5AN1A

Crystallographic structure of the glutathione s-transferase from litopenaeus vannamei complexed with glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
MLPVLGYWKTRALCQPIRLMLGYTGTEFEEKNYPVGDAPDYDKSEWLAVKFKLGLAFPNLPYYIDGDVKITQSKAIMRYLARKHGLCGTTPEELVRTDMIECQLTDMHEAFFTVTYEHYEQKDAYTASLPAKLRQYSDFLGSRPWFAGDKLTYIDFLAYEIFDQHLSLDRTCLDGFKNLQAFQKRFEDLEAIKKYMASPKFLKKPICNKYAQFTIIEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of a class-mu glutathione S-transferase from whiteleg shrimp Litopenaeus vannamei: structural changes in the xenobiotic binding H-site may alter the spectra of molecules bound.
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Transferase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5an1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5an1A01
4OO4A 2A2RA 1WMJA 5GSSA 4X0XA 3GKMA 4OFMA 5A4WA 4KDUA 3QAWA 1M2BA 3I69A 4G2EA 1B9XC 2JSZA 3GL5A 4E8HA 2C0EA 5CRWA 1GSUA 1EZKA 4DSQA 3VPQA 3ZFLA 5CAXA 1XWAA 4TR1B 4EXJA 1QQ2A 1URMA 2FWFA 1FVKA 3EMPA 4WKWA 3L9VA 1WOUA 1Z7RA 1PX6A 1HD2A 3FZ5A 5D73A 1GP1A 3GX8A 2WFCA 4NHZA 5HR1A 4TR4A 1YKCA 3ERGA 2VL3A 1PA3A 4DVCA 1MDIA 2H76A 5G1LA 2JZTA 2DJKA 1O85A 4XRAA 1HQOA 2LJAA 2C1YA 1DE2A 2DIYA 4XIHA 3BJ5A 4MJCA 2L4QA 3DYRA 2M80A 3UAPA 2N5AA 4ZBBA 2PPTA 2LTKA 2HNLA 1HNCA 1TI3A 4OFTA 1F3AA 4G10A 4JRRA 2NDOA 4WR4A 5DQSA 5J5NA 2DJ1A 3QFBC 1JLVA 2X99A 2DSAA 2JACA 5KN3A 1PMTA 2FWGA 4G0LA 4WEYA 3U5RE 1E2YA 1Z5YE 5CRHA 3KIJA 1I5GA 2YZHA 3MNGA 1JZDA 1TK5B 1MD4A 5G5FA 4IJIA 4XS4A 3E9JB 2B5YA 4MP4A 2TRXA 2R37A 2C0FA 4WR5A 5DCGA 3GV1A 5ECSA 3LYPA 1WRYA 2H19A 1THXA 4YQUA 2E2MA 4P3YB 3IAS2 2HSMA 4PQHA 3CTFA 1U88A 3QOUA 3UEMA 4IHUA 4TW5A 4ZL7A 2WCIA 2MBSA 4G0KA 4GSNA 3TKSA 3F3QA 4EF0A 2VLUA 5JWQB 4MF6A 1GTAA 3APQA 2PBJA 13GSA 2CVBA 2IN3A 4F03A 1BQ7A 1AIUA 1MD3A 5KN0A 1SL2B 5ECPB 2LS5A 4MABA 5ECKB 4TRXA 2GTUA 4BPYA 1V9WA 3ZFBA 3IC4A 3VLNA 5F0GA 1R4WA 3GMFA 2M72A 4YAVA 2E7PA 2OE3A 1SK1A 2XBIA 5HFIA 4I97A 1A23A 1EP8A 1LJRA 3HJPA 3KM6A 2EIOA 2B5EA 5A4VA 3CRUA 2E0QA 4HUAA 1GTUA 3Q19A 2FLSA 3C71A 4MZWA 2CX3A 3HZ4A 1F3BA 4IW9A 3UBLA 1XWKA 1B9YC 4AJ6A 4NXIA 4HS1A 4Q5RA 3L0HA 1AW9A 1EV9A 4DSSB 2H6YA 3FR9A 3NOFA 3C7MA 5FT3A 3EU3A 2GLRA 2B1LA 4FIWA 3GUSA 4MDCA 2H1DA 1XCCA 3LSZA 1QUWA 4PGTA 2XC2A 3D21A 2MMZA 1SJIA 1WE0A 1GUHA 4POLA 2FWEA 4GQCA 3EMXA 5KN2A 3F9UA 2WDUA 1IYIA 3ZRDA 1SD8A 2JZRA 3FKFA 3GSTA 2F3MA 1A2JA 2YNXA 1DBYA 4K2DA 1JZWA 4MJEA 4L0UA 4EE0A 4J57E 2N5BA 1EWXA 1K0OA 3M1GA 3RAZA 3DXBA 2PERA 3CBUA 1O73A 4MCUA 2Z9SA 1OVNA 1FW1A 2DJ2A 1YF1A 1F9MA 1KBNA 2NTOA 3QPMA 1ABAA 3EU4A 1EP7A 3TKQA 3DIEA 3C1RA 1AAZA 5F07A 4K6XA 5DAKA 4POMA 4G9HA 5DJLA 1ACVA 3RHBA 4IGJA 2VCQA 2I1UA 2OKAA 3CTGA 3C1SA 4ML1A 5JWOB 5ECNB 2KLXA 3GURA 3E3EA 5B8BA 4BA7A 3V1WA 4Q5FA 1G7OA 1NW2A 3HVXA 2LSTA 3O76A 4KUNA 1HYUA 3VFIA 5HQPA 6GSWA 5G2ZA 1JZRA 4GXZA 1A0RP 4I5QA 1YQ1A 1FG4A 2LRTA 1TK8B 4GSTA 3US3A 3QAVA 3D6IA 3HHVA 2H71A 3FR3A 2AB6A 5CYYA 5G30A 1VF4A 5AIVA 3GKKA 1GSEA 3TKSE 1X5EA 4BVYB 3UBKA 5G31A 5DQYA 5JCUA 2FHEA 1K3OA 2VOCA 5IQYA 2REMA 4AF2A 1T7PB 5F06A 2V41A 4ZL9A 3QAGA 3EVIA 3I43A 4V2MA 3M9KA 3DWVA 2CA8A 4WXTA 3L4NA 1O6JA 4AJ8A 3SWLA 3N9JA 4IVFA 5INYA 1M2AA 1FVJA 1YZXA 1SYRA 3QR6A 4NAXA 3S9FA 3KH9A 1R5AA 4KH7A 3R3EA 2B5XA 2MMOA 2NVLA 1G0TA 2JZSA 4K8MA 1GNEA 2BTOT 1TXXA 3ZYWA 1BX9A 2E2GA 1V98A 2LNSA 4NV5A 3ZIVA 4HEA2 1K0BA 3LXZA 4ZB6A 5CNWA 1OE7A 3ZREA 1S3AA 4HQZA 1UC7A 2OE1A 2VL2C 1Q4JA 2HRFA 2OJLA 2KP2A 2L5LA 4KB3A 3KP9A 4MMMA 2KUCA 1TU8A 3CSIA 2VD1A 3HYPA 2H1BA 2O85A 4IP1A 5DJMA 4WBRD 3W8SA 2YWNA 3ME8A 1S3DA 4K7NA 1MTCA 3VWXA 1SENA 2EIRA 3HZ8A 6GSUA 3F6FA 3VWUA 1K0NA 4KCAA 3AY8A 3H8QA 3LFLA 1VF2A 3RDWA 5ID2B 2K6VA 3IDVA 2V6OA 4EC0A 2YP6A 2LRCA 4D73A 3KD0A 3UVTA 2GZYA 1K0AA 3QD9A 1T00A 1ST9A 4BL7B 4BWQA 1ZZYA 5BMUA 4IN0A 1W89A 1ERTA 5LNKe 2LQQA 4TVEA 1K0DA 2H1AA 4EO3A 5JWRB 1A24A 2LJRA 1O7UA 5ECHB 1ZCPA 1M0UA 4X43A 2A4VA 1Z7PA 2XPDA 3TJGA 2J23A 1R26A 4XS6A 4ECIA 2I81A 5KEJA 4POKA 2RM5A 5DBQA 5CRDA 2C8UA 2QGVA 2L57A 20GSA 5DVBA 3GTUB 4JR4A 3IA1A 1OC8A 1K3LA 5J41A 1PN9A 3QFAC 2FGXA 1B4PA 1NSWA 2VM1A 1SKRB 2HZEB 5IO0A 3DEXA 5H5SA 4GQFA 5CREA 1DUGA 1Y6EA 4FQUA 1WPIA 3EINA 1R7HA 2CQ9A 3EURA 2H8LA 1YF0A 3A3TA 1G6YA 1ZL9A 2IFQB 5ABRA 4BVXB 3K8NA 5IOWA 2IMIA 1DE1A 5FWGA 2ZUPA 3KTBA 2LJKA 4KSOA 1O8XA 4I8BA 3UJ1A 1TU7A 1XVQA 4I2TA 1ON4A 1XFLA 5GAPD 4HOJA 1QFNA 1PX7A 16GSA 2KHPA 3TJBA 1SKWB 1USBA 4IBPA 6GSVA 4N30A 2H6XA 5GSTA 2RUEA 3A5WA 2IMFA 4JR6A 4KAEA 1SU9A 3CSJA 1TK0B 4IELA 3TOUA 3ERWA 3EC3A 7GSSA 3IRAA 1QXHA 2HYXA 3C73A 1GLQA 4ACSA 1T3BA 5ECIB 2LKUA 2RUFA 3R2QA 1JZOA 5IMCA 4DEJA 3P90A 4QL7A 3GRXA 4EVMA 4MF7A 1YJ6A 2GSTA 2FY6A 1OC9A 4NHWA 4WBJA 4TKYA 2AHEA 4MLYA 1PKWA 4LL1B 3DKSA 1W4VA 4F0CA 2X8GA 1XWGA 1YKAA 4TN8A 4PQ1A 1C72A 4K1FA 4ILFA 3TJJA 2WRTA 4O7HA 1WJKA 1X9SB 2H6ZA 5AN1A 3FZAA 1YEPA 1U3IA 2H01A 1U87A 3GKXA 4JU5A 2YJ7A 1Z9HA 1GSDA 1SK2A 4AGSA 2FNOA 4RQRA 1EV4A 1O81A 4XHMA 4ISDA 4IS0A 1WP0A 2WGRA 4CHSA 2YJHA 1EOHA 2HRKB 1XW5A 2B7KA 2G2QA 4K0GA 2GS3A 5CP1A 3IHQA 4GSSA 1ILOA 1EEMA 1AQWA 2L6CA 2H75A 4MK3A 3GSSA 4G0IA 1A2MA 3ZL5A 4HDEA 3IK9A 3GA4A 2IWTA 3TRXA 3IR4A 3QCPA 1SL0B 1GL8A 2H66A 3I9V2 3F63A 2GQLA 5LCZA 5IM9A 2GSQA 3IOSA 3HD5A 4XCSA 3IE3A 2YANA 1S3CA 1G7EA 1OAZA 5E59A 2I3YA 3TCOA 2L4CA 2AV4A 2LRNA 3LORA 3EE2A 4V2NA 4TXOA 5F05A 4MA9A 2FWHA 1T8EB 3KMOA 5EY6A 3IXRA 5D96A 2M46A 2CVDA 1THOA 18GSA 1GUKA 3TKSC 3MAKA 3F6DA 4WF5A 2GQKA 4NMUA 3D0ZA 3ISOA 4IP6A 2H0HA 4HI7A 5ECMB 2C80A 4L0WA 2AAWA 2H72A 6GSTA 1RQMA 2HFDA 5D9WA 2HRAA 3FZ4A 1H4OA 3CXGA 2YWIA 1TJDA 2GT5A 3J7Yk 3TKPA 4JBBA 5IMZA 2YV7A 3VPTA 4CDOA 3W6GA 2HZFA 4J56E 2X8HA 5GZZB 2HSNB 2IL3A 3GH9A 4F82A 1Z6MA 2FA8A 1ZYEA 3FY7A 4XS4B 2HSHA 1M9AA 3IBHA 1TRUA 3ZZXA 5HR0A 5E4WA 2PVOC 4F2IA 4PXOA 9GSSA 4ZB8A 3F4TA 4FO5A 1X0RA 2CX4A 1BJXA 4TXVA 2HSMB 2V6KA 4GWRA 1AC1A 3MSZA 4IKHA 2K8VA 4ML6A 1XW6A 12GSA 3ZMLA 11GSA 1EEJA 1OE8A 2CZ2A 1TRWA 3GH6A 3VK9A 2OACA 1XW9A 3GL3A 2HLSA 4LMVA 1OKDA 5D93A 2WB9A 1TI1A 8GSSA 5EPFA 1R5PA 4I2UA 4XRDA 5DALA 3KZQA 2DBCA 1PRXA 5IPGA 1YY7A 3UMAA 2VAFA 4KW6A 2O87A 3TKRA 2H73A 2PU9C 1K0CA 1GTIA 1OKTA 2JSYA 3FR6A 3LXTA 2YWMA 3FEUA 1GSYA 3ERFA 4PUAA 4KX4A 2IMEA 3TRQA 1Z3EA 1BAYA 1TOFA 3LJRA 4TR1A 1SJ6A 1Q98A 4ULXA 1PL2A 2ON7A 2VCZA 2H30A 2LQOA 2ZNMA 3JCML 3I6AA 3J7Yb 1KEBA 4ZBDA 2JU5A 4OMVA 3WYWA 2VUPA 2MZCA 1I9DA 4RI6A 1TRVA 3GIXA 5COHA 4F9ZA 2K8SA 2MYGA 3L9UA 1X5DA 3HVVA 2XBQA 3HXSA 1ZOFA 1YDKA 3MDKA 1UN2A 2PN8A 2C3QA 1Y25A 1JLWA 4AJ7A 3M9JA 2PUKC 3F8UA 5B6NA 4N11A 3VI7A 2F8AA 1GNWA 3PINA 1TTZA 3DGQA 4MZBA 4F0BA 1KNGA 3NIVA 5A5KA 2DMLA 3GN3A 4YH2A 3HVSA 4ID0A 1TP9A 2GSSA 5ELGA 2GSRA 2OBKA 4LLRA 4ZBAA 1K3YA 4ECBA 3BCIA 3A2WA 5DAKB 2FA4A 2XPEA 2VCVA 4OO5A 3IPZA 3G7JA 3TJKA 3F4SA 4MZCA 1H75A 4TOPA 2K18A 4RUVA 3ME7A 1J9BA 2GDRA 2L59A 22GSA 1GTBA 5EVOA 3WT1A 5ECLB 2IMDA 2A2SA 1JFUA 4FYUA 19GSA 3PR8A 3PGTA 4LMWA 2HT9A 3KTLA 3BCKA 4HQSA 3WD6A 2G0FA 3KP8A 1PL1A 3G7IA 1GLPA 5H5RA 4PURA 4CW9A 3P7XA 2WJUA 1N8JA 3TJFA 2R3XA 4O92A 2H70A 2OADA 2GVPA 5EL8A 1K0MA 1ERVA 4PX1A 3FHKA 2ZCTA 2KP1A 4PQIA 3SBCA 4Q5QA 1NHOA 3EYTA 2K9FA 2P5QA 2IIYA 5D8IA 3PPUA 2GZPA 5HFGA 1GSFA 1VF1A 5ECOB 2CVKA 3A2XA 3GKNA 4NPBA 3UARA 2C0DA 3F3RA 2B6MA 3H93A 4J2FA 3HY2A 5AGYA 4DSSA 6GSXA 2HRNA 5H5QA 2KOKA 2RIIA 4KCEA 1GH2A 4EDZA 3VI5A 3BBYA 1FHEA 4V2LA 2R2JA 4HZ2A 4MH2A 3IC8A 3GX0A 5IIZA 3NZNA 4Q5NA 3HJOA 4POBA 4KDYA 4K7OA 2FCHA 2FD3A 2MBTA 4MJAA 5C00A 4L5LA 3FYGA 2QC7A 1FB6A 1A8YA 1V2AA 1XWBA 2JL4A 4HU9A 3O3TA 4EL1A 1XXUA 2LEGA 4OCEA 3QDNA 4G19A 3HDCA 1GSSA 4Z7XA 2ALBA 1IYHA 2QKEA 5HR2A 3RBTA 2GGTA 4L5OA 4H86A 4V1Ap 4HJ2A 5B7CA 2L6DA 5B6MA 2PMTA 1U6TA 2IPAA 3CRTA 3BD2A 3IK7A 1F6MC 2PVQA 3WGXA 4ZL8A 5DCHA 3G9BA 2YV9A 4MPFA 4PNGA 5AISA 1T1VA 3W8JA 2QSIA 4HJMA 3UL3A 4N0VA 1O8WA 3FZ9A 3M3MA 4USSA 3KJYA 3DVXA 3F4RA 4DSRA 2HI7A 3DRNA 2GQMA 1XVWA 4N0ZA 2CAQA 2DJ3A 3ZTLA 5G5EA 2I9HA 5D9XA 2AYTA 5CRGA 1SD9A 2J9HA 4D73B 3DD3A 3H79A 3D4TA 4ZB9A 4ZIJA 2B7JA 2L5OA 2YWOA 2V1MA 5IO2A 4RQXA 3L9SA 1PD21 1B48A 2LNTA 3O6TA 1N2AA 5IMVA 1VGLA 1B4QA 2MMNA 3M8NA 2YPMA 4YQVA 3KH7A 2XHFA 3UOMA 3Q18A 2H74A 4XS1A 2AJQB 3VWWA 2PWJA 2VIMA 1UVZA 2AUVA 2CZ3A 1SJZA 4RI7A 1DSBA 5D9VA 1XOAA 1PGTA 5DDLA 1FB0A 1UA5A 1AXDA 4FYCA 5ECRB 4KE3A 2C3NA 4BVYA 3N5OA 2OE0A 3FW2A 4EUYA 1QMVA 5J4UA 4ECJA 2HQTA 4OCFA 4OFNA 4HZ4A 4K9ZA 2OA7A 1CQGA 1WWJA 3IAM2 4IQ1A 1SK0A 3H4KA 1FO5A 1YEXA 4KDXA 1FOVA 2B1KA 4YAPA 3RHCA 2IMKA 3G7YA 4ZILA 5LD0A 2WZ9A 2R5GA 2DJJA 2YCDA 4XTSA 2F8FA 1QK8A 5G1KA 1NM3A 2RM6A 2IJYA 1LBKA 1U3AA 1SYXA 2F51A 1OC3A 3KMNA 3LGCA 1KTEA 2EC4A 3BOAA 2HSYA 2TIRA 2UZ8A 3LYKA 5CO3A 1T4YA 5JCWA 3Q74A 4ZXGA 3HA9A 2V32A 1EOGA 1A8LA 1SKSB 3E0UA 3LEFA 3TUEA 2DMMA 4PUFC 4TR3A 3OR5A 2P0GA 4TR0A 1HNAA 4JZQA 4MPGA 3ZLPA 3APSA 2R6KA 1X9WB 3LWAA 4FH8A 4IJ3A 1CQHA 2YZUA 4LA1A 4MJBA 5GAND 1V57A 3D5JA 5ENUA 4QL9A 1XBSA 4L8EA 1NHYA 1VF3A 1GRXA 2F9SA 2WULA 5HR3A 1TDIA 2VLVA 2O89A 4QQ7A 4O5RA 1HNBA 2CT6A 3FK8A 2DJ0A 1OC9B 1ERUA 1RK4A 2EIQA 3KEBA 3DMLA 3ED3A 2VM2A 2B3SA 3PH9A 5B8AA 1GSQA 1M9BA 1QGVA 1ZYQB 5L71A 4EKZA 5ID2A 3D22A 2VO4A 1WIKA 2H1GA 1F2EA 2BMXA 3TOTA 3ZIJA 2C0GA 1ERWA 3KCMA 5ELAA 5FHIA 5J3RA 3HKRA 5KN1A 4GF0A 2DLXA 5IMFA 5IMDA 3U6VA 4WETA 1G6WA 4BL7A 1SL1B 2LUSA 2BJXA 2I4AA 1GULA 2FUG2 1Z6NA 3FRCA 5J9CA 1J08A 2O7KA 5IPHA 3MWHA 3WGEA 1XWCA 2NBSA 2GT6A 1AQVA 5ECQB 2O8VB 4YQMA 2VL2A 2JADA 3DVWA 2N5FA 3TRPA 3ZVJA 2VCTA 3TDGA 4ECCA 6GSSA 1TRSA 3CSHA 1TW9A 4GTUA 3GTUA 3ZITA 2HXKA 3RPNA 3IV4A 3KGKA 1ML6A 4EDYA 1V40A 1M2DA 3A2VA 2HZEA 1BYEA 1VRSD 1V58A 3P8WA 3HJMA 4GLTA 3VWVA 4MF5A 3Q6OA 10GSA 5AIXA 4I6XA 3UIWA 2H0GA 1PKZA 2D2ZA 3GFKA 5IOXA 2X8CA 2RLIA 4PNFA 1PSQA 4K0NA 4HU7A 4LL4B 5J9BA 2IFQA 1LU4A 4KA0A 4GRFA 3M0FA 4BVXA 2P5RA 4MH3A 2ON5A 2NPBA 1E6BA 3WGDA 1ZMAA 4TXOB 2WS2A 3QMXA 3VURA 1J0FA 3P2AA 1MDJA 3EWLA 1EGRA 3LQ7A 1MDKA 3ZMKA 3D4MA 2C4JA 2MMAA 3L78A 4O32A 1GUMA 3H1NA 3C8EA 1BEDA 4JE1A 1B8XA 1EGOA 2OBIA 4K7IA 5F8BA 4WF4A 3GHAA 1PQNA 1ZGNA 1M99A 1AQXA 3LG6A 2R4VA 3GYKA 2VL9A 1TKDB 3RPPA 1MEKA 3ZVJD 1RW1A 4GCIA 1XZOA 2CAIA 1FAAA 1XPVA 5IMAA 2TRCP 4IQAA 2HE3A 3F0IA 2VLTA 3HCZA 1T4ZA 1A2LA 2P31A 2VCWA 5D9TA 4FYBA 2DC5A 4KSMA 3KXOA 1AUCA 4JEDA 1GWCA 1A0FA 4KF9A 2YN1A 1X9MB 4N10A 2V2GA 4E8EA 2PGTA 1OYJA 2GZZA 3TB2A 1X5CA 4NV2A 4BWSA 3TGZA 3CMIA 5A4UA 2ES7A 6GSYA 4X1UA 2X64A 4OWYA 2H0IA 3UVHA 1JHBA 3GNJA 5JCGA 4KNDA 2HRKA 2C3TA 4KGIA 4PTSA 5HFKA 1M7TA 4NWYA 5C04A 14GSA 1XOBA 2YOIA 1F37A 3WT2A 2LV3A 3APOA 2DIZA 2VD0A 3CYNA 2VCXA 5DALB 4V1Ag 1XIYA 2CV4A 17GSA 4OD7A 1BG5A
chains in the Genus database with same CATH superfamily
4OO4A 2A2RA 1WMJA 5GSSA 4X0XA 3GKMA 4OFMA 5A4WA 4KDUA 3QAWA 1M2BA 3I69A 4G2EA 1B9XC 2JSZA 3GL5A 4E8HA 2C0EA 5CRWA 1GSUA 1EZKA 4DSQA 3VPQA 3ZFLA 5CAXA 1XWAA 4TR1B 4EXJA 2WZSA 1QQ2A 1URMA 2FWFA 1FVKA 3EMPA 4WKWA 3L9VA 1WOUA 1Z7RA 3MYDA 1PX6A 1HD2A 3FZ5A 5D73A 1GP1A 2DKIA 2WFCA 3GX8A 4ICYA 4NHZA 5HR1A 4TR4A 1YKCA 3ERGA 2VL3A 1PA3A 4DVCA 1MDIA 1PFOA 4AI6A 2H76A 5KOWA 5G1LA 2JZTA 2DJKA 4YKGA 1O85A 4XRAA 1HQOA 2LJAA 2C1YA 1DE2A 2DIYA 4XIHA 1S3RA 3BJ5A 4MJCA 2L4QA 3DYRA 2M80A 3UAPA 2N5AA 4ZBBA 2PPTA 2LTKA 2HNLA 1HNCA 1TI3A 4OFTA 1F3AA 4G10A 4JRRA 2NDOA 4WR4A 5DQSA 1TXUA 5J5NA 2DJ1A 3QFBC 3RFRC 1JLVA 2X99A 2DSAA 2JACA 5KN3A 1PMTA 2FWGA 4G0LA 4WEYA 3U5RE 1E2YA 1Z5YE 2HSNA 5CRHA 3KIJA 1I5GA 2YZHA 3MNGA 1JZDA 1TK5B 1MD4A 5G5FA 4IJIA 4XS4A 3E9JB 2B5YA 4MP4A 2TRXA 2R37A 2C0FA 4WR5A 5DCGA 3GV1A 5ECSA 3LYPA 1WRYA 2H19A 1THXA 4YQUA 2E2MA 4P3YB 3IAS2 2HSMA 4PQHA 3CTFA 1U88A 3QOUA 3UEMA 4IHUA 2R0PA 4TW5A 4ZL7A 2WCIA 2MBSA 4G0KA 4GSNA 3TKSA 3F3QA 4EF0A 2VLUA 5JWQB 4MF6A 1GTAA 3APQA 2PBJA 5A34A 13GSA 2CVBA 2IN3A 4F03A 1BQ7A 1AIUA 1MD3A 5KN0A 1SL2B 5ECPB 2LS5A 4MABA 5ECKB 4TRXA 2GTUA 4BPYA 1V9WA 3ZFBA 3IC4A 3VLNA 5F0GA 1R4WA 3GMFA 2M72A 4YAVA 2E7PA 2OE3A 1SK1A 2XBIA 5HFIA 4I97A 1A23A 1EP8A 1LJRA 3HJPA 3KM6A 2EIOA 2B5EA 5A4VA 3CRUA 4PI2C 2E0QA 4HUAA 1GTUA 3Q19A 2FLSA 1ZYNA 3C71A 4MZWA 2CX3A 3HZ4A 1F3BA 4IW9A 3UBLA 1XWKA 1B9YC 4AJ6A 4NXIA 4HS1A 4Q5RA 3L0HA 1AW9A 1EV9A 4DSSB 2H6YA 3FR9A 3NOFA 3C7MA 5FT3A 3EU3A 2GLRA 2B1LA 4FIWA 3GUSA 4MDCA 2H1DA 1XCCA 4PI0C 3LSZA 1QUWA 4PGTA 2XC2A 3D21A 2MMZA 1SJIA 1WE0A 1GUHA 4POLA 2FWEA 4GQCA 3EMXA 5KN2A 3F9UA 2WDUA 1IYIA 3ZRDA 1SD8A 2JZRA 3FKFA 3GSTA 2F3MA 1A2JA 2YNXA 1DBYA 4K2DA 1JZWA 4MJEA 4L0UA 4EE0A 4J57E 4K2XA 2N5BA 1EWXA 1K0OA 3M1GA 3RAZA 3DXBA 2PERA 3CBUA 4A5PA 1O73A 4MCUA 2Z9SA 1OVNA 1FW1A 2DJ2A 3CWGA 1YF1A 1F9MA 1KBNA 2NTOA 3QPMA 1ABAA 4BIKA 3EU4A 1EP7A 3TKQA 3DIEA 3C1RA 1AAZA 5F07A 4K6XA 5DAKA 4POMA 4G9HA 3HVNA 5DJLA 1ACVA 3RHBA 4IGJA 2VCQA 2I1UA 2OKAA 3CTGA 3C1SA 4ML1A 1M3IA 5JWOB 5ECNB 2KLXA 3GURA 3E3EA 5B8BA 4BA7A 3V1WA 4Q5FA 1G7OA 1NW2A 3HVXA 2LSTA 3O76A 4AKHA 4KUNA 5A5HA 1HYUA 3VFIA 5HQPA 6GSWA 5G2ZA 1JZRA 4GXZA 1A0RP 4I5QA 1YQ1A 1FG4A 2LRTA 4EIPA 1TK8B 4GSTA 3US3A 3QAVA 3D6IA 3HHVA 2H71A 3FR3A 2AB6A 5CYYA 5G30A 1VF4A 5AIVA 3GKKA 1GSEA 2WW1A 2A4HA 3TKSE 1X5EA 4BVYB 3UBKA 5G31A 5DQYA 5JCUA 2FHEA 1K3OA 2VOCA 5IQYA 2REMA 4AF2A 1T7PB 5F06A 2V41A 4ZL9A 3QAGA 3EVIA 3I43A 3IHGA 4V2MA 3M9KA 3DWVA 2CA8A 4WXTA 3L4NA 1O6JA 4AJ8A 3SWLA 3N9JA 4IVFA 5INYA 1M2AA 1FVJA 1YZXA 1SYRA 3QR6A 3EPTA 4NAXA 1SVOA 3S9FA 3KH9A 1SVMA 1R5AA 4KH7A 3R3EA 2B5XA 2MMOA 2NVLA 1G0TA 2JZSA 4K8MA 1GNEA 2BTOT 1TXXA 3ZYWA 1BX9A 2E2GA 1V98A 2LNSA 4NV5A 3ZIVA 4HEA2 1K0BA 5KOXA 3LXZA 4ZB6A 5CNWA 1OE7A 3ZREA 1S3AA 4HQZA 1UC7A 2OE1A 2VL2C 1Q4JA 2HRFA 2OJLA 2KP2A 1YVLA 2L5LA 4KB3A 3KP9A 4MMMA 2KUCA 1TU8A 3CSIA 2VD1A 3HYPA 2H1BA 2O85A 2DKHA 5DJMA 4IP1A 4WBRD 3W8SA 2YWNA 3ME8A 1S3DA 4K7NA 1MTCA 3VWXA 1SENA 2EIRA 3HZ8A 4AKXB 2WVXB 6GSUA 3F6FA 3VWUA 1K0NA 1ZYPA 4KCAA 3AY8A 3H8QA 3LFLA 1VF2A 3RDWA 5ID2B 2K6VA 3IDVA 2V6OA 4EC0A 4EIQA 2YP6A 2LRCA 4D73A 3KD0A 3UVTA 2GZYA 1I1IP 1K0AA 3QD9A 3LW9A 1T00A 1ST9A 4BL7B 4BWQA 1ZZYA 5BMUA 4IN0A 1W89A 1ERTA 5LNKe 2LQQA 4TVEA 1K0DA 2H1AA 4EO3A 5JWRB 1A24A 2LJRA 3A5IA 1O7UA 5ECHB 1ZCPA 1M0UA 4X43A 2A4VA 1Z7PA 2XPDA 3TJGA 2J23A 1R26A 4XS6A 2WW0A 4ECIA 2I81A 5KEJA 4POKA 2RM5A 5DBQA 5CRDA 2C8UA 2QGVA 2L57A 20GSA 5DVBA 3GTUB 4JR4A 4X4JA 3IA1A 1OC8A 1K3LA 5J41A 1PN9A 3QFAC 2FGXA 1B4PA 1NSWA 2VM1A 1SKRB 4E68A 2HZEB 5IO0A 3DEXA 5H5SA 4GQFA 5CREA 1DUGA 2A2PA 1Y6EA 4FQUA 1WPIA 3EINA 1R7HA 2CQ9A 3EURA 2H8LA 1YF0A 3A3TA 1G6YA 1ZL9A 2IFQB 5ABRA 4AKGA 4BVXB 3K8NA 5IOWA 2IMIA 1DE1A 5FWGA 2ZUPA 3KTBA 2LJKA 4KSOA 1O8XA 4I8BA 3UJ1A 1TU7A 1XVQA 4I2TA 1ON4A 1XFLA 5GAPD 4HOJA 1QFNA 1PX7A 16GSA 2KHPA 3TJBA 1SKWB 1USBA 4IBPA 6GSVA 4N30A 2H6XA 2EFEA 5GSTA 2RUEA 3A5WA 2IMFA 4JR6A 4KAEA 1SU9A 3CSJA 1TK0B 4IELA 3TOUA 3ERWA 3EC3A 7GSSA 3IRAA 1QXHA 2HYXA 3C73A 1GLQA 4O5UA 4ACSA 1T3BA 5ECIB 2O3EA 2LKUA 2RUFA 3R2QA 1JZOA 5IMCA 4DEJA 3P90A 4QL7A 3GRXA 4EVMA 4MF7A 1YJ6A 2GSTA 2FY6A 1OC9A 4NHWA 4WBJA 4TKYA 2AHEA 4MLYA 1PKWA 4LL1B 3DKSA 1W4VA 4F0CA 2X8GA 1XWGA 1YKAA 4TN8A 4PQ1A 1C72A 4K1FA 4ILFA 3TJJA 2WRTA 4O7HA 1WJKA 1X9SB 2H6ZA 5AN1A 3FZAA 1YEPA 1U3IA 2H01A 1U87A 3GKXA 4JU5A 2YJ7A 1Z9HA 1GSDA 1SK2A 4AGSA 1FOHA 2FNOA 4RQRA 1EV4A 1O81A 4XHMA 4ISDA 4IS0A 1WP0A 2WGRA 4CHSA 4GDFA 2YJHA 5A1NA 4ZB7A 1EOHA 2HRKB 1XW5A 2B7KA 4W66A 2G2QA 4K0GA 2GS3A 5CP1A 3IHQA 4GSSA 1ILOA 1EEMA 1AQWA 2L6CA 2H75A 4MK3A 2O5VA 3GSSA 4G0IA 2EFDA 1A2MA 3ZL5A 4HDEA 3IK9A 3GA4A 2IWTA 3TRXA 3IR4A 3QCPA 1SL0B 1GL8A 2H66A 3I9V2 3F63A 2GQLA 5LCZA 5IM9A 4MNNA 2GSQA 3IOSA 3HD5A 4XCSA 3IE3A 2YANA 4AKIA 1S3CA 1G7EA 1OAZA 5E59A 2I3YA 3CQFA 3TCOA 2L4CA 2AV4A 2LRNA 3LORA 3EE2A 4V2NA 4TXOA 5F05A 4MA9A 2FWHA 1T8EB 3KMOA 5EY6A 3IXRA 5D96A 2M46A 2CVDA 1THOA 18GSA 1GUKA 3TKSC 3MAKA 2X49A 3F6DA 4WF5A 2GQKA 4NMUA 3D0ZA 3ISOA 4IP6A 2H0HA 4HI7A 5ECMB 2C80A 4L0WA 2AAWA 2H72A 4Z2UA 6GSTA 1RQMA 2HFDA 5D9WA 2HRAA 3FZ4A 1H4OA 3CXGA 2YWIA 1TJDA 2GT5A 3J7Yk 3TKPA 4JBBA 5IMZA 2YV7A 3VPTA 1BF5A 4CDOA 3W6GA 2HZFA 4J56E 2X8HA 5GZZB 2HSNB 2IL3A 3GH9A 4F82A 1Z6MA 2FA8A 1ZYEA 3FY7A 4XS4B 2HSHA 1M9AA 3IBHA 1TRUA 3ZZXA 5HR0A 5E4WA 2PVOC 4F2IA 4PXOA 9GSSA 4ZB8A 3F4TA 4FO5A 1X0RA 2CX4A 1BJXA 4TXVA 2HSMB 2V6KA 4GWRA 1AC1A 3MSZA 4IKHA 5J4VA 2K8VA 4ML6A 1XW6A 12GSA 3RGBC 3ZMLA 2H1LA 11GSA 1EEJA 1OE8A 5A34B 2CZ2A 1TRWA 3GH6A 3VK9A 2OACA 1XW9A 3GL3A 2HLSA 4LMVA 4O5QA 1OKDA 5D93A 2WB9A 1TI1A 8GSSA 5EPFA 1R5PA 4I2UA 4XRDA 5DALA 3KZQA 2DBCA 1PRXA 5IPGA 1YY7A 3UMAA 2VAFA 4KW6A 2O87A 3TKRA 2H73A 2PU9C 1K0CA 1GTIA 1OKTA 2JSYA 3FR6A 3LXTA 2YWMA 3FEUA 1GSYA 3ERFA 4PUAA 4KX4A 2IMEA 3TRQA 1Z3EA 1BAYA 1TOFA 3LJRA 4TR1A 1SJ6A 1Q98A 4ULXA 1PL2A 2ON7A 2LQOA 2VCZA 2H30A 2ZNMA 3JCML 3I6AA 3J7Yb 1KEBA 4ZBDA 2JU5A 4OMVA 3WYWA 2VUPA 1M3JA 2MZCA 1I9DA 4RI6A 1TRVA 3GIXA 5COHA 4F9ZA 2K8SA 2MYGA 3L9UA 1X5DA 3HVVA 2XBQA 3HXSA 1ZOFA 1YDKA 3MDKA 1UN2A 2PN8A 2C3QA 1PN0A 1Y25A 1JLWA 4AJ7A 3M9JA 4N3ZA 2PUKC 3F8UA 5B6NA 4N11A 3VI7A 2F8AA 1GNWA 3PINA 1TTZA 3DGQA 4MZBA 4F0BA 1KNGA 3NIVA 5A5KA 2DMLA 3GN3A 4YH2A 3HVSA 4ID0A 1TP9A 2GSSA 5J4YA 5ELGA 2GSRA 2EFCA 2OBKA 4LLRA 4ZBAA 1K3YA 4ECBA 3BCIA 3A2WA 5DAKB 2FA4A 2XPEA 2VCVA 4OO5A 3IPZA 3G7JA 3TJKA 3F4SA 4MZCA 1H75A 4TOPA 2K18A 4RUVA 3ME7A 1J9BA 2GDRA 2L59A 5J47A 22GSA 1GTBA 5EVOA 3WT1A 5ECLB 2IMDA 2A2SA 1JFUA 4FYUA 19GSA 3PR8A 3PGTA 4LMWA 2HT9A 3KTLA 3BCKA 4HQSA 3WD6A 2G0FA 3KP8A 1PL1A 3G7IA 1GLPA 5H5RA 4PURA 5A5HB 4CW9A 3P7XA 2WJUA 1N8JA 3TJFA 2R3XA 4O92A 2H70A 2OADA 2GVPA 5EL8A 1K0MA 1ERVA 4PX1A 3FHKA 2VKZG 2ZCTA 2QA1A 2KP1A 4PQIA 3SBCA 4Q5QA 1NHOA 4QMKA 3EYTA 2K9FA 2P5QA 2IIYA 5D8IA 3PPUA 2GZPA 5HFGA 1GSFA 1VF1A 5ECOB 2CVKA 3A2XA 3GKNA 4NPBA 3UARA 2C0DA 3F3RA 2B6MA 3H93A 4J2FA 3HY2A 5AGYA 4DSSA 6GSXA 2HRNA 5H5QA 2KOKA 2RIIA 4KCEA 1GH2A 4EDZA 3VI5A 3BBYA 1FHEA 4V2LA 2R2JA 4HZ2A 4MH2A 3IC8A 3GX0A 5IIZA 3NZNA 4Q5NA 3HJOA 4POBA 4KDYA 4K7OA 2FCHA 2FD3A 2MBTA 5BRTA 4MJAA 5C00A 4L5LA 3FYGA 2QC7A 1FB6A 1A8YA 1V2AA 1YEWC 1XWBA 2JL4A 4HU9A 3O3TA 4EL1A 2R0CA 1XXUA 2LEGA 4OCEA 3QDNA 3TU3B 4G19A 3HDCA 1GSSA 4Z7XA 4Z2TA 2ALBA 1IYHA 2QKEA 5HR2A 4CY8A 3RBTA 2GGTA 4L5OA 4H86A 4V1Ap 4HJ2A 5B7CA 2L6DA 5B6MA 2PMTA 1U6TA 2IPAA 3CRTA 3BD2A 3IK7A 2QA2A 1F6MC 2PVQA 3WGXA 4ZL8A 5DCHA 3G9BA 4CY6A 2YV9A 4MPFA 4PNGA 5AISA 1T1VA 3W8JA 2QSIA 4HJMA 3UL3A 4N0VA 1O8WA 3FZ9A 3M3MA 4USSA 3KJYA 3DVXA 3F4RA 4DSRA 2HI7A 3DRNA 2GQMA 1XVWA 4N0ZA 2CAQA 2DJ3A 3ZTLA 5G5EA 2I9HA 5D9XA 2AYTA 5CRGA 1SD9A 2J9HA 4D73B 3DD3A 3H79A 3D4TA 4ZB9A 4ZIJA 2B7JA 2L5OA 2YWOA 2V1MA 5IO2A 4RQXA 3L9SA 1PD21 1B48A 2LNTA 5BMUB 3O6TA 1N2AA 5IMVA 1VGLA 1B4QA 2MMNA 3M8NA 1BG1A 2YPMA 4YQVA 3KH7A 2XHFA 3UOMA 3Q18A 2H74A 4XS1A 2AJQB 3VWWA 2PWJA 2VIMA 1UVZA 2AUVA 2CZ3A 1SJZA 2OT3A 4RI7A 1DSBA 5D9VA 2X4AA 1XOAA 1PGTA 5DDLA 1FB0A 1UA5A 1AXDA 4FYCA 5ECRB 4KE3A 2C3NA 4BVYA 3FMWA 3N5OA 2OE0A 3FW2A 4EUYA 1QMVA 5J4UA 4ECJA 2HQTA 4G01A 4OCFA 4OFNA 4K5SA 4HZ4A 4K9ZA 2OA7A 1CQGA 1WWJA 3IAM2 4IQ1A 1SK0A 3H4KA 1FO5A 1YEXA 4KDXA 1FOVA 2B1KA 4YAPA 3RHCA 2IMKA 3G7YA 4ZILA 5LD0A 2WZ9A 2R5GA 2DJJA 2YCDA 4XTSA 1SVLA 2F8FA 1QK8A 5G1KA 1NM3A 2RM6A 2IJYA 1LBKA 1U3AA 1SYXA 2F51A 1OC3A 3KMNA 3LGCA 1KTEA 4HSCX 2EC4A 3BOAA 2HSYA 2TIRA 2UZ8A 3LYKA 5CO3A 1T4YA 1N25A 5JCWA 3Q74A 4ZXGA 3HA9A 2V32A 1EOGA 1A8LA 1SKSB 3E0UA 3LEFA 3TUEA 2DMMA 4PUFC 4TR3A 3OR5A 2P0GA 4TR0A 1HNAA 4JZQA 3CHXC 4MPGA 3ZLPA 3APSA 2R6KA 1X9WB 3LWAA 4FH8A 4IJ3A 1CQHA 2YZUA 4LA1A 4MJBA 5GAND 1V57A 3D5JA 5ENUA 4QL9A 1XBSA 4L8EA 1NHYA 1VF3A 1GRXA 2F9SA 2WULA 5HR3A 1TDIA 2VLVA 2O89A 4QQ7A 4O5RA 1HNBA 2CT6A 3FK8A 2DJ0A 2WVXA 1OC9B 1ERUA 1RK4A 2EIQA 3KEBA 3DMLA 3ED3A 2VM2A 2B3SA 3PH9A 5B8AA 1GSQA 1M9BA 1QGVA 1ZYQB 5L71A 4EKZA 5ID2A 3D22A 2VO4A 1WIKA 2H1GA 1F2EA 2BMXA 3TOTA 3ZIJA 2C0GA 1ERWA 2O36A 3KCMA 5ELAA 5FHIA 5J3RA 3HKRA 5KN1A 4GF0A 2DLXA 5IMFA 5IMDA 3U6VA 2R0GA 4WETA 1G6WA 4BL7A 1SL1B 2LUSA 2BJXA 2I4AA 1GULA 5J40A 2FUG2 1Z6NA 3FRCA 5J9CA 1J08A 2O7KA 5IPHA 3MWHA 3WGEA 1XWCA 2NBSA 5A1NB 1AQVA 2GT6A 5ECQB 2O8VB 4YQMA 2VL2A 2JADA 3DVWA 2N5FA 3TRPA 3ZVJA 2VCTA 3TDGA 4ECCA 1S4BP 6GSSA 1TRSA 3CSHA 1TW9A 4GTUA 3GTUA 3ZITA 2HXKA 3RPNA 3IV4A 3KGKA 1ML6A 4EDYA 1V40A 1M2DA 3A2VA 2HZEA 1BYEA 1VRSD 1V58A 3P8WA 3HJMA 4GLTA 3VWVA 4MF5A 2WVZA 3Q6OA 10GSA 5AIXA 4I6XA 3UIWA 2H0GA 1PKZA 2D2ZA 3GFKA 5IOXA 2X8CA 2RLIA 2WW3A 4PNFA 1PSQA 4K0NA 4FXYP 4HU7A 4LL4B 5J9BA 3HMJG 2IFQA 1LU4A 4KA0A 4GRFA 3M0FA 4BVXA 2P5RA 4MH3A 2ON5A 2NPBA 1E6BA 3WGDA 1ZMAA 4TXOB 2WS2A 3QMXA 3VURA 1J0FA 3P2AA 4Z2RA 1MDJA 3EWLA 1EGRA 3LQ7A 1MDKA 3ZMKA 3D4MA 2C4JA 2MMAA 3L78A 4O32A 4YKFA 1GUMA 3H1NA 3C8EA 1BEDA 4JE1A 1B8XA 1EGOA 2OBIA 4K7IA 5F8BA 4WF4A 3GHAA 1PQNA 1ZGNA 1M99A 2WVYA 1AQXA 3LG6A 2R4VA 3GYKA 2VL9A 4PHZC 1TKDB 3RPPA 1MEKA 3ZVJD 1RW1A 4GCIA 1XZOA 2CAIA 1FAAA 1XPVA 5IMAA 2TRCP 4IQAA 2HE3A 3F0IA 2VLTA 3HCZA 1T4ZA 1A2LA 1Y1UA 2P31A 2VCWA 5D9TA 4FYBA 2DC5A 4KSMA 3KXOA 1AUCA 4JEDA 1GWCA 1A0FA 4KF9A 2YN1A 1X9MB 4N10A 2V2GA 4E8EA 2PGTA 1OYJA 2GZZA 3TB2A 1X5CA 4NV2A 4BWSA 3TGZA 3CMIA 5A4UA 4K5RA 2ES7A 6GSYA 4X1UA 2X64A 4OWYA 2H0IA 3UVHA 2UV8G 1JHBA 2EFHA 3GNJA 5JCGA 4KNDA 2HRKA 2C3TA 3MIXA 4KGIA 4PTSA 5HFKA 1M7TA 4NWYA 5C04A 14GSA 1XG8A 1XOBA 2YOIA 2WW2A 1F37A 3WT2A 2LV3A 3APOA 2DIZA 2VD0A 3CYNA 2VCXA 5DALB 4V1Ag 1XIYA 2CV4A 17GSA 4OD7A 1BG5A
chains in the Genus database with same CATH topology
4OO4A 2A2RA 1WMJA 5GSSA 4X0XA 3GKMA 4OFMA 5A4WA 4KDUA 3QAWA 1M2BA 3I69A 4G2EA 1B9XC 2JSZA 3GL5A 4E8HA 2C0EA 5CRWA 1GSUA 1EZKA 4DSQA 3VPQA 3ZFLA 5CAXA 1XWAA 4TR1B 4EXJA 1QQ2A 1URMA 2FWFA 1FVKA 3EMPA 4WKWA 3L9VA 1WOUA 1Z7RA 3MYDA 1PX6A 1HD2A 3FZ5A 5D73A 1GP1A 2DKIA 2WFCA 3GX8A 4ICYA 4NHZA 5HR1A 4TR4A 1YKCA 3ERGA 2VL3A 1PA3A 4DVCA 1MDIA 4AI6A 2H76A 5KOWA 5G1LA 2JZTA 2DJKA 4YKGA 1O85A 4XRAA 1HQOA 2LJAA 2C1YA 1DE2A 2DIYA 4XIHA 3BJ5A 4MJCA 2L4QA 3DYRA 2M80A 3UAPA 2N5AA 4ZBBA 2PPTA 2LTKA 2HNLA 1HNCA 1TI3A 4OFTA 1F3AA 4G10A 4JRRA 2NDOA 4WR4A 5DQSA 1TXUA 5J5NA 2DJ1A 3QFBC 1JLVA 2X99A 2DSAA 2JACA 5KN3A 1PMTA 2FWGA 4G0LA 4WEYA 3U5RE 1E2YA 1Z5YE 2HSNA 5CRHA 3KIJA 1I5GA 2YZHA 3MNGA 1JZDA 1TK5B 1MD4A 5G5FA 4IJIA 4XS4A 3E9JB 2B5YA 4MP4A 2TRXA 2R37A 2C0FA 4WR5A 5DCGA 3GV1A 5ECSA 3LYPA 1WRYA 2H19A 1THXA 4YQUA 2E2MA 4P3YB 3IAS2 2HSMA 4PQHA 3CTFA 1U88A 3QOUA 3UEMA 4IHUA 2R0PA 4TW5A 4ZL7A 2WCIA 2MBSA 4G0KA 4GSNA 3TKSA 3F3QA 4EF0A 2VLUA 5JWQB 4MF6A 1GTAA 3APQA 2PBJA 5A34A 13GSA 2CVBA 2IN3A 4F03A 1BQ7A 1AIUA 1MD3A 5KN0A 1SL2B 5ECPB 2LS5A 4MABA 5ECKB 4TRXA 2GTUA 4BPYA 1V9WA 3ZFBA 3IC4A 3VLNA 5F0GA 1R4WA 3GMFA 2M72A 4YAVA 2E7PA 2OE3A 1SK1A 2XBIA 5HFIA 4I97A 1A23A 1EP8A 1LJRA 3HJPA 3KM6A 2EIOA 2B5EA 5A4VA 3CRUA 2E0QA 4HUAA 1GTUA 3Q19A 2FLSA 1ZYNA 3C71A 4MZWA 2CX3A 3HZ4A 1F3BA 4IW9A 3UBLA 1XWKA 1B9YC 4AJ6A 4NXIA 4HS1A 4Q5RA 3L0HA 1AW9A 1EV9A 4DSSB 2H6YA 3FR9A 3NOFA 3C7MA 5FT3A 3EU3A 2GLRA 2B1LA 4FIWA 3GUSA 4MDCA 2H1DA 1XCCA 3LSZA 1QUWA 4PGTA 2XC2A 3D21A 2MMZA 1SJIA 1WE0A 1GUHA 4POLA 2FWEA 4GQCA 3EMXA 5KN2A 3F9UA 2WDUA 1IYIA 3ZRDA 1SD8A 2JZRA 3FKFA 3GSTA 2F3MA 1A2JA 2YNXA 1DBYA 4K2DA 1JZWA 4MJEA 4L0UA 4EE0A 4J57E 4K2XA 2N5BA 1EWXA 1K0OA 3M1GA 3RAZA 3DXBA 2PERA 3CBUA 4A5PA 1O73A 4MCUA 2Z9SA 1OVNA 1FW1A 2DJ2A 3CWGA 1YF1A 1F9MA 1KBNA 2NTOA 3QPMA 1ABAA 3EU4A 1EP7A 3TKQA 3DIEA 3C1RA 1AAZA 5F07A 4K6XA 5DAKA 4POMA 4G9HA 5DJLA 1ACVA 3RHBA 4IGJA 2VCQA 2I1UA 2OKAA 3CTGA 3C1SA 4ML1A 5JWOB 5ECNB 2KLXA 3GURA 3E3EA 5B8BA 4BA7A 3V1WA 4Q5FA 1G7OA 1NW2A 3HVXA 2LSTA 3O76A 4AKHA 4KUNA 5A5HA 1HYUA 3VFIA 5HQPA 6GSWA 5G2ZA 1JZRA 4GXZA 1A0RP 4I5QA 1YQ1A 1FG4A 2LRTA 4EIPA 1TK8B 4GSTA 3US3A 3QAVA 3D6IA 3HHVA 2H71A 3FR3A 2AB6A 5CYYA 5G30A 1VF4A 5AIVA 3GKKA 1GSEA 2A4HA 3TKSE 1X5EA 4BVYB 3UBKA 5G31A 5DQYA 5JCUA 2FHEA 1K3OA 2VOCA 5IQYA 2REMA 4AF2A 1T7PB 5F06A 2V41A 4ZL9A 3QAGA 3EVIA 3I43A 3IHGA 4V2MA 3M9KA 3DWVA 2CA8A 4WXTA 3L4NA 1O6JA 4AJ8A 3SWLA 3N9JA 4IVFA 5INYA 1M2AA 1FVJA 1YZXA 1SYRA 3QR6A 3EPTA 4NAXA 1SVOA 3S9FA 3KH9A 1SVMA 1R5AA 4KH7A 3R3EA 2B5XA 2MMOA 2NVLA 1G0TA 2JZSA 4K8MA 1GNEA 2BTOT 1TXXA 3ZYWA 1BX9A 2E2GA 1V98A 2LNSA 4NV5A 3ZIVA 4HEA2 1K0BA 5KOXA 3LXZA 4ZB6A 5CNWA 1OE7A 3ZREA 1S3AA 4HQZA 1UC7A 2OE1A 2VL2C 1Q4JA 2HRFA 2OJLA 2KP2A 1YVLA 2L5LA 4KB3A 3KP9A 4MMMA 2KUCA 1TU8A 3CSIA 2VD1A 3HYPA 2H1BA 2O85A 2DKHA 5DJMA 4IP1A 4WBRD 3W8SA 2YWNA 3ME8A 1S3DA 4K7NA 1MTCA 3VWXA 1SENA 2EIRA 3HZ8A 4AKXB 6GSUA 3F6FA 3VWUA 1K0NA 1ZYPA 4KCAA 3AY8A 3H8QA 3LFLA 1VF2A 3RDWA 5ID2B 2K6VA 3IDVA 2V6OA 4EC0A 4EIQA 2YP6A 2LRCA 4D73A 3KD0A 3UVTA 2GZYA 1K0AA 3QD9A 3LW9A 1T00A 1ST9A 4BL7B 4BWQA 1ZZYA 5BMUA 4IN0A 1W89A 1ERTA 5LNKe 2LQQA 4TVEA 1K0DA 2H1AA 4EO3A 5JWRB 1A24A 2LJRA 3A5IA 1O7UA 5ECHB 1ZCPA 1M0UA 4X43A 2A4VA 1Z7PA 2XPDA 3TJGA 2J23A 1R26A 4XS6A 4ECIA 2I81A 5KEJA 4POKA 2RM5A 5DBQA 5CRDA 2C8UA 2QGVA 2L57A 20GSA 5DVBA 3GTUB 4JR4A 4X4JA 3IA1A 1OC8A 1K3LA 5J41A 1PN9A 3QFAC 2FGXA 1B4PA 1NSWA 2VM1A 1SKRB 4E68A 2HZEB 5IO0A 3DEXA 5H5SA 4GQFA 5CREA 1DUGA 2A2PA 1Y6EA 4FQUA 1WPIA 3EINA 1R7HA 2CQ9A 3EURA 2H8LA 1YF0A 3A3TA 1G6YA 1ZL9A 2IFQB 5ABRA 4AKGA 4BVXB 3K8NA 5IOWA 2IMIA 1DE1A 5FWGA 2ZUPA 3KTBA 2LJKA 4KSOA 1O8XA 4I8BA 3UJ1A 1TU7A 1XVQA 4I2TA 1ON4A 1XFLA 5GAPD 4HOJA 1QFNA 1PX7A 16GSA 2KHPA 3TJBA 1SKWB 1USBA 4IBPA 6GSVA 4N30A 2H6XA 2EFEA 5GSTA 2RUEA 3A5WA 2IMFA 4JR6A 4KAEA 1SU9A 3CSJA 1TK0B 4IELA 3TOUA 3ERWA 3EC3A 7GSSA 3IRAA 1QXHA 2HYXA 3C73A 1GLQA 4O5UA 4ACSA 1T3BA 5ECIB 2LKUA 2RUFA 3R2QA 1JZOA 5IMCA 4DEJA 3P90A 4QL7A 3GRXA 4EVMA 4MF7A 1YJ6A 2GSTA 2FY6A 1OC9A 4NHWA 4WBJA 4TKYA 2AHEA 4MLYA 1PKWA 4LL1B 3DKSA 1W4VA 4F0CA 2X8GA 1XWGA 1YKAA 4TN8A 4PQ1A 1C72A 4K1FA 4ILFA 3TJJA 2WRTA 4O7HA 1WJKA 1X9SB 2H6ZA 5AN1A 3FZAA 1YEPA 1U3IA 2H01A 1U87A 3GKXA 4JU5A 2YJ7A 1Z9HA 1GSDA 1SK2A 4AGSA 1FOHA 2FNOA 4RQRA 1EV4A 1O81A 4XHMA 4ISDA 4IS0A 1WP0A 2WGRA 4CHSA 4GDFA 2YJHA 5A1NA 4ZB7A 1EOHA 2HRKB 1XW5A 2B7KA 4W66A 2G2QA 4K0GA 2GS3A 5CP1A 3IHQA 4GSSA 1ILOA 1EEMA 1AQWA 2L6CA 2H75A 4MK3A 2O5VA 3GSSA 4G0IA 2EFDA 1A2MA 3ZL5A 4HDEA 3IK9A 3GA4A 2IWTA 3TRXA 3IR4A 3QCPA 1SL0B 1GL8A 2H66A 3I9V2 3F63A 2GQLA 5LCZA 5IM9A 4MNNA 2GSQA 3IOSA 3HD5A 4XCSA 3IE3A 2YANA 4AKIA 1S3CA 1G7EA 1OAZA 5E59A 2I3YA 3TCOA 2L4CA 2AV4A 2LRNA 3LORA 3EE2A 4V2NA 4TXOA 5F05A 4MA9A 2FWHA 1T8EB 3KMOA 5EY6A 3IXRA 5D96A 2M46A 2CVDA 1THOA 18GSA 1GUKA 3TKSC 3MAKA 2X49A 3F6DA 4WF5A 2GQKA 4NMUA 3D0ZA 3ISOA 4IP6A 2H0HA 4HI7A 5ECMB 2C80A 4L0WA 2AAWA 2H72A 4Z2UA 6GSTA 1RQMA 2HFDA 5D9WA 2HRAA 3FZ4A 1H4OA 3CXGA 2YWIA 1TJDA 2GT5A 3J7Yk 3TKPA 4JBBA 5IMZA 2YV7A 3VPTA 1BF5A 4CDOA 3W6GA 2HZFA 4J56E 2X8HA 5GZZB 2HSNB 2IL3A 3GH9A 4F82A 1Z6MA 2FA8A 1ZYEA 3FY7A 4XS4B 2HSHA 1M9AA 3IBHA 1TRUA 3ZZXA 5HR0A 5E4WA 2PVOC 4F2IA 4PXOA 9GSSA 4ZB8A 3F4TA 4FO5A 1X0RA 2CX4A 1BJXA 4TXVA 2HSMB 2V6KA 4GWRA 1AC1A 3MSZA 4IKHA 5J4VA 2K8VA 4ML6A 1XW6A 12GSA 3ZMLA 2H1LA 11GSA 1EEJA 1OE8A 5A34B 2CZ2A 1TRWA 3GH6A 3VK9A 2OACA 1XW9A 3GL3A 2HLSA 4LMVA 4O5QA 1OKDA 5D93A 2WB9A 1TI1A 8GSSA 5EPFA 1R5PA 4I2UA 4XRDA 5DALA 3KZQA 2DBCA 1PRXA 5IPGA 1YY7A 3UMAA 2VAFA 4KW6A 2O87A 3TKRA 2H73A 2PU9C 1K0CA 1GTIA 1OKTA 2JSYA 3FR6A 3LXTA 2YWMA 3FEUA 1GSYA 3ERFA 4PUAA 4KX4A 2IMEA 3TRQA 1Z3EA 1BAYA 1TOFA 3LJRA 4TR1A 1SJ6A 1Q98A 4ULXA 1PL2A 2ON7A 2VCZA 2H30A 2LQOA 2ZNMA 3JCML 3I6AA 3J7Yb 1KEBA 4ZBDA 2JU5A 4OMVA 3WYWA 2VUPA 2MZCA 1I9DA 4RI6A 1TRVA 3GIXA 5COHA 4F9ZA 2K8SA 2MYGA 3L9UA 1X5DA 3HVVA 2XBQA 3HXSA 1ZOFA 1YDKA 3MDKA 1UN2A 2PN8A 2C3QA 1PN0A 1Y25A 1JLWA 4AJ7A 3M9JA 4N3ZA 2PUKC 3F8UA 5B6NA 4N11A 3VI7A 2F8AA 1GNWA 3PINA 1TTZA 3DGQA 4MZBA 4F0BA 1KNGA 3NIVA 5A5KA 2DMLA 3GN3A 4YH2A 3HVSA 4ID0A 1TP9A 2GSSA 5J4YA 5ELGA 2GSRA 2EFCA 2OBKA 4LLRA 4ZBAA 1K3YA 4ECBA 3BCIA 3A2WA 5DAKB 2FA4A 2XPEA 2VCVA 4OO5A 3IPZA 3G7JA 3TJKA 3F4SA 4MZCA 1H75A 4TOPA 2K18A 4RUVA 3ME7A 1J9BA 2GDRA 2L59A 5J47A 22GSA 1GTBA 5EVOA 3WT1A 5ECLB 2IMDA 2A2SA 1JFUA 4FYUA 19GSA 3PR8A 3PGTA 4LMWA 2HT9A 3KTLA 3BCKA 4HQSA 3WD6A 2G0FA 3KP8A 1PL1A 3G7IA 1GLPA 5H5RA 4PURA 5A5HB 4CW9A 3P7XA 2WJUA 1N8JA 3TJFA 2R3XA 4O92A 2H70A 2OADA 2GVPA 5EL8A 1K0MA 1ERVA 4PX1A 3FHKA 2VKZG 2ZCTA 2QA1A 2KP1A 4PQIA 3SBCA 4Q5QA 1NHOA 4QMKA 3EYTA 2K9FA 2P5QA 2IIYA 5D8IA 3PPUA 2GZPA 5HFGA 1GSFA 1VF1A 5ECOB 2CVKA 3A2XA 3GKNA 4NPBA 3UARA 2C0DA 3F3RA 2B6MA 3H93A 4J2FA 3HY2A 5AGYA 4DSSA 6GSXA 2HRNA 5H5QA 2KOKA 2RIIA 4KCEA 1GH2A 4EDZA 3VI5A 3BBYA 1FHEA 4V2LA 2R2JA 4HZ2A 4MH2A 3IC8A 3GX0A 5IIZA 3NZNA 4Q5NA 3HJOA 4POBA 4KDYA 4K7OA 2FCHA 2FD3A 2MBTA 5BRTA 4MJAA 5C00A 4L5LA 3FYGA 2QC7A 1FB6A 1A8YA 1V2AA 1XWBA 2JL4A 4HU9A 3O3TA 4EL1A 2R0CA 1XXUA 2LEGA 4OCEA 3QDNA 3TU3B 4G19A 3HDCA 1GSSA 4Z7XA 4Z2TA 2ALBA 1IYHA 2QKEA 5HR2A 4CY8A 3RBTA 2GGTA 4L5OA 4H86A 4V1Ap 4HJ2A 5B7CA 2L6DA 5B6MA 2PMTA 1U6TA 2IPAA 3CRTA 3BD2A 3IK7A 2QA2A 1F6MC 2PVQA 3WGXA 4ZL8A 5DCHA 3G9BA 4CY6A 2YV9A 4MPFA 4PNGA 5AISA 1T1VA 3W8JA 2QSIA 4HJMA 3UL3A 4N0VA 1O8WA 3FZ9A 3M3MA 4USSA 3KJYA 3DVXA 3F4RA 4DSRA 2HI7A 3DRNA 2GQMA 1XVWA 4N0ZA 2CAQA 2DJ3A 3ZTLA 5G5EA 2I9HA 5D9XA 2AYTA 5CRGA 1SD9A 2J9HA 4D73B 3DD3A 3H79A 3D4TA 4ZB9A 4ZIJA 2B7JA 2L5OA 2YWOA 2V1MA 5IO2A 4RQXA 3L9SA 1PD21 1B48A 2LNTA 5BMUB 3O6TA 1N2AA 5IMVA 1VGLA 1B4QA 2MMNA 3M8NA 1BG1A 2YPMA 4YQVA 3KH7A 2XHFA 3UOMA 3Q18A 2H74A 4XS1A 2AJQB 3VWWA 2PWJA 2VIMA 1UVZA 2AUVA 2CZ3A 1SJZA 2OT3A 4RI7A 1DSBA 5D9VA 2X4AA 1XOAA 1PGTA 5DDLA 1FB0A 1UA5A 1AXDA 4FYCA 5ECRB 4KE3A 2C3NA 4BVYA 3FMWA 3N5OA 2OE0A 3FW2A 4EUYA 1QMVA 5J4UA 4ECJA 2HQTA 4G01A 4OCFA 4OFNA 4K5SA 4HZ4A 4K9ZA 2OA7A 1CQGA 1WWJA 3IAM2 4IQ1A 1SK0A 3H4KA 1FO5A 1YEXA 4KDXA 1FOVA 2B1KA 4YAPA 3RHCA 2IMKA 3G7YA 4ZILA 5LD0A 2WZ9A 2R5GA 2DJJA 2YCDA 4XTSA 1SVLA 2F8FA 1QK8A 5G1KA 1NM3A 2RM6A 2IJYA 1LBKA 1U3AA 1SYXA 2F51A 1OC3A 3KMNA 3LGCA 1KTEA 2EC4A 3BOAA 2HSYA 2TIRA 2UZ8A 3LYKA 5CO3A 1T4YA 1N25A 5JCWA 3Q74A 4ZXGA 3HA9A 2V32A 1EOGA 1A8LA 1SKSB 3E0UA 3LEFA 3TUEA 2DMMA 4PUFC 4TR3A 3OR5A 2P0GA 4TR0A 1HNAA 4JZQA 4MPGA 3ZLPA 3APSA 2R6KA 1X9WB 3LWAA 4FH8A 4IJ3A 1CQHA 2YZUA 4LA1A 4MJBA 5GAND 1V57A 3D5JA 5ENUA 4QL9A 1XBSA 4L8EA 1NHYA 1VF3A 1GRXA 2F9SA 2WULA 5HR3A 1TDIA 2VLVA 2O89A 4QQ7A 4O5RA 1HNBA 2CT6A 3FK8A 2DJ0A 1OC9B 1ERUA 1RK4A 2EIQA 3KEBA 3DMLA 3ED3A 2VM2A 2B3SA 3PH9A 5B8AA 1GSQA 1M9BA 1QGVA 1ZYQB 5L71A 4EKZA 5ID2A 3D22A 2VO4A 1WIKA 2H1GA 1F2EA 2BMXA 3TOTA 3ZIJA 2C0GA 1ERWA 3KCMA 5ELAA 5FHIA 5J3RA 3HKRA 5KN1A 4GF0A 2DLXA 5IMFA 5IMDA 3U6VA 2R0GA 4WETA 1G6WA 4BL7A 1SL1B 2LUSA 2BJXA 2I4AA 1GULA 5J40A 2FUG2 1Z6NA 3FRCA 5J9CA 1J08A 2O7KA 5IPHA 3MWHA 3WGEA 1XWCA 2NBSA 5A1NB 1AQVA 2GT6A 5ECQB 2O8VB 4YQMA 2VL2A 2JADA 3DVWA 2N5FA 3TRPA 3ZVJA 2VCTA 3TDGA 4ECCA 6GSSA 1TRSA 3CSHA 1TW9A 4GTUA 3GTUA 3ZITA 2HXKA 3RPNA 3IV4A 3KGKA 1ML6A 4EDYA 1V40A 1M2DA 3A2VA 2HZEA 1BYEA 1VRSD 1V58A 3P8WA 3HJMA 4GLTA 3VWVA 4MF5A 3Q6OA 10GSA 5AIXA 4I6XA 3UIWA 2H0GA 1PKZA 2D2ZA 3GFKA 5IOXA 2X8CA 2RLIA 4PNFA 1PSQA 4K0NA 4HU7A 4LL4B 5J9BA 3HMJG 2IFQA 1LU4A 4KA0A 4GRFA 3M0FA 4BVXA 2P5RA 4MH3A 2ON5A 2NPBA 1E6BA 3WGDA 1ZMAA 4TXOB 2WS2A 3QMXA 3VURA 1J0FA 3P2AA 4Z2RA 1MDJA 3EWLA 1EGRA 3LQ7A 1MDKA 3ZMKA 3D4MA 2C4JA 2MMAA 3L78A 4O32A 4YKFA 1GUMA 3H1NA 3C8EA 1BEDA 4JE1A 1B8XA 1EGOA 2OBIA 4K7IA 5F8BA 4WF4A 3GHAA 1PQNA 1ZGNA 1M99A 1AQXA 3LG6A 2R4VA 3GYKA 2VL9A 1TKDB 3RPPA 1MEKA 3ZVJD 1RW1A 4GCIA 1XZOA 2CAIA 1FAAA 1XPVA 5IMAA 2TRCP 4IQAA 2HE3A 3F0IA 2VLTA 3HCZA 1T4ZA 1A2LA 1Y1UA 2P31A 2VCWA 5D9TA 4FYBA 2DC5A 4KSMA 3KXOA 1AUCA 4JEDA 1GWCA 1A0FA 4KF9A 2YN1A 1X9MB 4N10A 2V2GA 4E8EA 2PGTA 1OYJA 2GZZA 3TB2A 1X5CA 4NV2A 4BWSA 3TGZA 3CMIA 5A4UA 4K5RA 2ES7A 6GSYA 4X1UA 2X64A 4OWYA 2H0IA 3UVHA 2UV8G 1JHBA 2EFHA 3GNJA 5JCGA 4KNDA 2HRKA 2C3TA 3MIXA 4KGIA 4PTSA 5HFKA 1M7TA 4NWYA 5C04A 14GSA 1XOBA 2YOIA 1F37A 3WT2A 2LV3A 3APOA 2DIZA 2VD0A 3CYNA 2VCXA 5DALB 4V1Ag 1XIYA 2CV4A 17GSA 4OD7A 1BG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO4 A;  2A2R A;  1WMJ A;  5GSS A;  4X0X A;  3GKM A;  4OFM A;  5A4W A;  4KDU A;  3QAW A;  1M2B A;  3I69 A;  4G2E A;  1B9X C;  2JSZ A;  3GL5 A;  4E8H A;  2C0E A;  5CRW A;  1GSU A;  1EZK A;  4DSQ A;  3VPQ A;  3ZFL A;  5CAX A;  1XWA A;  4TR1 B;  4EXJ A;  1QQ2 A;  1URM A;  2FWF A;  1FVK A;  3EMP A;  4WKW A;  3L9V A;  1WOU A;  1Z7R A;  1PX6 A;  1HD2 A;  3FZ5 A;  5D73 A;  1GP1 A;  3GX8 A;  2WFC A;  4NHZ A;  5HR1 A;  4TR4 A;  1YKC A;  3ERG A;  2VL3 A;  1PA3 A;  4DVC A;  1MDI A;  2H76 A;  5G1L A;  2JZT A;  2DJK A;  1O85 A;  4XRA A;  1HQO A;  2LJA A;  2C1Y A;  1DE2 A;  2DIY A;  4XIH A;  3BJ5 A;  4MJC A;  2L4Q A;  3DYR A;  2M80 A;  3UAP A;  2N5A A;  4ZBB A;  2PPT A;  2LTK A;  2HNL A;  1HNC A;  1TI3 A;  4OFT A;  1F3A A;  4G10 A;  4JRR A;  2NDO A;  4WR4 A;  5DQS A;  5J5N A;  2DJ1 A;  3QFB C;  1JLV A;  2X99 A;  2DSA A;  2JAC A;  5KN3 A;  1PMT A;  2FWG A;  4G0L A;  4WEY A;  3U5R E;  1E2Y A;  1Z5Y E;  5CRH A;  3KIJ A;  1I5G A;  2YZH A;  3MNG A;  1JZD A;  1TK5 B;  1MD4 A;  5G5F A;  4IJI A;  4XS4 A;  3E9J B;  2B5Y A;  4MP4 A;  2TRX A;  2R37 A;  2C0F A;  4WR5 A;  5DCG A;  3GV1 A;  5ECS A;  3LYP A;  1WRY A;  2H19 A;  1THX A;  4YQU A;  2E2M A;  4P3Y B;  3IAS 2;  2HSM A;  4PQH A;  3CTF A;  1U88 A;  3QOU A;  3UEM A;  4IHU A;  4TW5 A;  4ZL7 A;  2WCI A;  2MBS A;  4G0K A;  4GSN A;  3TKS A;  3F3Q A;  4EF0 A;  2VLU A;  5JWQ B;  4MF6 A;  1GTA A;  3APQ A;  2PBJ A;  13GS A;  2CVB A;  2IN3 A;  4F03 A;  1BQ7 A;  1AIU A;  1MD3 A;  5KN0 A;  1SL2 B;  5ECP B;  2LS5 A;  4MAB A;  5ECK B;  4TRX A;  2GTU A;  4BPY A;  1V9W A;  3ZFB A;  3IC4 A;  3VLN A;  5F0G A;  1R4W A;  3GMF A;  2M72 A;  4YAV A;  2E7P A;  2OE3 A;  1SK1 A;  2XBI A;  5HFI A;  4I97 A;  1A23 A;  1EP8 A;  1LJR A;  3HJP A;  3KM6 A;  2EIO A;  2B5E A;  5A4V A;  3CRU A;  2E0Q A;  4HUA A;  1GTU A;  3Q19 A;  2FLS A;  3C71 A;  4MZW A;  2CX3 A;  3HZ4 A;  1F3B A;  4IW9 A;  3UBL A;  1XWK A;  1B9Y C;  4AJ6 A;  4NXI A;  4HS1 A;  4Q5R A;  3L0H A;  1AW9 A;  1EV9 A;  4DSS B;  2H6Y A;  3FR9 A;  3NOF A;  3C7M A;  5FT3 A;  3EU3 A;  2GLR A;  2B1L A;  4FIW A;  3GUS A;  4MDC A;  2H1D A;  1XCC A;  3LSZ A;  1QUW A;  4PGT A;  2XC2 A;  3D21 A;  2MMZ A;  1SJI A;  1WE0 A;  1GUH A;  4POL A;  2FWE A;  4GQC A;  3EMX A;  5KN2 A;  3F9U A;  2WDU A;  1IYI A;  3ZRD A;  1SD8 A;  2JZR A;  3FKF A;  3GST A;  2F3M A;  1A2J A;  2YNX A;  1DBY A;  4K2D A;  1JZW A;  4MJE A;  4L0U A;  4EE0 A;  4J57 E;  2N5B A;  1EWX A;  1K0O A;  3M1G A;  3RAZ A;  3DXB A;  2PER A;  3CBU A;  1O73 A;  4MCU A;  2Z9S A;  1OVN A;  1FW1 A;  2DJ2 A;  1YF1 A;  1F9M A;  1KBN A;  2NTO A;  3QPM A;  1ABA A;  3EU4 A;  1EP7 A;  3TKQ A;  3DIE A;  3C1R A;  1AAZ A;  5F07 A;  4K6X A;  5DAK A;  4POM A;  4G9H A;  5DJL A;  1ACV A;  3RHB A;  4IGJ A;  2VCQ A;  2I1U A;  2OKA A;  3CTG A;  3C1S A;  4ML1 A;  5JWO B;  5ECN B;  2KLX A;  3GUR A;  3E3E A;  5B8B A;  4BA7 A;  3V1W A;  4Q5F A;  1G7O A;  1NW2 A;  3HVX A;  2LST A;  3O76 A;  4KUN A;  1HYU A;  3VFI A;  5HQP A;  6GSW A;  5G2Z A;  1JZR A;  4GXZ A;  1A0R P;  4I5Q A;  1YQ1 A;  1FG4 A;  2LRT A;  1TK8 B;  4GST A;  3US3 A;  3QAV A;  3D6I A;  3HHV A;  2H71 A;  3FR3 A;  2AB6 A;  5CYY A;  5G30 A;  1VF4 A;  5AIV A;  3GKK A;  1GSE A;  3TKS E;  1X5E A;  4BVY B;  3UBK A;  5G31 A;  5DQY A;  5JCU A;  2FHE A;  1K3O A;  2VOC A;  5IQY A;  2REM A;  4AF2 A;  1T7P B;  5F06 A;  2V41 A;  4ZL9 A;  3QAG A;  3EVI A;  3I43 A;  4V2M A;  3M9K A;  3DWV A;  2CA8 A;  4WXT A;  3L4N A;  1O6J A;  4AJ8 A;  3SWL A;  3N9J A;  4IVF A;  5INY A;  1M2A A;  1FVJ A;  1YZX A;  1SYR A;  3QR6 A;  4NAX A;  3S9F A;  3KH9 A;  1R5A A;  4KH7 A;  3R3E A;  2B5X A;  2MMO A;  2NVL A;  1G0T A;  2JZS A;  4K8M A;  1GNE A;  2BTO T;  1TXX A;  3ZYW A;  1BX9 A;  2E2G A;  1V98 A;  2LNS A;  4NV5 A;  3ZIV A;  4HEA 2;  1K0B A;  3LXZ A;  4ZB6 A;  5CNW A;  1OE7 A;  3ZRE A;  1S3A A;  4HQZ A;  1UC7 A;  2OE1 A;  2VL2 C;  1Q4J A;  2HRF A;  2OJL A;  2KP2 A;  2L5L A;  4KB3 A;  3KP9 A;  4MMM A;  2KUC A;  1TU8 A;  3CSI A;  2VD1 A;  3HYP A;  2H1B A;  2O85 A;  4IP1 A;  5DJM A;  4WBR D;  3W8S A;  2YWN A;  3ME8 A;  1S3D A;  4K7N A;  1MTC A;  3VWX A;  1SEN A;  2EIR A;  3HZ8 A;  6GSU A;  3F6F A;  3VWU A;  1K0N A;  4KCA A;  3AY8 A;  3H8Q A;  3LFL A;  1VF2 A;  3RDW A;  5ID2 B;  2K6V A;  3IDV A;  2V6O A;  4EC0 A;  2YP6 A;  2LRC A;  4D73 A;  3KD0 A;  3UVT A;  2GZY A;  1K0A A;  3QD9 A;  1T00 A;  1ST9 A;  4BL7 B;  4BWQ A;  1ZZY A;  5BMU A;  4IN0 A;  1W89 A;  1ERT A;  5LNK e;  2LQQ A;  4TVE A;  1K0D A;  2H1A A;  4EO3 A;  5JWR B;  1A24 A;  2LJR A;  1O7U A;  5ECH B;  1ZCP A;  1M0U A;  4X43 A;  2A4V A;  1Z7P A;  2XPD A;  3TJG A;  2J23 A;  1R26 A;  4XS6 A;  4ECI A;  2I81 A;  5KEJ A;  4POK A;  2RM5 A;  5DBQ A;  5CRD A;  2C8U A;  2QGV A;  2L57 A;  20GS A;  5DVB A;  3GTU B;  4JR4 A;  3IA1 A;  1OC8 A;  1K3L A;  5J41 A;  1PN9 A;  3QFA C;  2FGX A;  1B4P A;  1NSW A;  2VM1 A;  1SKR B;  2HZE B;  5IO0 A;  3DEX A;  5H5S A;  4GQF A;  5CRE A;  1DUG A;  1Y6E A;  4FQU A;  1WPI A;  3EIN A;  1R7H A;  2CQ9 A;  3EUR A;  2H8L A;  1YF0 A;  3A3T A;  1G6Y A;  1ZL9 A;  2IFQ B;  5ABR A;  4BVX B;  3K8N A;  5IOW A;  2IMI A;  1DE1 A;  5FWG A;  2ZUP A;  3KTB A;  2LJK A;  4KSO A;  1O8X A;  4I8B A;  3UJ1 A;  1TU7 A;  1XVQ A;  4I2T A;  1ON4 A;  1XFL A;  5GAP D;  4HOJ A;  1QFN A;  1PX7 A;  16GS A;  2KHP A;  3TJB A;  1SKW B;  1USB A;  4IBP A;  6GSV A;  4N30 A;  2H6X A;  5GST A;  2RUE A;  3A5W A;  2IMF A;  4JR6 A;  4KAE A;  1SU9 A;  3CSJ A;  1TK0 B;  4IEL A;  3TOU A;  3ERW A;  3EC3 A;  7GSS A;  3IRA A;  1QXH A;  2HYX A;  3C73 A;  1GLQ A;  4ACS A;  1T3B A;  5ECI B;  2LKU A;  2RUF A;  3R2Q A;  1JZO A;  5IMC A;  4DEJ A;  3P90 A;  4QL7 A;  3GRX A;  4EVM A;  4MF7 A;  1YJ6 A;  2GST A;  2FY6 A;  1OC9 A;  4NHW A;  4WBJ A;  4TKY A;  2AHE A;  4MLY A;  1PKW A;  4LL1 B;  3DKS A;  1W4V A;  4F0C A;  2X8G A;  1XWG A;  1YKA A;  4TN8 A;  4PQ1 A;  1C72 A;  4K1F A;  4ILF A;  3TJJ A;  2WRT A;  4O7H A;  1WJK A;  1X9S B;  2H6Z A;  5AN1 A;  3FZA A;  1YEP A;  1U3I A;  2H01 A;  1U87 A;  3GKX A;  4JU5 A;  2YJ7 A;  1Z9H A;  1GSD A;  1SK2 A;  4AGS A;  2FNO A;  4RQR A;  1EV4 A;  1O81 A;  4XHM A;  4ISD A;  4IS0 A;  1WP0 A;  2WGR A;  4CHS A;  2YJH A;  1EOH A;  2HRK B;  1XW5 A;  2B7K A;  2G2Q A;  4K0G A;  2GS3 A;  5CP1 A;  3IHQ A;  4GSS A;  1ILO A;  1EEM A;  1AQW A;  2L6C A;  2H75 A;  4MK3 A;  3GSS A;  4G0I A;  1A2M A;  3ZL5 A;  4HDE A;  3IK9 A;  3GA4 A;  2IWT A;  3TRX A;  3IR4 A;  3QCP A;  1SL0 B;  1GL8 A;  2H66 A;  3I9V 2;  3F63 A;  2GQL A;  5LCZ A;  5IM9 A;  2GSQ A;  3IOS A;  3HD5 A;  4XCS A;  3IE3 A;  2YAN A;  1S3C A;  1G7E A;  1OAZ A;  5E59 A;  2I3Y A;  3TCO A;  2L4C A;  2AV4 A;  2LRN A;  3LOR A;  3EE2 A;  4V2N A;  4TXO A;  5F05 A;  4MA9 A;  2FWH A;  1T8E B;  3KMO A;  5EY6 A;  3IXR A;  5D96 A;  2M46 A;  2CVD A;  1THO A;  18GS A;  1GUK A;  3TKS C;  3MAK A;  3F6D A;  4WF5 A;  2GQK A;  4NMU A;  3D0Z A;  3ISO A;  4IP6 A;  2H0H A;  4HI7 A;  5ECM B;  2C80 A;  4L0W A;  2AAW A;  2H72 A;  6GST A;  1RQM A;  2HFD A;  5D9W A;  2HRA A;  3FZ4 A;  1H4O A;  3CXG A;  2YWI A;  1TJD A;  2GT5 A;  3J7Y k;  3TKP A;  4JBB A;  5IMZ A;  2YV7 A;  3VPT A;  4CDO A;  3W6G A;  2HZF A;  4J56 E;  2X8H A;  5GZZ B;  2HSN B;  2IL3 A;  3GH9 A;  4F82 A;  1Z6M A;  2FA8 A;  1ZYE A;  3FY7 A;  4XS4 B;  2HSH A;  1M9A A;  3IBH A;  1TRU A;  3ZZX A;  5HR0 A;  5E4W A;  2PVO C;  4F2I A;  4PXO A;  9GSS A;  4ZB8 A;  3F4T A;  4FO5 A;  1X0R A;  2CX4 A;  1BJX A;  4TXV A;  2HSM B;  2V6K A;  4GWR A;  1AC1 A;  3MSZ A;  4IKH A;  2K8V A;  4ML6 A;  1XW6 A;  12GS A;  3ZML A;  11GS A;  1EEJ A;  1OE8 A;  2CZ2 A;  1TRW A;  3GH6 A;  3VK9 A;  2OAC A;  1XW9 A;  3GL3 A;  2HLS A;  4LMV A;  1OKD A;  5D93 A;  2WB9 A;  1TI1 A;  8GSS A;  5EPF A;  1R5P A;  4I2U A;  4XRD A;  5DAL A;  3KZQ A;  2DBC A;  1PRX A;  5IPG A;  1YY7 A;  3UMA A;  2VAF A;  4KW6 A;  2O87 A;  3TKR A;  2H73 A;  2PU9 C;  1K0C A;  1GTI A;  1OKT A;  2JSY A;  3FR6 A;  3LXT A;  2YWM A;  3FEU A;  1GSY A;  3ERF A;  4PUA A;  4KX4 A;  2IME A;  3TRQ A;  1Z3E A;  1BAY A;  1TOF A;  3LJR A;  4TR1 A;  1SJ6 A;  1Q98 A;  4ULX A;  1PL2 A;  2ON7 A;  2VCZ A;  2H30 A;  2LQO A;  2ZNM A;  3JCM L;  3I6A A;  3J7Y b;  1KEB A;  4ZBD A;  2JU5 A;  4OMV A;  3WYW A;  2VUP A;  2MZC A;  1I9D A;  4RI6 A;  1TRV A;  3GIX A;  5COH A;  4F9Z A;  2K8S A;  2MYG A;  3L9U A;  1X5D A;  3HVV A;  2XBQ A;  3HXS A;  1ZOF A;  1YDK A;  3MDK A;  1UN2 A;  2PN8 A;  2C3Q A;  1Y25 A;  1JLW A;  4AJ7 A;  3M9J A;  2PUK C;  3F8U A;  5B6N A;  4N11 A;  3VI7 A;  2F8A A;  1GNW A;  3PIN A;  1TTZ A;  3DGQ A;  4MZB A;  4F0B A;  1KNG A;  3NIV A;  5A5K A;  2DML A;  3GN3 A;  4YH2 A;  3HVS A;  4ID0 A;  1TP9 A;  2GSS A;  5ELG A;  2GSR A;  2OBK A;  4LLR A;  4ZBA A;  1K3Y A;  4ECB A;  3BCI A;  3A2W A;  5DAK B;  2FA4 A;  2XPE A;  2VCV A;  4OO5 A;  3IPZ A;  3G7J A;  3TJK A;  3F4S A;  4MZC A;  1H75 A;  4TOP A;  2K18 A;  4RUV A;  3ME7 A;  1J9B A;  2GDR A;  2L59 A;  22GS A;  1GTB A;  5EVO A;  3WT1 A;  5ECL B;  2IMD A;  2A2S A;  1JFU A;  4FYU A;  19GS A;  3PR8 A;  3PGT A;  4LMW A;  2HT9 A;  3KTL A;  3BCK A;  4HQS A;  3WD6 A;  2G0F A;  3KP8 A;  1PL1 A;  3G7I A;  1GLP A;  5H5R A;  4PUR A;  4CW9 A;  3P7X A;  2WJU A;  1N8J A;  3TJF A;  2R3X A;  4O92 A;  2H70 A;  2OAD A;  2GVP A;  5EL8 A;  1K0M A;  1ERV A;  4PX1 A;  3FHK A;  2ZCT A;  2KP1 A;  4PQI A;  3SBC A;  4Q5Q A;  1NHO A;  3EYT A;  2K9F A;  2P5Q A;  2IIY A;  5D8I A;  3PPU A;  2GZP A;  5HFG A;  1GSF A;  1VF1 A;  5ECO B;  2CVK A;  3A2X A;  3GKN A;  4NPB A;  3UAR A;  2C0D A;  3F3R A;  2B6M A;  3H93 A;  4J2F A;  3HY2 A;  5AGY A;  4DSS A;  6GSX A;  2HRN A;  5H5Q A;  2KOK A;  2RII A;  4KCE A;  1GH2 A;  4EDZ A;  3VI5 A;  3BBY A;  1FHE A;  4V2L A;  2R2J A;  4HZ2 A;  4MH2 A;  3IC8 A;  3GX0 A;  5IIZ A;  3NZN A;  4Q5N A;  3HJO A;  4POB A;  4KDY A;  4K7O A;  2FCH A;  2FD3 A;  2MBT A;  4MJA A;  5C00 A;  4L5L A;  3FYG A;  2QC7 A;  1FB6 A;  1A8Y A;  1V2A A;  1XWB A;  2JL4 A;  4HU9 A;  3O3T A;  4EL1 A;  1XXU A;  2LEG A;  4OCE A;  3QDN A;  4G19 A;  3HDC A;  1GSS A;  4Z7X A;  2ALB A;  1IYH A;  2QKE A;  5HR2 A;  3RBT A;  2GGT A;  4L5O A;  4H86 A;  4V1A p;  4HJ2 A;  5B7C A;  2L6D A;  5B6M A;  2PMT A;  1U6T A;  2IPA A;  3CRT A;  3BD2 A;  3IK7 A;  1F6M C;  2PVQ A;  3WGX A;  4ZL8 A;  5DCH A;  3G9B A;  2YV9 A;  4MPF A;  4PNG A;  5AIS A;  1T1V A;  3W8J A;  2QSI A;  4HJM A;  3UL3 A;  4N0V A;  1O8W A;  3FZ9 A;  3M3M A;  4USS A;  3KJY A;  3DVX A;  3F4R A;  4DSR A;  2HI7 A;  3DRN A;  2GQM A;  1XVW A;  4N0Z A;  2CAQ A;  2DJ3 A;  3ZTL A;  5G5E A;  2I9H A;  5D9X A;  2AYT A;  5CRG A;  1SD9 A;  2J9H A;  4D73 B;  3DD3 A;  3H79 A;  3D4T A;  4ZB9 A;  4ZIJ A;  2B7J A;  2L5O A;  2YWO A;  2V1M A;  5IO2 A;  4RQX A;  3L9S A;  1PD2 1;  1B48 A;  2LNT A;  3O6T A;  1N2A A;  5IMV A;  1VGL A;  1B4Q A;  2MMN A;  3M8N A;  2YPM A;  4YQV A;  3KH7 A;  2XHF A;  3UOM A;  3Q18 A;  2H74 A;  4XS1 A;  2AJQ B;  3VWW A;  2PWJ A;  2VIM A;  1UVZ A;  2AUV A;  2CZ3 A;  1SJZ A;  4RI7 A;  1DSB A;  5D9V A;  1XOA A;  1PGT A;  5DDL A;  1FB0 A;  1UA5 A;  1AXD A;  4FYC A;  5ECR B;  4KE3 A;  2C3N A;  4BVY A;  3N5O A;  2OE0 A;  3FW2 A;  4EUY A;  1QMV A;  5J4U A;  4ECJ A;  2HQT A;  4OCF A;  4OFN A;  4HZ4 A;  4K9Z A;  2OA7 A;  1CQG A;  1WWJ A;  3IAM 2;  4IQ1 A;  1SK0 A;  3H4K A;  1FO5 A;  1YEX A;  4KDX A;  1FOV A;  2B1K A;  4YAP A;  3RHC A;  2IMK A;  3G7Y A;  4ZIL A;  5LD0 A;  2WZ9 A;  2R5G A;  2DJJ A;  2YCD A;  4XTS A;  2F8F A;  1QK8 A;  5G1K A;  1NM3 A;  2RM6 A;  2IJY A;  1LBK A;  1U3A A;  1SYX A;  2F51 A;  1OC3 A;  3KMN A;  3LGC A;  1KTE A;  2EC4 A;  3BOA A;  2HSY A;  2TIR A;  2UZ8 A;  3LYK A;  5CO3 A;  1T4Y A;  5JCW A;  3Q74 A;  4ZXG A;  3HA9 A;  2V32 A;  1EOG A;  1A8L A;  1SKS B;  3E0U A;  3LEF A;  3TUE A;  2DMM A;  4PUF C;  4TR3 A;  3OR5 A;  2P0G A;  4TR0 A;  1HNA A;  4JZQ A;  4MPG A;  3ZLP A;  3APS A;  2R6K A;  1X9W B;  3LWA A;  4FH8 A;  4IJ3 A;  1CQH A;  2YZU A;  4LA1 A;  4MJB A;  5GAN D;  1V57 A;  3D5J A;  5ENU A;  4QL9 A;  1XBS A;  4L8E A;  1NHY A;  1VF3 A;  1GRX A;  2F9S A;  2WUL A;  5HR3 A;  1TDI A;  2VLV A;  2O89 A;  4QQ7 A;  4O5R A;  1HNB A;  2CT6 A;  3FK8 A;  2DJ0 A;  1OC9 B;  1ERU A;  1RK4 A;  2EIQ A;  3KEB A;  3DML A;  3ED3 A;  2VM2 A;  2B3S A;  3PH9 A;  5B8A A;  1GSQ A;  1M9B A;  1QGV A;  1ZYQ B;  5L71 A;  4EKZ A;  5ID2 A;  3D22 A;  2VO4 A;  1WIK A;  2H1G A;  1F2E A;  2BMX A;  3TOT A;  3ZIJ A;  2C0G A;  1ERW A;  3KCM A;  5ELA A;  5FHI A;  5J3R A;  3HKR A;  5KN1 A;  4GF0 A;  2DLX A;  5IMF A;  5IMD A;  3U6V A;  4WET A;  1G6W A;  4BL7 A;  1SL1 B;  2LUS A;  2BJX A;  2I4A A;  1GUL A;  2FUG 2;  1Z6N A;  3FRC A;  5J9C A;  1J08 A;  2O7K A;  5IPH A;  3MWH A;  3WGE A;  1XWC A;  2NBS A;  2GT6 A;  1AQV A;  5ECQ B;  2O8V B;  4YQM A;  2VL2 A;  2JAD A;  3DVW A;  2N5F A;  3TRP A;  3ZVJ A;  2VCT A;  3TDG A;  4ECC A;  6GSS A;  1TRS A;  3CSH A;  1TW9 A;  4GTU A;  3GTU A;  3ZIT A;  2HXK A;  3RPN A;  3IV4 A;  3KGK A;  1ML6 A;  4EDY A;  1V40 A;  1M2D A;  3A2V A;  2HZE A;  1BYE A;  1VRS D;  1V58 A;  3P8W A;  3HJM A;  4GLT A;  3VWV A;  4MF5 A;  3Q6O A;  10GS A;  5AIX A;  4I6X A;  3UIW A;  2H0G A;  1PKZ A;  2D2Z A;  3GFK A;  5IOX A;  2X8C A;  2RLI A;  4PNF A;  1PSQ A;  4K0N A;  4HU7 A;  4LL4 B;  5J9B A;  2IFQ A;  1LU4 A;  4KA0 A;  4GRF A;  3M0F A;  4BVX A;  2P5R A;  4MH3 A;  2ON5 A;  2NPB A;  1E6B A;  3WGD A;  1ZMA A;  4TXO B;  2WS2 A;  3QMX A;  3VUR A;  1J0F A;  3P2A A;  1MDJ A;  3EWL A;  1EGR A;  3LQ7 A;  1MDK A;  3ZMK A;  3D4M A;  2C4J A;  2MMA A;  3L78 A;  4O32 A;  1GUM A;  3H1N A;  3C8E A;  1BED A;  4JE1 A;  1B8X A;  1EGO A;  2OBI A;  4K7I A;  5F8B A;  4WF4 A;  3GHA A;  1PQN A;  1ZGN A;  1M99 A;  1AQX A;  3LG6 A;  2R4V A;  3GYK A;  2VL9 A;  1TKD B;  3RPP A;  1MEK A;  3ZVJ D;  1RW1 A;  4GCI A;  1XZO A;  2CAI A;  1FAA A;  1XPV A;  5IMA A;  2TRC P;  4IQA A;  2HE3 A;  3F0I A;  2VLT A;  3HCZ A;  1T4Z A;  1A2L A;  2P31 A;  2VCW A;  5D9T A;  4FYB A;  2DC5 A;  4KSM A;  3KXO A;  1AUC A;  4JED A;  1GWC A;  1A0F A;  4KF9 A;  2YN1 A;  1X9M B;  4N10 A;  2V2G A;  4E8E A;  2PGT A;  1OYJ A;  2GZZ A;  3TB2 A;  1X5C A;  4NV2 A;  4BWS A;  3TGZ A;  3CMI A;  5A4U A;  2ES7 A;  6GSY A;  4X1U A;  2X64 A;  4OWY A;  2H0I A;  3UVH A;  1JHB A;  3GNJ A;  5JCG A;  4KND A;  2HRK A;  2C3T A;  4KGI A;  4PTS A;  5HFK A;  1M7T A;  4NWY A;  5C04 A;  14GS A;  1XOB A;  2YOI A;  1F37 A;  3WT2 A;  2LV3 A;  3APO A;  2DIZ A;  2VD0 A;  3CYN A;  2VCX A;  5DAL B;  4V1A g;  1XIY A;  2CV4 A;  17GS A;  4OD7 A;  1BG5 A; 
#chains in the Genus database with same CATH topology
 4OO4 A;  2A2R A;  1WMJ A;  5GSS A;  4X0X A;  3GKM A;  4OFM A;  5A4W A;  4KDU A;  3QAW A;  1M2B A;  3I69 A;  4G2E A;  1B9X C;  2JSZ A;  3GL5 A;  4E8H A;  2C0E A;  5CRW A;  1GSU A;  1EZK A;  4DSQ A;  3VPQ A;  3ZFL A;  5CAX A;  1XWA A;  4TR1 B;  4EXJ A;  2WZS A;  1QQ2 A;  1URM A;  2FWF A;  1FVK A;  3EMP A;  4WKW A;  3L9V A;  1WOU A;  1Z7R A;  3MYD A;  1PX6 A;  1HD2 A;  3FZ5 A;  5D73 A;  1GP1 A;  2DKI A;  2WFC A;  3GX8 A;  4ICY A;  4NHZ A;  5HR1 A;  4TR4 A;  1YKC A;  3ERG A;  2VL3 A;  1PA3 A;  4DVC A;  1MDI A;  1PFO A;  4AI6 A;  2H76 A;  5KOW A;  5G1L A;  2JZT A;  2DJK A;  4YKG A;  1O85 A;  4XRA A;  1HQO A;  2LJA A;  2C1Y A;  1DE2 A;  2DIY A;  4XIH A;  1S3R A;  3BJ5 A;  4MJC A;  2L4Q A;  3DYR A;  2M80 A;  3UAP A;  2N5A A;  4ZBB A;  2PPT A;  2LTK A;  2HNL A;  1HNC A;  1TI3 A;  4OFT A;  1F3A A;  4G10 A;  4JRR A;  2NDO A;  4WR4 A;  5DQS A;  1TXU A;  5J5N A;  2DJ1 A;  3QFB C;  3RFR C;  1JLV A;  2X99 A;  2DSA A;  2JAC A;  5KN3 A;  1PMT A;  2FWG A;  4G0L A;  4WEY A;  3U5R E;  1E2Y A;  1Z5Y E;  2HSN A;  5CRH A;  3KIJ A;  1I5G A;  2YZH A;  3MNG A;  1JZD A;  1TK5 B;  1MD4 A;  5G5F A;  4IJI A;  4XS4 A;  3E9J B;  2B5Y A;  4MP4 A;  2TRX A;  2R37 A;  2C0F A;  4WR5 A;  5DCG A;  3GV1 A;  5ECS A;  3LYP A;  1WRY A;  2H19 A;  1THX A;  4YQU A;  2E2M A;  4P3Y B;  3IAS 2;  2HSM A;  4PQH A;  3CTF A;  1U88 A;  3QOU A;  3UEM A;  4IHU A;  2R0P A;  4TW5 A;  4ZL7 A;  2WCI A;  2MBS A;  4G0K A;  4GSN A;  3TKS A;  3F3Q A;  4EF0 A;  2VLU A;  5JWQ B;  4MF6 A;  1GTA A;  3APQ A;  2PBJ A;  5A34 A;  13GS A;  2CVB A;  2IN3 A;  4F03 A;  1BQ7 A;  1AIU A;  1MD3 A;  5KN0 A;  1SL2 B;  5ECP B;  2LS5 A;  4MAB A;  5ECK B;  4TRX A;  2GTU A;  4BPY A;  1V9W A;  3ZFB A;  3IC4 A;  3VLN A;  5F0G A;  1R4W A;  3GMF A;  2M72 A;  4YAV A;  2E7P A;  2OE3 A;  1SK1 A;  2XBI A;  5HFI A;  4I97 A;  1A23 A;  1EP8 A;  1LJR A;  3HJP A;  3KM6 A;  2EIO A;  2B5E A;  5A4V A;  3CRU A;  4PI2 C;  2E0Q A;  4HUA A;  1GTU A;  3Q19 A;  2FLS A;  1ZYN A;  3C71 A;  4MZW A;  2CX3 A;  3HZ4 A;  1F3B A;  4IW9 A;  3UBL A;  1XWK A;  1B9Y C;  4AJ6 A;  4NXI A;  4HS1 A;  4Q5R A;  3L0H A;  1AW9 A;  1EV9 A;  4DSS B;  2H6Y A;  3FR9 A;  3NOF A;  3C7M A;  5FT3 A;  3EU3 A;  2GLR A;  2B1L A;  4FIW A;  3GUS A;  4MDC A;  2H1D A;  1XCC A;  4PI0 C;  3LSZ A;  1QUW A;  4PGT A;  2XC2 A;  3D21 A;  2MMZ A;  1SJI A;  1WE0 A;  1GUH A;  4POL A;  2FWE A;  4GQC A;  3EMX A;  5KN2 A;  3F9U A;  2WDU A;  1IYI A;  3ZRD A;  1SD8 A;  2JZR A;  3FKF A;  3GST A;  2F3M A;  1A2J A;  2YNX A;  1DBY A;  4K2D A;  1JZW A;  4MJE A;  4L0U A;  4EE0 A;  4J57 E;  4K2X A;  2N5B A;  1EWX A;  1K0O A;  3M1G A;  3RAZ A;  3DXB A;  2PER A;  3CBU A;  4A5P A;  1O73 A;  4MCU A;  2Z9S A;  1OVN A;  1FW1 A;  2DJ2 A;  3CWG A;  1YF1 A;  1F9M A;  1KBN A;  2NTO A;  3QPM A;  1ABA A;  4BIK A;  3EU4 A;  1EP7 A;  3TKQ A;  3DIE A;  3C1R A;  1AAZ A;  5F07 A;  4K6X A;  5DAK A;  4POM A;  4G9H A;  3HVN A;  5DJL A;  1ACV A;  3RHB A;  4IGJ A;  2VCQ A;  2I1U A;  2OKA A;  3CTG A;  3C1S A;  4ML1 A;  1M3I A;  5JWO B;  5ECN B;  2KLX A;  3GUR A;  3E3E A;  5B8B A;  4BA7 A;  3V1W A;  4Q5F A;  1G7O A;  1NW2 A;  3HVX A;  2LST A;  3O76 A;  4AKH A;  4KUN A;  5A5H A;  1HYU A;  3VFI A;  5HQP A;  6GSW A;  5G2Z A;  1JZR A;  4GXZ A;  1A0R P;  4I5Q A;  1YQ1 A;  1FG4 A;  2LRT A;  4EIP A;  1TK8 B;  4GST A;  3US3 A;  3QAV A;  3D6I A;  3HHV A;  2H71 A;  3FR3 A;  2AB6 A;  5CYY A;  5G30 A;  1VF4 A;  5AIV A;  3GKK A;  1GSE A;  2WW1 A;  2A4H A;  3TKS E;  1X5E A;  4BVY B;  3UBK A;  5G31 A;  5DQY A;  5JCU A;  2FHE A;  1K3O A;  2VOC A;  5IQY A;  2REM A;  4AF2 A;  1T7P B;  5F06 A;  2V41 A;  4ZL9 A;  3QAG A;  3EVI A;  3I43 A;  3IHG A;  4V2M A;  3M9K A;  3DWV A;  2CA8 A;  4WXT A;  3L4N A;  1O6J A;  4AJ8 A;  3SWL A;  3N9J A;  4IVF A;  5INY A;  1M2A A;  1FVJ A;  1YZX A;  1SYR A;  3QR6 A;  3EPT A;  4NAX A;  1SVO A;  3S9F A;  3KH9 A;  1SVM A;  1R5A A;  4KH7 A;  3R3E A;  2B5X A;  2MMO A;  2NVL A;  1G0T A;  2JZS A;  4K8M A;  1GNE A;  2BTO T;  1TXX A;  3ZYW A;  1BX9 A;  2E2G A;  1V98 A;  2LNS A;  4NV5 A;  3ZIV A;  4HEA 2;  1K0B A;  5KOX A;  3LXZ A;  4ZB6 A;  5CNW A;  1OE7 A;  3ZRE A;  1S3A A;  4HQZ A;  1UC7 A;  2OE1 A;  2VL2 C;  1Q4J A;  2HRF A;  2OJL A;  2KP2 A;  1YVL A;  2L5L A;  4KB3 A;  3KP9 A;  4MMM A;  2KUC A;  1TU8 A;  3CSI A;  2VD1 A;  3HYP A;  2H1B A;  2O85 A;  2DKH A;  5DJM A;  4IP1 A;  4WBR D;  3W8S A;  2YWN A;  3ME8 A;  1S3D A;  4K7N A;  1MTC A;  3VWX A;  1SEN A;  2EIR A;  3HZ8 A;  4AKX B;  2WVX B;  6GSU A;  3F6F A;  3VWU A;  1K0N A;  1ZYP A;  4KCA A;  3AY8 A;  3H8Q A;  3LFL A;  1VF2 A;  3RDW A;  5ID2 B;  2K6V A;  3IDV A;  2V6O A;  4EC0 A;  4EIQ A;  2YP6 A;  2LRC A;  4D73 A;  3KD0 A;  3UVT A;  2GZY A;  1I1I P;  1K0A A;  3QD9 A;  3LW9 A;  1T00 A;  1ST9 A;  4BL7 B;  4BWQ A;  1ZZY A;  5BMU A;  4IN0 A;  1W89 A;  1ERT A;  5LNK e;  2LQQ A;  4TVE A;  1K0D A;  2H1A A;  4EO3 A;  5JWR B;  1A24 A;  2LJR A;  3A5I A;  1O7U A;  5ECH B;  1ZCP A;  1M0U A;  4X43 A;  2A4V A;  1Z7P A;  2XPD A;  3TJG A;  2J23 A;  1R26 A;  4XS6 A;  2WW0 A;  4ECI A;  2I81 A;  5KEJ A;  4POK A;  2RM5 A;  5DBQ A;  5CRD A;  2C8U A;  2QGV A;  2L57 A;  20GS A;  5DVB A;  3GTU B;  4JR4 A;  4X4J A;  3IA1 A;  1OC8 A;  1K3L A;  5J41 A;  1PN9 A;  3QFA C;  2FGX A;  1B4P A;  1NSW A;  2VM1 A;  1SKR B;  4E68 A;  2HZE B;  5IO0 A;  3DEX A;  5H5S A;  4GQF A;  5CRE A;  1DUG A;  2A2P A;  1Y6E A;  4FQU A;  1WPI A;  3EIN A;  1R7H A;  2CQ9 A;  3EUR A;  2H8L A;  1YF0 A;  3A3T A;  1G6Y A;  1ZL9 A;  2IFQ B;  5ABR A;  4AKG A;  4BVX B;  3K8N A;  5IOW A;  2IMI A;  1DE1 A;  5FWG A;  2ZUP A;  3KTB A;  2LJK A;  4KSO A;  1O8X A;  4I8B A;  3UJ1 A;  1TU7 A;  1XVQ A;  4I2T A;  1ON4 A;  1XFL A;  5GAP D;  4HOJ A;  1QFN A;  1PX7 A;  16GS A;  2KHP A;  3TJB A;  1SKW B;  1USB A;  4IBP A;  6GSV A;  4N30 A;  2H6X A;  2EFE A;  5GST A;  2RUE A;  3A5W A;  2IMF A;  4JR6 A;  4KAE A;  1SU9 A;  3CSJ A;  1TK0 B;  4IEL A;  3TOU A;  3ERW A;  3EC3 A;  7GSS A;  3IRA A;  1QXH A;  2HYX A;  3C73 A;  1GLQ A;  4O5U A;  4ACS A;  1T3B A;  5ECI B;  2O3E A;  2LKU A;  2RUF A;  3R2Q A;  1JZO A;  5IMC A;  4DEJ A;  3P90 A;  4QL7 A;  3GRX A;  4EVM A;  4MF7 A;  1YJ6 A;  2GST A;  2FY6 A;  1OC9 A;  4NHW A;  4WBJ A;  4TKY A;  2AHE A;  4MLY A;  1PKW A;  4LL1 B;  3DKS A;  1W4V A;  4F0C A;  2X8G A;  1XWG A;  1YKA A;  4TN8 A;  4PQ1 A;  1C72 A;  4K1F A;  4ILF A;  3TJJ A;  2WRT A;  4O7H A;  1WJK A;  1X9S B;  2H6Z A;  5AN1 A;  3FZA A;  1YEP A;  1U3I A;  2H01 A;  1U87 A;  3GKX A;  4JU5 A;  2YJ7 A;  1Z9H A;  1GSD A;  1SK2 A;  4AGS A;  1FOH A;  2FNO A;  4RQR A;  1EV4 A;  1O81 A;  4XHM A;  4ISD A;  4IS0 A;  1WP0 A;  2WGR A;  4CHS A;  4GDF A;  2YJH A;  5A1N A;  4ZB7 A;  1EOH A;  2HRK B;  1XW5 A;  2B7K A;  4W66 A;  2G2Q A;  4K0G A;  2GS3 A;  5CP1 A;  3IHQ A;  4GSS A;  1ILO A;  1EEM A;  1AQW A;  2L6C A;  2H75 A;  4MK3 A;  2O5V A;  3GSS A;  4G0I A;  2EFD A;  1A2M A;  3ZL5 A;  4HDE A;  3IK9 A;  3GA4 A;  2IWT A;  3TRX A;  3IR4 A;  3QCP A;  1SL0 B;  1GL8 A;  2H66 A;  3I9V 2;  3F63 A;  2GQL A;  5LCZ A;  5IM9 A;  4MNN A;  2GSQ A;  3IOS A;  3HD5 A;  4XCS A;  3IE3 A;  2YAN A;  4AKI A;  1S3C A;  1G7E A;  1OAZ A;  5E59 A;  2I3Y A;  3CQF A;  3TCO A;  2L4C A;  2AV4 A;  2LRN A;  3LOR A;  3EE2 A;  4V2N A;  4TXO A;  5F05 A;  4MA9 A;  2FWH A;  1T8E B;  3KMO A;  5EY6 A;  3IXR A;  5D96 A;  2M46 A;  2CVD A;  1THO A;  18GS A;  1GUK A;  3TKS C;  3MAK A;  2X49 A;  3F6D A;  4WF5 A;  2GQK A;  4NMU A;  3D0Z A;  3ISO A;  4IP6 A;  2H0H A;  4HI7 A;  5ECM B;  2C80 A;  4L0W A;  2AAW A;  2H72 A;  4Z2U A;  6GST A;  1RQM A;  2HFD A;  5D9W A;  2HRA A;  3FZ4 A;  1H4O A;  3CXG A;  2YWI A;  1TJD A;  2GT5 A;  3J7Y k;  3TKP A;  4JBB A;  5IMZ A;  2YV7 A;  3VPT A;  1BF5 A;  4CDO A;  3W6G A;  2HZF A;  4J56 E;  2X8H A;  5GZZ B;  2HSN B;  2IL3 A;  3GH9 A;  4F82 A;  1Z6M A;  2FA8 A;  1ZYE A;  3FY7 A;  4XS4 B;  2HSH A;  1M9A A;  3IBH A;  1TRU A;  3ZZX A;  5HR0 A;  5E4W A;  2PVO C;  4F2I A;  4PXO A;  9GSS A;  4ZB8 A;  3F4T A;  4FO5 A;  1X0R A;  2CX4 A;  1BJX A;  4TXV A;  2HSM B;  2V6K A;  4GWR A;  1AC1 A;  3MSZ A;  4IKH A;  5J4V A;  2K8V A;  4ML6 A;  1XW6 A;  12GS A;  3RGB C;  3ZML A;  2H1L A;  11GS A;  1EEJ A;  1OE8 A;  5A34 B;  2CZ2 A;  1TRW A;  3GH6 A;  3VK9 A;  2OAC A;  1XW9 A;  3GL3 A;  2HLS A;  4LMV A;  4O5Q A;  1OKD A;  5D93 A;  2WB9 A;  1TI1 A;  8GSS A;  5EPF A;  1R5P A;  4I2U A;  4XRD A;  5DAL A;  3KZQ A;  2DBC A;  1PRX A;  5IPG A;  1YY7 A;  3UMA A;  2VAF A;  4KW6 A;  2O87 A;  3TKR A;  2H73 A;  2PU9 C;  1K0C A;  1GTI A;  1OKT A;  2JSY A;  3FR6 A;  3LXT A;  2YWM A;  3FEU A;  1GSY A;  3ERF A;  4PUA A;  4KX4 A;  2IME A;  3TRQ A;  1Z3E A;  1BAY A;  1TOF A;  3LJR A;  4TR1 A;  1SJ6 A;  1Q98 A;  4ULX A;  1PL2 A;  2ON7 A;  2LQO A;  2VCZ A;  2H30 A;  2ZNM A;  3JCM L;  3I6A A;  3J7Y b;  1KEB A;  4ZBD A;  2JU5 A;  4OMV A;  3WYW A;  2VUP A;  1M3J A;  2MZC A;  1I9D A;  4RI6 A;  1TRV A;  3GIX A;  5COH A;  4F9Z A;  2K8S A;  2MYG A;  3L9U A;  1X5D A;  3HVV A;  2XBQ A;  3HXS A;  1ZOF A;  1YDK A;  3MDK A;  1UN2 A;  2PN8 A;  2C3Q A;  1PN0 A;  1Y25 A;  1JLW A;  4AJ7 A;  3M9J A;  4N3Z A;  2PUK C;  3F8U A;  5B6N A;  4N11 A;  3VI7 A;  2F8A A;  1GNW A;  3PIN A;  1TTZ A;  3DGQ A;  4MZB A;  4F0B A;  1KNG A;  3NIV A;  5A5K A;  2DML A;  3GN3 A;  4YH2 A;  3HVS A;  4ID0 A;  1TP9 A;  2GSS A;  5J4Y A;  5ELG A;  2GSR A;  2EFC A;  2OBK A;  4LLR A;  4ZBA A;  1K3Y A;  4ECB A;  3BCI A;  3A2W A;  5DAK B;  2FA4 A;  2XPE A;  2VCV A;  4OO5 A;  3IPZ A;  3G7J A;  3TJK A;  3F4S A;  4MZC A;  1H75 A;  4TOP A;  2K18 A;  4RUV A;  3ME7 A;  1J9B A;  2GDR A;  2L59 A;  5J47 A;  22GS A;  1GTB A;  5EVO A;  3WT1 A;  5ECL B;  2IMD A;  2A2S A;  1JFU A;  4FYU A;  19GS A;  3PR8 A;  3PGT A;  4LMW A;  2HT9 A;  3KTL A;  3BCK A;  4HQS A;  3WD6 A;  2G0F A;  3KP8 A;  1PL1 A;  3G7I A;  1GLP A;  5H5R A;  4PUR A;  5A5H B;  4CW9 A;  3P7X A;  2WJU A;  1N8J A;  3TJF A;  2R3X A;  4O92 A;  2H70 A;  2OAD A;  2GVP A;  5EL8 A;  1K0M A;  1ERV A;  4PX1 A;  3FHK A;  2VKZ G;  2ZCT A;  2QA1 A;  2KP1 A;  4PQI A;  3SBC A;  4Q5Q A;  1NHO A;  4QMK A;  3EYT A;  2K9F A;  2P5Q A;  2IIY A;  5D8I A;  3PPU A;  2GZP A;  5HFG A;  1GSF A;  1VF1 A;  5ECO B;  2CVK A;  3A2X A;  3GKN A;  4NPB A;  3UAR A;  2C0D A;  3F3R A;  2B6M A;  3H93 A;  4J2F A;  3HY2 A;  5AGY A;  4DSS A;  6GSX A;  2HRN A;  5H5Q A;  2KOK A;  2RII A;  4KCE A;  1GH2 A;  4EDZ A;  3VI5 A;  3BBY A;  1FHE A;  4V2L A;  2R2J A;  4HZ2 A;  4MH2 A;  3IC8 A;  3GX0 A;  5IIZ A;  3NZN A;  4Q5N A;  3HJO A;  4POB A;  4KDY A;  4K7O A;  2FCH A;  2FD3 A;  2MBT A;  5BRT A;  4MJA A;  5C00 A;  4L5L A;  3FYG A;  2QC7 A;  1FB6 A;  1A8Y A;  1V2A A;  1YEW C;  1XWB A;  2JL4 A;  4HU9 A;  3O3T A;  4EL1 A;  2R0C A;  1XXU A;  2LEG A;  4OCE A;  3QDN A;  3TU3 B;  4G19 A;  3HDC A;  1GSS A;  4Z7X A;  4Z2T A;  2ALB A;  1IYH A;  2QKE A;  5HR2 A;  4CY8 A;  3RBT A;  2GGT A;  4L5O A;  4H86 A;  4V1A p;  4HJ2 A;  5B7C A;  2L6D A;  5B6M A;  2PMT A;  1U6T A;  2IPA A;  3CRT A;  3BD2 A;  3IK7 A;  2QA2 A;  1F6M C;  2PVQ A;  3WGX A;  4ZL8 A;  5DCH A;  3G9B A;  4CY6 A;  2YV9 A;  4MPF A;  4PNG A;  5AIS A;  1T1V A;  3W8J A;  2QSI A;  4HJM A;  3UL3 A;  4N0V A;  1O8W A;  3FZ9 A;  3M3M A;  4USS A;  3KJY A;  3DVX A;  3F4R A;  4DSR A;  2HI7 A;  3DRN A;  2GQM A;  1XVW A;  4N0Z A;  2CAQ A;  2DJ3 A;  3ZTL A;  5G5E A;  2I9H A;  5D9X A;  2AYT A;  5CRG A;  1SD9 A;  2J9H A;  4D73 B;  3DD3 A;  3H79 A;  3D4T A;  4ZB9 A;  4ZIJ A;  2B7J A;  2L5O A;  2YWO A;  2V1M A;  5IO2 A;  4RQX A;  3L9S A;  1PD2 1;  1B48 A;  2LNT A;  5BMU B;  3O6T A;  1N2A A;  5IMV A;  1VGL A;  1B4Q A;  2MMN A;  3M8N A;  1BG1 A;  2YPM A;  4YQV A;  3KH7 A;  2XHF A;  3UOM A;  3Q18 A;  2H74 A;  4XS1 A;  2AJQ B;  3VWW A;  2PWJ A;  2VIM A;  1UVZ A;  2AUV A;  2CZ3 A;  1SJZ A;  2OT3 A;  4RI7 A;  1DSB A;  5D9V A;  2X4A A;  1XOA A;  1PGT A;  5DDL A;  1FB0 A;  1UA5 A;  1AXD A;  4FYC A;  5ECR B;  4KE3 A;  2C3N A;  4BVY A;  3FMW A;  3N5O A;  2OE0 A;  3FW2 A;  4EUY A;  1QMV A;  5J4U A;  4ECJ A;  2HQT A;  4G01 A;  4OCF A;  4OFN A;  4K5S A;  4HZ4 A;  4K9Z A;  2OA7 A;  1CQG A;  1WWJ A;  3IAM 2;  4IQ1 A;  1SK0 A;  3H4K A;  1FO5 A;  1YEX A;  4KDX A;  1FOV A;  2B1K A;  4YAP A;  3RHC A;  2IMK A;  3G7Y A;  4ZIL A;  5LD0 A;  2WZ9 A;  2R5G A;  2DJJ A;  2YCD A;  4XTS A;  1SVL A;  2F8F A;  1QK8 A;  5G1K A;  1NM3 A;  2RM6 A;  2IJY A;  1LBK A;  1U3A A;  1SYX A;  2F51 A;  1OC3 A;  3KMN A;  3LGC A;  1KTE A;  4HSC X;  2EC4 A;  3BOA A;  2HSY A;  2TIR A;  2UZ8 A;  3LYK A;  5CO3 A;  1T4Y A;  1N25 A;  5JCW A;  3Q74 A;  4ZXG A;  3HA9 A;  2V32 A;  1EOG A;  1A8L A;  1SKS B;  3E0U A;  3LEF A;  3TUE A;  2DMM A;  4PUF C;  4TR3 A;  3OR5 A;  2P0G A;  4TR0 A;  1HNA A;  4JZQ A;  3CHX C;  4MPG A;  3ZLP A;  3APS A;  2R6K A;  1X9W B;  3LWA A;  4FH8 A;  4IJ3 A;  1CQH A;  2YZU A;  4LA1 A;  4MJB A;  5GAN D;  1V57 A;  3D5J A;  5ENU A;  4QL9 A;  1XBS A;  4L8E A;  1NHY A;  1VF3 A;  1GRX A;  2F9S A;  2WUL A;  5HR3 A;  1TDI A;  2VLV A;  2O89 A;  4QQ7 A;  4O5R A;  1HNB A;  2CT6 A;  3FK8 A;  2DJ0 A;  2WVX A;  1OC9 B;  1ERU A;  1RK4 A;  2EIQ A;  3KEB A;  3DML A;  3ED3 A;  2VM2 A;  2B3S A;  3PH9 A;  5B8A A;  1GSQ A;  1M9B A;  1QGV A;  1ZYQ B;  5L71 A;  4EKZ A;  5ID2 A;  3D22 A;  2VO4 A;  1WIK A;  2H1G A;  1F2E A;  2BMX A;  3TOT A;  3ZIJ A;  2C0G A;  1ERW A;  2O36 A;  3KCM A;  5ELA A;  5FHI A;  5J3R A;  3HKR A;  5KN1 A;  4GF0 A;  2DLX A;  5IMF A;  5IMD A;  3U6V A;  2R0G A;  4WET A;  1G6W A;  4BL7 A;  1SL1 B;  2LUS A;  2BJX A;  2I4A A;  1GUL A;  5J40 A;  2FUG 2;  1Z6N A;  3FRC A;  5J9C A;  1J08 A;  2O7K A;  5IPH A;  3MWH A;  3WGE A;  1XWC A;  2NBS A;  5A1N B;  1AQV A;  2GT6 A;  5ECQ B;  2O8V B;  4YQM A;  2VL2 A;  2JAD A;  3DVW A;  2N5F A;  3TRP A;  3ZVJ A;  2VCT A;  3TDG A;  4ECC A;  1S4B P;  6GSS A;  1TRS A;  3CSH A;  1TW9 A;  4GTU A;  3GTU A;  3ZIT A;  2HXK A;  3RPN A;  3IV4 A;  3KGK A;  1ML6 A;  4EDY A;  1V40 A;  1M2D A;  3A2V A;  2HZE A;  1BYE A;  1VRS D;  1V58 A;  3P8W A;  3HJM A;  4GLT A;  3VWV A;  4MF5 A;  2WVZ A;  3Q6O A;  10GS A;  5AIX A;  4I6X A;  3UIW A;  2H0G A;  1PKZ A;  2D2Z A;  3GFK A;  5IOX A;  2X8C A;  2RLI A;  2WW3 A;  4PNF A;  1PSQ A;  4K0N A;  4FXY P;  4HU7 A;  4LL4 B;  5J9B A;  3HMJ G;  2IFQ A;  1LU4 A;  4KA0 A;  4GRF A;  3M0F A;  4BVX A;  2P5R A;  4MH3 A;  2ON5 A;  2NPB A;  1E6B A;  3WGD A;  1ZMA A;  4TXO B;  2WS2 A;  3QMX A;  3VUR A;  1J0F A;  3P2A A;  4Z2R A;  1MDJ A;  3EWL A;  1EGR A;  3LQ7 A;  1MDK A;  3ZMK A;  3D4M A;  2C4J A;  2MMA A;  3L78 A;  4O32 A;  4YKF A;  1GUM A;  3H1N A;  3C8E A;  1BED A;  4JE1 A;  1B8X A;  1EGO A;  2OBI A;  4K7I A;  5F8B A;  4WF4 A;  3GHA A;  1PQN A;  1ZGN A;  1M99 A;  2WVY A;  1AQX A;  3LG6 A;  2R4V A;  3GYK A;  2VL9 A;  4PHZ C;  1TKD B;  3RPP A;  1MEK A;  3ZVJ D;  1RW1 A;  4GCI A;  1XZO A;  2CAI A;  1FAA A;  1XPV A;  5IMA A;  2TRC P;  4IQA A;  2HE3 A;  3F0I A;  2VLT A;  3HCZ A;  1T4Z A;  1A2L A;  1Y1U A;  2P31 A;  2VCW A;  5D9T A;  4FYB A;  2DC5 A;  4KSM A;  3KXO A;  1AUC A;  4JED A;  1GWC A;  1A0F A;  4KF9 A;  2YN1 A;  1X9M B;  4N10 A;  2V2G A;  4E8E A;  2PGT A;  1OYJ A;  2GZZ A;  3TB2 A;  1X5C A;  4NV2 A;  4BWS A;  3TGZ A;  3CMI A;  5A4U A;  4K5R A;  2ES7 A;  6GSY A;  4X1U A;  2X64 A;  4OWY A;  2H0I A;  3UVH A;  2UV8 G;  1JHB A;  2EFH A;  3GNJ A;  5JCG A;  4KND A;  2HRK A;  2C3T A;  3MIX A;  4KGI A;  4PTS A;  5HFK A;  1M7T A;  4NWY A;  5C04 A;  14GS A;  1XG8 A;  1XOB A;  2YOI A;  2WW2 A;  1F37 A;  3WT2 A;  2LV3 A;  3APO A;  2DIZ A;  2VD0 A;  3CYN A;  2VCX A;  5DAL B;  4V1A g;  1XIY A;  2CV4 A;  17GS A;  4OD7 A;  1BG5 A; 
#chains in the Genus database with same CATH homology
 4OO4 A;  2A2R A;  1WMJ A;  5GSS A;  4X0X A;  3GKM A;  4OFM A;  5A4W A;  4KDU A;  3QAW A;  1M2B A;  3I69 A;  4G2E A;  1B9X C;  2JSZ A;  3GL5 A;  4E8H A;  2C0E A;  5CRW A;  1GSU A;  1EZK A;  4DSQ A;  3VPQ A;  3ZFL A;  5CAX A;  1XWA A;  4TR1 B;  4EXJ A;  1QQ2 A;  1URM A;  2FWF A;  1FVK A;  3EMP A;  4WKW A;  3L9V A;  1WOU A;  1Z7R A;  3MYD A;  1PX6 A;  1HD2 A;  3FZ5 A;  5D73 A;  1GP1 A;  2DKI A;  2WFC A;  3GX8 A;  4ICY A;  4NHZ A;  5HR1 A;  4TR4 A;  1YKC A;  3ERG A;  2VL3 A;  1PA3 A;  4DVC A;  1MDI A;  4AI6 A;  2H76 A;  5KOW A;  5G1L A;  2JZT A;  2DJK A;  4YKG A;  1O85 A;  4XRA A;  1HQO A;  2LJA A;  2C1Y A;  1DE2 A;  2DIY A;  4XIH A;  3BJ5 A;  4MJC A;  2L4Q A;  3DYR A;  2M80 A;  3UAP A;  2N5A A;  4ZBB A;  2PPT A;  2LTK A;  2HNL A;  1HNC A;  1TI3 A;  4OFT A;  1F3A A;  4G10 A;  4JRR A;  2NDO A;  4WR4 A;  5DQS A;  1TXU A;  5J5N A;  2DJ1 A;  3QFB C;  1JLV A;  2X99 A;  2DSA A;  2JAC A;  5KN3 A;  1PMT A;  2FWG A;  4G0L A;  4WEY A;  3U5R E;  1E2Y A;  1Z5Y E;  2HSN A;  5CRH A;  3KIJ A;  1I5G A;  2YZH A;  3MNG A;  1JZD A;  1TK5 B;  1MD4 A;  5G5F A;  4IJI A;  4XS4 A;  3E9J B;  2B5Y A;  4MP4 A;  2TRX A;  2R37 A;  2C0F A;  4WR5 A;  5DCG A;  3GV1 A;  5ECS A;  3LYP A;  1WRY A;  2H19 A;  1THX A;  4YQU A;  2E2M A;  4P3Y B;  3IAS 2;  2HSM A;  4PQH A;  3CTF A;  1U88 A;  3QOU A;  3UEM A;  4IHU A;  2R0P A;  4TW5 A;  4ZL7 A;  2WCI A;  2MBS A;  4G0K A;  4GSN A;  3TKS A;  3F3Q A;  4EF0 A;  2VLU A;  5JWQ B;  4MF6 A;  1GTA A;  3APQ A;  2PBJ A;  5A34 A;  13GS A;  2CVB A;  2IN3 A;  4F03 A;  1BQ7 A;  1AIU A;  1MD3 A;  5KN0 A;  1SL2 B;  5ECP B;  2LS5 A;  4MAB A;  5ECK B;  4TRX A;  2GTU A;  4BPY A;  1V9W A;  3ZFB A;  3IC4 A;  3VLN A;  5F0G A;  1R4W A;  3GMF A;  2M72 A;  4YAV A;  2E7P A;  2OE3 A;  1SK1 A;  2XBI A;  5HFI A;  4I97 A;  1A23 A;  1EP8 A;  1LJR A;  3HJP A;  3KM6 A;  2EIO A;  2B5E A;  5A4V A;  3CRU A;  2E0Q A;  4HUA A;  1GTU A;  3Q19 A;  2FLS A;  1ZYN A;  3C71 A;  4MZW A;  2CX3 A;  3HZ4 A;  1F3B A;  4IW9 A;  3UBL A;  1XWK A;  1B9Y C;  4AJ6 A;  4NXI A;  4HS1 A;  4Q5R A;  3L0H A;  1AW9 A;  1EV9 A;  4DSS B;  2H6Y A;  3FR9 A;  3NOF A;  3C7M A;  5FT3 A;  3EU3 A;  2GLR A;  2B1L A;  4FIW A;  3GUS A;  4MDC A;  2H1D A;  1XCC A;  3LSZ A;  1QUW A;  4PGT A;  2XC2 A;  3D21 A;  2MMZ A;  1SJI A;  1WE0 A;  1GUH A;  4POL A;  2FWE A;  4GQC A;  3EMX A;  5KN2 A;  3F9U A;  2WDU A;  1IYI A;  3ZRD A;  1SD8 A;  2JZR A;  3FKF A;  3GST A;  2F3M A;  1A2J A;  2YNX A;  1DBY A;  4K2D A;  1JZW A;  4MJE A;  4L0U A;  4EE0 A;  4J57 E;  4K2X A;  2N5B A;  1EWX A;  1K0O A;  3M1G A;  3RAZ A;  3DXB A;  2PER A;  3CBU A;  4A5P A;  1O73 A;  4MCU A;  2Z9S A;  1OVN A;  1FW1 A;  2DJ2 A;  3CWG A;  1YF1 A;  1F9M A;  1KBN A;  2NTO A;  3QPM A;  1ABA A;  3EU4 A;  1EP7 A;  3TKQ A;  3DIE A;  3C1R A;  1AAZ A;  5F07 A;  4K6X A;  5DAK A;  4POM A;  4G9H A;  5DJL A;  1ACV A;  3RHB A;  4IGJ A;  2VCQ A;  2I1U A;  2OKA A;  3CTG A;  3C1S A;  4ML1 A;  5JWO B;  5ECN B;  2KLX A;  3GUR A;  3E3E A;  5B8B A;  4BA7 A;  3V1W A;  4Q5F A;  1G7O A;  1NW2 A;  3HVX A;  2LST A;  3O76 A;  4AKH A;  4KUN A;  5A5H A;  1HYU A;  3VFI A;  5HQP A;  6GSW A;  5G2Z A;  1JZR A;  4GXZ A;  1A0R P;  4I5Q A;  1YQ1 A;  1FG4 A;  2LRT A;  4EIP A;  1TK8 B;  4GST A;  3US3 A;  3QAV A;  3D6I A;  3HHV A;  2H71 A;  3FR3 A;  2AB6 A;  5CYY A;  5G30 A;  1VF4 A;  5AIV A;  3GKK A;  1GSE A;  2A4H A;  3TKS E;  1X5E A;  4BVY B;  3UBK A;  5G31 A;  5DQY A;  5JCU A;  2FHE A;  1K3O A;  2VOC A;  5IQY A;  2REM A;  4AF2 A;  1T7P B;  5F06 A;  2V41 A;  4ZL9 A;  3QAG A;  3EVI A;  3I43 A;  3IHG A;  4V2M A;  3M9K A;  3DWV A;  2CA8 A;  4WXT A;  3L4N A;  1O6J A;  4AJ8 A;  3SWL A;  3N9J A;  4IVF A;  5INY A;  1M2A A;  1FVJ A;  1YZX A;  1SYR A;  3QR6 A;  3EPT A;  4NAX A;  1SVO A;  3S9F A;  3KH9 A;  1SVM A;  1R5A A;  4KH7 A;  3R3E A;  2B5X A;  2MMO A;  2NVL A;  1G0T A;  2JZS A;  4K8M A;  1GNE A;  2BTO T;  1TXX A;  3ZYW A;  1BX9 A;  2E2G A;  1V98 A;  2LNS A;  4NV5 A;  3ZIV A;  4HEA 2;  1K0B A;  5KOX A;  3LXZ A;  4ZB6 A;  5CNW A;  1OE7 A;  3ZRE A;  1S3A A;  4HQZ A;  1UC7 A;  2OE1 A;  2VL2 C;  1Q4J A;  2HRF A;  2OJL A;  2KP2 A;  1YVL A;  2L5L A;  4KB3 A;  3KP9 A;  4MMM A;  2KUC A;  1TU8 A;  3CSI A;  2VD1 A;  3HYP A;  2H1B A;  2O85 A;  2DKH A;  5DJM A;  4IP1 A;  4WBR D;  3W8S A;  2YWN A;  3ME8 A;  1S3D A;  4K7N A;  1MTC A;  3VWX A;  1SEN A;  2EIR A;  3HZ8 A;  4AKX B;  6GSU A;  3F6F A;  3VWU A;  1K0N A;  1ZYP A;  4KCA A;  3AY8 A;  3H8Q A;  3LFL A;  1VF2 A;  3RDW A;  5ID2 B;  2K6V A;  3IDV A;  2V6O A;  4EC0 A;  4EIQ A;  2YP6 A;  2LRC A;  4D73 A;  3KD0 A;  3UVT A;  2GZY A;  1K0A A;  3QD9 A;  3LW9 A;  1T00 A;  1ST9 A;  4BL7 B;  4BWQ A;  1ZZY A;  5BMU A;  4IN0 A;  1W89 A;  1ERT A;  5LNK e;  2LQQ A;  4TVE A;  1K0D A;  2H1A A;  4EO3 A;  5JWR B;  1A24 A;  2LJR A;  3A5I A;  1O7U A;  5ECH B;  1ZCP A;  1M0U A;  4X43 A;  2A4V A;  1Z7P A;  2XPD A;  3TJG A;  2J23 A;  1R26 A;  4XS6 A;  4ECI A;  2I81 A;  5KEJ A;  4POK A;  2RM5 A;  5DBQ A;  5CRD A;  2C8U A;  2QGV A;  2L57 A;  20GS A;  5DVB A;  3GTU B;  4JR4 A;  4X4J A;  3IA1 A;  1OC8 A;  1K3L A;  5J41 A;  1PN9 A;  3QFA C;  2FGX A;  1B4P A;  1NSW A;  2VM1 A;  1SKR B;  4E68 A;  2HZE B;  5IO0 A;  3DEX A;  5H5S A;  4GQF A;  5CRE A;  1DUG A;  2A2P A;  1Y6E A;  4FQU A;  1WPI A;  3EIN A;  1R7H A;  2CQ9 A;  3EUR A;  2H8L A;  1YF0 A;  3A3T A;  1G6Y A;  1ZL9 A;  2IFQ B;  5ABR A;  4AKG A;  4BVX B;  3K8N A;  5IOW A;  2IMI A;  1DE1 A;  5FWG A;  2ZUP A;  3KTB A;  2LJK A;  4KSO A;  1O8X A;  4I8B A;  3UJ1 A;  1TU7 A;  1XVQ A;  4I2T A;  1ON4 A;  1XFL A;  5GAP D;  4HOJ A;  1QFN A;  1PX7 A;  16GS A;  2KHP A;  3TJB A;  1SKW B;  1USB A;  4IBP A;  6GSV A;  4N30 A;  2H6X A;  2EFE A;  5GST A;  2RUE A;  3A5W A;  2IMF A;  4JR6 A;  4KAE A;  1SU9 A;  3CSJ A;  1TK0 B;  4IEL A;  3TOU A;  3ERW A;  3EC3 A;  7GSS A;  3IRA A;  1QXH A;  2HYX A;  3C73 A;  1GLQ A;  4O5U A;  4ACS A;  1T3B A;  5ECI B;  2LKU A;  2RUF A;  3R2Q A;  1JZO A;  5IMC A;  4DEJ A;  3P90 A;  4QL7 A;  3GRX A;  4EVM A;  4MF7 A;  1YJ6 A;  2GST A;  2FY6 A;  1OC9 A;  4NHW A;  4WBJ A;  4TKY A;  2AHE A;  4MLY A;  1PKW A;  4LL1 B;  3DKS A;  1W4V A;  4F0C A;  2X8G A;  1XWG A;  1YKA A;  4TN8 A;  4PQ1 A;  1C72 A;  4K1F A;  4ILF A;  3TJJ A;  2WRT A;  4O7H A;  1WJK A;  1X9S B;  2H6Z A;  5AN1 A;  3FZA A;  1YEP A;  1U3I A;  2H01 A;  1U87 A;  3GKX A;  4JU5 A;  2YJ7 A;  1Z9H A;  1GSD A;  1SK2 A;  4AGS A;  1FOH A;  2FNO A;  4RQR A;  1EV4 A;  1O81 A;  4XHM A;  4ISD A;  4IS0 A;  1WP0 A;  2WGR A;  4CHS A;  4GDF A;  2YJH A;  5A1N A;  4ZB7 A;  1EOH A;  2HRK B;  1XW5 A;  2B7K A;  4W66 A;  2G2Q A;  4K0G A;  2GS3 A;  5CP1 A;  3IHQ A;  4GSS A;  1ILO A;  1EEM A;  1AQW A;  2L6C A;  2H75 A;  4MK3 A;  2O5V A;  3GSS A;  4G0I A;  2EFD A;  1A2M A;  3ZL5 A;  4HDE A;  3IK9 A;  3GA4 A;  2IWT A;  3TRX A;  3IR4 A;  3QCP A;  1SL0 B;  1GL8 A;  2H66 A;  3I9V 2;  3F63 A;  2GQL A;  5LCZ A;  5IM9 A;  4MNN A;  2GSQ A;  3IOS A;  3HD5 A;  4XCS A;  3IE3 A;  2YAN A;  4AKI A;  1S3C A;  1G7E A;  1OAZ A;  5E59 A;  2I3Y A;  3TCO A;  2L4C A;  2AV4 A;  2LRN A;  3LOR A;  3EE2 A;  4V2N A;  4TXO A;  5F05 A;  4MA9 A;  2FWH A;  1T8E B;  3KMO A;  5EY6 A;  3IXR A;  5D96 A;  2M46 A;  2CVD A;  1THO A;  18GS A;  1GUK A;  3TKS C;  3MAK A;  2X49 A;  3F6D A;  4WF5 A;  2GQK A;  4NMU A;  3D0Z A;  3ISO A;  4IP6 A;  2H0H A;  4HI7 A;  5ECM B;  2C80 A;  4L0W A;  2AAW A;  2H72 A;  4Z2U A;  6GST A;  1RQM A;  2HFD A;  5D9W A;  2HRA A;  3FZ4 A;  1H4O A;  3CXG A;  2YWI A;  1TJD A;  2GT5 A;  3J7Y k;  3TKP A;  4JBB A;  5IMZ A;  2YV7 A;  3VPT A;  1BF5 A;  4CDO A;  3W6G A;  2HZF A;  4J56 E;  2X8H A;  5GZZ B;  2HSN B;  2IL3 A;  3GH9 A;  4F82 A;  1Z6M A;  2FA8 A;  1ZYE A;  3FY7 A;  4XS4 B;  2HSH A;  1M9A A;  3IBH A;  1TRU A;  3ZZX A;  5HR0 A;  5E4W A;  2PVO C;  4F2I A;  4PXO A;  9GSS A;  4ZB8 A;  3F4T A;  4FO5 A;  1X0R A;  2CX4 A;  1BJX A;  4TXV A;  2HSM B;  2V6K A;  4GWR A;  1AC1 A;  3MSZ A;  4IKH A;  5J4V A;  2K8V A;  4ML6 A;  1XW6 A;  12GS A;  3ZML A;  2H1L A;  11GS A;  1EEJ A;  1OE8 A;  5A34 B;  2CZ2 A;  1TRW A;  3GH6 A;  3VK9 A;  2OAC A;  1XW9 A;  3GL3 A;  2HLS A;  4LMV A;  4O5Q A;  1OKD A;  5D93 A;  2WB9 A;  1TI1 A;  8GSS A;  5EPF A;  1R5P A;  4I2U A;  4XRD A;  5DAL A;  3KZQ A;  2DBC A;  1PRX A;  5IPG A;  1YY7 A;  3UMA A;  2VAF A;  4KW6 A;  2O87 A;  3TKR A;  2H73 A;  2PU9 C;  1K0C A;  1GTI A;  1OKT A;  2JSY A;  3FR6 A;  3LXT A;  2YWM A;  3FEU A;  1GSY A;  3ERF A;  4PUA A;  4KX4 A;  2IME A;  3TRQ A;  1Z3E A;  1BAY A;  1TOF A;  3LJR A;  4TR1 A;  1SJ6 A;  1Q98 A;  4ULX A;  1PL2 A;  2ON7 A;  2VCZ A;  2H30 A;  2LQO A;  2ZNM A;  3JCM L;  3I6A A;  3J7Y b;  1KEB A;  4ZBD A;  2JU5 A;  4OMV A;  3WYW A;  2VUP A;  2MZC A;  1I9D A;  4RI6 A;  1TRV A;  3GIX A;  5COH A;  4F9Z A;  2K8S A;  2MYG A;  3L9U A;  1X5D A;  3HVV A;  2XBQ A;  3HXS A;  1ZOF A;  1YDK A;  3MDK A;  1UN2 A;  2PN8 A;  2C3Q A;  1PN0 A;  1Y25 A;  1JLW A;  4AJ7 A;  3M9J A;  4N3Z A;  2PUK C;  3F8U A;  5B6N A;  4N11 A;  3VI7 A;  2F8A A;  1GNW A;  3PIN A;  1TTZ A;  3DGQ A;  4MZB A;  4F0B A;  1KNG A;  3NIV A;  5A5K A;  2DML A;  3GN3 A;  4YH2 A;  3HVS A;  4ID0 A;  1TP9 A;  2GSS A;  5J4Y A;  5ELG A;  2GSR A;  2EFC A;  2OBK A;  4LLR A;  4ZBA A;  1K3Y A;  4ECB A;  3BCI A;  3A2W A;  5DAK B;  2FA4 A;  2XPE A;  2VCV A;  4OO5 A;  3IPZ A;  3G7J A;  3TJK A;  3F4S A;  4MZC A;  1H75 A;  4TOP A;  2K18 A;  4RUV A;  3ME7 A;  1J9B A;  2GDR A;  2L59 A;  5J47 A;  22GS A;  1GTB A;  5EVO A;  3WT1 A;  5ECL B;  2IMD A;  2A2S A;  1JFU A;  4FYU A;  19GS A;  3PR8 A;  3PGT A;  4LMW A;  2HT9 A;  3KTL A;  3BCK A;  4HQS A;  3WD6 A;  2G0F A;  3KP8 A;  1PL1 A;  3G7I A;  1GLP A;  5H5R A;  4PUR A;  5A5H B;  4CW9 A;  3P7X A;  2WJU A;  1N8J A;  3TJF A;  2R3X A;  4O92 A;  2H70 A;  2OAD A;  2GVP A;  5EL8 A;  1K0M A;  1ERV A;  4PX1 A;  3FHK A;  2VKZ G;  2ZCT A;  2QA1 A;  2KP1 A;  4PQI A;  3SBC A;  4Q5Q A;  1NHO A;  4QMK A;  3EYT A;  2K9F A;  2P5Q A;  2IIY A;  5D8I A;  3PPU A;  2GZP A;  5HFG A;  1GSF A;  1VF1 A;  5ECO B;  2CVK A;  3A2X A;  3GKN A;  4NPB A;  3UAR A;  2C0D A;  3F3R A;  2B6M A;  3H93 A;  4J2F A;  3HY2 A;  5AGY A;  4DSS A;  6GSX A;  2HRN A;  5H5Q A;  2KOK A;  2RII A;  4KCE A;  1GH2 A;  4EDZ A;  3VI5 A;  3BBY A;  1FHE A;  4V2L A;  2R2J A;  4HZ2 A;  4MH2 A;  3IC8 A;  3GX0 A;  5IIZ A;  3NZN A;  4Q5N A;  3HJO A;  4POB A;  4KDY A;  4K7O A;  2FCH A;  2FD3 A;  2MBT A;  5BRT A;  4MJA A;  5C00 A;  4L5L A;  3FYG A;  2QC7 A;  1FB6 A;  1A8Y A;  1V2A A;  1XWB A;  2JL4 A;  4HU9 A;  3O3T A;  4EL1 A;  2R0C A;  1XXU A;  2LEG A;  4OCE A;  3QDN A;  3TU3 B;  4G19 A;  3HDC A;  1GSS A;  4Z7X A;  4Z2T A;  2ALB A;  1IYH A;  2QKE A;  5HR2 A;  4CY8 A;  3RBT A;  2GGT A;  4L5O A;  4H86 A;  4V1A p;  4HJ2 A;  5B7C A;  2L6D A;  5B6M A;  2PMT A;  1U6T A;  2IPA A;  3CRT A;  3BD2 A;  3IK7 A;  2QA2 A;  1F6M C;  2PVQ A;  3WGX A;  4ZL8 A;  5DCH A;  3G9B A;  4CY6 A;  2YV9 A;  4MPF A;  4PNG A;  5AIS A;  1T1V A;  3W8J A;  2QSI A;  4HJM A;  3UL3 A;  4N0V A;  1O8W A;  3FZ9 A;  3M3M A;  4USS A;  3KJY A;  3DVX A;  3F4R A;  4DSR A;  2HI7 A;  3DRN A;  2GQM A;  1XVW A;  4N0Z A;  2CAQ A;  2DJ3 A;  3ZTL A;  5G5E A;  2I9H A;  5D9X A;  2AYT A;  5CRG A;  1SD9 A;  2J9H A;  4D73 B;  3DD3 A;  3H79 A;  3D4T A;  4ZB9 A;  4ZIJ A;  2B7J A;  2L5O A;  2YWO A;  2V1M A;  5IO2 A;  4RQX A;  3L9S A;  1PD2 1;  1B48 A;  2LNT A;  5BMU B;  3O6T A;  1N2A A;  5IMV A;  1VGL A;  1B4Q A;  2MMN A;  3M8N A;  1BG1 A;  2YPM A;  4YQV A;  3KH7 A;  2XHF A;  3UOM A;  3Q18 A;  2H74 A;  4XS1 A;  2AJQ B;  3VWW A;  2PWJ A;  2VIM A;  1UVZ A;  2AUV A;  2CZ3 A;  1SJZ A;  2OT3 A;  4RI7 A;  1DSB A;  5D9V A;  2X4A A;  1XOA A;  1PGT A;  5DDL A;  1FB0 A;  1UA5 A;  1AXD A;  4FYC A;  5ECR B;  4KE3 A;  2C3N A;  4BVY A;  3FMW A;  3N5O A;  2OE0 A;  3FW2 A;  4EUY A;  1QMV A;  5J4U A;  4ECJ A;  2HQT A;  4G01 A;  4OCF A;  4OFN A;  4K5S A;  4HZ4 A;  4K9Z A;  2OA7 A;  1CQG A;  1WWJ A;  3IAM 2;  4IQ1 A;  1SK0 A;  3H4K A;  1FO5 A;  1YEX A;  4KDX A;  1FOV A;  2B1K A;  4YAP A;  3RHC A;  2IMK A;  3G7Y A;  4ZIL A;  5LD0 A;  2WZ9 A;  2R5G A;  2DJJ A;  2YCD A;  4XTS A;  1SVL A;  2F8F A;  1QK8 A;  5G1K A;  1NM3 A;  2RM6 A;  2IJY A;  1LBK A;  1U3A A;  1SYX A;  2F51 A;  1OC3 A;  3KMN A;  3LGC A;  1KTE A;  2EC4 A;  3BOA A;  2HSY A;  2TIR A;  2UZ8 A;  3LYK A;  5CO3 A;  1T4Y A;  1N25 A;  5JCW A;  3Q74 A;  4ZXG A;  3HA9 A;  2V32 A;  1EOG A;  1A8L A;  1SKS B;  3E0U A;  3LEF A;  3TUE A;  2DMM A;  4PUF C;  4TR3 A;  3OR5 A;  2P0G A;  4TR0 A;  1HNA A;  4JZQ A;  4MPG A;  3ZLP A;  3APS A;  2R6K A;  1X9W B;  3LWA A;  4FH8 A;  4IJ3 A;  1CQH A;  2YZU A;  4LA1 A;  4MJB A;  5GAN D;  1V57 A;  3D5J A;  5ENU A;  4QL9 A;  1XBS A;  4L8E A;  1NHY A;  1VF3 A;  1GRX A;  2F9S A;  2WUL A;  5HR3 A;  1TDI A;  2VLV A;  2O89 A;  4QQ7 A;  4O5R A;  1HNB A;  2CT6 A;  3FK8 A;  2DJ0 A;  1OC9 B;  1ERU A;  1RK4 A;  2EIQ A;  3KEB A;  3DML A;  3ED3 A;  2VM2 A;  2B3S A;  3PH9 A;  5B8A A;  1GSQ A;  1M9B A;  1QGV A;  1ZYQ B;  5L71 A;  4EKZ A;  5ID2 A;  3D22 A;  2VO4 A;  1WIK A;  2H1G A;  1F2E A;  2BMX A;  3TOT A;  3ZIJ A;  2C0G A;  1ERW A;  3KCM A;  5ELA A;  5FHI A;  5J3R A;  3HKR A;  5KN1 A;  4GF0 A;  2DLX A;  5IMF A;  5IMD A;  3U6V A;  2R0G A;  4WET A;  1G6W A;  4BL7 A;  1SL1 B;  2LUS A;  2BJX A;  2I4A A;  1GUL A;  5J40 A;  2FUG 2;  1Z6N A;  3FRC A;  5J9C A;  1J08 A;  2O7K A;  5IPH A;  3MWH A;  3WGE A;  1XWC A;  2NBS A;  5A1N B;  1AQV A;  2GT6 A;  5ECQ B;  2O8V B;  4YQM A;  2VL2 A;  2JAD A;  3DVW A;  2N5F A;  3TRP A;  3ZVJ A;  2VCT A;  3TDG A;  4ECC A;  6GSS A;  1TRS A;  3CSH A;  1TW9 A;  4GTU A;  3GTU A;  3ZIT A;  2HXK A;  3RPN A;  3IV4 A;  3KGK A;  1ML6 A;  4EDY A;  1V40 A;  1M2D A;  3A2V A;  2HZE A;  1BYE A;  1VRS D;  1V58 A;  3P8W A;  3HJM A;  4GLT A;  3VWV A;  4MF5 A;  3Q6O A;  10GS A;  5AIX A;  4I6X A;  3UIW A;  2H0G A;  1PKZ A;  2D2Z A;  3GFK A;  5IOX A;  2X8C A;  2RLI A;  4PNF A;  1PSQ A;  4K0N A;  4HU7 A;  4LL4 B;  5J9B A;  3HMJ G;  2IFQ A;  1LU4 A;  4KA0 A;  4GRF A;  3M0F A;  4BVX A;  2P5R A;  4MH3 A;  2ON5 A;  2NPB A;  1E6B A;  3WGD A;  1ZMA A;  4TXO B;  2WS2 A;  3QMX A;  3VUR A;  1J0F A;  3P2A A;  4Z2R A;  1MDJ A;  3EWL A;  1EGR A;  3LQ7 A;  1MDK A;  3ZMK A;  3D4M A;  2C4J A;  2MMA A;  3L78 A;  4O32 A;  4YKF A;  1GUM A;  3H1N A;  3C8E A;  1BED A;  4JE1 A;  1B8X A;  1EGO A;  2OBI A;  4K7I A;  5F8B A;  4WF4 A;  3GHA A;  1PQN A;  1ZGN A;  1M99 A;  1AQX A;  3LG6 A;  2R4V A;  3GYK A;  2VL9 A;  1TKD B;  3RPP A;  1MEK A;  3ZVJ D;  1RW1 A;  4GCI A;  1XZO A;  2CAI A;  1FAA A;  1XPV A;  5IMA A;  2TRC P;  4IQA A;  2HE3 A;  3F0I A;  2VLT A;  3HCZ A;  1T4Z A;  1A2L A;  1Y1U A;  2P31 A;  2VCW A;  5D9T A;  4FYB A;  2DC5 A;  4KSM A;  3KXO A;  1AUC A;  4JED A;  1GWC A;  1A0F A;  4KF9 A;  2YN1 A;  1X9M B;  4N10 A;  2V2G A;  4E8E A;  2PGT A;  1OYJ A;  2GZZ A;  3TB2 A;  1X5C A;  4NV2 A;  4BWS A;  3TGZ A;  3CMI A;  5A4U A;  4K5R A;  2ES7 A;  6GSY A;  4X1U A;  2X64 A;  4OWY A;  2H0I A;  3UVH A;  2UV8 G;  1JHB A;  2EFH A;  3GNJ A;  5JCG A;  4KND A;  2HRK A;  2C3T A;  3MIX A;  4KGI A;  4PTS A;  5HFK A;  1M7T A;  4NWY A;  5C04 A;  14GS A;  1XOB A;  2YOI A;  1F37 A;  3WT2 A;  2LV3 A;  3APO A;  2DIZ A;  2VD0 A;  3CYN A;  2VCX A;  5DAL B;  4V1A g;  1XIY A;  2CV4 A;  17GS A;  4OD7 A;  1BG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...