA 4IS0A 1SKRB 2CAIA 3UARA 4TXOA 4Q5NA 4BIKA 2FNOA 2OT3A 4RI6A 4PURA 5EVOA 3TKRA 2WW2A 2PVQA 2QSIA 3VFIA 1B9XC 4MNNA 4CHSA 6GSSA 4EKZA 1M7TA 2YJHA 4GSSA 4YAPA 4WEYA 2V6KA 1VF3A 1GTAA 1SYRA 4MZWA 2IFQA 1VRSD 2EIOA 4G9HA 4NAXA 4KE3A 2M72A 2CVDA 2I3YA 4Q5FA 4POBA 3GMFA 5ELGA 3SWLA 1X5CA 1T3BA 4N30A 4F2IA 1N25A 1DBYA 1N8JA 1GSFA 4IGJA 2P5QA 6GSYA 4TR1B 2R4VA 3F9UA 2F8FA 5F06A 4XS6A 1K3LA 2HSNB 1E2YA 1NHYA 2EFDA 3LGCA 1BG1A 2OBKA 5F07A 1M3IA 1TK5B 2WVZA 3ZYWA 2PU9C 3KP8A 2LNSA 4MF5A 3R2QA 3I6AA 3WGXA 3LW9A 4EIQA 1M2AA 1TRSA 3DWVA 3FKFA 2LS5A 5FWGA 4J56E 4OWYA 4YKGA 2WS2A 1F37A 4FYBA 2WGRA 3TJBA 3CTFA 5J40A 3HVXA 2H1AA 2LQOA 3GIXA 1TRVA 2C3QA 1U87A 4IP6A 1Z5YE 2AV4A 1U3IA 1QFNA 2B6MA 4JRRA 3GTUB 1JLWA 4OCFA 2FA8A 5KEJA 4KGIA 4I5QA 1TU8A 5JCGA 2H1GA 2N5BA 2B3SA 2C1YA 2F3MA 4XCSA 1Z6NA 1G6WA 3D0ZA 2HLSA 2GT6A 1OYJA 2Z9SA 3BD2A 5KN2A 1GSEA 5ECHB 4LL1B 4HS1A 2AAWA 3CSJA 2QA1A 2QKEA 5ECKB 2UV8G 1FOHA 1K0CA 5ABRA 4K9ZA 1SD8A 5IO2A 4IP1A 1F3AA 1HNAA 2YPMA 2K8SA 1MD4A 4Z2TA 4AKHA 2B5YA 1K0MA 1JFUA 3P2AA 2CX4A 2L5OA 1OC9B 5IOWA 3TKSE 2YWMA 5ECMB 1TI1A 3H79A 1Y6EA 1ON4A 1I5GA 2GSQA 1PX7A 2FGXA 1GULA 3VI5A 1I1IP 2GT5A 1FOVA 4ZXGA 5J4VA 1V58A 3ME8A 3EC3A 2HZEB 2VCVA 3LJRA 4L5OA 2VM1A 4N0ZA 1PA3A 2DMLA 3HZ4A 2A2PA 2ON5A 5A4UA 3HZ8A 1B4QA 4NMUA 2IN3A 3A5WA 2H0GA 3CQFA 3RHCA 5AN1A 3RHBA 2ALBA 3UAPA 5INYA 5IMZA 4ZL7A 4V2LA 6GSTA 3M1GA 4AI6A 2DIYA 1EGOA 2REMA 1VF2A 3GHAA 4CW9A 5G1LA 3HXSA 3WD6A 1DSBA 4WKWA 5LNKe 4L8EA 1PQNA 1F6MC 4HJ2A 4ML1A 4BVYA 1OVNA 3E0UA 3WT2A 2I4AA 5EY6A 4BL7A 4QL7A 5G5FA 2JL4A 4GQCA 3O6TA 4KCAA 3GH9A 4EF0A 1XOAA 4PI0C 1A24A 2JZTA 1S3AA 5E59A 4KAEA 2MMAA 6GSXA 1QUWA 2VCXA 3GYKA 1YEPA 1GUKA 4K6XA 2DMMA 2AJQB 4F82A 3EE2A 4KW6A 2OKAA 1HNBA 1XWCA 1OKDA 1XW5A 3MAKA 3G7IA 5A34B 2DJ2A 3QAGA 4XRAA 5IO0A 4POKA 3H8QA 2WJUA 2A4HA 2X4AA 2HYXA 3SBCA 3OR5A 1KBNA 1GSSA 1LJRA 3HVVA 4LA1A 1MDKA 5ECQB 2P5RA 2VIMA 2B1KA 1YJ6A 5IMVA 5IMDA 4N0VA 2X64A 2P0GA 4NHWA 5HQPA 2MBSA 3F3QA 4USSA 4WBJA 2IMIA 2X99A 1BAYA 5J9BA 4AF2A 1W4VA 2YP6A 5DQYA 1GNWA 2XBIA 3GL5A 3CBUA 1X9WB 4NV5A 2PERA 3QD9A 2H74A 3QFBC 9GSSA 5JCWA 4AKGA 6GSWA 3QAWA 4NXIA 4MLYA 2K9FA 3UVHA 3GFKA 3HJMA 5CAXA 2N5AA 4N11A 3ZMLA 2PN8A 3PINA 2RM5A 4V2NA 4O7HA 2HRNA 1ACVA 5D9VA 2IWTA 1ZZYA 2YV7A 2LRNA 3N9JA 1WPIA 2V6OA 4MF7A 1IYHA 1YVLA 4O92A 2H1DA 1ZOFA 4MA9A 2PPTA 4BWQA 3EU3A 4CY6A 1A23A 2I81A 1AC1A 1XWGA 3TB2A 3IC4A 1AAZA 2R0CA 4EE0A 4K0NA 1J08A 3LXZA 2GVPA 4TKYA 3IR4A 1DUGA 2A2RA 1OE7A 4K1FA 3UJ1A 5DALB 1C72A 3LWAA 1A2MA 1OC8A 3G7JA 1O73A 1M3JA 5B6MA 1Y25A 3KEBA 1QMVA 1M9AA 3M9JA 4EDZA 1WWJA 1N2AA 3IXRA 4AGSA 4PNFA 4J2FA 5B6NA 1GUHA 3IA1A 2GLRA 2VLVA 4XRDA 1EEJA 2R5GA 3U5RE 3UL3A 3ZMKA 2PWJA 1YKAA 1F9MA 5DDLA 3GNJA 4MCUA 4TR1A 1YKCA 3BJ5A 1SVOA 3GL3A 3EINA 6GSUA 2WW1A 1PX6A 17GSA 2HSNA 3ERGA 4KB3A 3KMNA 2XC2A 3FZ5A 4G19A 2X49A 4WXTA 3F4SA 2IMDA 3DXBA 3DVXA 1USBA 3HJPA 5HFKA 4WBRD 3RPPA 3MIXA 1I9DA 1XG8A 4EL1A 4MH3A 4PQ1A 5CYYA 2K18A 3DGQA 3EYTA 2EIQA 1J9BA 4G0KA 4DEJA 1EOGA 1A8LA 1M2DA 5A1NA 3W6GA 5DQSA 4V2MA 2DJJA 3ZFBA 3WGDA 2PBJA 3NOFA 4ID0A 3GTUA 4HOJA 1ST9A 2LTKA 3QR6A 1UVZA 5CNWA 2WW3A 5FT3A 3L78A 1GLPA 1A2LA 3I43A 1XWKA 1TW9A 1O81A 3E3EA 3VWWA 2F51A 2PUKC 2L57A 3EVIA 4K5RA 4MJCA 3VURA 2LKUA 1TI3A 3GSTA 2O85A 5AIXA 4IHUA 4G10A 2BTOT 1GSQA 5J3RA 2KLXA 2YWOA 4ZBAA 2HSMB 3E9JB 2VKZG 1OC9A 3VPTA 1XFLA 1XBSA 1F3BA 4IBPA 3TJJA 4PGTA 3C73A 1XWBA 4EIPA 4BVXB 5G5EA 2VO4A 3F63A 2WVYA 2H19A 3DIEA 2JZSA 1ERWA 4JZQA 4EVMA 2FWGA 1G7EA 5G31A 5IMCA 2OACA 13GSA 3L9VA 3UOMA 4OO4A 2HZEA 3D5JA 5KN1A 11GSA 4V1Ag 2FY6A 2X8CA 2LRCA 5DAKB 3HY2A 1BF5A 4YAVA 3TKSC 3DEXA 1SL0B 1OKTA 2WW0A 2FHEA 4TRXA 2H72A 3VWVA 3VI7A 1V9WA 2B5XA 4L5LA 2DJKA 5E4WA 4WF4A 3JCML 5HR3A 2LJAA 2VUPA 4MPGA 2XPDA 2JZRA 3IDVA 3H4KA 3CHXC 3RAZA 2KUCA 3CSIA 1BQ7A 2DBCA 4JBBA 1JZRA 4EC0A 2GQLA 3DKSA 3FZAA 3L4NA 3O76A 1XWAA 3S9FA 3A2WA 4YQMA 1WIKA 3QCPA 2HRFA 5D93A 5ECIB 2NPBA 1DE1A 2DKHA 1LBKA 3GX8A 2ZUPA 1X5DA 2WB9A 3IOSA 4XS4B 1Y1UA 3KGKA 3HMJG 3TJGA 4WR4A 5CRDA 1PGTA 5A34A 1SL2B 1X9MB 3RGBC 5DVBA 1M2BA 1URMA 2YJ7A 3MDKA 2LSTA 2DKIA 2WZSA 2FWHA 4AJ7A 2HRKB 4QMKA 1ERTA 5ECOB 1YDKA 1FW1A 1SKSB 2KOKA 4G0IA 4F03A 4FIWA 3KZQA 5ECLB 1M9BA 2DIZA 2MZCA 4GLTA 2VM2A 2WRTA 5H5SA 3L9SA 3IPZA 3MWHA 1OC3A 3IAM2 4MMMA 4KH7A 4GRFA 3DRNA 4GF0A 1S3CA 3CRUA 5CO3A 2C3TA 4ZB7A 1ZMAA 3DMLA 2HSYA 2YN1A 2NVLA 1WJKA 4RUVA 1F2EA 2OA7A 3TRXA 5H5RA 2OJLA 1KNGA 5CREA 1CQHA 4XS1A 3QDNA 5A5HB 2MMNA 1EV9A 4ISDA 2I1UA 3ZFLA 4IKHA 1UN2A 1A2JA 3RPNA 1SU9A 2XPEA 4BWSA 4I2UA 5HR0A 2HE3A 19GSA 2R0PA 3FR3A 4TXOB 4IQ1A 1TRUA 1WMJA 1GRXA 1XCCA 3IC8A 2H66A 2C4JA 4TR3A 3HJOA 4HQSA 4ZL8A 4Q5QA 1T4YA 3HVSA 4NHZA 5D8IA 4BPYA 4W66A 5JWOB 5A5KA 2OADA 1A0FA 1IYIA 3RBTA 5ECNB 3GH6A 2H0HA 2H6XA 2ZNMA 2YWNA 1YF1A 3CWGA 2HFDA 2IFQB 4GTUA 2WFCA 3A3TA 3KM6A 3UBKA 2JU5A 4ZBBA 2WVXA 2L6CA 3P90A 3F3RA 4HEA2 2GS3A 2FCHA 4H86A 2FD3A 1FHEA 3IRAA 1EGRA 1R5AA 1RW1A 2LJKA 1AQVA 4PQHA 1U88A 2CV4A 2G2QA 4ECIA 4L0WA 2H76A 5D96A 3ZTLA 4EO3A 5BRTA 2GSTA 1EWXA 4Z7XA 3U6VA 3GKNA 3WT1A 2BJXA 3UBLA 1LU4A 3ZL5A 2E7PA 1PRXA 4DSRA 1ZL9A 2V32A 5KOXA 1SVMA 2YV9A 2OBIA 2J9HA 2IMFA 2P31A 4DSSA 3MNGA 3FYGA 5GSTA 2JSYA 1GSDA 4J57E 4O5QA 4D73B 4MDCA 3H93A 2CZ2A 1FVJA 3KIJA 2VOCA 2MMZA 2K6VA 1T1VA 2RLIA 5HR2A 2GDRA 2FA4A 3KTLA 2FWFA 4HDEA 3FZ9A 2VCQA 1A0RP 1BJXA 1K0NA 1NM3A 1VGLA 4HI7A 2KP2A 3HCZA 3RFRC 3TRPA 3TUEA 5JWQB 1J0FA 2DSAA 1VF4A 4GDFA 4I6XA 1YY7A 1X5EA 3QPMA 1AW9A 2LJRA 3C1SA 2GZYA 1GTBA 4K8MA 3Q74A 4K0GA 3F8UA 3MSZA 2HSMA 1SVLA 3A2XA 1JHBA 1T4ZA 2YCDA 1MDIA 4WF5A 3I69A 2O3EA 4MP4A 1FB6A 5LD0A 4JEDA 3FZ4A 1GSUA 4KUNA 1V57A 1G0TA 2O89A 1PMTA 1G7OA 4KDUA 8GSSA 3LYPA 1R4WA 4BVXA 3RDWA 18GSA 4XTSA 4JR4A 3F6FA 5ECRB 3GRXA 1XOBA 1OE8A 1K0OA 1GWCA 4MJBA 1T8EB 3ZLPA 1WE0A 2CT6A 3LEFA 7GSSA 4E8EA 1GLQA 2VL9A 1MD3A 4TOPA 2YNXA 2E2MA 2AUVA 2JADA 4PQIA 3TOUA 4TN8A 1NHOA 3PR8A 1PN0A 5DAKA 2VL3A 2PVOC 4L0UA 4NWYA 1V98A 1ML6A 1MTCA 5AIVA 2HT9A 3GN3A 2EFHA 1O7UA 1THOA 2AHEA 1X0RA 3N5OA 1HD2A 3VK9A 3VPQA 4ZB8A 3L9UA 4YQVA 3F6DA 1ZGNA 1W89A 4EDYA 2H75A 1SJ6A 3QOUA 3P8WA 3GV1A 1GL8A 5AGYA 4TVEA 4IELA 5B7CA 1XIYA 3D6IA 4QL9A 4HJMA 4MABA 1QQ2A 2ZCTA 3IK9A 1R7HA 4FYUA 5L71A 4LMVA 3WYWA 2X8HA 2C80A 3CSHA 4HZ2A 4GSNA 5GZZB 2WULA 3APQA 12GSA 3TOTA 4JR6A 1SK2A 3G9BA 3UMAA 1SKWB 3IBHA 3C71A 2TRCP 4GCIA 5BMUB 4XS4A 4X1UA 5KOWA 4HQZA 1XW9A 3GA4A 1PKWA 3KH9A 3O3TA 2YZUA 4WETA 3ZITA 3VWUA 3M0FA 1QXHA 5IPGA 2EFCA 4TXVA 4G01A 3G7YA 1B48A 2HRKA 4KF9A 3LG6A 2RM6A 1SYXA 1CQGA 3GURA 2B1LA 1S3RA 2R37A 2LEGA 4IJIA 2DJ1A 2YANA 5JWRB 4KNDA 1BYEA 5A4VA 4RQXA 1XXUA 5ECSA 5D9TA 2VL2A 3ERFA 2VD1A 3FHKA 3F0IA 3APOA 3IV4A 4ZL9A 4MJEA 3GKKA 3CXGA 4KCEA 1NSWA 1Q98A 3ZIJA 1WP0A 1YEXA 2R3XA 1K0BA 3DVWA 2F9SA 3D4TA 1JLVA 3KP9A 2YOIA 1B4PA 4DSQA 3LYKA 4CY8A 5J9CA 4HSCX 1ZYPA 5DCGA 5DJMA 1EOHA 5A5HA 2IPAA 4XHMA 1PKZA 2PGTA 3CRTA 2B7KA 2H70A 3ZVJD 3M9KA 4K2DA 1ZYQB 2ES7A 1SJZA 1B8XA 1T00A 2MBTA 3IAS2 1EEMA 1XVWA 1GTIA 3NZNA 2GTUA 1GNEA 2H73A 3TU3B 2FWEA 1TXUA 2GGTA 1PL2A 3KCMA 4I2TA 4KX4A 2C0DA 1M0UA 3FRCA 1AUCA 3ZZXA 3KJYA 4OMVA 2X8GA 1TU7A 2TRXA 2MYGA 3R3EA 4KDYA 2C3NA 4DVCA 1SD9A 2GQMA 4P3YB 1TDIA 2FUG2 1TP9A 3HD5A 4F0BA 1S4BP 2N5FA 3W8JA 3US3A 1PN9A 2JSZA 1V2AA 2V41A 3VWXA 5ELAA 4KSOA 1KTEA 1Z9HA 2C0FA 4X43A 2RUEA 3P7XA 4OFTA 2O87A 3TKSA 6GSVA 1GH2A 3QAVA 5ENUA 3TRQA 2O5VA 3IK7A 1RK4A 4ZIJA 2R0GA 5G2ZA 2QGVA 3IE3A 4MZCA 1G6YA 2L6DA 4O32A 1M99A 1HYUA 5AISA 4PXOA 2O8VB 3Q19A 4CDOA 5GAPD 2C0GA 2VLTA 1ABAA 4IQAA 5IQYA 4I8BA 1YF0A 3K8NA 3PGTA 2V1MA 1EZKA 4YKFA 3GX0A 1EP7A 3TKPA 3FW2A 2M80A 3GUSA 2HQTA 2R2JA 3UIWA 2I9HA 4RQRA 3M8NA 3PPUA 2HXKA 3FY7A 4D73A 3GSSA 4Z2UA 3IHQA 3HA9A 1NW2A 4LL4B 1JZOA 3TKQA 1WOUA 4TR0A 2ON7A 1ILOA 2LQQA 2HSHA 3BOAA 5A4WA 5A1NB 10GSA 1O8XA 2H01A 22GSA 1O8WA 3F4TA 4ZBDA 3KH7A 4EUYA 4F0CA 5J47A 4MF6A 4IJ3A 4O5UA 4FYCA 4IN0A 1QGVA 1MEKA 4WR5A 2CVKA 1H4OA 3LORA 2K8VA 5ID2B 4FXYP 5JCUA 2H6ZA 5G1KA 1OAZA 4POLA 2FLSA 2NBSA 3HDCA 1UA5A 1Z7PA 1AQWA 2GQKA 1A8YA 1MDJA 4TR4A 3TDGA 3EU4A 2E2GA 3FK8A 3HVNA 3CTGA 1JZDA 3A5IA 3PH9A 20GSA 4FQUA 2IMEA 4RI7A 4MJAA 2OE1A 4KSMA 4ECBA 4QQ7A 2LV3A 5F8BA 1K3OA 1XW6A 1XZOA 5J4YA 1BX9A 4EXJA 5GAND 5HFIA 5DALA 3NIVA 3QFAC 4BA7A 1U3AA 2VLUA 4K2XA 5H5QA 5IOXA 3M3MA 4PI2C 4Q5RA 3UVTA 3TJKA 3ZIVA 2CVBA 5HR1A 1XPVA 3Q6OA 2XBQA 1THXA 5J4UA 2RIIA 4X0XA 4IVFA 2PMTA 1R5PA 1TRWA 3FEUA 4V1Ap 2YZHA 2H0IA 2CA8A 4PX1A 2AB6A 1SK0A 2OE0A 2HZFA 4GWRA 4I97A 1FG4A 4AKIA 5G30A 3A2VA 1U6TA 2UZ8A 3EURA 3ISOA 5DCHA 2V2GA 1K0AA 2DJ3A 5B8AA 2H8LA 5F0GA 2JACA 4GQFA 3C8EA 2GZPA 2KHPA 4ICYA 4MK3A 1Z7RA 1PD21 5DJLA 1XVQA 3HYPA 1FVKA 5J41A 3W8SA 4ZB9A 2B7JA 2CQ9A 2GZZA 1RQMA 2LNTA 5BMUA 4IW9A 1K0DA 4OFNA 4PUFC 3CYNA 5FHIA 2EFEA 1VF1A 3BBYA 1JZWA 2IJYA 5LCZA 4F9ZA 1TK0B 5EL8A 5F05A 4N10A 5ECPB 2WCIA 4MPFA 2O36A 1GP1A 1WRYA 3KTBA 2CZ3A 2YWIA 16GSA 1O6JA 2HNLA 4GSTA 4FO5A 5IIZA 2VCZA 1AXDA 3J7Yb 3MYDA 4MZBA 1QK8A 2LRTA 2L4QA 4POMA 4ECJA 3DYRA 4ACSA 5CP1A 4A5PA 1PFOA 1YQ1A 3UEMA 3ERWA 1GUMA 2L5LA 3DD3A 4OO5A 2J23A 3APSA 3F4RA 1B9YC 1Z6MA 1ZYEA 5D9XA 2WZ9A 5CRHA 3D21A 3L0HA 4G2EA 3I9V2 1O85A 1FAAA 3EPTA 2BMXA 4ILFA 2L59A 1TJDA 3BCKA 3ZVJA 5J5NA 2H71A 4N3ZA 4YH2A 4FH8A 1AIUA 1V40A 4X4JA 1YEWC 4HUAA 4JU5A 2C0EA 4KDXA 1K3YA 2DLXA 1BEDA 5CRWA 3TJFA 2KP1A 2G0FA 1Q4JA 3FR9A 3WGEA 4XIHA 1YZXA 3ED3A 1ZYNA 2H1LA 4K5SA 5CRGA 1GSYA 2D2ZA 2IMKA 4AJ6A 14GSA 3KD0A 4E8HA 1UC7A 2L4CA 4K7NA 3QMXA 4NPBA 2AYTA 1HNCA 3LQ7A 5DBQA 1SENA 5D73A 2RUFA 1EP8A 4MH2A 3ZREA 2GSRA 4OFMA 1E6BA 4GXZA 3TCOA 3TGZA 1ERUA 5C04A 2F8AA 2WDUA 4KA0A 1FO5A 2HRAA 2IIYA 4JE1A 1FB0A 3CMIA 2WVXB 4O5RA 2E0QA 1BG5A 4E68A 2MMOA 4PTSA 4Z2RA 4BVYB 5IMAA 4AKXB 4PUAA 3HKRA 3KXOA 2GSSA 1TXXA 2VCWA 2H1BA 1PL1A 3Q18A 1X9SB 3C1RA 2QC7A 3EWLA 4BL7B 2A2SA 4HU7A 1GTUA 2IL3A 2A4VA 1SL1B 5IPHA 1DE2A 4K7IA 3ME7A 2H6YA 4K7OA 1TKDB 2TIRA 4ZB6A 1T7PB 4LMWA 4G0LA 5KN3A 4AJ8A 4ULXA 2DC5A 4ECCA 2EC4A 5HFGA 4ZILA 3ZRDA 3V1WA 1TK8B 1TOFA 3HHVA 4DSSB 2H30A 5IMFA 2QA2A 4NV2A 5EPFA 3KMOA 2VL2C 2O7KA
chains in the Genus database with same CATH topology
5B8BA 2M46A 3D22A 3VLNA 1R26A 3GKXA 4ML6A 1SK1A 3H1NA 2NDOA 3GKMA 1S3DA 2CAQA 2VCTA 4PNGA 3BCIA 1TTZA 1H75A 2R6KA 4OCEA 3FR6A 2CX3A 5IM9A 2C8UA 3AY8A 5ID2A 3FMWA 1Z3EA 1PSQA 1SJIA 2B5EA 2LUSA 1EV4A 4LLRA 4TW5A 2XHFA 4OD7A 2NTOA 4HZ4A 2OE3A 1ZCPA 5GSSA 3EMXA 1ERVA 1HQOA 2HI7A 2VD0A 5COHA 3EMPA 3C7MA 5D9WA 3D4MA 2VAFA 1AQXA 5KN0A 3IHGA 4HU9A 5C00A 3LFLA 1KEBA 3J7Yk 3LSZA 4YQUA 3LXTA 2DJ0A 2EIRA 4IS0A 1SKRB 2CAIA 3UARA 4TXOA 4Q5NA 2FNOA 2OT3A 4RI6A 4PURA 5EVOA 3TKRA 2PVQA 2QSIA 3VFIA 1B9XC 4MNNA 4CHSA 6GSSA 4EKZA 1M7TA 2YJHA 4GSSA 4YAPA 4WEYA 2V6KA 1VF3A 1GTAA 1SYRA 4MZWA 2IFQA 1VRSD 2EIOA 4G9HA 4NAXA 4KE3A 2M72A 2CVDA 2I3YA 4Q5FA 4POBA 3GMFA 5ELGA 3SWLA 1X5CA 1T3BA 4N30A 4F2IA 1N25A 1DBYA 1N8JA 1GSFA 4IGJA 2P5QA 6GSYA 4TR1B 2R4VA 3F9UA 2F8FA 5F06A 4XS6A 1K3LA 2HSNB 1E2YA 1NHYA 2EFDA 3LGCA 1BG1A 2OBKA 5F07A 1TK5B 3ZYWA 2PU9C 3KP8A 2LNSA 4MF5A 3R2QA 3I6AA 3WGXA 3LW9A 4EIQA 1M2AA 1TRSA 3DWVA 3FKFA 2LS5A 5FWGA 4J56E 4OWYA 4YKGA 2WS2A 1F37A 4FYBA 2WGRA 3TJBA 3CTFA 5J40A 3HVXA 2H1AA 2LQOA 3GIXA 1TRVA 2C3QA 1U87A 4IP6A 1Z5YE 2AV4A 1U3IA 1QFNA 2B6MA 4JRRA 3GTUB 1JLWA 4OCFA 2FA8A 5KEJA 4KGIA 4I5QA 1TU8A 5JCGA 2H1GA 2N5BA 2B3SA 2C1YA 2F3MA 4XCSA 1Z6NA 1G6WA 3D0ZA 2HLSA 2GT6A 1OYJA 2Z9SA 3BD2A 5KN2A 1GSEA 5ECHB 4LL1B 4HS1A 2AAWA 3CSJA 2QA1A 2QKEA 5ECKB 2UV8G 1FOHA 1K0CA 5ABRA 4K9ZA 1SD8A 5IO2A 4IP1A 1F3AA 1HNAA 2YPMA 2K8SA 1MD4A 4Z2TA 4AKHA 2B5YA 1K0MA 1JFUA 3P2AA 2CX4A 2L5OA 1OC9B 5IOWA 3TKSE 2YWMA 5ECMB 1TI1A 3H79A 1Y6EA 1ON4A 1I5GA 2GSQA 1PX7A 2FGXA 1GULA 3VI5A 2GT5A 1FOVA 4ZXGA 5J4VA 1V58A 3ME8A 3EC3A 2HZEB 2VCVA 3LJRA 4L5OA 2VM1A 4N0ZA 1PA3A 2DMLA 3HZ4A 2A2PA 2ON5A 5A4UA 3HZ8A 1B4QA 4NMUA 2IN3A 3A5WA 2H0GA 3RHCA 5AN1A 3RHBA 2ALBA 3UAPA 5INYA 5IMZA 4ZL7A 4V2LA 6GSTA 3M1GA 4AI6A 2DIYA 1EGOA 2REMA 1VF2A 3GHAA 4CW9A 5G1LA 3HXSA 3WD6A 1DSBA 4WKWA 5LNKe 4L8EA 1PQNA 1F6MC 4HJ2A 4ML1A 4BVYA 1OVNA 3E0UA 3WT2A 2I4AA 5EY6A 4BL7A 4QL7A 5G5FA 2JL4A 4GQCA 3O6TA 4KCAA 3GH9A 4EF0A 1XOAA 1A24A 2JZTA 1S3AA 5E59A 4KAEA 2MMAA 6GSXA 1QUWA 2VCXA 3GYKA 1YEPA 1GUKA 4K6XA 2DMMA 2AJQB 4F82A 3EE2A 4KW6A 2OKAA 1HNBA 1XWCA 1OKDA 1XW5A 3MAKA 3G7IA 5A34B 2DJ2A 3QAGA 4XRAA 5IO0A 4POKA 3H8QA 2WJUA 2A4HA 2X4AA 2HYXA 3SBCA 3OR5A 1KBNA 1GSSA 1LJRA 3HVVA 4LA1A 1MDKA 5ECQB 2P5RA 2VIMA 2B1KA 1YJ6A 5IMVA 5IMDA 4N0VA 2X64A 2P0GA 4NHWA 5HQPA 2MBSA 3F3QA 4USSA 4WBJA 2IMIA 2X99A 1BAYA 5J9BA 4AF2A 1W4VA 2YP6A 5DQYA 1GNWA 2XBIA 3GL5A 3CBUA 1X9WB 4NV5A 2PERA 3QD9A 2H74A 3QFBC 9GSSA 5JCWA 4AKGA 6GSWA 3QAWA 4NXIA 4MLYA 2K9FA 3UVHA 3GFKA 3HJMA 5CAXA 2N5AA 4N11A 3ZMLA 2PN8A 3PINA 2RM5A 4V2NA 4O7HA 2HRNA 1ACVA 5D9VA 2IWTA 1ZZYA 2YV7A 2LRNA 3N9JA 1WPIA 2V6OA 4MF7A 1IYHA 1YVLA 4O92A 2H1DA 1ZOFA 4MA9A 2PPTA 4BWQA 3EU3A 4CY6A 1A23A 2I81A 1AC1A 1XWGA 3TB2A 3IC4A 1AAZA 2R0CA 4EE0A 4K0NA 1J08A 3LXZA 2GVPA 4TKYA 3IR4A 1DUGA 2A2RA 1OE7A 4K1FA 3UJ1A 5DALB 1C72A 3LWAA 1A2MA 1OC8A 3G7JA 1O73A 5B6MA 1Y25A 3KEBA 1QMVA 1M9AA 3M9JA 4EDZA 1WWJA 1N2AA 3IXRA 4AGSA 4PNFA 4J2FA 5B6NA 1GUHA 3IA1A 2GLRA 2VLVA 4XRDA 1EEJA 2R5GA 3U5RE 3UL3A 3ZMKA 2PWJA 1YKAA 1F9MA 5DDLA 3GNJA 4MCUA 4TR1A 1YKCA 3BJ5A 1SVOA 3GL3A 3EINA 6GSUA 1PX6A 17GSA 2HSNA 3ERGA 4KB3A 3KMNA 2XC2A 3FZ5A 4G19A 2X49A 4WXTA 3F4SA 2IMDA 3DXBA 3DVXA 1USBA 3HJPA 5HFKA 4WBRD 3RPPA 3MIXA 1I9DA 4EL1A 4MH3A 4PQ1A 5CYYA 2K18A 3DGQA 3EYTA 2EIQA 1J9BA 4G0KA 4DEJA 1EOGA 1A8LA 1M2DA 5A1NA 3W6GA 5DQSA 4V2MA 2DJJA 3ZFBA 3WGDA 2PBJA 3NOFA 4ID0A 3GTUA 4HOJA 1ST9A 2LTKA 3QR6A 1UVZA 5CNWA 5FT3A 3L78A 1GLPA 1A2LA 3I43A 1XWKA 1TW9A 1O81A 3E3EA 3VWWA 2F51A 2PUKC 2L57A 3EVIA 4K5RA 4MJCA 3VURA 2LKUA 1TI3A 3GSTA 2O85A 5AIXA 4IHUA 4G10A 2BTOT 1GSQA 5J3RA 2KLXA 2YWOA 4ZBAA 2HSMB 3E9JB 2VKZG 1OC9A 3VPTA 1XFLA 1XBSA 1F3BA 4IBPA 3TJJA 4PGTA 3C73A 1XWBA 4EIPA 4BVXB 5G5EA 2VO4A 3F63A 2H19A 3DIEA 2JZSA 1ERWA 4JZQA 4EVMA 2FWGA 1G7EA 5G31A 5IMCA 2OACA 13GSA 3L9VA 3UOMA 4OO4A 2HZEA 3D5JA 5KN1A 11GSA 4V1Ag 2FY6A 2X8CA 2LRCA 5DAKB 3HY2A 1BF5A 4YAVA 3TKSC 3DEXA 1SL0B 1OKTA 2FHEA 4TRXA 2H72A 3VWVA 3VI7A 1V9WA 2B5XA 4L5LA 2DJKA 5E4WA 4WF4A 3JCML 5HR3A 2LJAA 2VUPA 4MPGA 2XPDA 2JZRA 3IDVA 3H4KA 3RAZA 2KUCA 3CSIA 1BQ7A 2DBCA 4JBBA 1JZRA 4EC0A 2GQLA 3DKSA 3FZAA 3L4NA 3O76A 1XWAA 3S9FA 3A2WA 4YQMA 1WIKA 3QCPA 2HRFA 5D93A 5ECIB 2NPBA 1DE1A 2DKHA 1LBKA 3GX8A 2ZUPA 1X5DA 2WB9A 3IOSA 4XS4B 1Y1UA 3KGKA 3HMJG 3TJGA 4WR4A 5CRDA 1PGTA 5A34A 1SL2B 1X9MB 5DVBA 1M2BA 1URMA 2YJ7A 3MDKA 2LSTA 2DKIA 2FWHA 4AJ7A 2HRKB 4QMKA 1ERTA 5ECOB 1YDKA 1FW1A 1SKSB 2KOKA 4G0IA 4F03A 4FIWA 3KZQA 5ECLB 1M9BA 2DIZA 2MZCA 4GLTA 2VM2A 2WRTA 5H5SA 3L9SA 3MWHA 3IPZA 1OC3A 3IAM2 4MMMA 4KH7A 4GRFA 3DRNA 4GF0A 1S3CA 3CRUA 5CO3A 2C3TA 4ZB7A 1ZMAA 2HSYA 3DMLA 2YN1A 2NVLA 1WJKA 4RUVA 1F2EA 2OA7A 3TRXA 5H5RA 2OJLA 1KNGA 5CREA 1CQHA 4XS1A 3QDNA 5A5HB 2MMNA 1EV9A 4ISDA 2I1UA 3ZFLA 4IKHA 1UN2A 1A2JA 3RPNA 1SU9A 2XPEA 4BWSA 4I2UA 5HR0A 2HE3A 19GSA 2R0PA 3FR3A 4TXOB 4IQ1A 1TRUA 1WMJA 1GRXA 1XCCA 3IC8A 2H66A 2C4JA 4TR3A 3HJOA 4HQSA 4ZL8A 4Q5QA 1T4YA 3HVSA 4NHZA 5D8IA 4BPYA 4W66A 5JWOB 5A5KA 2OADA 1A0FA 1IYIA 3RBTA 5ECNB 3GH6A 2H0HA 2H6XA 2ZNMA 2YWNA 1YF1A 3CWGA 2HFDA 2IFQB 4GTUA 2WFCA 3A3TA 3KM6A 3UBKA 2JU5A 4ZBBA 2L6CA 3P90A 3F3RA 4HEA2 2GS3A 2FCHA 4H86A 2FD3A 1FHEA 3IRAA 1EGRA 1R5AA 1RW1A 2LJKA 1AQVA 4PQHA 1U88A 2CV4A 2G2QA 4ECIA 4L0WA 2H76A 5D96A 3ZTLA 4EO3A 5BRTA 2GSTA 1EWXA 4Z7XA 3U6VA 3GKNA 3WT1A 2BJXA 3UBLA 1LU4A 3ZL5A 2E7PA 1PRXA 4DSRA 1ZL9A 2V32A 5KOXA 1SVMA 2YV9A 2OBIA 2J9HA 2IMFA 2P31A 4DSSA 3MNGA 3FYGA 5GSTA 2JSYA 1GSDA 4J57E 4O5QA 4D73B 4MDCA 3H93A 2CZ2A 1FVJA 3KIJA 2VOCA 2MMZA 2K6VA 1T1VA 2RLIA 5HR2A 2GDRA 2FA4A 3KTLA 2FWFA 4HDEA 3FZ9A 2VCQA 1A0RP 1BJXA 1K0NA 1NM3A 1VGLA 4HI7A 2KP2A 3HCZA 3TRPA 3TUEA 5JWQB 1J0FA 2DSAA 1VF4A 4GDFA 4I6XA 1YY7A 1X5EA 3QPMA 1AW9A 2LJRA 3C1SA 2GZYA 1GTBA 4K8MA 3Q74A 4K0GA 3F8UA 3MSZA 2HSMA 1SVLA 3A2XA 1JHBA 1T4ZA 2YCDA 1MDIA 4WF5A 3I69A 4MP4A 1FB6A 5LD0A 4JEDA 3FZ4A 1GSUA 4KUNA 1V57A 1G0TA 2O89A 1PMTA 1G7OA 4KDUA 8GSSA 3LYPA 1R4WA 4BVXA 3RDWA 18GSA 4XTSA 4JR4A 3F6FA 5ECRB 3GRXA 1XOBA 1OE8A 1K0OA 1GWCA 4MJBA 1T8EB 3ZLPA 1WE0A 2CT6A 3LEFA 7GSSA 4E8EA 1GLQA 2VL9A 1MD3A 4TOPA 2YNXA 2E2MA 2AUVA 2JADA 4PQIA 3TOUA 4TN8A 1NHOA 3PR8A 1PN0A 5DAKA 2VL3A 2PVOC 4L0UA 4NWYA 1V98A 1ML6A 1MTCA 5AIVA 2HT9A 3GN3A 2EFHA 1O7UA 1THOA 2AHEA 1X0RA 3N5OA 1HD2A 3VK9A 3VPQA 4ZB8A 3L9UA 4YQVA 3F6DA 1ZGNA 1W89A 4EDYA 2H75A 1SJ6A 3QOUA 3P8WA 3GV1A 1GL8A 5AGYA 4TVEA 4IELA 5B7CA 1XIYA 3D6IA 4QL9A 4HJMA 4MABA 1QQ2A 2ZCTA 3IK9A 1R7HA 4FYUA 5L71A 4LMVA 3WYWA 2X8HA 2C80A 3CSHA 4HZ2A 4GSNA 5GZZB 2WULA 3APQA 12GSA 3TOTA 4JR6A 1SK2A 3G9BA 3UMAA 1SKWB 3IBHA 3C71A 2TRCP 4GCIA 5BMUB 4XS4A 4X1UA 5KOWA 4HQZA 1XW9A 3GA4A 1PKWA 3KH9A 3O3TA 2YZUA 4WETA 3ZITA 3VWUA 3M0FA 1QXHA 5IPGA 2EFCA 4TXVA 4G01A 3G7YA 1B48A 2HRKA 4KF9A 3LG6A 2RM6A 1SYXA 1CQGA 3GURA 2B1LA 2R37A 2LEGA 4IJIA 2DJ1A 2YANA 5JWRB 4KNDA 1BYEA 5A4VA 4RQXA 1XXUA 5ECSA 5D9TA 2VL2A 3ERFA 2VD1A 3FHKA 3F0IA 3APOA 3IV4A 4ZL9A 4MJEA 3GKKA 3CXGA 4KCEA 1NSWA 1Q98A 3ZIJA 1WP0A 1YEXA 2R3XA 1K0BA 3DVWA 2F9SA 3D4TA 1JLVA 3KP9A 2YOIA 1B4PA 4DSQA 3LYKA 4CY8A 5J9CA 1ZYPA 5DCGA 5DJMA 1EOHA 5A5HA 2IPAA 4XHMA 1PKZA 2PGTA 3CRTA 2B7KA 2H70A 3ZVJD 3M9KA 4K2DA 1ZYQB 2ES7A 1SJZA 1B8XA 1T00A 2MBTA 3IAS2 1EEMA 1XVWA 1GTIA 3NZNA 2GTUA 1GNEA 2H73A 3TU3B 2FWEA 1TXUA 2GGTA 1PL2A 3KCMA 4I2TA 4KX4A 2C0DA 1M0UA 3FRCA 1AUCA 3ZZXA 3KJYA 4OMVA 2X8GA 1TU7A 2TRXA 2MYGA 3R3EA 4KDYA 2C3NA 4DVCA 1SD9A 2GQMA 4P3YB 1TDIA 2FUG2 1TP9A 3HD5A 4F0BA 2N5FA 3W8JA 3US3A 1PN9A 2JSZA 1V2AA 2V41A 3VWXA 5ELAA 4KSOA 1KTEA 1Z9HA 2C0FA 4X43A 2RUEA 3P7XA 4OFTA 2O87A 3TKSA 6GSVA 1GH2A 3QAVA 5ENUA 3TRQA 2O5VA 3IK7A 1RK4A 4ZIJA 2R0GA 5G2ZA 2QGVA 3IE3A 4MZCA 1G6YA 2L6DA 4O32A 1M99A 1HYUA 5AISA 4PXOA 2O8VB 3Q19A 4CDOA 5GAPD 2C0GA 2VLTA 1ABAA 4IQAA 5IQYA 4I8BA 1YF0A 3K8NA 3PGTA 2V1MA 1EZKA 4YKFA 3GX0A 1EP7A 3TKPA 3FW2A 2M80A 3GUSA 2HQTA 2R2JA 3UIWA 2I9HA 4RQRA 3M8NA 3PPUA 2HXKA 3FY7A 4D73A 3GSSA 4Z2UA 3IHQA 3HA9A 1NW2A 4LL4B 1JZOA 3TKQA 1WOUA 4TR0A 2ON7A 1ILOA 2LQQA 2HSHA 3BOAA 5A4WA 5A1NB 10GSA 1O8XA 2H01A 22GSA 1O8WA 3F4TA 4ZBDA 3KH7A 4EUYA 4F0CA 5J47A 4MF6A 4IJ3A 4O5UA 4FYCA 4IN0A 1QGVA 1MEKA 4WR5A 2CVKA 1H4OA 3LORA 2K8VA 5ID2B 5JCUA 2H6ZA 5G1KA 1OAZA 4POLA 2FLSA 2NBSA 3HDCA 1UA5A 1Z7PA 1AQWA 2GQKA 1A8YA 1MDJA 4TR4A 3TDGA 3EU4A 2E2GA 3FK8A 3CTGA 1JZDA 3A5IA 3PH9A 20GSA 4FQUA 2IMEA 4RI7A 4MJAA 2OE1A 4KSMA 4ECBA 4QQ7A 2LV3A 5F8BA 1K3OA 1XW6A 1XZOA 5J4YA 1BX9A 4EXJA 5GAND 5HFIA 5DALA 3NIVA 3QFAC 4BA7A 1U3AA 2VLUA 4K2XA 5H5QA 5IOXA 3M3MA 4Q5RA 3UVTA 3TJKA 3ZIVA 2CVBA 5HR1A 1XPVA 3Q6OA 2XBQA 1THXA 5J4UA 2RIIA 4X0XA 4IVFA 2PMTA 1R5PA 1TRWA 3FEUA 4V1Ap 2YZHA 2H0IA 2CA8A 4PX1A 2AB6A 1SK0A 2OE0A 2HZFA 4GWRA 4I97A 1FG4A 4AKIA 5G30A 3A2VA 1U6TA 2UZ8A 3EURA 3ISOA 5DCHA 2V2GA 1K0AA 2DJ3A 5B8AA 2H8LA 5F0GA 2JACA 4GQFA 3C8EA 2GZPA 2KHPA 4ICYA 4MK3A 1Z7RA 1PD21 5DJLA 1XVQA 3HYPA 1FVKA 5J41A 3W8SA 4ZB9A 2B7JA 2CQ9A 2GZZA 1RQMA 2LNTA 5BMUA 4IW9A 1K0DA 4OFNA 4PUFC 3CYNA 5FHIA 2EFEA 1VF1A 3BBYA 1JZWA 2IJYA 5LCZA 4F9ZA 1TK0B 5EL8A 5F05A 4N10A 5ECPB 2WCIA 4MPFA 1GP1A 1WRYA 3KTBA 2CZ3A 2YWIA 16GSA 1O6JA 2HNLA 4GSTA 4FO5A 5IIZA 2VCZA 1AXDA 3J7Yb 3MYDA 4MZBA 1QK8A 2LRTA 2L4QA 4POMA 4ECJA 3DYRA 4ACSA 5CP1A 4A5PA 1YQ1A 3UEMA 3ERWA 1GUMA 2L5LA 3DD3A 4OO5A 2J23A 3APSA 3F4RA 1B9YC 1Z6MA 1ZYEA 5D9XA 2WZ9A 5CRHA 3D21A 3L0HA 4G2EA 3I9V2 1O85A 1FAAA 3EPTA 2BMXA 4ILFA 2L59A 1TJDA 3BCKA 3ZVJA 5J5NA 2H71A 4N3ZA 4YH2A 4FH8A 1AIUA 1V40A 4X4JA 4HUAA 4JU5A 2C0EA 4KDXA 1K3YA 2DLXA 1BEDA 5CRWA 3TJFA 2KP1A 2G0FA 1Q4JA 3FR9A 3WGEA 4XIHA 1YZXA 3ED3A 1ZYNA 2H1LA 4K5SA 5CRGA 1GSYA 2D2ZA 2IMKA 4AJ6A 14GSA 3KD0A 4E8HA 1UC7A 2L4CA 4K7NA 3QMXA 4NPBA 2AYTA 1HNCA 3LQ7A 5DBQA 1SENA 5D73A 2RUFA 1EP8A 4MH2A 3ZREA 2GSRA 4OFMA 1E6BA 4GXZA 3TCOA 3TGZA 1ERUA 5C04A 2F8AA 2WDUA 4KA0A 1FO5A 2HRAA 2IIYA 4JE1A 1FB0A 3CMIA 4O5RA 2E0QA 1BG5A 4E68A 2MMOA 4PTSA 4Z2RA 4BVYB 5IMAA 4AKXB 4PUAA 3HKRA 3KXOA 2GSSA 1TXXA 2VCWA 2H1BA 1PL1A 3Q18A 1X9SB 3C1RA 2QC7A 3EWLA 4BL7B 2A2SA 4HU7A 1GTUA 2IL3A 2A4VA 1SL1B 5IPHA 1DE2A 4K7IA 3ME7A 2H6YA 4K7OA 1TKDB 2TIRA 4ZB6A 1T7PB 4LMWA 4G0LA 5KN3A 4AJ8A 4ULXA 2DC5A 4ECCA 2EC4A 5HFGA 4ZILA 3ZRDA 3V1WA 1TK8B 1TOFA 3HHVA 4DSSB 2H30A 5IMFA 2QA2A 4NV2A 5EPFA 3KMOA 2VL2C 2O7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8B A;  2M46 A;  3D22 A;  3VLN A;  1R26 A;  3GKX A;  4ML6 A;  1SK1 A;  3H1N A;  2NDO A;  3GKM A;  1S3D A;  2CAQ A;  2VCT A;  4PNG A;  3BCI A;  1TTZ A;  1H75 A;  2R6K A;  4OCE A;  3FR6 A;  2CX3 A;  5IM9 A;  2C8U A;  3AY8 A;  5ID2 A;  1Z3E A;  1PSQ A;  1SJI A;  2B5E A;  2LUS A;  1EV4 A;  4LLR A;  4TW5 A;  2XHF A;  4OD7 A;  2NTO A;  4HZ4 A;  2OE3 A;  1ZCP A;  5GSS A;  3EMX A;  1ERV A;  1HQO A;  2HI7 A;  2VD0 A;  5COH A;  3EMP A;  3C7M A;  5D9W A;  3D4M A;  2VAF A;  1AQX A;  5KN0 A;  4HU9 A;  5C00 A;  3LFL A;  1KEB A;  3J7Y k;  3LSZ A;  4YQU A;  3LXT A;  2DJ0 A;  2EIR A;  4IS0 A;  1SKR B;  2CAI A;  3UAR A;  4TXO A;  4Q5N A;  2FNO A;  4RI6 A;  4PUR A;  5EVO A;  3TKR A;  2PVQ A;  2QSI A;  3VFI A;  1B9X C;  4CHS A;  6GSS A;  4EKZ A;  1M7T A;  2YJH A;  4GSS A;  4YAP A;  4WEY A;  2V6K A;  1VF3 A;  1GTA A;  1SYR A;  4MZW A;  2IFQ A;  1VRS D;  2EIO A;  4G9H A;  4NAX A;  4KE3 A;  2M72 A;  2CVD A;  2I3Y A;  4Q5F A;  4POB A;  3GMF A;  5ELG A;  3SWL A;  1X5C A;  1T3B A;  4N30 A;  4F2I A;  1DBY A;  1N8J A;  1GSF A;  4IGJ A;  2P5Q A;  6GSY A;  4TR1 B;  2R4V A;  3F9U A;  2F8F A;  5F06 A;  4XS6 A;  1K3L A;  2HSN B;  1E2Y A;  1NHY A;  3LGC A;  2OBK A;  5F07 A;  1TK5 B;  3ZYW A;  2PU9 C;  3KP8 A;  2LNS A;  4MF5 A;  3R2Q A;  3I6A A;  3WGX A;  1M2A A;  1TRS A;  3DWV A;  3FKF A;  2LS5 A;  5FWG A;  4J56 E;  4OWY A;  2WS2 A;  1F37 A;  4FYB A;  2WGR A;  3TJB A;  3CTF A;  3HVX A;  2H1A A;  2LQO A;  3GIX A;  1TRV A;  2C3Q A;  1U87 A;  4IP6 A;  1Z5Y E;  2AV4 A;  1U3I A;  1QFN A;  2B6M A;  4JRR A;  3GTU B;  1JLW A;  4OCF A;  2FA8 A;  5KEJ A;  4KGI A;  4I5Q A;  1TU8 A;  5JCG A;  2H1G A;  2N5B A;  2B3S A;  2C1Y A;  2F3M A;  4XCS A;  1Z6N A;  1G6W A;  3D0Z A;  2HLS A;  2GT6 A;  1OYJ A;  2Z9S A;  3BD2 A;  5KN2 A;  1GSE A;  5ECH B;  4LL1 B;  4HS1 A;  2AAW A;  3CSJ A;  2QKE A;  5ECK B;  1K0C A;  5ABR A;  4K9Z A;  1SD8 A;  5IO2 A;  4IP1 A;  1F3A A;  1HNA A;  2YPM A;  2K8S A;  1MD4 A;  2B5Y A;  1K0M A;  1JFU A;  3P2A A;  2CX4 A;  2L5O A;  1OC9 B;  5IOW A;  3TKS E;  2YWM A;  5ECM B;  1TI1 A;  3H79 A;  1Y6E A;  1ON4 A;  1I5G A;  2GSQ A;  1PX7 A;  2FGX A;  1GUL A;  3VI5 A;  2GT5 A;  1FOV A;  4ZXG A;  1V58 A;  3ME8 A;  3EC3 A;  2HZE B;  2VCV A;  3LJR A;  4L5O A;  2VM1 A;  4N0Z A;  1PA3 A;  2DML A;  3HZ4 A;  2ON5 A;  5A4U A;  3HZ8 A;  1B4Q A;  4NMU A;  2IN3 A;  3A5W A;  2H0G A;  3RHC A;  5AN1 A;  3RHB A;  2ALB A;  3UAP A;  5INY A;  5IMZ A;  4ZL7 A;  4V2L A;  6GST A;  3M1G A;  2DIY A;  1EGO A;  2REM A;  1VF2 A;  3GHA A;  4CW9 A;  5G1L A;  3HXS A;  3WD6 A;  1DSB A;  4WKW A;  5LNK e;  4L8E A;  1PQN A;  1F6M C;  4HJ2 A;  4ML1 A;  4BVY A;  1OVN A;  3E0U A;  3WT2 A;  2I4A A;  5EY6 A;  4BL7 A;  4QL7 A;  5G5F A;  2JL4 A;  4GQC A;  3O6T A;  4KCA A;  3GH9 A;  4EF0 A;  1XOA A;  1A24 A;  2JZT A;  1S3A A;  5E59 A;  4KAE A;  2MMA A;  6GSX A;  1QUW A;  2VCX A;  3GYK A;  1YEP A;  1GUK A;  4K6X A;  2DMM A;  2AJQ B;  4F82 A;  3EE2 A;  4KW6 A;  2OKA A;  1HNB A;  1XWC A;  1OKD A;  1XW5 A;  3MAK A;  3G7I A;  2DJ2 A;  3QAG A;  4XRA A;  5IO0 A;  4POK A;  3H8Q A;  2WJU A;  2HYX A;  3SBC A;  3OR5 A;  1KBN A;  1GSS A;  1LJR A;  3HVV A;  4LA1 A;  1MDK A;  5ECQ B;  2P5R A;  2VIM A;  2B1K A;  1YJ6 A;  5IMV A;  5IMD A;  4N0V A;  2X64 A;  2P0G A;  4NHW A;  5HQP A;  2MBS A;  3F3Q A;  4USS A;  4WBJ A;  2IMI A;  2X99 A;  1BAY A;  5J9B A;  4AF2 A;  1W4V A;  2YP6 A;  5DQY A;  1GNW A;  2XBI A;  3GL5 A;  3CBU A;  1X9W B;  4NV5 A;  2PER A;  3QD9 A;  2H74 A;  3QFB C;  9GSS A;  5JCW A;  6GSW A;  3QAW A;  4NXI A;  4MLY A;  2K9F A;  3UVH A;  3GFK A;  3HJM A;  5CAX A;  2N5A A;  4N11 A;  3ZML A;  2PN8 A;  3PIN A;  2RM5 A;  4V2N A;  4O7H A;  2HRN A;  1ACV A;  5D9V A;  2IWT A;  1ZZY A;  2YV7 A;  2LRN A;  3N9J A;  1WPI A;  2V6O A;  4MF7 A;  1IYH A;  4O92 A;  2H1D A;  1ZOF A;  4MA9 A;  2PPT A;  4BWQ A;  3EU3 A;  1A23 A;  2I81 A;  1AC1 A;  1XWG A;  3TB2 A;  3IC4 A;  1AAZ A;  4EE0 A;  4K0N A;  1J08 A;  3LXZ A;  2GVP A;  4TKY A;  3IR4 A;  1DUG A;  2A2R A;  1OE7 A;  4K1F A;  3UJ1 A;  5DAL B;  1C72 A;  3LWA A;  1A2M A;  1OC8 A;  3G7J A;  1O73 A;  5B6M A;  1Y25 A;  3KEB A;  1QMV A;  1M9A A;  3M9J A;  4EDZ A;  1WWJ A;  1N2A A;  3IXR A;  4AGS A;  4PNF A;  4J2F A;  5B6N A;  1GUH A;  3IA1 A;  2GLR A;  2VLV A;  4XRD A;  1EEJ A;  2R5G A;  3U5R E;  3UL3 A;  3ZMK A;  2PWJ A;  1YKA A;  1F9M A;  5DDL A;  3GNJ A;  4MCU A;  4TR1 A;  1YKC A;  3BJ5 A;  3GL3 A;  3EIN A;  6GSU A;  1PX6 A;  17GS A;  3ERG A;  4KB3 A;  3KMN A;  2XC2 A;  3FZ5 A;  4G19 A;  4WXT A;  3F4S A;  2IMD A;  3DXB A;  3DVX A;  1USB A;  3HJP A;  5HFK A;  4WBR D;  3RPP A;  1I9D A;  4EL1 A;  4MH3 A;  4PQ1 A;  5CYY A;  2K18 A;  3DGQ A;  3EYT A;  2EIQ A;  1J9B A;  4G0K A;  4DEJ A;  1EOG A;  1A8L A;  1M2D A;  3W6G A;  5DQS A;  4V2M A;  2DJJ A;  3ZFB A;  3WGD A;  2PBJ A;  3NOF A;  4ID0 A;  3GTU A;  4HOJ A;  1ST9 A;  2LTK A;  3QR6 A;  1UVZ A;  5CNW A;  5FT3 A;  3L78 A;  1GLP A;  1A2L A;  3I43 A;  1XWK A;  1TW9 A;  1O81 A;  3E3E A;  3VWW A;  2F51 A;  2PUK C;  2L57 A;  3EVI A;  4MJC A;  3VUR A;  2LKU A;  1TI3 A;  3GST A;  2O85 A;  5AIX A;  4IHU A;  4G10 A;  2BTO T;  1GSQ A;  5J3R A;  2KLX A;  2YWO A;  4ZBA A;  2HSM B;  3E9J B;  1OC9 A;  3VPT A;  1XFL A;  1XBS A;  1F3B A;  4IBP A;  3TJJ A;  4PGT A;  3C73 A;  1XWB A;  4BVX B;  5G5E A;  2VO4 A;  3F63 A;  2H19 A;  3DIE A;  2JZS A;  1ERW A;  4JZQ A;  4EVM A;  2FWG A;  1G7E A;  5G31 A;  5IMC A;  2OAC A;  13GS A;  3L9V A;  3UOM A;  4OO4 A;  2HZE A;  3D5J A;  5KN1 A;  11GS A;  4V1A g;  2FY6 A;  2X8C A;  2LRC A;  5DAK B;  3HY2 A;  4YAV A;  3TKS C;  3DEX A;  1SL0 B;  1OKT A;  2FHE A;  4TRX A;  2H72 A;  3VWV A;  3VI7 A;  1V9W A;  2B5X A;  4L5L A;  2DJK A;  5E4W A;  4WF4 A;  3JCM L;  5HR3 A;  2LJA A;  2VUP A;  4MPG A;  2XPD A;  2JZR A;  3IDV A;  3H4K A;  3RAZ A;  2KUC A;  3CSI A;  1BQ7 A;  2DBC A;  4JBB A;  1JZR A;  4EC0 A;  2GQL A;  3DKS A;  3FZA A;  3L4N A;  3O76 A;  1XWA A;  3S9F A;  3A2W A;  4YQM A;  1WIK A;  3QCP A;  2HRF A;  5D93 A;  5ECI B;  2NPB A;  1DE1 A;  1LBK A;  3GX8 A;  2ZUP A;  1X5D A;  2WB9 A;  3IOS A;  4XS4 B;  3KGK A;  3TJG A;  4WR4 A;  5CRD A;  1PGT A;  1SL2 B;  1X9M B;  5DVB A;  1M2B A;  1URM A;  2YJ7 A;  3MDK A;  2LST A;  2FWH A;  4AJ7 A;  2HRK B;  1ERT A;  5ECO B;  1YDK A;  1FW1 A;  1SKS B;  2KOK A;  4G0I A;  4F03 A;  4FIW A;  3KZQ A;  5ECL B;  1M9B A;  2DIZ A;  2MZC A;  4GLT A;  2VM2 A;  2WRT A;  5H5S A;  3L9S A;  3MWH A;  3IPZ A;  1OC3 A;  3IAM 2;  4MMM A;  4KH7 A;  4GRF A;  3DRN A;  4GF0 A;  1S3C A;  3CRU A;  5CO3 A;  2C3T A;  1ZMA A;  2HSY A;  3DML A;  2YN1 A;  2NVL A;  1WJK A;  4RUV A;  1F2E A;  2OA7 A;  3TRX A;  5H5R A;  2OJL A;  1KNG A;  5CRE A;  1CQH A;  4XS1 A;  3QDN A;  2MMN A;  1EV9 A;  4ISD A;  2I1U A;  3ZFL A;  4IKH A;  1UN2 A;  1A2J A;  3RPN A;  1SU9 A;  2XPE A;  4BWS A;  4I2U A;  5HR0 A;  2HE3 A;  19GS A;  3FR3 A;  4TXO B;  4IQ1 A;  1TRU A;  1WMJ A;  1GRX A;  1XCC A;  3IC8 A;  2H66 A;  2C4J A;  4TR3 A;  3HJO A;  4HQS A;  4ZL8 A;  4Q5Q A;  1T4Y A;  3HVS A;  4NHZ A;  5D8I A;  4BPY A;  5JWO B;  5A5K A;  2OAD A;  1A0F A;  1IYI A;  3RBT A;  5ECN B;  3GH6 A;  2H0H A;  2H6X A;  2ZNM A;  2YWN A;  1YF1 A;  2HFD A;  2IFQ B;  4GTU A;  2WFC A;  3A3T A;  3KM6 A;  3UBK A;  2JU5 A;  4ZBB A;  2L6C A;  3P90 A;  3F3R A;  4HEA 2;  2GS3 A;  2FCH A;  4H86 A;  2FD3 A;  1FHE A;  3IRA A;  1EGR A;  1R5A A;  1RW1 A;  2LJK A;  1AQV A;  4PQH A;  1U88 A;  2CV4 A;  2G2Q A;  4ECI A;  4L0W A;  2H76 A;  5D96 A;  3ZTL A;  4EO3 A;  2GST A;  1EWX A;  4Z7X A;  3U6V A;  3GKN A;  3WT1 A;  2BJX A;  3UBL A;  1LU4 A;  3ZL5 A;  2E7P A;  1PRX A;  4DSR A;  1ZL9 A;  2V32 A;  2YV9 A;  2OBI A;  2J9H A;  2IMF A;  2P31 A;  4DSS A;  3MNG A;  3FYG A;  5GST A;  2JSY A;  1GSD A;  4J57 E;  4D73 B;  4MDC A;  3H93 A;  2CZ2 A;  1FVJ A;  3KIJ A;  2VOC A;  2MMZ A;  2K6V A;  1T1V A;  2RLI A;  5HR2 A;  2GDR A;  2FA4 A;  3KTL A;  2FWF A;  4HDE A;  3FZ9 A;  2VCQ A;  1A0R P;  1BJX A;  1K0N A;  1NM3 A;  1VGL A;  4HI7 A;  2KP2 A;  3HCZ A;  3TRP A;  3TUE A;  5JWQ B;  1J0F A;  2DSA A;  1VF4 A;  4I6X A;  1YY7 A;  1X5E A;  3QPM A;  4K8M A;  1AW9 A;  2LJR A;  2GZY A;  1GTB A;  3C1S A;  3Q74 A;  4K0G A;  3F8U A;  3MSZ A;  2HSM A;  3A2X A;  1JHB A;  1T4Z A;  2YCD A;  1MDI A;  4WF5 A;  3I69 A;  4MP4 A;  1FB6 A;  5LD0 A;  4JED A;  3FZ4 A;  1GSU A;  4KUN A;  1V57 A;  1G0T A;  2O89 A;  1PMT A;  1G7O A;  4KDU A;  8GSS A;  3LYP A;  1R4W A;  4BVX A;  3RDW A;  18GS A;  4XTS A;  4JR4 A;  3F6F A;  5ECR B;  3GRX A;  1XOB A;  1OE8 A;  1K0O A;  1GWC A;  4MJB A;  1T8E B;  3ZLP A;  1WE0 A;  2CT6 A;  3LEF A;  7GSS A;  4E8E A;  1GLQ A;  2VL9 A;  1MD3 A;  4TOP A;  2YNX A;  2E2M A;  2AUV A;  2JAD A;  4PQI A;  3TOU A;  4TN8 A;  1NHO A;  3PR8 A;  5DAK A;  2VL3 A;  2PVO C;  4L0U A;  4NWY A;  1V98 A;  1ML6 A;  1MTC A;  5AIV A;  2HT9 A;  3GN3 A;  1O7U A;  1THO A;  2AHE A;  1X0R A;  3N5O A;  1HD2 A;  3VK9 A;  3VPQ A;  4ZB8 A;  3L9U A;  4YQV A;  3F6D A;  1ZGN A;  1W89 A;  4EDY A;  2H75 A;  1SJ6 A;  3QOU A;  3P8W A;  3GV1 A;  1GL8 A;  5AGY A;  4TVE A;  4IEL A;  5B7C A;  1XIY A;  3D6I A;  4QL9 A;  4HJM A;  4MAB A;  1QQ2 A;  2ZCT A;  3IK9 A;  1R7H A;  4FYU A;  5L71 A;  4LMV A;  3WYW A;  2X8H A;  2C80 A;  3CSH A;  4HZ2 A;  4GSN A;  5GZZ B;  2WUL A;  3APQ A;  12GS A;  3TOT A;  4JR6 A;  1SK2 A;  3G9B A;  3UMA A;  1SKW B;  3IBH A;  3C71 A;  2TRC P;  4GCI A;  4XS4 A;  4X1U A;  4HQZ A;  1XW9 A;  3GA4 A;  1PKW A;  3KH9 A;  3O3T A;  2YZU A;  4WET A;  3ZIT A;  3VWU A;  3M0F A;  1QXH A;  5IPG A;  4TXV A;  3G7Y A;  1B48 A;  2HRK A;  4KF9 A;  3LG6 A;  2RM6 A;  1SYX A;  1CQG A;  3GUR A;  2B1L A;  2R37 A;  2LEG A;  4IJI A;  2DJ1 A;  2YAN A;  5JWR B;  4KND A;  1BYE A;  5A4V A;  4RQX A;  1XXU A;  5ECS A;  5D9T A;  2VL2 A;  3ERF A;  2VD1 A;  3FHK A;  3F0I A;  3APO A;  3IV4 A;  4ZL9 A;  4MJE A;  3GKK A;  3CXG A;  4KCE A;  1NSW A;  1Q98 A;  3ZIJ A;  1WP0 A;  1YEX A;  2R3X A;  1K0B A;  3DVW A;  2F9S A;  3D4T A;  1JLV A;  3KP9 A;  2YOI A;  1B4P A;  4DSQ A;  3LYK A;  5J9C A;  5DCG A;  5DJM A;  1EOH A;  2IPA A;  4XHM A;  1PKZ A;  2PGT A;  3CRT A;  2B7K A;  2H70 A;  3ZVJ D;  3M9K A;  4K2D A;  1ZYQ B;  2ES7 A;  1SJZ A;  1B8X A;  1T00 A;  2MBT A;  3IAS 2;  1EEM A;  1XVW A;  1GTI A;  3NZN A;  2GTU A;  1GNE A;  2H73 A;  2FWE A;  2GGT A;  1PL2 A;  3KCM A;  4I2T A;  4KX4 A;  2C0D A;  1M0U A;  3FRC A;  1AUC A;  3ZZX A;  3KJY A;  4OMV A;  2X8G A;  1TU7 A;  2TRX A;  2MYG A;  3R3E A;  4KDY A;  2C3N A;  4DVC A;  1SD9 A;  2GQM A;  4P3Y B;  1TDI A;  2FUG 2;  1TP9 A;  3HD5 A;  4F0B A;  2N5F A;  3W8J A;  3US3 A;  1PN9 A;  2JSZ A;  1V2A A;  2V41 A;  3VWX A;  5ELA A;  4KSO A;  1KTE A;  1Z9H A;  2C0F A;  4X43 A;  2RUE A;  3P7X A;  4OFT A;  2O87 A;  3TKS A;  6GSV A;  1GH2 A;  3QAV A;  5ENU A;  3TRQ A;  3IK7 A;  1RK4 A;  4ZIJ A;  5G2Z A;  2QGV A;  3IE3 A;  4MZC A;  1G6Y A;  2L6D A;  4O32 A;  1M99 A;  1HYU A;  5AIS A;  4PXO A;  2O8V B;  3Q19 A;  4CDO A;  5GAP D;  2C0G A;  2VLT A;  1ABA A;  4IQA A;  5IQY A;  4I8B A;  1YF0 A;  3K8N A;  3PGT A;  2V1M A;  1EZK A;  3GX0 A;  1EP7 A;  3TKP A;  3FW2 A;  2M80 A;  3GUS A;  2HQT A;  2R2J A;  3UIW A;  2I9H A;  4RQR A;  3M8N A;  3PPU A;  2HXK A;  3FY7 A;  4D73 A;  3GSS A;  3IHQ A;  3HA9 A;  1NW2 A;  4LL4 B;  1JZO A;  3TKQ A;  1WOU A;  4TR0 A;  2ON7 A;  1ILO A;  2LQQ A;  2HSH A;  3BOA A;  5A4W A;  10GS A;  1O8X A;  2H01 A;  22GS A;  1O8W A;  3F4T A;  4ZBD A;  3KH7 A;  4EUY A;  4F0C A;  4MF6 A;  4IJ3 A;  4FYC A;  4IN0 A;  1QGV A;  1MEK A;  4WR5 A;  2CVK A;  1H4O A;  3LOR A;  2K8V A;  5ID2 B;  5JCU A;  2H6Z A;  5G1K A;  1OAZ A;  4POL A;  2FLS A;  2NBS A;  3HDC A;  1UA5 A;  1Z7P A;  1AQW A;  2GQK A;  1A8Y A;  1MDJ A;  4TR4 A;  3TDG A;  3EU4 A;  2E2G A;  3FK8 A;  3CTG A;  1JZD A;  3PH9 A;  20GS A;  4FQU A;  2IME A;  4RI7 A;  4MJA A;  2OE1 A;  4KSM A;  4ECB A;  4QQ7 A;  2LV3 A;  5F8B A;  1K3O A;  1XW6 A;  1XZO A;  1BX9 A;  4EXJ A;  5GAN D;  5HFI A;  5DAL A;  3NIV A;  3QFA C;  4BA7 A;  1U3A A;  2VLU A;  5H5Q A;  5IOX A;  3M3M A;  4Q5R A;  3UVT A;  3TJK A;  3ZIV A;  2CVB A;  5HR1 A;  1XPV A;  3Q6O A;  2XBQ A;  1THX A;  5J4U A;  2RII A;  4X0X A;  4IVF A;  2PMT A;  1R5P A;  1TRW A;  3FEU A;  4V1A p;  2YZH A;  2H0I A;  2CA8 A;  4PX1 A;  2AB6 A;  1SK0 A;  2OE0 A;  2HZF A;  4GWR A;  4I97 A;  1FG4 A;  5G30 A;  3A2V A;  1U6T A;  2UZ8 A;  3EUR A;  3ISO A;  5DCH A;  2V2G A;  1K0A A;  2DJ3 A;  5B8A A;  2H8L A;  5F0G A;  2JAC A;  4GQF A;  3C8E A;  2GZP A;  2KHP A;  4MK3 A;  1Z7R A;  1PD2 1;  5DJL A;  1XVQ A;  3HYP A;  1FVK A;  5J41 A;  3W8S A;  4ZB9 A;  2B7J A;  2CQ9 A;  2GZZ A;  1RQM A;  2LNT A;  5BMU A;  4IW9 A;  1K0D A;  4OFN A;  4PUF C;  3CYN A;  5FHI A;  1VF1 A;  3BBY A;  1JZW A;  2IJY A;  5LCZ A;  4F9Z A;  1TK0 B;  5EL8 A;  5F05 A;  4N10 A;  5ECP B;  2WCI A;  4MPF A;  1GP1 A;  1WRY A;  3KTB A;  2CZ3 A;  2YWI A;  16GS A;  1O6J A;  2HNL A;  4GST A;  4FO5 A;  5IIZ A;  2VCZ A;  1AXD A;  3J7Y b;  4MZB A;  1QK8 A;  2LRT A;  2L4Q A;  4POM A;  4ECJ A;  3DYR A;  4ACS A;  5CP1 A;  1YQ1 A;  3UEM A;  3ERW A;  1GUM A;  2L5L A;  3DD3 A;  4OO5 A;  2J23 A;  3APS A;  3F4R A;  1B9Y C;  1Z6M A;  1ZYE A;  5D9X A;  2WZ9 A;  5CRH A;  3D21 A;  3L0H A;  4G2E A;  3I9V 2;  1O85 A;  1FAA A;  4ILF A;  2BMX A;  2L59 A;  1TJD A;  3BCK A;  3ZVJ A;  5J5N A;  2H71 A;  4YH2 A;  4FH8 A;  1AIU A;  1V40 A;  4HUA A;  4JU5 A;  2C0E A;  4KDX A;  1K3Y A;  2DLX A;  1BED A;  5CRW A;  3TJF A;  2KP1 A;  2G0F A;  1Q4J A;  3FR9 A;  3WGE A;  4XIH A;  1YZX A;  3ED3 A;  5CRG A;  1GSY A;  2D2Z A;  2IMK A;  4AJ6 A;  14GS A;  3KD0 A;  4E8H A;  1UC7 A;  2L4C A;  4K7N A;  3QMX A;  4NPB A;  2AYT A;  1HNC A;  3LQ7 A;  5DBQ A;  1SEN A;  5D73 A;  2RUF A;  1EP8 A;  4MH2 A;  3ZRE A;  2GSR A;  4OFM A;  1E6B A;  4GXZ A;  3TCO A;  3TGZ A;  1ERU A;  5C04 A;  2F8A A;  2WDU A;  4KA0 A;  1FO5 A;  2HRA A;  2IIY A;  4JE1 A;  1FB0 A;  3CMI A;  4O5R A;  2E0Q A;  1BG5 A;  2MMO A;  4PTS A;  4BVY B;  5IMA A;  4PUA A;  3HKR A;  3KXO A;  2GSS A;  1TXX A;  2VCW A;  2H1B A;  1PL1 A;  3Q18 A;  1X9S B;  3C1R A;  2QC7 A;  3EWL A;  4BL7 B;  2A2S A;  4HU7 A;  1GTU A;  2IL3 A;  2A4V A;  1SL1 B;  5IPH A;  1DE2 A;  4K7I A;  3ME7 A;  2H6Y A;  4K7O A;  1TKD B;  2TIR A;  4ZB6 A;  1T7P B;  4LMW A;  4G0L A;  5KN3 A;  4AJ8 A;  4ULX A;  2DC5 A;  4ECC A;  2EC4 A;  5HFG A;  4ZIL A;  3ZRD A;  3V1W A;  1TK8 B;  1TOF A;  3HHV A;  4DSS B;  2H30 A;  5IMF A;  4NV2 A;  5EPF A;  3KMO A;  2VL2 C;  2O7K A; 
#chains in the Genus database with same CATH topology
 5B8B A;  2M46 A;  3D22 A;  3VLN A;  1R26 A;  3GKX A;  4ML6 A;  1SK1 A;  3H1N A;  2NDO A;  3GKM A;  1S3D A;  2CAQ A;  2VCT A;  4PNG A;  3BCI A;  1TTZ A;  1H75 A;  2R6K A;  4OCE A;  3FR6 A;  2CX3 A;  4PHZ C;  5IM9 A;  2C8U A;  3AY8 A;  5ID2 A;  3FMW A;  1Z3E A;  1PSQ A;  1SJI A;  2B5E A;  2LUS A;  1EV4 A;  4LLR A;  4TW5 A;  2XHF A;  4OD7 A;  2NTO A;  4HZ4 A;  2OE3 A;  1ZCP A;  5GSS A;  3EMX A;  1ERV A;  1HQO A;  2HI7 A;  2VD0 A;  5COH A;  3EMP A;  3C7M A;  5D9W A;  3D4M A;  2VAF A;  1AQX A;  5KN0 A;  3IHG A;  4HU9 A;  5C00 A;  3LFL A;  1KEB A;  3J7Y k;  3LSZ A;  4YQU A;  3LXT A;  2DJ0 A;  2EIR A;  4IS0 A;  1SKR B;  2CAI A;  3UAR A;  4TXO A;  4Q5N A;  4BIK A;  2FNO A;  2OT3 A;  4RI6 A;  4PUR A;  5EVO A;  3TKR A;  2WW2 A;  2PVQ A;  2QSI A;  3VFI A;  1B9X C;  4MNN A;  4CHS A;  6GSS A;  4EKZ A;  1M7T A;  2YJH A;  4GSS A;  4YAP A;  4WEY A;  2V6K A;  1VF3 A;  1GTA A;  1SYR A;  4MZW A;  2IFQ A;  1VRS D;  2EIO A;  4G9H A;  4NAX A;  4KE3 A;  2M72 A;  2CVD A;  2I3Y A;  4Q5F A;  4POB A;  3GMF A;  5ELG A;  3SWL A;  1X5C A;  1T3B A;  4N30 A;  4F2I A;  1N25 A;  1DBY A;  1N8J A;  1GSF A;  4IGJ A;  2P5Q A;  6GSY A;  4TR1 B;  2R4V A;  3F9U A;  2F8F A;  5F06 A;  4XS6 A;  1K3L A;  2HSN B;  1E2Y A;  1NHY A;  2EFD A;  3LGC A;  1BG1 A;  2OBK A;  5F07 A;  1M3I A;  1TK5 B;  2WVZ A;  3ZYW A;  2PU9 C;  3KP8 A;  2LNS A;  4MF5 A;  3R2Q A;  3I6A A;  3WGX A;  3LW9 A;  4EIQ A;  1M2A A;  1TRS A;  3DWV A;  3FKF A;  2LS5 A;  5FWG A;  4J56 E;  4OWY A;  4YKG A;  2WS2 A;  1F37 A;  4FYB A;  2WGR A;  3TJB A;  3CTF A;  5J40 A;  3HVX A;  2H1A A;  2LQO A;  3GIX A;  1TRV A;  2C3Q A;  1U87 A;  4IP6 A;  1Z5Y E;  2AV4 A;  1U3I A;  1QFN A;  2B6M A;  4JRR A;  3GTU B;  1JLW A;  4OCF A;  2FA8 A;  5KEJ A;  4KGI A;  4I5Q A;  1TU8 A;  5JCG A;  2H1G A;  2N5B A;  2B3S A;  2C1Y A;  2F3M A;  4XCS A;  1Z6N A;  1G6W A;  3D0Z A;  2HLS A;  2GT6 A;  1OYJ A;  2Z9S A;  3BD2 A;  5KN2 A;  1GSE A;  5ECH B;  4LL1 B;  4HS1 A;  2AAW A;  3CSJ A;  2QA1 A;  2QKE A;  5ECK B;  2UV8 G;  1FOH A;  1K0C A;  5ABR A;  4K9Z A;  1SD8 A;  5IO2 A;  4IP1 A;  1F3A A;  1HNA A;  2YPM A;  2K8S A;  1MD4 A;  4Z2T A;  4AKH A;  2B5Y A;  1K0M A;  1JFU A;  3P2A A;  2CX4 A;  2L5O A;  1OC9 B;  5IOW A;  3TKS E;  2YWM A;  5ECM B;  1TI1 A;  3H79 A;  1Y6E A;  1ON4 A;  1I5G A;  2GSQ A;  1PX7 A;  2FGX A;  1GUL A;  3VI5 A;  1I1I P;  2GT5 A;  1FOV A;  4ZXG A;  5J4V A;  1V58 A;  3ME8 A;  3EC3 A;  2HZE B;  2VCV A;  3LJR A;  4L5O A;  2VM1 A;  4N0Z A;  1PA3 A;  2DML A;  3HZ4 A;  2A2P A;  2ON5 A;  5A4U A;  3HZ8 A;  1B4Q A;  4NMU A;  2IN3 A;  3A5W A;  2H0G A;  3CQF A;  3RHC A;  5AN1 A;  3RHB A;  2ALB A;  3UAP A;  5INY A;  5IMZ A;  4ZL7 A;  4V2L A;  6GST A;  3M1G A;  4AI6 A;  2DIY A;  1EGO A;  2REM A;  1VF2 A;  3GHA A;  4CW9 A;  5G1L A;  3HXS A;  3WD6 A;  1DSB A;  4WKW A;  5LNK e;  4L8E A;  1PQN A;  1F6M C;  4HJ2 A;  4ML1 A;  4BVY A;  1OVN A;  3E0U A;  3WT2 A;  2I4A A;  5EY6 A;  4BL7 A;  4QL7 A;  5G5F A;  2JL4 A;  4GQC A;  3O6T A;  4KCA A;  3GH9 A;  4EF0 A;  1XOA A;  4PI0 C;  1A24 A;  2JZT A;  1S3A A;  5E59 A;  4KAE A;  2MMA A;  6GSX A;  1QUW A;  2VCX A;  3GYK A;  1YEP A;  1GUK A;  4K6X A;  2DMM A;  2AJQ B;  4F82 A;  3EE2 A;  4KW6 A;  2OKA A;  1HNB A;  1XWC A;  1OKD A;  1XW5 A;  3MAK A;  3G7I A;  5A34 B;  2DJ2 A;  3QAG A;  4XRA A;  5IO0 A;  4POK A;  3H8Q A;  2WJU A;  2A4H A;  2X4A A;  2HYX A;  3SBC A;  3OR5 A;  1KBN A;  1GSS A;  1LJR A;  3HVV A;  4LA1 A;  1MDK A;  5ECQ B;  2P5R A;  2VIM A;  2B1K A;  1YJ6 A;  5IMV A;  5IMD A;  4N0V A;  2X64 A;  2P0G A;  4NHW A;  5HQP A;  2MBS A;  3F3Q A;  4USS A;  4WBJ A;  2IMI A;  2X99 A;  1BAY A;  5J9B A;  4AF2 A;  1W4V A;  2YP6 A;  5DQY A;  1GNW A;  2XBI A;  3GL5 A;  3CBU A;  1X9W B;  4NV5 A;  2PER A;  3QD9 A;  2H74 A;  3QFB C;  9GSS A;  5JCW A;  4AKG A;  6GSW A;  3QAW A;  4NXI A;  4MLY A;  2K9F A;  3UVH A;  3GFK A;  3HJM A;  5CAX A;  2N5A A;  4N11 A;  3ZML A;  2PN8 A;  3PIN A;  2RM5 A;  4V2N A;  4O7H A;  2HRN A;  1ACV A;  5D9V A;  2IWT A;  1ZZY A;  2YV7 A;  2LRN A;  3N9J A;  1WPI A;  2V6O A;  4MF7 A;  1IYH A;  1YVL A;  4O92 A;  2H1D A;  1ZOF A;  4MA9 A;  2PPT A;  4BWQ A;  3EU3 A;  4CY6 A;  1A23 A;  2I81 A;  1AC1 A;  1XWG A;  3TB2 A;  3IC4 A;  1AAZ A;  2R0C A;  4EE0 A;  4K0N A;  1J08 A;  3LXZ A;  2GVP A;  4TKY A;  3IR4 A;  1DUG A;  2A2R A;  1OE7 A;  4K1F A;  3UJ1 A;  5DAL B;  1C72 A;  3LWA A;  1A2M A;  1OC8 A;  3G7J A;  1O73 A;  1M3J A;  5B6M A;  1Y25 A;  3KEB A;  1QMV A;  1M9A A;  3M9J A;  4EDZ A;  1WWJ A;  1N2A A;  3IXR A;  4AGS A;  4PNF A;  4J2F A;  5B6N A;  1GUH A;  3IA1 A;  2GLR A;  2VLV A;  4XRD A;  1EEJ A;  2R5G A;  3U5R E;  3UL3 A;  3ZMK A;  2PWJ A;  1YKA A;  1F9M A;  5DDL A;  3GNJ A;  4MCU A;  4TR1 A;  1YKC A;  3BJ5 A;  1SVO A;  3GL3 A;  3EIN A;  6GSU A;  2WW1 A;  1PX6 A;  17GS A;  2HSN A;  3ERG A;  4KB3 A;  3KMN A;  2XC2 A;  3FZ5 A;  4G19 A;  2X49 A;  4WXT A;  3F4S A;  2IMD A;  3DXB A;  3DVX A;  1USB A;  3HJP A;  5HFK A;  4WBR D;  3RPP A;  3MIX A;  1I9D A;  1XG8 A;  4EL1 A;  4MH3 A;  4PQ1 A;  5CYY A;  2K18 A;  3DGQ A;  3EYT A;  2EIQ A;  1J9B A;  4G0K A;  4DEJ A;  1EOG A;  1A8L A;  1M2D A;  5A1N A;  3W6G A;  5DQS A;  4V2M A;  2DJJ A;  3ZFB A;  3WGD A;  2PBJ A;  3NOF A;  4ID0 A;  3GTU A;  4HOJ A;  1ST9 A;  2LTK A;  3QR6 A;  1UVZ A;  5CNW A;  2WW3 A;  5FT3 A;  3L78 A;  1GLP A;  1A2L A;  3I43 A;  1XWK A;  1TW9 A;  1O81 A;  3E3E A;  3VWW A;  2F51 A;  2PUK C;  2L57 A;  3EVI A;  4K5R A;  4MJC A;  3VUR A;  2LKU A;  1TI3 A;  3GST A;  2O85 A;  5AIX A;  4IHU A;  4G10 A;  2BTO T;  1GSQ A;  5J3R A;  2KLX A;  2YWO A;  4ZBA A;  2HSM B;  3E9J B;  2VKZ G;  1OC9 A;  3VPT A;  1XFL A;  1XBS A;  1F3B A;  4IBP A;  3TJJ A;  4PGT A;  3C73 A;  1XWB A;  4EIP A;  4BVX B;  5G5E A;  2VO4 A;  3F63 A;  2WVY A;  2H19 A;  3DIE A;  2JZS A;  1ERW A;  4JZQ A;  4EVM A;  2FWG A;  1G7E A;  5G31 A;  5IMC A;  2OAC A;  13GS A;  3L9V A;  3UOM A;  4OO4 A;  2HZE A;  3D5J A;  5KN1 A;  11GS A;  4V1A g;  2FY6 A;  2X8C A;  2LRC A;  5DAK B;  3HY2 A;  1BF5 A;  4YAV A;  3TKS C;  3DEX A;  1SL0 B;  1OKT A;  2WW0 A;  2FHE A;  4TRX A;  2H72 A;  3VWV A;  3VI7 A;  1V9W A;  2B5X A;  4L5L A;  2DJK A;  5E4W A;  4WF4 A;  3JCM L;  5HR3 A;  2LJA A;  2VUP A;  4MPG A;  2XPD A;  2JZR A;  3IDV A;  3H4K A;  3CHX C;  3RAZ A;  2KUC A;  3CSI A;  1BQ7 A;  2DBC A;  4JBB A;  1JZR A;  4EC0 A;  2GQL A;  3DKS A;  3FZA A;  3L4N A;  3O76 A;  1XWA A;  3S9F A;  3A2W A;  4YQM A;  1WIK A;  3QCP A;  2HRF A;  5D93 A;  5ECI B;  2NPB A;  1DE1 A;  2DKH A;  1LBK A;  3GX8 A;  2ZUP A;  1X5D A;  2WB9 A;  3IOS A;  4XS4 B;  1Y1U A;  3KGK A;  3HMJ G;  3TJG A;  4WR4 A;  5CRD A;  1PGT A;  5A34 A;  1SL2 B;  1X9M B;  3RGB C;  5DVB A;  1M2B A;  1URM A;  2YJ7 A;  3MDK A;  2LST A;  2DKI A;  2WZS A;  2FWH A;  4AJ7 A;  2HRK B;  4QMK A;  1ERT A;  5ECO B;  1YDK A;  1FW1 A;  1SKS B;  2KOK A;  4G0I A;  4F03 A;  4FIW A;  3KZQ A;  5ECL B;  1M9B A;  2DIZ A;  2MZC A;  4GLT A;  2VM2 A;  2WRT A;  5H5S A;  3L9S A;  3IPZ A;  3MWH A;  1OC3 A;  3IAM 2;  4MMM A;  4KH7 A;  4GRF A;  3DRN A;  4GF0 A;  1S3C A;  3CRU A;  5CO3 A;  2C3T A;  4ZB7 A;  1ZMA A;  3DML A;  2HSY A;  2YN1 A;  2NVL A;  1WJK A;  4RUV A;  1F2E A;  2OA7 A;  3TRX A;  5H5R A;  2OJL A;  1KNG A;  5CRE A;  1CQH A;  4XS1 A;  3QDN A;  5A5H B;  2MMN A;  1EV9 A;  4ISD A;  2I1U A;  3ZFL A;  4IKH A;  1UN2 A;  1A2J A;  3RPN A;  1SU9 A;  2XPE A;  4BWS A;  4I2U A;  5HR0 A;  2HE3 A;  19GS A;  2R0P A;  3FR3 A;  4TXO B;  4IQ1 A;  1TRU A;  1WMJ A;  1GRX A;  1XCC A;  3IC8 A;  2H66 A;  2C4J A;  4TR3 A;  3HJO A;  4HQS A;  4ZL8 A;  4Q5Q A;  1T4Y A;  3HVS A;  4NHZ A;  5D8I A;  4BPY A;  4W66 A;  5JWO B;  5A5K A;  2OAD A;  1A0F A;  1IYI A;  3RBT A;  5ECN B;  3GH6 A;  2H0H A;  2H6X A;  2ZNM A;  2YWN A;  1YF1 A;  3CWG A;  2HFD A;  2IFQ B;  4GTU A;  2WFC A;  3A3T A;  3KM6 A;  3UBK A;  2JU5 A;  4ZBB A;  2WVX A;  2L6C A;  3P90 A;  3F3R A;  4HEA 2;  2GS3 A;  2FCH A;  4H86 A;  2FD3 A;  1FHE A;  3IRA A;  1EGR A;  1R5A A;  1RW1 A;  2LJK A;  1AQV A;  4PQH A;  1U88 A;  2CV4 A;  2G2Q A;  4ECI A;  4L0W A;  2H76 A;  5D96 A;  3ZTL A;  4EO3 A;  5BRT A;  2GST A;  1EWX A;  4Z7X A;  3U6V A;  3GKN A;  3WT1 A;  2BJX A;  3UBL A;  1LU4 A;  3ZL5 A;  2E7P A;  1PRX A;  4DSR A;  1ZL9 A;  2V32 A;  5KOX A;  1SVM A;  2YV9 A;  2OBI A;  2J9H A;  2IMF A;  2P31 A;  4DSS A;  3MNG A;  3FYG A;  5GST A;  2JSY A;  1GSD A;  4J57 E;  4O5Q A;  4D73 B;  4MDC A;  3H93 A;  2CZ2 A;  1FVJ A;  3KIJ A;  2VOC A;  2MMZ A;  2K6V A;  1T1V A;  2RLI A;  5HR2 A;  2GDR A;  2FA4 A;  3KTL A;  2FWF A;  4HDE A;  3FZ9 A;  2VCQ A;  1A0R P;  1BJX A;  1K0N A;  1NM3 A;  1VGL A;  4HI7 A;  2KP2 A;  3HCZ A;  3RFR C;  3TRP A;  3TUE A;  5JWQ B;  1J0F A;  2DSA A;  1VF4 A;  4GDF A;  4I6X A;  1YY7 A;  1X5E A;  3QPM A;  1AW9 A;  2LJR A;  3C1S A;  2GZY A;  1GTB A;  4K8M A;  3Q74 A;  4K0G A;  3F8U A;  3MSZ A;  2HSM A;  1SVL A;  3A2X A;  1JHB A;  1T4Z A;  2YCD A;  1MDI A;  4WF5 A;  3I69 A;  2O3E A;  4MP4 A;  1FB6 A;  5LD0 A;  4JED A;  3FZ4 A;  1GSU A;  4KUN A;  1V57 A;  1G0T A;  2O89 A;  1PMT A;  1G7O A;  4KDU A;  8GSS A;  3LYP A;  1R4W A;  4BVX A;  3RDW A;  18GS A;  4XTS A;  4JR4 A;  3F6F A;  5ECR B;  3GRX A;  1XOB A;  1OE8 A;  1K0O A;  1GWC A;  4MJB A;  1T8E B;  3ZLP A;  1WE0 A;  2CT6 A;  3LEF A;  7GSS A;  4E8E A;  1GLQ A;  2VL9 A;  1MD3 A;  4TOP A;  2YNX A;  2E2M A;  2AUV A;  2JAD A;  4PQI A;  3TOU A;  4TN8 A;  1NHO A;  3PR8 A;  1PN0 A;  5DAK A;  2VL3 A;  2PVO C;  4L0U A;  4NWY A;  1V98 A;  1ML6 A;  1MTC A;  5AIV A;  2HT9 A;  3GN3 A;  2EFH A;  1O7U A;  1THO A;  2AHE A;  1X0R A;  3N5O A;  1HD2 A;  3VK9 A;  3VPQ A;  4ZB8 A;  3L9U A;  4YQV A;  3F6D A;  1ZGN A;  1W89 A;  4EDY A;  2H75 A;  1SJ6 A;  3QOU A;  3P8W A;  3GV1 A;  1GL8 A;  5AGY A;  4TVE A;  4IEL A;  5B7C A;  1XIY A;  3D6I A;  4QL9 A;  4HJM A;  4MAB A;  1QQ2 A;  2ZCT A;  3IK9 A;  1R7H A;  4FYU A;  5L71 A;  4LMV A;  3WYW A;  2X8H A;  2C80 A;  3CSH A;  4HZ2 A;  4GSN A;  5GZZ B;  2WUL A;  3APQ A;  12GS A;  3TOT A;  4JR6 A;  1SK2 A;  3G9B A;  3UMA A;  1SKW B;  3IBH A;  3C71 A;  2TRC P;  4GCI A;  5BMU B;  4XS4 A;  4X1U A;  5KOW A;  4HQZ A;  1XW9 A;  3GA4 A;  1PKW A;  3KH9 A;  3O3T A;  2YZU A;  4WET A;  3ZIT A;  3VWU A;  3M0F A;  1QXH A;  5IPG A;  2EFC A;  4TXV A;  4G01 A;  3G7Y A;  1B48 A;  2HRK A;  4KF9 A;  3LG6 A;  2RM6 A;  1SYX A;  1CQG A;  3GUR A;  2B1L A;  1S3R A;  2R37 A;  2LEG A;  4IJI A;  2DJ1 A;  2YAN A;  5JWR B;  4KND A;  1BYE A;  5A4V A;  4RQX A;  1XXU A;  5ECS A;  5D9T A;  2VL2 A;  3ERF A;  2VD1 A;  3FHK A;  3F0I A;  3APO A;  3IV4 A;  4ZL9 A;  4MJE A;  3GKK A;  3CXG A;  4KCE A;  1NSW A;  1Q98 A;  3ZIJ A;  1WP0 A;  1YEX A;  2R3X A;  1K0B A;  3DVW A;  2F9S A;  3D4T A;  1JLV A;  3KP9 A;  2YOI A;  1B4P A;  4DSQ A;  3LYK A;  4CY8 A;  5J9C A;  4HSC X;  1ZYP A;  5DCG A;  5DJM A;  1EOH A;  5A5H A;  2IPA A;  4XHM A;  1PKZ A;  2PGT A;  3CRT A;  2B7K A;  2H70 A;  3ZVJ D;  3M9K A;  4K2D A;  1ZYQ B;  2ES7 A;  1SJZ A;  1B8X A;  1T00 A;  2MBT A;  3IAS 2;  1EEM A;  1XVW A;  1GTI A;  3NZN A;  2GTU A;  1GNE A;  2H73 A;  3TU3 B;  2FWE A;  1TXU A;  2GGT A;  1PL2 A;  3KCM A;  4I2T A;  4KX4 A;  2C0D A;  1M0U A;  3FRC A;  1AUC A;  3ZZX A;  3KJY A;  4OMV A;  2X8G A;  1TU7 A;  2TRX A;  2MYG A;  3R3E A;  4KDY A;  2C3N A;  4DVC A;  1SD9 A;  2GQM A;  4P3Y B;  1TDI A;  2FUG 2;  1TP9 A;  3HD5 A;  4F0B A;  1S4B P;  2N5F A;  3W8J A;  3US3 A;  1PN9 A;  2JSZ A;  1V2A A;  2V41 A;  3VWX A;  5ELA A;  4KSO A;  1KTE A;  1Z9H A;  2C0F A;  4X43 A;  2RUE A;  3P7X A;  4OFT A;  2O87 A;  3TKS A;  6GSV A;  1GH2 A;  3QAV A;  5ENU A;  3TRQ A;  2O5V A;  3IK7 A;  1RK4 A;  4ZIJ A;  2R0G A;  5G2Z A;  2QGV A;  3IE3 A;  4MZC A;  1G6Y A;  2L6D A;  4O32 A;  1M99 A;  1HYU A;  5AIS A;  4PXO A;  2O8V B;  3Q19 A;  4CDO A;  5GAP D;  2C0G A;  2VLT A;  1ABA A;  4IQA A;  5IQY A;  4I8B A;  1YF0 A;  3K8N A;  3PGT A;  2V1M A;  1EZK A;  4YKF A;  3GX0 A;  1EP7 A;  3TKP A;  3FW2 A;  2M80 A;  3GUS A;  2HQT A;  2R2J A;  3UIW A;  2I9H A;  4RQR A;  3M8N A;  3PPU A;  2HXK A;  3FY7 A;  4D73 A;  3GSS A;  4Z2U A;  3IHQ A;  3HA9 A;  1NW2 A;  4LL4 B;  1JZO A;  3TKQ A;  1WOU A;  4TR0 A;  2ON7 A;  1ILO A;  2LQQ A;  2HSH A;  3BOA A;  5A4W A;  5A1N B;  10GS A;  1O8X A;  2H01 A;  22GS A;  1O8W A;  3F4T A;  4ZBD A;  3KH7 A;  4EUY A;  4F0C A;  5J47 A;  4MF6 A;  4IJ3 A;  4O5U A;  4FYC A;  4IN0 A;  1QGV A;  1MEK A;  4WR5 A;  2CVK A;  1H4O A;  3LOR A;  2K8V A;  5ID2 B;  4FXY P;  5JCU A;  2H6Z A;  5G1K A;  1OAZ A;  4POL A;  2FLS A;  2NBS A;  3HDC A;  1UA5 A;  1Z7P A;  1AQW A;  2GQK A;  1A8Y A;  1MDJ A;  4TR4 A;  3TDG A;  3EU4 A;  2E2G A;  3FK8 A;  3HVN A;  3CTG A;  1JZD A;  3A5I A;  3PH9 A;  20GS A;  4FQU A;  2IME A;  4RI7 A;  4MJA A;  2OE1 A;  4KSM A;  4ECB A;  4QQ7 A;  2LV3 A;  5F8B A;  1K3O A;  1XW6 A;  1XZO A;  5J4Y A;  1BX9 A;  4EXJ A;  5GAN D;  5HFI A;  5DAL A;  3NIV A;  3QFA C;  4BA7 A;  1U3A A;  2VLU A;  4K2X A;  5H5Q A;  5IOX A;  3M3M A;  4PI2 C;  4Q5R A;  3UVT A;  3TJK A;  3ZIV A;  2CVB A;  5HR1 A;  1XPV A;  3Q6O A;  2XBQ A;  1THX A;  5J4U A;  2RII A;  4X0X A;  4IVF A;  2PMT A;  1R5P A;  1TRW A;  3FEU A;  4V1A p;  2YZH A;  2H0I A;  2CA8 A;  4PX1 A;  2AB6 A;  1SK0 A;  2OE0 A;  2HZF A;  4GWR A;  4I97 A;  1FG4 A;  4AKI A;  5G30 A;  3A2V A;  1U6T A;  2UZ8 A;  3EUR A;  3ISO A;  5DCH A;  2V2G A;  1K0A A;  2DJ3 A;  5B8A A;  2H8L A;  5F0G A;  2JAC A;  4GQF A;  3C8E A;  2GZP A;  2KHP A;  4ICY A;  4MK3 A;  1Z7R A;  1PD2 1;  5DJL A;  1XVQ A;  3HYP A;  1FVK A;  5J41 A;  3W8S A;  4ZB9 A;  2B7J A;  2CQ9 A;  2GZZ A;  1RQM A;  2LNT A;  5BMU A;  4IW9 A;  1K0D A;  4OFN A;  4PUF C;  3CYN A;  5FHI A;  2EFE A;  1VF1 A;  3BBY A;  1JZW A;  2IJY A;  5LCZ A;  4F9Z A;  1TK0 B;  5EL8 A;  5F05 A;  4N10 A;  5ECP B;  2WCI A;  4MPF A;  2O36 A;  1GP1 A;  1WRY A;  3KTB A;  2CZ3 A;  2YWI A;  16GS A;  1O6J A;  2HNL A;  4GST A;  4FO5 A;  5IIZ A;  2VCZ A;  1AXD A;  3J7Y b;  3MYD A;  4MZB A;  1QK8 A;  2LRT A;  2L4Q A;  4POM A;  4ECJ A;  3DYR A;  4ACS A;  5CP1 A;  4A5P A;  1PFO A;  1YQ1 A;  3UEM A;  3ERW A;  1GUM A;  2L5L A;  3DD3 A;  4OO5 A;  2J23 A;  3APS A;  3F4R A;  1B9Y C;  1Z6M A;  1ZYE A;  5D9X A;  2WZ9 A;  5CRH A;  3D21 A;  3L0H A;  4G2E A;  3I9V 2;  1O85 A;  1FAA A;  3EPT A;  2BMX A;  4ILF A;  2L59 A;  1TJD A;  3BCK A;  3ZVJ A;  5J5N A;  2H71 A;  4N3Z A;  4YH2 A;  4FH8 A;  1AIU A;  1V40 A;  4X4J A;  1YEW C;  4HUA A;  4JU5 A;  2C0E A;  4KDX A;  1K3Y A;  2DLX A;  1BED A;  5CRW A;  3TJF A;  2KP1 A;  2G0F A;  1Q4J A;  3FR9 A;  3WGE A;  4XIH A;  1YZX A;  3ED3 A;  1ZYN A;  2H1L A;  4K5S A;  5CRG A;  1GSY A;  2D2Z A;  2IMK A;  4AJ6 A;  14GS A;  3KD0 A;  4E8H A;  1UC7 A;  2L4C A;  4K7N A;  3QMX A;  4NPB A;  2AYT A;  1HNC A;  3LQ7 A;  5DBQ A;  1SEN A;  5D73 A;  2RUF A;  1EP8 A;  4MH2 A;  3ZRE A;  2GSR A;  4OFM A;  1E6B A;  4GXZ A;  3TCO A;  3TGZ A;  1ERU A;  5C04 A;  2F8A A;  2WDU A;  4KA0 A;  1FO5 A;  2HRA A;  2IIY A;  4JE1 A;  1FB0 A;  3CMI A;  2WVX B;  4O5R A;  2E0Q A;  1BG5 A;  4E68 A;  2MMO A;  4PTS A;  4Z2R A;  4BVY B;  5IMA A;  4AKX B;  4PUA A;  3HKR A;  3KXO A;  2GSS A;  1TXX A;  2VCW A;  2H1B A;  1PL1 A;  3Q18 A;  1X9S B;  3C1R A;  2QC7 A;  3EWL A;  4BL7 B;  2A2S A;  4HU7 A;  1GTU A;  2IL3 A;  2A4V A;  1SL1 B;  5IPH A;  1DE2 A;  4K7I A;  3ME7 A;  2H6Y A;  4K7O A;  1TKD B;  2TIR A;  4ZB6 A;  1T7P B;  4LMW A;  4G0L A;  5KN3 A;  4AJ8 A;  4ULX A;  2DC5 A;  4ECC A;  2EC4 A;  5HFG A;  4ZIL A;  3ZRD A;  3V1W A;  1TK8 B;  1TOF A;  3HHV A;  4DSS B;  2H30 A;  5IMF A;  2QA2 A;  4NV2 A;  5EPF A;  3KMO A;  2VL2 C;  2O7K A; 
#chains in the Genus database with same CATH homology
 5B8B A;  2M46 A;  3D22 A;  3VLN A;  1R26 A;  3GKX A;  4ML6 A;  1SK1 A;  3H1N A;  2NDO A;  3GKM A;  1S3D A;  2CAQ A;  2VCT A;  4PNG A;  3BCI A;  1TTZ A;  1H75 A;  2R6K A;  4OCE A;  3FR6 A;  2CX3 A;  5IM9 A;  2C8U A;  3AY8 A;  5ID2 A;  3FMW A;  1Z3E A;  1PSQ A;  1SJI A;  2B5E A;  2LUS A;  1EV4 A;  4LLR A;  4TW5 A;  2XHF A;  4OD7 A;  2NTO A;  4HZ4 A;  2OE3 A;  1ZCP A;  5GSS A;  3EMX A;  1ERV A;  1HQO A;  2HI7 A;  2VD0 A;  5COH A;  3EMP A;  3C7M A;  5D9W A;  3D4M A;  2VAF A;  1AQX A;  5KN0 A;  3IHG A;  4HU9 A;  5C00 A;  3LFL A;  1KEB A;  3J7Y k;  3LSZ A;  4YQU A;  3LXT A;  2DJ0 A;  2EIR A;  4IS0 A;  1SKR B;  2CAI A;  3UAR A;  4TXO A;  4Q5N A;  2FNO A;  2OT3 A;  4RI6 A;  4PUR A;  5EVO A;  3TKR A;  2PVQ A;  2QSI A;  3VFI A;  1B9X C;  4MNN A;  4CHS A;  6GSS A;  4EKZ A;  1M7T A;  2YJH A;  4GSS A;  4YAP A;  4WEY A;  2V6K A;  1VF3 A;  1GTA A;  1SYR A;  4MZW A;  2IFQ A;  1VRS D;  2EIO A;  4G9H A;  4NAX A;  4KE3 A;  2M72 A;  2CVD A;  2I3Y A;  4Q5F A;  4POB A;  3GMF A;  5ELG A;  3SWL A;  1X5C A;  1T3B A;  4N30 A;  4F2I A;  1N25 A;  1DBY A;  1N8J A;  1GSF A;  4IGJ A;  2P5Q A;  6GSY A;  4TR1 B;  2R4V A;  3F9U A;  2F8F A;  5F06 A;  4XS6 A;  1K3L A;  2HSN B;  1E2Y A;  1NHY A;  2EFD A;  3LGC A;  1BG1 A;  2OBK A;  5F07 A;  1TK5 B;  3ZYW A;  2PU9 C;  3KP8 A;  2LNS A;  4MF5 A;  3R2Q A;  3I6A A;  3WGX A;  3LW9 A;  4EIQ A;  1M2A A;  1TRS A;  3DWV A;  3FKF A;  2LS5 A;  5FWG A;  4J56 E;  4OWY A;  4YKG A;  2WS2 A;  1F37 A;  4FYB A;  2WGR A;  3TJB A;  3CTF A;  5J40 A;  3HVX A;  2H1A A;  2LQO A;  3GIX A;  1TRV A;  2C3Q A;  1U87 A;  4IP6 A;  1Z5Y E;  2AV4 A;  1U3I A;  1QFN A;  2B6M A;  4JRR A;  3GTU B;  1JLW A;  4OCF A;  2FA8 A;  5KEJ A;  4KGI A;  4I5Q A;  1TU8 A;  5JCG A;  2H1G A;  2N5B A;  2B3S A;  2C1Y A;  2F3M A;  4XCS A;  1Z6N A;  1G6W A;  3D0Z A;  2HLS A;  2GT6 A;  1OYJ A;  2Z9S A;  3BD2 A;  5KN2 A;  1GSE A;  5ECH B;  4LL1 B;  4HS1 A;  2AAW A;  3CSJ A;  2QA1 A;  2QKE A;  5ECK B;  2UV8 G;  1FOH A;  1K0C A;  5ABR A;  4K9Z A;  1SD8 A;  5IO2 A;  4IP1 A;  1F3A A;  1HNA A;  2YPM A;  2K8S A;  1MD4 A;  4Z2T A;  4AKH A;  2B5Y A;  1K0M A;  1JFU A;  3P2A A;  2CX4 A;  2L5O A;  1OC9 B;  5IOW A;  3TKS E;  2YWM A;  5ECM B;  1TI1 A;  3H79 A;  1Y6E A;  1ON4 A;  1I5G A;  2GSQ A;  1PX7 A;  2FGX A;  1GUL A;  3VI5 A;  2GT5 A;  1FOV A;  4ZXG A;  5J4V A;  1V58 A;  3ME8 A;  3EC3 A;  2HZE B;  2VCV A;  3LJR A;  4L5O A;  2VM1 A;  4N0Z A;  1PA3 A;  2DML A;  3HZ4 A;  2A2P A;  2ON5 A;  5A4U A;  3HZ8 A;  1B4Q A;  4NMU A;  2IN3 A;  3A5W A;  2H0G A;  3RHC A;  5AN1 A;  3RHB A;  2ALB A;  3UAP A;  5INY A;  5IMZ A;  4ZL7 A;  4V2L A;  6GST A;  3M1G A;  4AI6 A;  2DIY A;  1EGO A;  2REM A;  1VF2 A;  3GHA A;  4CW9 A;  5G1L A;  3HXS A;  3WD6 A;  1DSB A;  4WKW A;  5LNK e;  4L8E A;  1PQN A;  1F6M C;  4HJ2 A;  4ML1 A;  4BVY A;  1OVN A;  3E0U A;  3WT2 A;  2I4A A;  5EY6 A;  4BL7 A;  4QL7 A;  5G5F A;  2JL4 A;  4GQC A;  3O6T A;  4KCA A;  3GH9 A;  4EF0 A;  1XOA A;  1A24 A;  2JZT A;  1S3A A;  5E59 A;  4KAE A;  2MMA A;  6GSX A;  1QUW A;  2VCX A;  3GYK A;  1YEP A;  1GUK A;  4K6X A;  2DMM A;  2AJQ B;  4F82 A;  3EE2 A;  4KW6 A;  2OKA A;  1HNB A;  1XWC A;  1OKD A;  1XW5 A;  3MAK A;  3G7I A;  5A34 B;  2DJ2 A;  3QAG A;  4XRA A;  5IO0 A;  4POK A;  3H8Q A;  2WJU A;  2A4H A;  2X4A A;  2HYX A;  3SBC A;  3OR5 A;  1KBN A;  1GSS A;  1LJR A;  3HVV A;  4LA1 A;  1MDK A;  5ECQ B;  2P5R A;  2VIM A;  2B1K A;  1YJ6 A;  5IMV A;  5IMD A;  4N0V A;  2X64 A;  2P0G A;  4NHW A;  5HQP A;  2MBS A;  3F3Q A;  4USS A;  4WBJ A;  2IMI A;  2X99 A;  1BAY A;  5J9B A;  4AF2 A;  1W4V A;  2YP6 A;  5DQY A;  1GNW A;  2XBI A;  3GL5 A;  3CBU A;  1X9W B;  4NV5 A;  2PER A;  3QD9 A;  2H74 A;  3QFB C;  9GSS A;  5JCW A;  4AKG A;  6GSW A;  3QAW A;  4NXI A;  4MLY A;  2K9F A;  3UVH A;  3GFK A;  3HJM A;  5CAX A;  2N5A A;  4N11 A;  3ZML A;  2PN8 A;  3PIN A;  2RM5 A;  4V2N A;  4O7H A;  2HRN A;  1ACV A;  5D9V A;  2IWT A;  1ZZY A;  2YV7 A;  2LRN A;  3N9J A;  1WPI A;  2V6O A;  4MF7 A;  1IYH A;  1YVL A;  4O92 A;  2H1D A;  1ZOF A;  4MA9 A;  2PPT A;  4BWQ A;  3EU3 A;  4CY6 A;  1A23 A;  2I81 A;  1AC1 A;  1XWG A;  3TB2 A;  3IC4 A;  1AAZ A;  2R0C A;  4EE0 A;  4K0N A;  1J08 A;  3LXZ A;  2GVP A;  4TKY A;  3IR4 A;  1DUG A;  2A2R A;  1OE7 A;  4K1F A;  3UJ1 A;  5DAL B;  1C72 A;  3LWA A;  1A2M A;  1OC8 A;  3G7J A;  1O73 A;  5B6M A;  1Y25 A;  3KEB A;  1QMV A;  1M9A A;  3M9J A;  4EDZ A;  1WWJ A;  1N2A A;  3IXR A;  4AGS A;  4PNF A;  4J2F A;  5B6N A;  1GUH A;  3IA1 A;  2GLR A;  2VLV A;  4XRD A;  1EEJ A;  2R5G A;  3U5R E;  3UL3 A;  3ZMK A;  2PWJ A;  1YKA A;  1F9M A;  5DDL A;  3GNJ A;  4MCU A;  4TR1 A;  1YKC A;  3BJ5 A;  1SVO A;  3GL3 A;  3EIN A;  6GSU A;  1PX6 A;  17GS A;  2HSN A;  3ERG A;  4KB3 A;  3KMN A;  2XC2 A;  3FZ5 A;  4G19 A;  2X49 A;  4WXT A;  3F4S A;  2IMD A;  3DXB A;  3DVX A;  1USB A;  3HJP A;  5HFK A;  4WBR D;  3RPP A;  3MIX A;  1I9D A;  4EL1 A;  4MH3 A;  4PQ1 A;  5CYY A;  2K18 A;  3DGQ A;  3EYT A;  2EIQ A;  1J9B A;  4G0K A;  4DEJ A;  1EOG A;  1A8L A;  1M2D A;  5A1N A;  3W6G A;  5DQS A;  4V2M A;  2DJJ A;  3ZFB A;  3WGD A;  2PBJ A;  3NOF A;  4ID0 A;  3GTU A;  4HOJ A;  1ST9 A;  2LTK A;  3QR6 A;  1UVZ A;  5CNW A;  5FT3 A;  3L78 A;  1GLP A;  1A2L A;  3I43 A;  1XWK A;  1TW9 A;  1O81 A;  3E3E A;  3VWW A;  2F51 A;  2PUK C;  2L57 A;  3EVI A;  4K5R A;  4MJC A;  3VUR A;  2LKU A;  1TI3 A;  3GST A;  2O85 A;  5AIX A;  4IHU A;  4G10 A;  2BTO T;  1GSQ A;  5J3R A;  2KLX A;  2YWO A;  4ZBA A;  2HSM B;  3E9J B;  2VKZ G;  1OC9 A;  3VPT A;  1XFL A;  1XBS A;  1F3B A;  4IBP A;  3TJJ A;  4PGT A;  3C73 A;  1XWB A;  4EIP A;  4BVX B;  5G5E A;  2VO4 A;  3F63 A;  2H19 A;  3DIE A;  2JZS A;  1ERW A;  4JZQ A;  4EVM A;  2FWG A;  1G7E A;  5G31 A;  5IMC A;  2OAC A;  13GS A;  3L9V A;  3UOM A;  4OO4 A;  2HZE A;  3D5J A;  5KN1 A;  11GS A;  4V1A g;  2FY6 A;  2X8C A;  2LRC A;  5DAK B;  3HY2 A;  1BF5 A;  4YAV A;  3TKS C;  3DEX A;  1SL0 B;  1OKT A;  2FHE A;  4TRX A;  2H72 A;  3VWV A;  3VI7 A;  1V9W A;  2B5X A;  4L5L A;  2DJK A;  5E4W A;  4WF4 A;  3JCM L;  5HR3 A;  2LJA A;  2VUP A;  4MPG A;  2XPD A;  2JZR A;  3IDV A;  3H4K A;  3RAZ A;  2KUC A;  3CSI A;  1BQ7 A;  2DBC A;  4JBB A;  1JZR A;  4EC0 A;  2GQL A;  3DKS A;  3FZA A;  3L4N A;  3O76 A;  1XWA A;  3S9F A;  3A2W A;  4YQM A;  1WIK A;  3QCP A;  2HRF A;  5D93 A;  5ECI B;  2NPB A;  1DE1 A;  2DKH A;  1LBK A;  3GX8 A;  2ZUP A;  1X5D A;  2WB9 A;  3IOS A;  4XS4 B;  1Y1U A;  3KGK A;  3HMJ G;  3TJG A;  4WR4 A;  5CRD A;  1PGT A;  5A34 A;  1SL2 B;  1X9M B;  5DVB A;  1M2B A;  1URM A;  2YJ7 A;  3MDK A;  2LST A;  2DKI A;  2FWH A;  4AJ7 A;  2HRK B;  4QMK A;  1ERT A;  5ECO B;  1YDK A;  1FW1 A;  1SKS B;  2KOK A;  4G0I A;  4F03 A;  4FIW A;  3KZQ A;  5ECL B;  1M9B A;  2DIZ A;  2MZC A;  4GLT A;  2VM2 A;  2WRT A;  5H5S A;  3L9S A;  3MWH A;  3IPZ A;  1OC3 A;  3IAM 2;  4MMM A;  4KH7 A;  4GRF A;  3DRN A;  4GF0 A;  1S3C A;  3CRU A;  5CO3 A;  2C3T A;  4ZB7 A;  1ZMA A;  2HSY A;  3DML A;  2YN1 A;  2NVL A;  1WJK A;  4RUV A;  1F2E A;  2OA7 A;  3TRX A;  5H5R A;  2OJL A;  1KNG A;  5CRE A;  1CQH A;  4XS1 A;  3QDN A;  5A5H B;  2MMN A;  1EV9 A;  4ISD A;  2I1U A;  3ZFL A;  4IKH A;  1UN2 A;  1A2J A;  3RPN A;  1SU9 A;  2XPE A;  4BWS A;  4I2U A;  5HR0 A;  2HE3 A;  19GS A;  2R0P A;  3FR3 A;  4TXO B;  4IQ1 A;  1TRU A;  1WMJ A;  1GRX A;  1XCC A;  3IC8 A;  2H66 A;  2C4J A;  4TR3 A;  3HJO A;  4HQS A;  4ZL8 A;  4Q5Q A;  1T4Y A;  3HVS A;  4NHZ A;  5D8I A;  4BPY A;  4W66 A;  5JWO B;  5A5K A;  2OAD A;  1A0F A;  1IYI A;  3RBT A;  5ECN B;  3GH6 A;  2H0H A;  2H6X A;  2ZNM A;  2YWN A;  1YF1 A;  3CWG A;  2HFD A;  2IFQ B;  4GTU A;  2WFC A;  3A3T A;  3KM6 A;  3UBK A;  2JU5 A;  4ZBB A;  2L6C A;  3P90 A;  3F3R A;  4HEA 2;  2GS3 A;  2FCH A;  4H86 A;  2FD3 A;  1FHE A;  3IRA A;  1EGR A;  1R5A A;  1RW1 A;  2LJK A;  1AQV A;  4PQH A;  1U88 A;  2CV4 A;  2G2Q A;  4ECI A;  4L0W A;  2H76 A;  5D96 A;  3ZTL A;  4EO3 A;  5BRT A;  2GST A;  1EWX A;  4Z7X A;  3U6V A;  3GKN A;  3WT1 A;  2BJX A;  3UBL A;  1LU4 A;  3ZL5 A;  2E7P A;  1PRX A;  4DSR A;  1ZL9 A;  2V32 A;  5KOX A;  1SVM A;  2YV9 A;  2OBI A;  2J9H A;  2IMF A;  2P31 A;  4DSS A;  3MNG A;  3FYG A;  5GST A;  2JSY A;  1GSD A;  4J57 E;  4O5Q A;  4D73 B;  4MDC A;  3H93 A;  2CZ2 A;  1FVJ A;  3KIJ A;  2VOC A;  2MMZ A;  2K6V A;  1T1V A;  2RLI A;  5HR2 A;  2GDR A;  2FA4 A;  3KTL A;  2FWF A;  4HDE A;  3FZ9 A;  2VCQ A;  1A0R P;  1BJX A;  1K0N A;  1NM3 A;  1VGL A;  4HI7 A;  2KP2 A;  3HCZ A;  3TRP A;  3TUE A;  5JWQ B;  1J0F A;  2DSA A;  1VF4 A;  4GDF A;  4I6X A;  1YY7 A;  1X5E A;  3QPM A;  1AW9 A;  2LJR A;  3C1S A;  2GZY A;  1GTB A;  4K8M A;  3Q74 A;  4K0G A;  3F8U A;  3MSZ A;  2HSM A;  1SVL A;  3A2X A;  1JHB A;  1T4Z A;  2YCD A;  1MDI A;  4WF5 A;  3I69 A;  4MP4 A;  1FB6 A;  5LD0 A;  4JED A;  3FZ4 A;  1GSU A;  4KUN A;  1V57 A;  1G0T A;  2O89 A;  1PMT A;  1G7O A;  4KDU A;  8GSS A;  3LYP A;  1R4W A;  4BVX A;  3RDW A;  18GS A;  4XTS A;  4JR4 A;  3F6F A;  5ECR B;  3GRX A;  1XOB A;  1OE8 A;  1K0O A;  1GWC A;  4MJB A;  1T8E B;  3ZLP A;  1WE0 A;  2CT6 A;  3LEF A;  7GSS A;  4E8E A;  1GLQ A;  2VL9 A;  1MD3 A;  4TOP A;  2YNX A;  2E2M A;  2AUV A;  2JAD A;  4PQI A;  3TOU A;  4TN8 A;  1NHO A;  3PR8 A;  1PN0 A;  5DAK A;  2VL3 A;  2PVO C;  4L0U A;  4NWY A;  1V98 A;  1ML6 A;  1MTC A;  5AIV A;  2HT9 A;  3GN3 A;  2EFH A;  1O7U A;  1THO A;  2AHE A;  1X0R A;  3N5O A;  1HD2 A;  3VK9 A;  3VPQ A;  4ZB8 A;  3L9U A;  4YQV A;  3F6D A;  1ZGN A;  1W89 A;  4EDY A;  2H75 A;  1SJ6 A;  3QOU A;  3P8W A;  3GV1 A;  1GL8 A;  5AGY A;  4TVE A;  4IEL A;  5B7C A;  1XIY A;  3D6I A;  4QL9 A;  4HJM A;  4MAB A;  1QQ2 A;  2ZCT A;  3IK9 A;  1R7H A;  4FYU A;  5L71 A;  4LMV A;  3WYW A;  2X8H A;  2C80 A;  3CSH A;  4HZ2 A;  4GSN A;  5GZZ B;  2WUL A;  3APQ A;  12GS A;  3TOT A;  4JR6 A;  1SK2 A;  3G9B A;  3UMA A;  1SKW B;  3IBH A;  3C71 A;  2TRC P;  4GCI A;  5BMU B;  4XS4 A;  4X1U A;  5KOW A;  4HQZ A;  1XW9 A;  3GA4 A;  1PKW A;  3KH9 A;  3O3T A;  2YZU A;  4WET A;  3ZIT A;  3VWU A;  3M0F A;  1QXH A;  5IPG A;  2EFC A;  4TXV A;  4G01 A;  3G7Y A;  1B48 A;  2HRK A;  4KF9 A;  3LG6 A;  2RM6 A;  1SYX A;  1CQG A;  3GUR A;  2B1L A;  2R37 A;  2LEG A;  4IJI A;  2DJ1 A;  2YAN A;  5JWR B;  4KND A;  1BYE A;  5A4V A;  4RQX A;  1XXU A;  5ECS A;  5D9T A;  2VL2 A;  3ERF A;  2VD1 A;  3FHK A;  3F0I A;  3APO A;  3IV4 A;  4ZL9 A;  4MJE A;  3GKK A;  3CXG A;  4KCE A;  1NSW A;  1Q98 A;  3ZIJ A;  1WP0 A;  1YEX A;  2R3X A;  1K0B A;  3DVW A;  2F9S A;  3D4T A;  1JLV A;  3KP9 A;  2YOI A;  1B4P A;  4DSQ A;  3LYK A;  4CY8 A;  5J9C A;  1ZYP A;  5DCG A;  5DJM A;  1EOH A;  5A5H A;  2IPA A;  4XHM A;  1PKZ A;  2PGT A;  3CRT A;  2B7K A;  2H70 A;  3ZVJ D;  3M9K A;  4K2D A;  1ZYQ B;  2ES7 A;  1SJZ A;  1B8X A;  1T00 A;  2MBT A;  3IAS 2;  1EEM A;  1XVW A;  1GTI A;  3NZN A;  2GTU A;  1GNE A;  2H73 A;  3TU3 B;  2FWE A;  1TXU A;  2GGT A;  1PL2 A;  3KCM A;  4I2T A;  4KX4 A;  2C0D A;  1M0U A;  3FRC A;  1AUC A;  3ZZX A;  3KJY A;  4OMV A;  2X8G A;  1TU7 A;  2TRX A;  2MYG A;  3R3E A;  4KDY A;  2C3N A;  4DVC A;  1SD9 A;  2GQM A;  4P3Y B;  1TDI A;  2FUG 2;  1TP9 A;  3HD5 A;  4F0B A;  2N5F A;  3W8J A;  3US3 A;  1PN9 A;  2JSZ A;  1V2A A;  2V41 A;  3VWX A;  5ELA A;  4KSO A;  1KTE A;  1Z9H A;  2C0F A;  4X43 A;  2RUE A;  3P7X A;  4OFT A;  2O87 A;  3TKS A;  6GSV A;  1GH2 A;  3QAV A;  5ENU A;  3TRQ A;  2O5V A;  3IK7 A;  1RK4 A;  4ZIJ A;  2R0G A;  5G2Z A;  2QGV A;  3IE3 A;  4MZC A;  1G6Y A;  2L6D A;  4O32 A;  1M99 A;  1HYU A;  5AIS A;  4PXO A;  2O8V B;  3Q19 A;  4CDO A;  5GAP D;  2C0G A;  2VLT A;  1ABA A;  4IQA A;  5IQY A;  4I8B A;  1YF0 A;  3K8N A;  3PGT A;  2V1M A;  1EZK A;  4YKF A;  3GX0 A;  1EP7 A;  3TKP A;  3FW2 A;  2M80 A;  3GUS A;  2HQT A;  2R2J A;  3UIW A;  2I9H A;  4RQR A;  3M8N A;  3PPU A;  2HXK A;  3FY7 A;  4D73 A;  3GSS A;  4Z2U A;  3IHQ A;  3HA9 A;  1NW2 A;  4LL4 B;  1JZO A;  3TKQ A;  1WOU A;  4TR0 A;  2ON7 A;  1ILO A;  2LQQ A;  2HSH A;  3BOA A;  5A4W A;  5A1N B;  10GS A;  1O8X A;  2H01 A;  22GS A;  1O8W A;  3F4T A;  4ZBD A;  3KH7 A;  4EUY A;  4F0C A;  5J47 A;  4MF6 A;  4IJ3 A;  4O5U A;  4FYC A;  4IN0 A;  1QGV A;  1MEK A;  4WR5 A;  2CVK A;  1H4O A;  3LOR A;  2K8V A;  5ID2 B;  5JCU A;  2H6Z A;  5G1K A;  1OAZ A;  4POL A;  2FLS A;  2NBS A;  3HDC A;  1UA5 A;  1Z7P A;  1AQW A;  2GQK A;  1A8Y A;  1MDJ A;  4TR4 A;  3TDG A;  3EU4 A;  2E2G A;  3FK8 A;  3CTG A;  1JZD A;  3A5I A;  3PH9 A;  20GS A;  4FQU A;  2IME A;  4RI7 A;  4MJA A;  2OE1 A;  4KSM A;  4ECB A;  4QQ7 A;  2LV3 A;  5F8B A;  1K3O A;  1XW6 A;  1XZO A;  5J4Y A;  1BX9 A;  4EXJ A;  5GAN D;  5HFI A;  5DAL A;  3NIV A;  3QFA C;  4BA7 A;  1U3A A;  2VLU A;  4K2X A;  5H5Q A;  5IOX A;  3M3M A;  4Q5R A;  3UVT A;  3TJK A;  3ZIV A;  2CVB A;  5HR1 A;  1XPV A;  3Q6O A;  2XBQ A;  1THX A;  5J4U A;  2RII A;  4X0X A;  4IVF A;  2PMT A;  1R5P A;  1TRW A;  3FEU A;  4V1A p;  2YZH A;  2H0I A;  2CA8 A;  4PX1 A;  2AB6 A;  1SK0 A;  2OE0 A;  2HZF A;  4GWR A;  4I97 A;  1FG4 A;  4AKI A;  5G30 A;  3A2V A;  1U6T A;  2UZ8 A;  3EUR A;  3ISO A;  5DCH A;  2V2G A;  1K0A A;  2DJ3 A;  5B8A A;  2H8L A;  5F0G A;  2JAC A;  4GQF A;  3C8E A;  2GZP A;  2KHP A;  4ICY A;  4MK3 A;  1Z7R A;  1PD2 1;  5DJL A;  1XVQ A;  3HYP A;  1FVK A;  5J41 A;  3W8S A;  4ZB9 A;  2B7J A;  2CQ9 A;  2GZZ A;  1RQM A;  2LNT A;  5BMU A;  4IW9 A;  1K0D A;  4OFN A;  4PUF C;  3CYN A;  5FHI A;  2EFE A;  1VF1 A;  3BBY A;  1JZW A;  2IJY A;  5LCZ A;  4F9Z A;  1TK0 B;  5EL8 A;  5F05 A;  4N10 A;  5ECP B;  2WCI A;  4MPF A;  1GP1 A;  1WRY A;  3KTB A;  2CZ3 A;  2YWI A;  16GS A;  1O6J A;  2HNL A;  4GST A;  4FO5 A;  5IIZ A;  2VCZ A;  1AXD A;  3J7Y b;  3MYD A;  4MZB A;  1QK8 A;  2LRT A;  2L4Q A;  4POM A;  4ECJ A;  3DYR A;  4ACS A;  5CP1 A;  4A5P A;  1YQ1 A;  3UEM A;  3ERW A;  1GUM A;  2L5L A;  3DD3 A;  4OO5 A;  2J23 A;  3APS A;  3F4R A;  1B9Y C;  1Z6M A;  1ZYE A;  5D9X A;  2WZ9 A;  5CRH A;  3D21 A;  3L0H A;  4G2E A;  3I9V 2;  1O85 A;  1FAA A;  3EPT A;  2BMX A;  4ILF A;  2L59 A;  1TJD A;  3BCK A;  3ZVJ A;  5J5N A;  2H71 A;  4N3Z A;  4YH2 A;  4FH8 A;  1AIU A;  1V40 A;  4X4J A;  4HUA A;  4JU5 A;  2C0E A;  4KDX A;  1K3Y A;  2DLX A;  1BED A;  5CRW A;  3TJF A;  2KP1 A;  2G0F A;  1Q4J A;  3FR9 A;  3WGE A;  4XIH A;  1YZX A;  3ED3 A;  1ZYN A;  2H1L A;  4K5S A;  5CRG A;  1GSY A;  2D2Z A;  2IMK A;  4AJ6 A;  14GS A;  3KD0 A;  4E8H A;  1UC7 A;  2L4C A;  4K7N A;  3QMX A;  4NPB A;  2AYT A;  1HNC A;  3LQ7 A;  5DBQ A;  1SEN A;  5D73 A;  2RUF A;  1EP8 A;  4MH2 A;  3ZRE A;  2GSR A;  4OFM A;  1E6B A;  4GXZ A;  3TCO A;  3TGZ A;  1ERU A;  5C04 A;  2F8A A;  2WDU A;  4KA0 A;  1FO5 A;  2HRA A;  2IIY A;  4JE1 A;  1FB0 A;  3CMI A;  4O5R A;  2E0Q A;  1BG5 A;  4E68 A;  2MMO A;  4PTS A;  4Z2R A;  4BVY B;  5IMA A;  4AKX B;  4PUA A;  3HKR A;  3KXO A;  2GSS A;  1TXX A;  2VCW A;  2H1B A;  1PL1 A;  3Q18 A;  1X9S B;  3C1R A;  2QC7 A;  3EWL A;  4BL7 B;  2A2S A;  4HU7 A;  1GTU A;  2IL3 A;  2A4V A;  1SL1 B;  5IPH A;  1DE2 A;  4K7I A;  3ME7 A;  2H6Y A;  4K7O A;  1TKD B;  2TIR A;  4ZB6 A;  1T7P B;  4LMW A;  4G0L A;  5KN3 A;  4AJ8 A;  4ULX A;  2DC5 A;  4ECC A;  2EC4 A;  5HFG A;  4ZIL A;  3ZRD A;  3V1W A;  1TK8 B;  1TOF A;  3HHV A;  4DSS B;  2H30 A;  5IMF A;  2QA2 A;  4NV2 A;  5EPF A;  3KMO A;  2VL2 C;  2O7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...