5ANHA

Crystal structure of laccase from basidiomycete pm1 (cect 2971)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
496
structure length
496
Chain Sequence
SIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGPAVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHTFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVDNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTTQTPSTQPLVESALTTLEGTAAPGNPTPGGVDLALNMAFGFAGGRFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATSAAPGFPHPFHLHGHTFAVVRSAGSSTYNYANPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-Designing the Substrate Binding Pocket of Laccase for Enhanced Oxidation of Sinapic Acid
doi rcsb
source organism Basidiomycete pm1
molecule tags Oxidoreductase
molecule keywords LACCASE
total genus 134
structure length 496
sequence length 496
chains with identical sequence B, C
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5anhA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5anhA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5anhA03
4P5SA 3HEIB 1KCWA 4KNUA 1GYCA 4YSCA 1JZEA 1QHQA 1AG0A 2GHZA 3SBPA 4DPCX 1PY0A 5I6MA 1N70A 3S8GB 3PAUA 1J5DA 3GXUB 1ASOA 3T9WA 2JXMA 4Q8BA 1NIFA 2E86A 2IH8A 2HLEB 2FQEA 2PP8A 4YVNA 3TU6A 2OCCB 2DWTA 3H4FA 3HB3B 2VSMB 1ILSA 1PNCA 1M57B 1AS8A 3QJRB 1OE1A 5I6NA 2XLLA 1NDTA 1SNRA 3FU8A 2VMJA 1SF3A 3FU7A 4X4KA 3WNJA 1EHKB 3PAZA 1ASQA 1ET7A 2B3IA 1JVLA 1XB8A 2Q5BA 4AX3A 2FQDA 3T71A 5PCYA 1WS8A 5B1BB 2WSDA 1NIDA 3AW5A 3PPSA 5I6LA 5B1KA 1BAWA 1AOZA 1ZPUA 2IDSA 4DP4X 1FWXA 1GS8A 1RZPA 2EIKB 4KNSA 2XWZA 2DYRB 3X1EA 2BO0A 1ET5A 1OE2A 2BP8B 4KOBA 3NJKA 1IUZA 1X9UA 2JKWA 4CSPA 3AG3B 4KO6A 1SHWA 1L9OA 2PCYA 2PPCA 1JZHA 1E30A 3NSCA 3FQ1A 1E67A 1MG2C 4UANA 4G70B 1V55B 4F2FA 4E9YA 3SBQA 3V9CA 2PPFA 3MX0B 1PLBA 1TU2A 5ANHA 5TK4A 1A3ZA 2YAHA 1PZCA 3NJLA 3T6VA 4E9RA 3D12B 2XX0A 3NSYA 4BWWA 1ADWA 2FT7A 2IAAC 1FFTB 3PXLA 2CCWA 3WG7B 1E65A 4DP1X 4YSUA 1A65A 4MFHA 3NJFA 4E9TA 1AAJA 3FYEB 2FQGA 4HHGA 3CVDA 2CALA 3L45A 1I53A 3TBCA 5IY5B 1J9SA 5B7EA 3CDZA 1JOIA 1RCYA 4E9WA 4BWUA 2UX7A 4A2FA 4YSEA 5D4JA 1NWOA 5E9NA 2J56A 1FA4A 1AANA 4F2EA 1AQ8A 5AKRA 1CUOA 4DP6X 3GDCA 4AKPA 4DP2X 2HXAA 2WO3B 2FJSA 4G7RB 2GB2A 2PPAA 5I5JA 9PCYA 3UACA 4BWTA 1ID2A 5I5IA 2UXGA 1BQ5A 1HAUA 1QNIA 2VSKB 2R7EB 2YARA 3ZIYA 2VM4A 2UXFA 4CSZA 1TEFA 3H4HA 1NPJA 2BWDA 2DY2A 4HZ1A 1V54B 4P5RA 2X88A 4N4YB 1JXGA 3FU7B 1M9WA 4HCGA 2A3TA 5TK2A 2XUWA 4JKNA 4QKTA 1B3IA 4N8UA 1TKWA 4G71B 1JERA 4W1TA 1KBWA 4E9XA 4E9QA 4PAZA 4AKQA 2FQFA 1HFUA 1ZIBA 1A8ZA 1A4AA 5B3SB 3UAAA 5B1JA 3UAEA 2BZ7A 2PP7A 3FQ2A 5D4HA 5I28A 2XXFA 1KGYE 3CDZB 2ZONA 3OD3A 4BK5C 5B7FA 2YXVA 1QLEB 3FQYA 3IEAA 1KDIA 2OV0A 4BDVB 1WAEA 2XX1A 1AR1B 3FYIB 3AG1B 4NAJA 5F7AA 3N55A 3SQRA 2XU9A 1AACA 2DV6A 2XV3A 3BVDB 1YLBB 3QQXA 4NERA 4A2DA 2IWFA 6PAZA 4ZK8A 1BYOA 1EZLA 3QJQB 1F56A 2W8CA 2AVFA 2PCFA 1NICA 2QT6A 1KYAA 2J55A 1DZ0A 1GY2A 5A7EA 4WKXA 1KV7A 2FT6A 4KO7A 2GI0A 2GC4C 5D4IA 1CC3A 2ZXWB 1PCSA 2FNWA 3IN0A 1N68A 3GYRA 1V10A 3S3BB 4YSOA 3C75A 1OCCB 3EH4B 3ZBMA 2IDTA 3NJNA 4WTQA 4ENZA 2J57A 2VW6A 4Q89A 1OCOB 1RZQA 2XV0A 2HRGA 1GSKA 3X1BA 1CURA 1JZGA 2GIMA 3UGEA 1JZIA 3WIAA 3DTUB 2YAFA 3QJUB 6PCYA 1PLCA 2VW7A 4YVUA 1ZDQA 4KO5A 3T6XA 1PMYA 2UX6A 4UAHA 4FA7B 1J9TA 1SDDA 3N2JA 3PAVA 1ET8A 5I6OA 4YSQA 1OOWA 2OJ1A 3OMNB 2YAMA 1AZBA 1PNDA 3QJSB 5AFAA 1GS7A 4JHVA 2PLTA 2JFCA 3OMIB 1T5KA 3AZUA 2I7OA 1L9TA 3ERXA 2W88A 4DP8X 2FWLB 2XVBA 2X87A 1L9QA 1PZAA 1XMEB 1NINA 2AANA 5FC9A 3X1NA 1TEGA 4F7KA 1JXDA 1GS6X 4AKOA 4JHUA 4YSAA 1SF5A 3IN2A 3IBOA 4RH4A 2FTAA 2ZWNA 3ABLB 3T6WA 4DPBX 1CYWA 2IWEA 2EILB 5EHFA 1XB6A 2XYBA 1SDDB 2I85A 1W6LA 3EF4A 3UABA 2CAKA 7PAZA 4UF7C 4GP5B 1IC0A 4AI7A 3FS9A 1AZUA 4DP9X 5LDUA 3S8FB 1WA1X 4K9JA 7PCYA 3X1GA 2IDFA 3AG4B 2AZUA 2VW4A 3TASA 2B08A 4A2HA 2BZCA 4KNTA 1PZBA 2H47C 3ABMB 8PAZA 4M3HA 4HCFA 5B1AB 2DYSB 3V9EA 2YAQA 4A2EA 4M4RB 3NSDA 4GYBA 2BHFA 3NYKA 2XV2A 1AZCA 2HX7A 2MRYA 5I6PA 3FT0A 1VLXA 2P80D 1RKRA 3QPKA 4GP4B 3ZX1A 4A2GA 3FPXA 3G5WA 3KW7A 3FSVA 3ASOB 3X1FA 1DYZA 4HCIA 2CUAA 3OM3B 1A4CA 2XXGA 2J5WA 3NJJA 2BP0A 2PP9A 4KO9A 1E5YA 4AZUA 1L9SA 2IDUA 2HZHA 3MBWB 2IH9A 3OQRA 1SFDA 5B1JC 3ABKB 2GC7C 3WI9A 1AZRA 1PLAA 2YXWA 3BQVA 3NJIA 4YSDA 4YSRA 1ZV2A 3TA4D 3FU9A 3FSZA 1JVOA 1J9RA 1R1CA 4A66A 2HX8A 3NP4A 4A67A 1L9RA 1MDAA 3U25A 2EIMB 4L0PB 2PPEA 2R7EA 3CZUB 1X9RA 3DKHA 4DPAX 3WKPA 2Q9OA 3NJMA 1M56B 4YL4A 1HAWA 5F7BA 2AFNA 4TXVB 2TSAA 1NWPA 1URIA 1KDJA 1BQKA 4YSPA 2PPDA 5AZUA 2QDVA 2YAEA 1OF0A 2GBAA 4DP7X 2H3XC 3X2QB 4EF3A 1ZDSA 3WKQA 2HRHA 1OE3A 4BXVA 4GP8B 1UATA 3FSAA 2EINB 1E5ZA 5I6KA 1KCBA 3KW8A 4G7SB 1BXUA 2N0MA 3H56A 2AZAA 1BXAA 4BDVA 3AG2B 2VN3A 4DP0X 1L9PA 2I7SA 4QLWA 3PCYA 4NB7A 1BEXA 3EH5B 2YAPA 4HALA 3T6ZA 1BXVA 1MZZA 1BYPA 1NTDA 1SJMA 4FAAB 3IE9A 3FPYA 3PLYA 1AS6A 1ASPA 4PCYA 4YSTA 3ABGA 2CJ3A 1NZRA 1GW0A 4HIPA 4DP5X 1NIBA 3RYMA 3FSWA 3DIVA 1MZYA 1W8EA 3QJTB 2RACA 2YAOA 4W9ZA 3CVBA 4KOCA 5B7MA 2GSMB 2Y1AA 2WO2B 3JTBA 2BP8A 2YQBA 2QPDB 4E9SA 1AZNA 3EH3B 3QJVB 2ZOOA 3SBRA 1J5CA 3NSFA 1WS7A 3NJHA 1A4BA 1NIAA 3UADA 1NIEA 2EIJB 5I5MA 4BXSV 1SFHA 3ZDWA 1WA2X 1IBZA 1OV8A 1GR7A 2UXTA 1W6WA 2CBPA 3JT2A 1GY1A 1ZIAA 4A68A 1IKOP 3OMAB 2LLNA 1AS7A 1AIZA 3WNIA 2HX9A 1JXFA 1JZJA 1XB3A 3NP3A 2P80A 2BW4A 3CG8A 3ASNB 2IDQA 2DWSA 3NT0A 1PAZA 2IWKA 1ILUA 4HAKA 3AY2A 4YSSA 2BP0B 2UXVA 1KBVA 1OCZB 1SHXA 2QDWA 2VM3A 1AG6A 1MG3C 2Y69B 1PF3A 2QPEB 1NPNA 4G72B 1J9QA 4G7QB 1WA0X 1CYXA 1ETJA 1IBYA 1JZFA 3EHBB 5I26A 2H5UA 1OCRB 2BWIA 5PAZA 3TBBA 3NJGA 4HHWA 2FT8A 1BQRA 2NRDA 3S3DB 2TSBA 2MTAA 3S3CB 4E9VA 4GY4A 3CVCA 4GXFA 2BW5A
chains in the Genus database with same CATH superfamily
4Z0BL 4HA1A 4JZNB 2B9AA 4DPRA 1XF5A 5BV7H 2LE9A 3R18A 4KK9C 1DLFL 2ENPA 3PV7A 3LKPA 1PIGA 3D18A 4QRBA 4NJAH 1HE7A 4EDWH 3OPZH 3EH2A 4Y4FD 4FJZA 1G7HB 1ASOA 2K3TA 3T9WA 2KDYA 1XAUA 3COOA 4O51B 3L3JB 3B9KC 3FT4B 2A9BA 2GQHA 5AD0B 1T1YA 4JKPL 2P4AB 1GGCL 3B8SA 2BVQB 2IANE 2VDNB 4X7SL 3ZMRA 2CUIA 1F0LA 3EGDA 1V7NL 1WT5C 1ZHNB 4D0DA 2A2QT 2VXQA 2XQYK 5IMMA 3JVGC 5E99L 1VFAB 5INCB 2MNUA 5CINL 4MDRA 5CHNB 5K93A 4FQ1H 4L4VA 2V9RA 3E6HB 5EU6E 1BLNA 2DJMA 2HFGL 1KZQA 4G6KH 2QGBA 3TV3H 1ZA3A 4MAUL 1OGAA 1DBJL 3OKDB 1IVTA 1YG9A 5D6CB 2QPUA 5CCKL 2QZ5A 4N90E 3FCSB 1VAHA 4JRFA 4NRYB 4LCCA 2VDKL 1EJOL 2FHFA 3RUGE 1BIIB 3OSVA 1GS8A 43CAB 3GMQB 4RA3A 1IILE 1W15A 2BP8B 4BKSC 3B9KA 3GGWB 4V2BA 3SPHA 4FFZA 5CINH 1EVTC 1WAAF 1CVSC 2B16A 4MAYC 2EO7A 4OLWH 5I0VA 2X6AA 4NP4L 3OX8A 2PCYA 5T3ZD 1R75A 3FQ1A 1IFHH 2P8PB 4LT7A 5E0FA 1IFGA 2HKFL 2X70B 4NIKB 3SBQA 1GH7A 2A9AA 4A7QA 4KTEL 4H2AA 5LVEA 5IOPB 2K9UA 1TZIB 4WNQB 3HKZA 2FT7A 3HNVH 1G6RB 1AY1L 3BQUC 2O61A 1FFTB 4HWZA 3TPKA 3T0WA 4N2EA 4PJ8D 3JWNC 2AQ2A 4PEEA 3KBHE 5FGCB 3QI9A 4YX2L 1TZ8A 2FNBA 4AK1A 2CBQA 3SYPA 5JW4N 2XZZA 3ZQXA 4F8TA 1C08A 3BEVA 1ZANL 3QDJD 4BFJA 1NWOA 5ID1A 4JO3H 3H9ZA 1EEZB 1AQ8A 3KPSA 1U3YA 4OGYL 4PVLA 4DP6X 1J0JA 2OMVB 3N06B 1KBBA 2L3BA 3GD1C 4L37A 2HXAA 3FQXB 1NGXA 4PJCA 5C07B 4Y5VB 4XBPB 5DZVA 2PPAA 4ZPTA 5E7BA 3QQ9C 5I1AA 5EUKA 4TSBL 2HWZH 2OMBA 4HZLA 5E94B 1TETH 4LHUG 5SX4H 3V79C 4N2KA 2ODHA 3LQAL 5CJ8A 3SOBH 5I66A 1IGJA 1MN4A 3QCUH 1IM3B 1ZXKA 3V4VH 4MD0B 4JFOA 5I2IA 1JPTL 3V52H 3OKNB 2AEPL 4K9EH 5BO1H 3Q2CA 3PQYA 4OGXL 2APFA 3HI5H 5MERB 4XCNA 2QR0A 1A6ZA 1XAKA 4W1TA 4FXLA 5LBSA 2IMNA 2HMIC 2ADIB 5GJSH 3HC3H 8FABB 4R7DA 2EDKA 2IVFC 2ATKB 4HISA 4ZNCD 1I8MA 1VZGA 3H9SB 3EJZD 3EO9L 3JV6B 1TU2B 5DFAA 4LEOA 3UIZA 3ES6B 4WWKD 4GFXA 3RVUC 5DR5L 1B0RA 2LU3A 1NC2D 2F68X 3ZW3A 3KD4A 4GAFB 2NY4B 3GNML 1CE1L 4L05A 4XCEB 5BOZG 1CDCA 2J8UB 3QI9D 1EANA 4EO5A 5IF0A 4XNUH 4UQ9A 3BRGC 1WAEA 3AITA 4WI6A 2XX1A 3OX8B 3VXUA 2EIDA 1WHPA 4F27A 3FQRB 4F58H 5K9QI 3BVDB 4OVVA 2IWFA 2QFRA 4UM9B 3AAZA 4B53A 5IP4A 5LAPA 4KK8D 3PQYE 3HRZC 1DZ0A 4KHTH 3G5ZB 1LP9B 2V0AA 5I82A 1GCYA 4KO7A 3W9EB 4F57H 2RJMA 4H13C 3TYGL 3IN0A 1CFMA 1BFSA 3RPIB 1AGCA 4LKCA 5CCHE 3MYJB 3BVNA 4AYGA 1VEOA 3MNZA 4XPHL 5CEZL 1OCCB 1A14L 1JFQH 3CFNA 1ECYA 4OGAC 4FHJA 3AMLA 3CFKB 4EIGB 3CXDL 2O5YL 4YUEH 1JPSL 5EO1A 2CO3A 3L3OB 4PGBA 1WBYB 4NLHA 4G7VL 3FQ4A 4GBXC 1PX4A 4P2YA 4XVUD 1JWUA 1JCKA 1J0ZA 3BSZA 4LQFL 3GFUA 5IM7A 4JVWA 5AW0B 1E9OA 3DJSA 2AKRB 4XNZC 2R0KH 1MIML 1T22B 4CAGA 3BJ91 43CAA 4D9QD 1GS7A 1X9QA 3JWDC 4PD4J 1NFIB 1T5KA 3NGBC 4KHXL 4Y1AD 3CIAA 3BUYB 4HK3J 2BSSB 3W9DB 3HN3A 3ZDXF 3ARFA 3VDAA 3FSOA 3JWOL 4A63A 4G3YH 1IEBA 1HYSC 5LCVA 2WXIA 2Z8WC 2DJUA 1YQVL 4Q97A 2VAAA 3NQKA 3MV8B 1BJ1J 3GMLB 4B9KC 3C60D 1IFRA 4IK7A 3UDWC 2E7CA 5C0BD 5HHOB 4CMMB 5D7JD 2W9DH 1SF5A 4KK5C 3P3TA 3ISRA 4HKZA 3IBOA 2VM9A 5HHQB 2EILB 3RVUD 3KPRD 4NHCH 3P0VH 2WXQA 5C0AE 3JWOH 5HGBA 4HWZB 1S7WB 2B1HL 3HRZA 4LLUA 4PLKC 4RFEA 4Q2ZA 3RTQD 4Q9RH 1NAMA 1LO4L 4NZUH 2XCMC 3RDTB 1KUMA 2GJZA 2EH7H 2NY0D 1QLFA 5DMKA 3S4SG 3TBVA 5JW3L 1CLVA 3LTVA 2E3VA 2A7BA 5L8JB 3HCVA 2ZJSL 4W9CC 3NAAH 4MTMA 4EUPH 3CBRA 3MXVH 4HT1H 2DYSB 4LK4A 3BDYL 2F58L 3MV9A 3GKWH 1LO3L 3U6RB 5T3XL 3MOQA 4JFEB 4LO9A 2ERJB 3L2NA 2DEXX 1WF5A 5E08H 2VDOH 3CMGA 1N7ML 1QI3A 3CUPB 3MUHL 3O6MH 3NJJA 2BP0A 2OAAA 5EC1A 3A6CL 1FJ1B 1E5YA 1FFOB 5IHZA 3NRFA 3HFFA 4XR8C 4P46C 1CI3M 1KJMA 3MJ9L 5CR1A 2XWEA 3MQIA 2WZPD 4GO8A 4QNPF 4DZ8A 5B1JC 5JHMA 5GJTH 4I0PC 4PIRF 3WD5H 1PYWB 3KBPA 2WY3B 3F01A 5FB8A 4I18B 3UC0L 5C0DB 3DXAE 4MD4B 2Z4QA 4UOW0 1R1CA 5IWLA 3VFSB 5CNHA 1W0WB 1KTDB 1A6ZB 5DJ2B 5TTRA 1J86A 3GLDA 3QWOB 3ZKNC 5BOJA 3V4PB 2XVLA 4U7KA 3DKHA 5JLZA 1T22A 2O6DA 3MLRL 5GGUB 2Q9OA 3S3PA 4Q14A 1AYOA 3MRRB 1T5WA 1XIWC 1TYRA 3ARTA 5E1AB 4YR6B 5HDBB 1MFAL 2V9QA 3CH1B 3MKGA 2WLLB 3QFJD 2JJUA 2BHYA 3HE6A 2HTLC 3W0WE 2FIRT 4R7XA 1LE5A 4XCEA 5K33A 3UYOD 2GJ6B 1DLHA 3DIFB 3QUGA 2HFEB 4I89A 5CEXA 2ZX9A 5CN2A 3BP7B 4NO2A 5HPMA 1IJNA 1GYWA 1ZSHA 2HFFA 3E8UH 3MLVL 2XKNB 2B2XL 2ENJA 3BT0A 3LIUA 2RQ8A 3NIDB 3ESMA 1VGEH 1NQBA 1VPOH 4XMTA 3S48A 1OE3A 1UB5A 3K6SA 3FHQA 4I8DA 2XZCL 3HUJE 2VDQH 4GRMA 3WUWB 4CADA 4HOXA 4ZQKA 2W07B 2R0LL 4LLUB 1JNNL 4HSCX 3BPOC 3K6FA 1MCOH 2H32A 3QNYB 2EC9T 4F2MB 1E8ZA 4GBXB 5EIQA 1IC7L 4I5BA 3S8WA 1CGVA 3RWHB 4IU2B 4FAAB 1KBPA 1U3NA 5IKCA 4FQHB 5KSUB 1WWBX 1NOFA 2RFXA 4Z95H 3VW3H 2A83A 3DX8A 5JOFA 3NJXA 2F5BL 1G7PA 4X9YA 4KQ0A 2XZCH 4D0CB 1QTPA 4Z0BH 2IBBA 2Q76A 1LWHA 5IM7B 4FABH 3O3DA 1JS4A 2WKOA 4JPVH 3T09A 5MI0C 1R5IB 3IT8D 4JZJA 4R0LB 2Z34A 2E7BA 2EO1A 4RVBA 4E9LA 1O9WA 5ES4B 2CO1A 5DHVH 3EYOB 4J3UA 3OJMB 2ALAA 2G2RA 2BWQA 5IGXL 5EC1B 1FL6A 5BS0E 1NPUA 1JCVA 1ZWIB 2JK5A 3T1FA 3GMRB 5GGSA 3RVTD 1IKFH 1ETA1 1LWJA 1AS7A 2HN7B 3LY6A 1GKEA 1PG7H 3JWDL 3KJ4B 4M61A 1UURA 1WBXA 2NUPA 3MMEB 3RU8L 4I18A 4S1SL 5LQBL 2PW1A 3NN8A 3IJSB 1DJWA 2EDRA 2ZZUT 4KTDH 1DQML 1T5XB 5DUBB 1NBZB 4LGSB 2YMXH 4UUJA 4Y89A 1MI5E 1IBDA 4XMVA 5T5NF 2DQUH 1OCZB 3AABA 3P3SA 3VJ6A 3MRLA 1J88A 3LZQA 4RLDA 4PJEF 3ZGIA 1EO8H 2P8MA 2GKIA 1RIVL 2AJSH 2QPEB 4C4KO 3FMGL 1D5ZA 2FHCA 3O6FD 1LO3H 3SGJC 1YQ2A 3MLXL 4OD2B 4PWFA 2EIBA 4YAQA 3SDAB 4NFCA 2W59A 4G8GA 2YGVA 2BIMA 4ELDA 4QTIH 3KPLB 2FT8A 3DUHA 1BAFL 1CT8A 3MREA 3QJFB 4R3SA 4AITA 5MENE 3EYUH 4WJ5B 5T1JA 2JKLA 2JVUA 4Y5VC 4FQXC 1GYCA 5AWNH 1GZQB 4G11A 1DJYA 1JZEA 1SXNA 4G80B 1T0MA 5DD0L 6FABH 3LV3B 1BVOA 3GXIA 4PREB 4N0FA 2VZOA 4LXFA 4XB8A 1N70A 1BBJB 2GI7A 4MNQA 2BRQA 3VM5A 4HKBB 1BCIA 1VGKB 2IFFL 2BRRL 2NZ1A 2VLKE 3ARPA 1JPGA 4FQQB 1SM3L 4NQCE 2PP8A 5FUOL 1RIHL 4JFHE 4MXQD 3CBKB 1TJHL 1CVRA 3NBNA 1JF1B 3VFGL 3VQ2C 3WBDA 3KDMB 3DX3A 4FKEA 4NNPH 4L9LA 1KGIA 4UU9A 2VUOA 4W68A 3MBWA 3BP4A 5C0CB 4MMZB 4S10A 1G9NH 4PJFA 4QD2E 2JKTM 3FO2B 3HBGA 3JZ7A 4Y2OB 3TP4A 1U4EA 4GUOA 4MAZA 4NN6B 4RRPG 1MHCB 2PABA 4UI2A 1MJJB 3FU6A 3OZKA 4MSWB 3PHOA 2MOQA 4ZFQA 4LSTL 1NCWH 4Y5YB 5FLVA 3GRBA 4ZMZA 4XODA 3K3QA 2WXOA 2EZ0D 1RJLA 2YQ3A 3BE1L 3H7LA 1WZKA 3OJDB 5F7KC 3BAEL 3STBA 2EDMA 4KNSA 2X09A 1A6TB 1UKSA 5G5DA 5T3ZL 3C60A 4MA3A 1UM6L 3DX7B 2ENSA 2P48B 4AG4L 1CDBA 4HSQA 4HU8A 5J89A 1P9MA 1YN7A 2Y6SC 3ZYJA 4IRZH 1TTRA 5J1AB 2Y4SA 3DGCR 1NAKH 3NFPA 4F3FB 4JDTH 1FL3B 1YYCA 2FO8A 2W07A 3VJ6B 4UANA 2FEDD 4G70B 4AYMC 4WU5B 4NO3A 2PWGA 4PHXA 5IHUH 1D9KB 5K59E 1P5UC 3FCTA 1HH9A 4KV5E 5T1MA 4MMZC 1GPOH 1UYWL 3OVUB 1NCAH 4U7SA 5FCUL 3VXQB 3M8OH 5DF0A 5KSUA 2R83A 2X4OA 2J1ZA 5TGBA 1T6BX 1H8NA 2YGQA 2CO4A 2EKSB 2DMGA 1ZGLM 3BZ4B 3ZL2A 2EAEA 1N6UA 3WN5A 4XNYH 1F00I 4PJAA 3DOHA 3UZQB 5IY5B 3SOTA 1RCYA 1ZA3B 3UFIA 1KFGA 1JGLL 3NZUA 4A2FA 1CGSL 1B9KA 3FCSA 4HJ0C 3UZEA 2ENYA 4FP8H 5A16A 2NNXA 1XGPA 1DZBA 2B3RA 4ODBD 4QXTA 2C7UB 4YPGB 1NLDH 4AKPA 4KNQA 5HHPB 3FUHA 5KVGE 3Q2NA 3LB6C 1FVEB 4H20L 5HYJE 2VZ3A 3CMOL 1BLNB 4O4YH 4N0RA 2F8XC 1X5FA 1JN6B 1JWSA 2DQIH 4OCNC 4MQ7A 4E42B 2MQCA 2O30A 2EYSB 1FP5A 1B0GB 2B1HH 3U1SH 4K94H 4TQEL 4M5YL 3V7MA 1T5XA 2V7NA 1FDLH 3ZIYA 1IE5A 2BSCA 4ZS6D 5DHDA 2VQ1B 1YY9D 3KPQB 1G9HA 5FO2A 2R27A 3IKKA 5AW8B 4Z78A 4ZT1A 5C0BA 1G7HA 4PJXF 3DBXB 3APFA 1GZPB 1N8OE 1AC0A 4U4BA 3WYRA 3TTSA 1EGJL 4U0QB 2DLFL 4MJ2A 3AU1B 3P4NA 4A55A 2M1KA 4IKKA 4YDMA 4AEHL 4N9GB 4DKEH 4JO3L 4PWKA 1IQDB 3CXHK 4AGOA 2PNDA 1EJ6A 3B9DA 4XMPL 5EBGA 4TSCH 1JE6A 2A6KA 3V55A 4TQIA 3GLEA 3LB6D 4TULH 3ZO9A 2J25A 1SJHB 2CDEB 4ICWA 1LDPH 3MRQB 4FC3E 1A6WL 4NKIH 4NPKA 4M62L 1AKJD 3QEQB 3E6FB 3QEGH 4LOFA 3N55A 2XU9A 3L17A 4F33B 5C0IB 3EGXB 1KN2H 3IMSA 3FQUB 2AJSL 4F2ME 2ZXEB 3Q1SH 4AMWA 4AGPA 4DJMA 1A9VA 5HHXL 1LK2B 3Q9QA 4PTTB 4FQJL 3T8XB 2R4SL 4P3DA 5CEYA 4N8CH 2WXHA 4JFQA 4XP1H 2HH0L 4IK6A 1N26A 4PJ5E 4IJ3C 1LE9B 1NEZG 4HZAA 3GZPA 4G83A 1KJ2H 5GS1B 1NKOA 3GHPA 3QAZC 1M05B 2NSQA 2CJUH 2R2BA 2X2IA 3C6SA 5E6IC 2UWEA 4Q89A 1OCOB 4PJXB 3UPCA 2ETWA 4APQC 3OB0H 4XOAA 3DVNB 3WFHB 2CGRH 2LHAA 2VIRB 2YSSB 1PLCA 1RH8A 2VW7A 4KROD 5I30L 2HFTA 3PHOB 2NY3D 1ZDQA 3WXWL 3MI6A 1F4AA 2UX6A 4WO0A 2C7UA 4YPGA 4TLKA 1HSAB 1TO4A 1O7SA 2X6VA 2HWZL 4Z7QF 5T5FA 4WI5A 3IJ8A 1JYXA 1JWSB 3BIBX 5ABAA 4AIEA 1KGCD 4E42A 3O4LB 2I7OA 1HJCA 4OLVH 4PRID 3GIVA 2BHZA 1KF9B 1QFHA 4XWGH 4QF1A 1U42A 1CK0L 4C59B 2PWFA 5A7BA 2EDTA 2W91A 4UT6L 1Q0YH 3GSUB 1U36A 2CLRA 1U58B 1JXDA 3ARBA 3M8OL 3SE4C 3P9WB 1BVZA 1KTJA 3DETD 3HG5A 1CDYA 5J5EA 3RBSA 4W9HC 2YJLA 3VFTB 4ODSH 2D7TH 4NP9A 2HJFA 3BVNB 3VI4F 1DVSA 3O6LL 3IPFA 2VQTA 4NQXA 3EF4A 2CDFB 2PW2A 4KC3B 1XTMA 4FD0A 4KVNL 5KSBA 3ZRCC 1MXDA 1NBVL 3VI3F 4JJ5B 4PMEA 2XWTB 4MHHG 2HVJA 1X5IA 2XT1B 3FOMA 4TS6A 3SE9L 2B08A 4I0PB 1PG7X 1UASA 5BXFA 2JQAA 4QKXB 3QJHA 1OK8A 1MCOL 4HCFA 3OXSB 5CZVH 5C0JB 5BV7B 4G1EB 4JHWH 2WNWA 1SEQL 2MCMA 4U3SB 3ZZSA 4U1NA 4LESA 4D7BA 1AXTL 1HXMA 2FGZA 2ED7A 3FQUA 4MD0A 1LK3L 3K80A 4H5SA 4KXBA 4NP4H 2DQIL 2WLIA 4XN7A 4WWOA 1ZT1B 3DJRA 2NY6C 5JIQA 3FN3A 3O4OB 1JNLL 1X3DA 1SY6H 2WO4A 1WIUA 1Z5LB 4JFDA 3DYOA 4NSKB 3T8XA 3B7TA 3BAJA 4OJAA 3TA3C 4L5FL 4NN5C 5I24A 3FRUB 2DQUL 5C0EA 1NFKA 4HXBH 4Q0XH 4J6IA 3M17B 1RULH 3CN2A 1MCIA 2GY5A 3GXMA 5I71C 3KWVA 2VQ1A 1NFIA 4LBAA 1ZV2A 3LRKA 2H6PA 5DUJA 4U1MA 3RDTC 3G5YB 3CFEB 2I24N 2YMOA 5F7FA 2N0KA 2P42B 2XWBB 3T0VA 2VRQA 1XCTB 2GUOA 5JOPD 5F3BA 3HG4A 1TKWB 3D4CA 3Q5OA 4Q56A 4WW2A 4M29A 3SB3A 4Q9RL 3BAWA 3L5HA 1CFBA 3CU1A 5HYEA 4S2SB 1HSAA 1DANU 4DUVA 3HE7A 2P44B 3NJMA 4FQJH 4UM9A 3I6KA 2A9NL 4QHLB 3B2PA 4BUHA 5JW5A 3RNKB 3K0YA 3VWKC 4Z7QE 3N0PB 2DPKA 5F7BA 2EIZA 3L1GA 5ETUB 2X12A 4AVHA 1URIA 2DM2A 2EKJA 3MV9B 1PAMA 2VDKB 3N9GL 1AGCB 1UT1A 1R24A 4LKCB 5AZUA 4WI3A 3B43A 4YZFF 4X7EC 4CMHC 2VSCA 4CN6A 5CGYC 2R0WH 2CXKA 2XPGA 3VFOA 3RGHA 5EZPA 2AKRA 3D2UA 1MJUL 2D4DA 3H7BB 4WK4B 5JPMC 4OJDH 3UTZB 3ARSA 4ZAKD 1JNJA 1LK2A 3R1GL 3WL9A 3WKQA 2WP3O 2L0DA 3AXHA 5DJ0B 3KGUA 4LCVA 1QYGH 3US9A 1I1FA 4GSDL 3NK3A 4HJGB 4EI6B 5CF3A 2BZDA 2JTYA 2VDNL 4N2BA 1N10A 1MCEA 1FF5A 2X0WA 5E00A 4LPWA 1AI1H 1R3LA 2YRLA 3FPYA 3PLYA 2JCWA 2ITDA 2Y22A 3UC0H 1GSMA 4YSTA 4R8WH 5I17B 1N0LA 4HKZB 4PQXA 3ET9F 4H8WC 3G08B 4XWGL 4ORZC 5HHQA 4CGUB 2XG4A 4XVTH 4FTVD 3KYKL 4P2RD 4NM8H 1CXFA 4MXWL 3KLHD 2WO2B 4MZ2A 1T5WB 1I9IH 5EU7E 5AW9B 5MEOA 1ZT7B 1THCA 2FJGB 1RSYA 1J5OL 1WFNA 3TCLA 4AH2A 5IG7A 5FM5O 4YK4B 5GZNA 4CC4A 4M1DL 4G2AA 2EIJB 5AAMC 4C55A 2G60L 1AQHA 1JF5A 2NY1B 3IU3B 4RGND 1UM5H 1W6WA 2WYZA 3QHTC 4PJ9A 4Z77B 3VXSE 2MFNA 4GW4A 2EDLA 3B3BA 3MRFA 1Q38A 3FN0L 5LAXA 3PHQA 5CLWA 4W9IC 2RTTA 1I1AC 3IRZA 3TBYA 3K74B 2BC4A 3FUNA 1AZZC 5CZRA 1KB5B 3LRHA 1WZ1L 1OT4A 1UD6A 3L5XL 4YDZA 3TIDB 2F8VA 2F0CA 5AENA 5KYWB 4JZJC 15C8H 1BZ7B 1DTUA 4JVPA 2BP0B 5FIEA 3RZCD 2B0SL 2ZKMX 1VA9A 2CO6A 2ICWA 2XWDA 3I6GA 3PU7A 4JPWH 3RWHA 3CXDH 4PR5B 2Y69B 1QKZL 1Z2KA 2NY5L 3ULVH 2EEDA 4LCWA 2QELA 4H25A 5L2JA 2IV8A 4XE5B 4ZTPH 3MA9L 4HFWA 4KK9D 3QUXB 1IM9B 4AJWA 1A02N 3LKNB 3MCKB 4G7QB 4ONGH 4M4PA 5B1CA 5FOJA 5I8OL 4WY7L 2DQFB 1IBFA 5C0JA 1Z9SA 3SPVB 2K70A 2ZP8A 4B6ZA 1F6FB 4BFIA 1DJSA 3FQNA 3LQMA 4ZAKA 3EYQD 2YR3A 4ZO9A 3S3CB 1I8LA 3H7BA 4XPTL 3LNHA 4AYDC 5KS9B 3HLKA 3PABA 1NH6A 3T0EA 4LRNL 1UGNA 1MCPH 2Y7MA 4QO1B 5CJQH 5E7FA 2WLLA 4L8BA 2VR5A 4YDLB 2ADJA 1RPKA 4K3JH 3T5WA 2ZXBA 3DGGB 5D4QA 3ZQWA 1DLHB 3HS9A 2AJVL 1WGOA 4M61B 2E46A 1AE6L 1D5RA 1CD0A 2DTSA 1IAMA 4AZ8A 1KBKA 2P43B 3HA0A 1KXVC 1NIFA 3AB0C 3U7AA 3IJSA 1BVLA 3M1BA 5IROA 3HUJF 3ESVF 5E1AA 5EG6C 4KJQD 3FT1A 4URTB 4Q9QH 2ADYA 1BZOA 1ZRUA 1YJDL 4M9OA 2VSMB 3ARDB 4OZ4A 4X4YB 1L0QA 2L7JA 5F3BB 1YNKH 2XKSA 1HL8A 1S8DB 2YPVL 3GSNL 3IFPA 1FYTA 1AY1H 4QGTA 5JNYB 1JGIA 1OZTG 5LXGL 5EF1A 2E7HA 3T4AA 3HE7B 2KPNA 3HBZA 5F6HI 1D5ZB 4PS7A 3OWEA 2BIQA 1NANI 4MYWB 4FS0A 5DUBA 2XTJC 5JW5B 4E41D 4JCWA 5IESH 3U2IA 2EIEA 2WSDA 4MAYB 1F90H 3KPLA 1OTUC 1T04A 2PO6D 5DURB 4RMUA 4PJ5D 3RBGA 1HNFA 4FYTA 4PYHA 4TOYH 4LVOC 4RA0C 4G6ML 3FT4A 5J4MA 4KPHH 2E9WA 4W6WB 2YPLD 5EOQL 3V5HB 2JKWA 5LBSH 1OGTB 3WY1A 1MQKH 3EGDB 3LV3A 1FFQA 2YD5A 4UT7H 3ZTDC 3ZZQA 4N0FB 4Y2DB 2VXUL 3GJFA 1AGDB 1LNUA 1DVXA 4HJGA 1JZHA 3REVB 5HVHB 1VGKA 5HYFA 4ELKA 1QFOA 1V55B 3UJTL 4F2FA 4JRYE 4R90L 4WJ5A 5E6UB 4HBCH 4LASL 3VYPA 1T66C 1UH2A 2AJ3A 2V9TA 3Q3GA 3IMWA 5DT1L 5F2FA 1A3ZA 3IFOB 2X6MA 1SM3H 2AQNA 4HD5A 4AYSA 1IM9A 2WXNA 1CG9A 3QZPA 2Q8BH 2HLFD 3I2CL 2HT4C 4TSAL 3FQWB 2W0LA 4U2ZA 1AXSA 4P4KC 3MNDA 1IU1A 1J87A 1MAML 3KCPB 4LSUL 3RB7A 1B4JL 4P5TC 3B9KB 5AWNL 4AL8L 1NEZA 4HF5L 3RJOA 3SQOH 3VH8A 4JDEA 5T3ZH 5H37H 3PDGA 4HBCL 2PYFA 3CDZA 5EEXA 3KMDA 4BWUA 1X5HA 3P69A 3V6BR 3MJGX 2D03H 1NAML 1JNHB 3MUY1 5C9JB 3KL5A 2C1OB 2IOMA 4LSTH 1IGFH 2UV3A 3FDWA 4APXA 3ULVF 4EKJA 3WEOA 1R0AH 4PJ9B 1T66D 1ZVYA 5DVOA 2EADA 2WO3B 3DX7A 3EJCA 4XN1A 5BZDA 3E38A 2JKRM 2EECA 3MLSL 3EXLA 5ALCH 4XGZA 1VADB 3EJZC 4XNMA 2NXZB 3N91A 2E59A 4YBHA 2PTVA 1A7OH 4N2MA 3FFCA 1M3IA 1FPTH 3K2MC 5GGRA 4H44C 5F88B 2OTPA 3VQMA 4L1TA 5HJ3A 3B37A 1MRDH 2DIBA 4J3XA 4X83A 3FCTB 1T83A 5KSBE 3WXVH 2VLKB 1G84A 1W8NA 2XUWA 4WEBH 4NJAL 2JLPA 2P5WE 3X13A 4DW2H 1TJGL 1XR9A 3PIQB 5ALBH 4EDWL 1MHPL 3C2SA 1JERA 1KBWA 3BAEH 4IU3B 4NQUA 1MEXL 4U1SB 3EDDA 2YEVB 5EA0H 1LTXA 4XO8A 2XBTA 3NIFF 1SYVA 4M1GL 3SDYH 3VGBA 4J8RB 5DMYA 1U8NB 5F89A 1D9KA 1HIMH 3LVTA 3KWXA 4Z3TA 5D4HA 1MY7A 4PJXE 5EORL 3HFMH 5HVGB 1HS6A 3TIEA 3CH8A 4JS7A 3HMXH 1S6NA 4XPAL 3Q6GH 5IWLC 3PV6A 2ED9A 2JKJA 1FIEA 1XGPB 4JM2D 3C5XA 2UZYA 4BZ2L 4Z7VB 5FS5A 3MRPA 3SQRA 3VD5A 1PLGL 2V7HA 2E7DA 4QTHB 3DO7A 4TNGA 1BYOA 3SPIA 1XT5A 1TNNA 3KWTA 4GH7B 3CGTA 3GZQA 4HEPG 1IRAY 4H2CA 2OQJA 3T3PB 4JHAL 5EORH 5D4IA 3BP5A 1CC3A 4X5LA 4YNYB 5ITBH 3CX2A 3O11B 4JKMA 5BUGA 4QRTA 4R97B 1L0YA 2D8KA 2OXGB 4I3SL 5K1JA 3BO8B 3EH4B 4Y16C 1CFTB 3ARRA 3SKJH 1Q1JH 3QP3A 4XN4A 3SIKA 2ILLA 1Q8MA 2GT9A 2JCCF 4DGYL 3SJVA 1PW3A 3KPPA 1JZGA 3GTNA 3KLLA 3A24A 3CE1A 1YC8A 4KKBC 4PRDB 3GJFK 3WIAA 4OUOA 1QFUL 1S9WB 3A6BH 4X5PA 1EFXB 2HT2D 4JE4B 4PH8A 1RUAL 2DBLH 1B4RA 3ZY7A 3GSVA 2YQGA 4Z78B 2QADD 5AFAA 3MRMB 1MFBH 4JPQA 1VADA 3W2DL 4QYAA 5DD1H 1M7UA 4LL4A 4U4IA 3FK3A 3G04B 3U0TB 2Y0SA 3F04A 3EJQA 1UG9A 4M62H 3SKOA 1MAMH 4P23D 5A2AA 3V0FA 1A1OB 5I76A 4OI8A 3QO0A 1QFUH 1G7MA 3EFOB 4X8GA 5GGVH 4PLNC 1TEGA 4IMLA 1VIWA 2J8UF 2VNCA 1A0QL 3QNFA 3U7YH 2EH7L 4NZJA 1KB5H 2ZAGA 5C6WH 3ZE1B 4LSSH 2JWYA 4X7CC 4NHCL 1MLBA 4N0UE 2PYED 2ZP9A 4EDXA 1E9OB 1AR1D 2IBZX 5HD8C 1SYVB 2BVOB 4N25A 1Y07A 5C7ZA 5ITFA 3GLZA 3HI1B 1DR9A 1WA1X 4ZO6A 2HG0A 2ED6A 2IDFA 3QB7C 1QFPA 3FB5A 3D0LA 5BRZD 1I82A 2DICA 3Q8EA 1WWWX 1AMXA 2BZCA 3ARFB 4LVEA 1GZPA 2KZWA 1PZBA 4J4PA 2WQ8A 4XMKL 3ABMB 4EI5C 4M3HA 4TVPL 1IAIM 1PL3A 3RKDC 5J06A 4H1LA 2YGPA 1RSFA 1IAII 1WFMA 1XF2B 5TPWH 2PXYB 3DPDA 3RQ3A 1F1DA 3Q43A 3MOAH 12E8H 3ZX1A 1Q0XL 4A2GA 1GGIL 1HHKA 5C0BB 1KGWA 2XYCA 3X1FA 3GIVB 5AKSA 4FFZH 5EV7A 3HUJB 3I74A 5EO0B 3IXAA 2AP2A 4WHDA 2R0LH 1MIEH 3PWLA 3D9AL 3SGEI 1T0NA 4BSJA 1SFDA 4YEFA 2F1EA 1MH5A 2YD3A 3BH4A 1GGCH 1VACB 1MCLA 1FQ9C 2BFGA 2EVIA 3DVGB 4G42A 1EDQA 4U2YA 4YSRA 2RAMA 3TA4D 3RA7H 3SJVB 4TVUA 4ZODA 1KACB 2XZQL 5L9DL 4DK3A 4A66A 3PREA 4O9HL 4YOKA 1FG2A 3QYMA 3NMEA 3TS8A 4K3EL 5LBGA 1ERNA 2FIKB 1VFMA 2BSRB 3TYGH 5DRXA 3B8YA 4Z0XA 3ARGC 2ZKHL 2F15A 4WI4A 1O6TA 1F4XH 1QX1A 2ZPKH 3MLYL 2MKWA 2BHUA 2J6EA 3L4UA 2NUTB 3RZWA 2QGEA 4BRVA 3EUDA 3OXSA 4H20H 3QIWA 2FATL 1AR2A 1UXSA 3UP6A 2LGNA 4LEBA 2R0KL 2OTWA 3DYPA 3WFHA 4HJSA 1AE6H 1ZHNA 4UYPA 1MDTA 1NJ9A 4MXVE 1V3MA 3Q44A 1PYWA 3NSJA 3DMMC 1FCGA 1JNLH 3F7YB 3B7UX 5AKVA 4AQ1B 3BGMB 3RY4A 4LOEA 4ALAH 3MCLL 3PF2A 3P9MB 3BPCA 4RWYH 3PGCA 4JY5H 4JPWL 3KR3L 5F6IC 1GC1L 4L1SA 1E27A 1JDCA 1MQ8A 1KCLA 4J2QA 2LT9A 5IJVA 5ACLA 2N7SA 2OSLA 4PJFE 3VXSB 2VR3A 3SKMA 3QJOA 2NY6D 1JIBA 1PJWA 2AXWA 1CICA 3D0LB 2HRPL 3P0YL 4LBEB 1ZVNA 4P46A 4M8VA 5HHOD 2APBA 5LLIC 1C7TA 4ABVA 4HS6B 1UZGA 1GW0A 4UT6A 4HVBA 1KIPB 1QSFE 2HFEA 2HJFB 3FRPG 4ZO8A 3VWJB 1PX8A 2YAOA 1BZQK 1SXZA 4HKXA 4WW1A 1I7RA 4QHLA 4X4ME 1LO5B 2NXZD 4JLRA 5FYKE 5LBSL 3RNKA 5C08D 1FE8L 3QRLA 4DO4A 1TZIA 4IJTA 2NZ9D 2H3NA 1ZHKB 1WS7A 3BZEA 1A4BA 4QOKB 3PNWB 2CRIA 5I1JL 2EDBA 3P40A 3BXNB 4QOKE 3V5KB 1BVNP 2D3LA 3IXAB 3APDA 2Q6WA 2JKNA 2OJEB 1S7XB 4RMRA 1Q9KB 1QR1A 3GO1H 4U6XB 4D0DB 1GY1A 3QIWD 1UXWA 2B7DT 1CL7H 1GYAA 4L3AA 4OFPA 2Z0BA 1QA9B 4OLYL 4P2QD 4NSKA 4AYID 2FX9L 2X28A 4XOEA 5I1LB 1RZIA 4A7SA 5MHSE 2BSRA 3R8QA 1BIHA 1HHHB 4ZTOH 1HX0A 5LXVA 1AOHA 3FO1B 4YXHL 3IDGA 4AMKL 4WU7A 1GGIH 4MDIB 5JZ7D 4OCSH 2W80C 1UUNA 3II3A 3RL1A 5D1QC 3TXAA 4F92B 5IROC 2ZUQC 5C92A 2E8YA 2A74A 2A99A 1WA0X 2UZIL 1JZFA 2R9HD 1KFAL 3WFDH 5E70A 3ECQA 1LEGA 3AREC 5A2JH 3ML9A 2H5UA 4Y4KC 5FEBA 3L3DA 4HHWA 4XAKE 3L5WB 2VL4A 2MTAA 3I02B 2F7IA 1I3RB 3I6KB 4Z7VF 4FFWC 1N0LB 2JELH 1TPXC 3J8F7 3IU4L 3GXDA 4G59C 1GTNA 2COQA 2WVTA 4K5OA 4PJ8B 2ODIA 4ZFFA 3D3VE 5IJVB 1A9BB 1KOAA 3L13A 4Z7NE 1MVYA 2F74B 4JPKL 3DXAD 3SGKA 5JPNB 1UT2A 2CNYA 4BZ1L 4WHTA 4DW2L 3ZE2E 1WWCA 4N86A 4LCIL 4BQ6A 4Z7NF 1UUSA 2X9WA 1UCTA 3QIUB 3QORD 5IG7B 1MPAH 4K73A 5BO1L 4OF7A 3VWJC 2WVVA 4OD2A 2ZWLT 4Y2LA 4XXCA 3ELAT 3O0RH 5J6HA 3BHBA 2Q3AA 3CPLB 5F9AC 2VZSA 2FH8A 2Q7YA 3AXIA 2QFPA 4P2QA 4Z95L 5I6NA 2WJ7A 5F1IB 4HOMA 1TFPA 4PRAB 4X99B 3FCGA 1C16A 1ETB1 3LDBB 2I9LA 3L4XA 4UQEA 4MJ6A 5HGAB 3RWCA 1TQWA 3BT2H 3P9LB 5GRVK 1MW2A 4AG4H 2WM0A 4Y5VA 5CZXC 3BZEB 2ITDB 3VI3E 2WN2A 1ROCA 4PJBA 1WS8A 1SBSL 5B1BB 5EUOA 3WU1A 4KAQH 4XBGB 5I66B 2CO6B 3G3LA 2XG4B 1FO0L 1YDPA 4RAUA 3VGHA 2VLLB 1CFVH 4RSVA 3DMMB 5EZJA 3VXRE 4FMFA 4EBQL 2JKXA 3PQYB 1RMFH 4J7RA 5A2IH 3CFQA 4Y9BA 3WS3B 5EZIH 3WY4A 2V8MA 5T1LA 4AH2B 4JPVL 2DKMA 4ZUTB 2G5UA 3HPJA 4ZFGL 3P9MA 2EUZA 3T4AC 1F58H 3I3EA 2C9SA 4M1GH 4GKNA 4HC1L 3SDYL 2OMTB 2IPKA 4Z7AA 2MCPL 3X3FL 1R9FA 2NYKA 1VFBA 3ZDYF 1J8HD 1WFIA 1TU2A 2J21A 3T0EB 3NG5A 3EO0A 4WGVB 3A23A 5HDQL 5TH2A 3TNMA 1ACCA 3WFEL 5J12B 1TVHA 5K69A 4X8CA 4YMPA 4HGWB 4KKLD 3EYQC 2XHNA 3PWPD 4ZUWA 2JE8A 2YKLH 3F62A 4OGYH 5IF0B 2VAAB 1OARH 3MU3A 4OSUL 4WUUD 2Q87A 3VWJA 4ZFZB 3HC2A 4Z77A 1UD5A 2J6EH 2V5TA 3L48A 2Q3ZA 4HHGA 4K7PH 3CVDA 4G82A 3STZA 3NCMA 4M5SA 2YC1B 4GEJA 5JXED 5AW6B 4MJHA 4OZ4B 3Q0HA 1WPCA 3T0BA 2FR4B 2C3HA 5CEZE 4V1DE 5EZOH 1AQKH 5DD6A 1NAMB 3N9GH 5HDWA 1JMZA 2OJEA 4HUKB 4W6XB 1WH0A 1UOVA 1N59B 3GIZL 3FQNB 3DTXB 1NBQA 2N3JA 5IV2B 3BEWA 4LF3A 4Z7IA 4X5XA 3L3IA 4Y16D 2WVVB 9PCYA 5J1SC 5H4YA 2VMFA 5C7XL 3CFTA 3JTTA 3VE0A 2G3MA 1RP9A 1QNIA 3DK2A 1DUZA 1ORSA 2VR6A 1UD3A 4N87A 5T1DH 2Q7YB 4AXWA 4I4WA 1ORQB 5E9DE 5KYUB 1MHHA 2IAMC 3C6LA 4XP1L 2NCMA 3C9NA 3HC0A 4K71B 2CGZA 1BWWA 4HGMA 4UBDD 4HQQH 3JYCA 5CGYD 5EZLB 3HI6H 2BY3A 4W9JC 2AI0L 2ZOTA 4KTYA 4Z7QB 3FT9A 5FFGA 3SPGA 5ESAA 4HXAL 4NC2B 4UINL 1MHEA 5BQDA 2DAVA 1NCCH 3QG7L 4W93A 2EUVA 3LD8C 3MACL 1OM3H 4PRBB 1SZNA 4FULA 4MQSB 4WF7A 1T4KB 2XWJA 1FZJB 2PN5A 3BKML 3OQ3B 4JDEB 3SQOL 2C7FA 5KSBF 5FGBA 2RB8A 1U8PB 4KFZC 3V6OA 5AVYB 1YPZE 4HK3N 1KXQA 5A3IC 4DETA 3P4OB 2UY7B 2R2CA 3JV0A 4GMTH 3KE0A 2NW3B 1AACA 4OF3A 4FGMA 1HNYA 1I8IA 3PJSA 5CP3H 2NNAB 4KKAD 4X6EA 2A73B 3DBXA 1XZ0B 3GSOA 3UTTB 5BRZB 3QORB 1OANA 3KM2A 3MNMA 3TBVB 4GINA 4K15A 4MB5A 4NS0A 1A7PH 5KYNA 3VD1A 3HE6B 3FQTB 1K8DA 1FYTD 1O5DT 2FNWA 2GJ6A 3QPXH 5TQ0L 5C0ND 1N68A 3BSZL 3NIFB 4L0ZA 2A4ZA 3DVFA 4OFDA 3TA3D 4LLQB 3SDCC 3DV6A 1F3JB 2XSKA 1R3IH 1RUMH 2AV1A 2H0PA 3HZKA 2VDQL 2F53D 4WJG3 2IDTA 2XXMB 2VLKA 1SJHA 5CIPH 4GSQA 1P7KA 3MX0A 3LPFA 3NZ8B 1YEHL 1A5FL 3CSYA 2VABB 4QT5B 2XV0A 4NUQA 3L2MA 4KJPD 5F3FA 3SSGA 3H9YA 4WFHE 4X5RA 4HIXL 4U1SA 4WI0A 5JHDA 2O6PA 4ZW5A 1RJYA 2VJXA 4K3GA 4N2CA 2DMHA 5C0IA 1ES0B 2ZUWA 2I69A 3HZYB 3V6ZA 4WWID 3N1FC 1LNUB 1MOEA 1PJ9A 2A6DA 3O3UN 4X0KA 3U9PH 5F9WB 5H94A 4LF3B 1Q9OA 2FD6H 2OR8A 4P3DB 5CEYB 2WIMA 1D7FA 3JV4B 2KERA 3ULUC 1MIMH 3QDGA 3GMOB 2XVBA 3P0VL 2L7QA 4O2FA 3QUZA 3NDYE 1NINA 5FO7A 3RL2A 4ISVA 1JWMB 4JCLA 1P6AB 1XWVA 1PCXA 1R5IA 1HL4A 2FATH 1GS6X 4M7LL 1VFBB 2EQDA 1UD2A 3CTTA 4APQA 4NIYE 3VXNA 4JFFA 2PYFB 1D7CA 4PW9A 3O11A 4HX1A 1MFVA 5CFHA 4HEME 4UILH 1JNHA 4EN3D 3GMNA 1A7QH 7PAZA 2VISB 1RZGA 3UMNA 2DJ4A 5CEXB 1UC6A 4JZOB 2YUWA 4YO0B 3VD9A 4XPTH 2D73A 2R1WA 4XI5D 3SYQA 3V8OA 4NNXB 1CIDA 3KPPB 2WANA 1G7LA 3POCA 3DVIA 2P3YA 3A67L 5EOTA 2CK0H 1UB5B 1WUNT 1YNLL 3QA3B 3QWRD 5DU7A 5T1DL 3V9EA 2NXZC 3K6SB 1DN2A 2XVKA 4KXZH 4LLMB 2ZWZA 2XV2A 4ONFL 2WLJA 4KVCH 1T6VN 1ZHBB 2MRYA 5DEFB 5AZEL 5L0QC 5D7IA 4DGVL 1XZ0A 1VZIA 1A6WH 4J8RA 4G7YH 1BD2D 2Y1YA 1MFBL 2H0FA 2HLFC 2ZJSH 1S9YA 3QIBB 1FUNA 2J1YA 3VYNA 1KCKA 4HH8A 3FSVA 4S0SD 3DETC 1P6FA 1BFVH 2CUAA 4OSUH 3X13B 5LGJB 3OHXA 4HOWA 4YXKH 2OI9C 2PP9A 3O3AB 4JG5A 3MACH 2ZNWA 1YNKL 4Z7VA 2ROYA 5FYKU 3OQRA 5DS1A 3ZT7A 1ORQA 1KPUB 3MRMA 2BOCB 4L4VB 3MGOA 4LE8A 4JDZA 2A9NH 2LU5A 3C9NB 2G4EA 3HC0B 4ZX6A 1YPZB 1NKRA 1IAKA 4IBTA 1FGNL 5FGRA 3I6LD 4WI0B 5JHDB 4NI6A 2QPFA 4IDJH 2O5ZH 4JN2B 1D9KD 5D6CA 2HVKB 2ZOKB 3O45A 1AMYA 1FL5B 1BOGB 5DUML 4L0PB 1FZOA 2Q20A 3IXTA 3WTSA 3UJIH 1NSNL 3PGFL 2DM7A 1ZT1A 2IF7A 4KXCA 4WFHD 4HV8A 4DPAX 2NNCA 2ATPB 2Z31A 3Q01A 3GMPB 3H2WA 3ORJA 4PRHD 1EO7A 3KHOA 1N9PA 3FRUA 4PBDA 2BNRD 2NW2B 3P77B 5C07E 2CHWA 1BAFH 4N2LA 4JFXB 1NWPA 5GGVL 2EACA 3LN4A 2FB4L 1BQKA 3NEEA 3IVKA 2P8PA 2A9MH 5D71H 2WMPB 5LG1A 2LABA 1C5DB 3KNBB 4G6JL 3RNQB 1OWWA 3O2DA 5DD0H 3WMPA 3QXUA 4CNIA 1K3ZA 2CA3A 2FSEB 4IBLT 4HX1B 3QH3A 1LM8V 4N9OB 3QZOA 3CZSA 3FQTA 2E27L 4YHMH 2V2TB 1E5ZA 4H1LB 1X7SA 2XTJB 2N0MA 3BUQA 3H9SD 2R51A 1RJLB 3BFWA 3I50L 3OJDA 3AG2B 1F8TH 3HE7C 5H2BB 3PCYA 3T6ZA 1F4WL 2ZOWA 1I85A 1NC2B 3QCTH 1ASPA 2H2SD 3RHWK 1Q0YL 2GPZA 3BESR 5F97E 1KJVA 3U0WL 4TTGA 3ARDC 3LIZH 1G6RH 3QRGL 3T08A 3HUJA 2IBGA 1OHQA 3MV8E 3FSWA 1MLBB 1AD0A 4YGAB 4KDVA 2YK1H 3HKFA 3STLA 2D7TL 2KKQA 4G6FD 4WU5A 5TF1H 3NACH 5B3NA 3QUHA 3SYCA 1G7MB 1JPEA 3EFOA 3PXJA 4HD9A 3ZTNH 3SGDH 1EEUA 2XN9B 4EN2A 1U8JA 3AXLB 5CJOH 1I8KB 4ZSOA 4BZ1H 3JV4A 2VXVL 1GIGH 1H3PL 2OXHB 2LVCA 2GW5A 3ZR6A 2D4FA 5I73C 4K3JL 1K6QL 4P2OC 2UXTA 2VN5A 3KYMA 4BZ2H 3BZ4A 1BA9A 4L37B 2V5SA 2WSKA 3KPSD 2E6PA 1KB9K 3WKML 3DJTA 1J1PL 2HFGH 4G6KL 1JI2A 4BFGA 1IAKB 3BUPA 4KJWC 4RBPH 1VFUA 3ZTNL 1BWMA 1E4WH 2HVKA 2ZOKA 3O45B 1DQDL 2VN4A 4LQFH 4EN3B 4B9PA 4BINA 4IMKA 4WY7H 2LLLA 4Z7UB 2WB1A 3TYFB 1C7SA 3PY9A 4Z9KB 1MFMA 2XWXA 2YXFA 5KVMC 4AQ1A 1FC1A 4LPTA 5JXAH 1NBYA 4KZDH 3BDBA 1QO3B 3H1ZA 4TL4A 2HT3C 1ZEAH 5FCSH 3WKMH 1PF3A 2J8UA 4LL1A 4G72B 5IOPA 1YEFH 3KVDD 3F6JA 4HMDA 2JLLA 3H42L 1CLZH 2X2YA 3KZ8A 2CO7A 1U8KB 2C1PB 3DA0A 3P11L 5GGTL 4N3UA 2XZAL 3QG6A 2C4FU 2EEAA 1K85A 3HLAA 2TSBA 4FQIL 3TPUB 4IHBA 3HPLB 5FX3A 3OTTA 4PN6A 4AVIA 1KCWA 3AU1A 3B2DC 1C08B 3PPEA 5F71A 4D0BB 2Z7ZA 2VQ4A 1LO0H 2AEQL 3KPNA 2W0FA 4NGHH 5DC0A 2GHZA 3O4LD 3I6GB 4DGWC 3VX1A 5A3ID 3HZMB 5D5MF 1IBGH 1L4IA 4YZWA 4DVRH 2E5EA 2XNAA 1UENA 3F8UB 4PJIF 2W81C 4B9GA 1RZKC 4XHJD 2WXKA 1F1GA 2DQEH 2BDNH 4ZAKC 4P23A 1YEGL 3L5JA 4FNRA 5E5LA 1V7MH 4YQXL 1Q9KA 1NGWB 3CQQA 1FBIH 1QPKA 5HPOA 1EGJH 4P59L 3IXTB 3EJSA 5HGDA 1Y18B 3LNDA 1J5HA 4YZFE 4TSAH 3QDMA 2EDXA 4ONHA 1E50A 2XN9A 3HNSL 4MLIA 3L3OA 4PGBB 4AE0A 1I8KA 1YUHB 4ZSOB 5HP5A 2P45B 5AG8A 4WV1B 3WIFB 4CBPA 1BX2A 3OZ9H 4PJFF 5AB1A 1K3IA 1N5YH 5HHMD 4NOBA 2QJDA 2DIAA 3OR6B 2RCSL 1FLRH 3AW5A 1SUHA 4FTVE 5A2KH 1Z3GH 4KY1L 3FTZA 3SO3C 4PGEB 4NKIL 2QQNH 1M05A 4XAKD 3UL4A 3X1EA 3C6SB 4JFSA 4KRPB 5LNEA 2P5WB 1FV1A 5F7MC 4RBPK 4Y9GA 1ADQL 4KI5E 4KUZH 4JFPA 2PTUA 1RZJH 1KNOB 2X4RA 3UJIL 4B60A 2YOCA 4G9FE 4WTWA 4YPJA 1GL4B 4O9HH 4X6CB 3R7QA 3FQRA 5ADPL 1O5PA 2KBGA 4WW1B 3U0WH 1ZS8B 3L7EA 3HS0B 4NDMA 2ZPKL 2HKHL 3UAJD 4GAAA 5HDRA 1H19A 3D12B 4ENED 4C47A 2AQQA 3IDUA 4FFYH 4GRWB 3VACA 5D7HA 3VFUA 4AYFA 3FF7A 2CO7B 1U8KA 4WFFE 4WHYH 1WICA 3L1EA 4Q2ZB 5TE6H 1NLBL 4ETQA 4I3GA 1X5ZA 4MA8L 4OUUA 5E9DB 4FG2A 1OAKL 3MFGB 3CDCA 4LSPL 1CXKA 5TFSL 2WWMC 4HIJB 4XO5A 1XR8A 2CALA 4QHUA 3GM8A 1H6EA 1UB6B 5DRNA 3MRJB 4QHPA 5B7EA 1KELL 1YAZA 4YDJB 3VFTA 4PTTA 1DN0B 3CNKA 2J56A 3REVA 2PW2B 3TA3B 1ZS2A 3MRDB 1L7IH 2JIXD 1DVQA 3B1TA 2P47B 3D08A 4JL2A 2I9LB 5EN2B 3VGDA 4ATWA 4C4KT 1L9NA 1R34A 2WNXA 4TF4A 3S6CA 3TN0D 2BSSA 3W9DA 3V4PA 4UMSA 4EE2A 3FUIA 1Y1UA 4EN3A 1KJMB 3BIKB 2VM4A 1BJMA 3C5ZC 5JXEC 2B4CC 2R23A 2VKXA 3EBHA 3IDXH 3MUZ1 5GRUH 3QXDA 4HLZG 3ZE0B 5FF6B 2XIDA 2J2ZA 3CMOH 4S1RH 3S5LA 4OB5H 4ONHB 2YLKA 5EOCH 2ICCA 4ODTL 2FEEI 3NA9L 1AR1C 2YEZA 4CVZB 1ITCA 5C9JA 4N8UA 1PEWA 3N41B 4NYLB 1YQVH 3OR6A 1E3XA 1LO2L 2D3VA 2F18A 1R33A 4ZFZA 1F6LL 1T3FB 4NO2B 5HPMB 5MP6L 2DQHH 3DO3A 4FFTA 3IJ7A 4DN4H 3KPRA 5JPNA 3LEVL 5DMIH 4MCYA 4LIQH 1OPOA 2QQLH 2ZG1A 3OSKA 3EFFB 1OAXL 3BH8B 3MRIB 1KDIA 1OT1A 3EDFA 1R3HB 3LDBC 3MJ9A 2ZUXA 3ILQD 3WELA 3KPNB 2JB5L 3GBNL 4NAJA 5EO9B 3X17A 1WCBA 3QQXA 4JK0D 4AY0A 3IPBA 2M8XA 1NICA 1Q1JL 2M2DA 4Z5RB 1UFUA 4JO8A 1QBMH 3V0WH 3MZGB 5ETUA 1UD4A 2X4QB 1HKLH 2GC4C 1CCZA 2CPCA 2N56A 1U92B 3DBSA 3QJHB 4L29A 4X6FB 5AL0A 1IQWH 4YHLL 2VDQB 4J3VA 4Z3FA 3C75A 4ETQB 3WJJA 3TJEL 5JPNC 2F54E 2GEQA 2H8PB 4KKLC 5KYXB 5IEKB 1Y0LA 2R1XB 3DMMA 2VLRE 4H8QA 3VD4A 4ENZA 3QDJA 3BN3B 3UBXG 5L4IA 3QW9A 5KOVC 3JTTB 3VE0B 2V5MA 5C0DA 5ESAB 4KBPA 3IF1A 1KULA 4WV1A 2YQ2A 2V7HB 3MAWA 4ESKA 3QWOA 3WFDL 2RHEA 2UZPA 1II4E 1NDMA 3M17A 3HHRB 2X4PB 3E1ZA 1DVFA 3AY4A 4JRWA 4YSQA 4I9XA 2YAMA 2DQCL 3ZL1A 1QLEL 5EZLA 1HOEA 2Q8AL 2AXJA 3PDDA 1CD1B 3WSQL 1UJ3B 5EF0A 1OOAA 2XRAL 3LQAC 1E9PB 2YBRB 1IC5L 1BPLB 4PRIE 2XWBA 2K78A 1ZXQA 2K7QA 4XVOA 1ACXA 4B9ZA 4MX7A 3VVWA 4L23A 3WNMA 4G43A 4OAWA 5L7XL 2X2UA 5MEOB 2CHXA 3ALWA 4Z8FH 2OFQA 2HFFB 4RGOH 4UM8B 4AKOA 3BEWB 4JHUA 4OZIB 5K39B 4IEFA 5I9QC 5AVWB 3VMOA 3K81A 4H88L 2C34A 3MKKA 2NW3A 4JDTL 2JJTA 4HP5A 3RX5A 3UG4A 1TQSA 3LXCA 4KI5D 1NCIA 5ALBL 4C56E 5DMGC 1OP4A 1AJ7L 2DD8L 5EEZA 2BC4B 4J6RH 4FI8A 4HUVB 4XCCH 3EFFA 3UTZA 1K8DB 1P5VB 4G80A 4K23L 5DUPL 4D3CL 3BCFA 2BP5M 4XBEL 3P4MA 2MNJB 2QSVA 2YAQA 5CILH 5D1ZI 5BOPA 4MKTA 4NZRL 4A2EA 4GYBA 4HJUA 2QSCL 4DEPB 3DV6B 4EI6A 4EMZA 3PP3K 4OU3A 4W4OA 3W39B 4HC1H 1VLXA 5LGKA 2G60H 4RFOL 1PU0A 4QUOA 3GT6A 4GP4B 1CJYA 4X5QA 3MGAA 2PTTB 4FFWD 3ASOB 5CUSL 1JMXA 1H5BC 1USZA 4HCIA 1XHHA 1XTLA 3OAUL 1A4CA 2NT0A 3C6LD 3DX6B 5IB2A 5TF1L 4AZUA 1XIWA 1ZWIA 2JK5B 2WIIB 1D6VL 2J72A 2R39A 1V7NH 3MBWB 3T1FB 5C0CA 4JRXA 3FCBA 3E9TA 5GXBB 4DT2A 3FO2A 3P3YA 3I3BA 4M5ZL 1WBXB 2NUPB 3UX9B 3MRNA 5AYQA 3DROA 3DJZA 3FSZA 4FQ1L 2AQSA 3QDGB 5FYJE 3GEFA 3L3KB 1SGKA 3TFKD 2QEJA 3S96A 2B4CL 1T80A 3WTWA 1RLWA 4TN9A 4LLQA 3CZUB 7FABL 2MTPA 1HHKB 2K6YA 2DIJA 4O02H 1FNGB 1FZKB 3SDXB 3S35H 3FJTA 3QA3A 2WLMA 3ARDA 4XC3L 2HMID 3PP4L 1R6VA 2VN6A 3U7WH 1CZ8H 5D7IB 4G8GE 3ZRFC 2RR3A 4J4PC 3HE6D 1KJ3L 1QRKA 3N3EA 3TBTB 2BP3A 3K71B 1S9YB 5D6DC 4X4MA 4ZMWA 1Z0MA 3WUZA 4OLXL 2DQMA 4K5NA 3QPQC 3CCHA 4U6YB 3H6AA 4X6FA 4JEGB 4RDBA 1DBMH 4ANUA 4HT1L 1XGUA 3SO5A 5DUMH 1L9PA 1CF8L 1JAEA 5T3XD 3LKRB 4ZD3L 1BEXA 5LN4A 1G5AA 2FBOJ 2HRPH 3B5HA 1J18A 3ZTCC 4XRCA 1BYPA 1MFDH 3C08L 1SJMA 4M7KH 1AS6A 5IVOA 4FNQA 4UNVA 2R69A 1OGTA 4CC1A 2YPVH 3GSNH 1QBAA 3RDJA 3VXNB 4G9DB 3D07A 2YO3A 1AKJB 4QDGA 3RYMA 3IK2A 3WNPA 5SWQA 3SDCD 5L4MA 5J6GB 2Y1AA 1KEGL 4UU9B 1TQTA 5D6DA 5HBBA 3QUYD 4X9FA 3LKQA 4JZOA 2R4SH 4FQPA 3VXTB 1CXIA 4M7JH 1RZ8B 1RK1A 1B0GA 3P4LA 3Q2LA 2FAUA 1BVLB 1KTBA 4JN2A 4XVJH 3CFDA 2OW7A 2A77L 3TJPA 5I30H 5FR3A 1C5DA 4KMTH 2VLRD 2C9XA 3P2TA 4NENA 1SOSA 2ARJB 1FGNH 4KKRA 3B2XA 1E4KC 1CQYA 1XGYL 1XB3A 4YO0A 3DROB 5GZND 1I9EA 1VERA 2NR6C 3NP3A 3CG8A 4LCUA 3ZTJH 2QL1A 2QTEA 1U8HB 1NLBH 5I18L 1MRDL 4WTZA 2D0GA 2QV2A 3M88A 4APXB 4QMEA 5JIKA 5DJZB 1N7MH 2WLKA 4IRJC 1WISA 4BK4A 3QEQD 5K1VA 1JYNA 3V6FB 3BUBA 4L4TA 5DGRA 1E6OL 1T6WA 1NPNA 2AK1H 4GSXA 5FV1L 3BVTA 5DWUL 1CYXA 4GIOA 2B0SH 1F97A 2IO5A 4X7TA 4HG4K 5LGJA 4XNUL 2AJVH 1U8LB 5I18H 1HXYB 1RZJL 2JJSA 3NJGA 1QD0A 2NY3C 3KJ4C 4CKVX 1A9EB 3MXWH 4KU1A 4YHYC 3D2UD 2JCCE 3L9RB 1HVXA 1PG7L 3CVCA 3JWDH 3KYNB 4XMZA 4N5ED 3S97C 1KSRA 3LN4B 3FO1A 1UT9A 3KH4A 1FZOB 5HHVH 1KGXA 2WMPA 4ODXB 2NNFA 4M02A 4ZW8A 5LNDA 4OIIL 5I8CA 4P4KA 5DGQA 1JGLH 4LSRL 4I0PD 5TDNA 4FHKA 1YEHH 1M3JA 2A74B 2P7TA 3V6OC 2ZUYA 3GBEA 3EADA 1CYGA 4ELME 3REWB 4AJ0A 3E3QE 3LSOA 4LSPH 3AU0A 4KKBD 4C56A 2EUWA 2EDFA 1QBLH 3O0LA 1PNCA 2BCKA 1MCBA 4LLAA 9CGTA 3NJVA 4R26L 2VMDA 4YFLI 2PR9A 4U1KA 4QY8B 2J12B 3V2AR 2XLLA 1BG1A 2P9RA 5D7LA 2FVNA 4OZHE 2FE0A 4WWKA 4CA4A 1GZHC 4LOUD 2XVGA 1RK1B 1SF3A 4G5ZL 4MHHI 4M56A 1VESA 4UTAH 3RWIA 1QUNB 1BGXL 1PTZA 4H0GA 4DERA 1KJVB 1Z5HA 3ULUH 4QF1B 2J4WL 3P4NB 3WEXB 5SX4I 4GG6E 2GFBA 2FDBP 2RALA 3STLB 3FUMA 5JNYA 3VUAA 1F11B 2DYRB 3QIUA 3HRPA 3MV7A 2AQ3A 2WLYA 1FH5L 3NJKA 3WGUB 2I5YH 1T1WB 3D2TA 3OR7A 4BQ8A 5JW3H 1LWRA 3LEYL 4PRDA 3MOBH 1GHFL 3BKCH 4RQQA 2R0ZL 3TZVB 4MCMA 3MNVA 3HZMA 1E67A 1MG2C 3L4WA 4DEUA 4P3CH 3K8LA 3TPUA 2W1NA 3MC0A 2IBZY 3ARYA 4RESB 4K7PL 1BLIA 1PZCA 1ETZB 3TWCH 4LCWD 3IMUA 5L2KE 1NCHA 1DQKA 5AAMA 4U3SA 5K9QG 1K5WA 4AQ8C 4KMTL 5I76B 1U6AH 3I9PA 5DD5L 3CFJA 4H5SB 4GXVH 4PJ9C 5JHBA 1E65A 3GXTA 2Y24A 3MBXH 3UTTE 5BVPH 1C1EL 3WTUA 3FOMB 2F19L 2C8NA 5E5MA 2OYPA 2FQGA 2WQRA 4KKNA 3QDGE 3TLRA 4M93C 1UCBL 4ZUTA 4E9WA 5IR1A 5KVEE 3BPLB 1FIGH 2Y23A 3OKDA 1B4JH 5D4JA 3S37L 3ZR5A 1OP3K 4NXSA 3CFDB 3LRSB 4UV4L 5T33L 2YSSA 3ZKSD 1G94A 2EEBA 4NQDB 4OZFB 5KAQF 3L6FB 4S1DC 1V5JA 1FNSH 4BCYA 1EZUA 2YXMA 4MLSA 5CIPA 4P4KB 4U1MB 5GS2H 5J7CC 4BKTC 2OBGA 5I5JA 5KJRL 1R3KA 3Q06A 1JPTH 2Y5QA 4LCUB 2VXTH 2ARWA 3LSOB 2UXGA 5I5IA 4JDVA 5AW7B 4WW2B 1NM9A 1TLKA 2PR4L 5F0PB 2R7EB 4E2OA 4DHLA 2YHGA 4DUWA 1G6RL 2HB0A 1HN1A 3O9WC 2IXQB 1NPJA 2BWDA 3D18B 1U0QA 3F6LA 3FBKA 1FZMA 4KK8C 5TQ0H 3STZB 3ZYOA 4AUJA 5BRZE 3FU7B 5GHWL 5IROD 1CD9B 1QNZL 5C09B 1DVFC 1TKWA 1N6VA 2N1TE 4A2LA 4NO0B 5DD6B 1L6ZA 4LVOB 5HDBF 2W0FB 1M71A 1MH5B 5FYLE 3WAKA 1U8CB 4ODVH 2E47A 5D93B 1QI4A 3QDMB 4AOFA 1LEIA 2ATAA 1A9EA 2XNAB 1WZMA 5FHAL 5IQOA 4HLEA 1C5BH 4NQVA 1HZKA 1ZE3H 3QRFM 2LFEA 4X4XA 3KYNA 3MOAL 2GITB 3IEAA 5D9SA 2P26A 2RA1A 3P1VA 3NEOA 3M45A 3MNVB 3F83A 3EBIA 3RTLA 1R5VA 1NAMH 5EEYA 2XV3A 4NERA 1EXGA 4NJ9H 2B39A 4O2EA 1SJEA 1VFOA 3CZKA 6PAZA 3F84A 4U3XA 1LQSR 2R29H 3O6KL 4K23H 5IMKA 4DKTA 1P7BA 2AVFA 3KGSA 5HYIA 1K8IB 3HMXL 4OQTA 4G8AC 3TWYA 3VMPA 5IIEB 4ZUUB 1KIRA 3EYFB 4B3VA 4KJYB 5DS8B 3D52A 3CHPA 4LP4A 1I1FB 4FA8A 1TR7A 1PCSA 3D0VA 1YA5A 3BIKA 1HINH 1KPRB 1E2ZA 4N8PA 4Z7UE 2PUQT 1CTNA 2OA9A 4JFTA 5FGBC 3SBWC 4DGIL 5M7QA 1OB1B 2VDPH 3QHZH 2PXYD 2CLZB 5AB9A 4JUSA 3UCQA 4UWQB 1DFBH 1QTSA 4N8VA 4L5FE 1ZT7A 4BQCA 4DAGL 5E4EC 4LDCA 2AMUA 2D3NA 2ZT9C 2ZXDA 4ZYKA 4PUBL 4WFEE 5MERA 3D09A 1IGMH 4XXDB 2KDGA 1LJMA 1Q72L 3O3EB 5JDSA 2ZSVA 4BKLA 1I8MB 4RETB 2EXWC 2R23B 3T6XA 1AQDB 2OR9H 5KG9A 5IB1B 2GFBB 1QHPA 2J1XA 3MBEC 3EJPA 3C12A 3GDBA 4N6RA 5E4IA 5B3JF 3TBYB 2VDOL 3SJVD 4EZKA 1L5GA 2ZG2A 4PPTA 1TT6A 4H26A 3DVGA 4G42B 1EO5A 1IEAB 3O41B 5AZEH 2C3VA 3GSXB 4F7EB 3BEVB 1IIKA 2IWGA 5TE4L 2ADFL 5FFLA 3BD4A 1QSEE 2EH8H 7FABH 2HLAA 3DHJA 1TCMA 4ERSL 4A7GA 4N2AA 4GSUA 1RUQH 2DW5A 1RPQA 1M2VB 3DDFA 4XC1L 2CWRA 1PSKH 1XR8B 4YSAA 1ZEAL 4BFNA 2Q7NA 2YRZA 5IUCA 3ARGA 2G30A 1RJYB 2DQHL 3T6WA 4EXPX 1I1AB 3FFCD 32C2B 4MAYD 3X3GL 3LAFA 2ADFH 3UABA 1HTYA 5CJ5A 4RMSA 2H1LM 4AI7A 4LVNC 4AM0B 2KS0A 3QO1A 3QUMA 1E0OB 4J3OC 4U0RB 5FHBL 1KWGA 2NY7L 3BIAX 3AG4B 4JFYB 4JFEE 2MKLC 5IVZB 3MLUL 4HFWB 2XFXA 3BGMA 5E2TH 5SWZD 1ZAGA 1PZDA 4XCNB 1TQCB 3MTXA 2R2HB 5E2WL 2XQYA 4F1SA 5C0AD 1SJEB 4KH9A 3PS6A 1DCEA 4HXAH 2DMKA 4UINH 3DHUA 3HN8A 3MNWB 4R7NA 3TN0B 3JV6A 5KS9A 4XCFL 3TVMA 2CHDA 2Y5EA 3VXRB 4Z76B 3FH5A 5DQDH 3G5WA 3BUYA 4NWUL 5DS8A 5BW7A 3J07A 4GW1A 1Q90A 5I1CH 3BH8A 3MRIA 5ABDE 4BFFA 5FOBA 3P3UA 5CMAA 4B7LA 5I1GH 3CLEL 3SN6N 3FUFA 3A22A 1HHGB 1WUZA 2IXQA 2IV9A 3C6EA 3PHQB 1CI5A 2AERT 1UJ3A 2YXWA 3NIDE 4XWOC 2VGLM 2QBWA 2VO5A 5TD4A 4XXDA 1BEYH 3IDNB 5TJWK 1QW8A 3IYLW 4IIQA 4LCIH 5CEZH 3FFDB 4LMQI 1U92A 5D1ZC 3NP4A 3BJLA 2KUTA 1AQDA 1MDAA 2KT6A 4XO9A 2I9TA 3RZCC 3MJ8B 1M71B 3ECUA 4YHZH 1BBDL 3QIBA 1RHHA 1A25A 2D31B 4K8RD 4NC0B 3R4RA 3Q7JA 3V0VA 1WITA 3AADB 3VWKB 1I1AD 4J3BA 4FCAA 4NQVB 2TSAA 4GG8A 5BS0A 2OP4H 3HW7A 3S4SB 1PD1A 5CM1A 2UUDK 2BOCA 3QBTB 1H6TA 4JDZB 2H3XC 1DVFB 2I07A 1NFDB 3QUYC 1CG9B 3NIGF 5IMKB 4XCYB 3PABB 1EVUA 1T4WA 3U46B 3DX6A 1UH4A 3K4DA 5C0AB 2EYTB 3QARA 1BXUA 1Y6MR 2EDOA 3RIKA 1BXAA 4OIAA 1MLCA 3MV8A 2AJ3B 2CLZA 3Q3GB 3FB7A 3GMPA 4OAWB 4Z7WF 2FYYA 4KQ4H 5JQ6H 4Y1SA 4CMMA 2NR6D 1XBDA 4LNRA 4OBRA 4IS6A 1KB3A 4PJGB 2WZ6A 4KXDA 1SVCP 2DWEA 2NY6B 3KNBA 3GO1L 1HEHC 4JG0H 3NZSA 2NR6A 3KLSA 3N85H 5F21B 4K5PA 4ES8A 3FUJA 5B7MA 5IB1A 3VNZA 4ZW7A 2XV6B 1PKQB 1U2HA 5I6XB 3HMWL 4K3DH 4YDVA 3FBQA 4M93B 3ATAA 1RI8A 2QQLL 1JGUL 5LN8A 1JVKA 3UADA 5BZZA 3BKJL 1NBVH 3A6BL 1TZAA 4FQXD 4NRXB 2W0PA 1DQQB 1GR7A 2AEWA 5J6HB 2Y06L 4M8QB 3PDOB 3JXAA 5CSBA 1QBBA 2QVIA 1LYQA 1T04B 2VWEE 4TPRL 5CO1A 2NZIA 1MW1A 1TLMA 4XGZB 3NUKA 5E8EB 4AIOA 1V27A 2F1BA 2YUVA 2P80A 1UM4H 1WD8A 3MLTA 3VWKD 3RWCB 4JB9H 5GS0H 5E5RB 1A7NL 2HPOA 4X8JB 5I1EH 3FFCB 1PG7W 1Z9PA 5DVLA 3AQZA 1QSFB 3FFCE 4PB9L 1G0DA 5DLLA 5JMOC 4OCRH 3US0A 4TQ8A 1N59A 2G75A 4UQAA 3DTXA 1MF2H 4XX1G 1KB5L 4M3KB 3WFCL 3L08A 2Q8AH 2Z1PA 2PO6A 3DX8B 4RNRA 5JOFB 3QT2A 4FLOA 4HEMA 4N2FA 5B21A 1RUQL 3S98A 2ID5A 4Z18A 1AXSB 4PCSA 3APNA 3AC0A 2V5RA 2BWIA 2DN7A 5KOMC 2EXYC 3WFZA 3KCPA 4XVUC 1FAIL 3DHPA 2A6JA 1DO5A 3UBXI 1PD0A 3CSBA 1W0VB 4ZMNA 4OCWH 3D39A 2OZ4H 5D1ZA 5TH2B 5C0AA 1BD2E 5E6IB 1TVHB 3TYFA 2YLHA 4M1CC 1E40A 5EU6D 4F8NA 5E23A 5GGSB 2QSQA 5KVDH 2IC2A 5B8CC 3MRCA 5HI5C 3S8GB 4POYA 5JA9A 2EVHA 1X4YA 2XDHA 1TMCB 1HH6B 4TRPL 2ITEA 4XB3A 3ARFD 2VLJA 5ESVA 4KI5C 2AEPH 1JF6A 2ZCLH 3HG0A 3AUVA 1A6PA 1CBVL 1S9WA 2BXZA 1V3LA 3F7PC 2ZUTA 4YQXH 4YHZL 5IHWA 1ILSA 2E0PA 1FAKT 4BQ9A 2OSWA 5ICZA 1GXEA 1IX2A 4M6MH 3VXSD 5C2BH 3R1GH 1QFWI 1CE1H 4R2GC 5F93C 1U41A 3TV8A 2WZ5A 2CMRL 1UM6H 4NBZB 4YHYB 4FQHA 3FUDA 3V0VB 1XB8A 2C3WA 2EE3A 3VFRB 3GS7A 4RFNC 3TO4C 4YLBA 2LTQB 4WKZB 2XICA 1F3JA 1O75A 1UM5L 1KGJA 1AOZA 3JTSA 4KJQC 1HL5A 2KYIA 1VPOL 2WQVA 3QJFA 4U1GC 4W9LC 1G5GA 4QYOA 1X5XA 1RJCA 4XNXL 4R4FL 4WFFD 4PJDF 1IAOA 4QI3A 1X9UA 2FWSA 4BYHA 5CBAA 5DRWB 2VDPL 2WCPA 2KHAA 1IL1B 3A4EA 4KO6A 4KZCA 1ES0A 1SHWA 2EDWA 4PJDE 5F3HB 4LKXA 5D7KE 1EJOH 4AV5A 1BBJA 1MCHA 1FNLA 4NENB 1SEQH 4N68A 5J6GA 5CN1A 5KVGH 2HYMA 5KUMA 1S7RB 2X4TB 3NJLA 4RRPA 3RGVA 3NSYA 3WLWD 1ADWA 4PJHB 1ACZA 1W72L 2GK0A 3QQNA 4YNYA 4EDXB 4JMXA 1BZ9B 3DUUA 4PVBA 2YPKB 1YEDA 4AE1A 2C9QA 3BC9A 3HBQA 5HJDA 1SRDA 3MPCA 3P4OA 4ODXA 5F8RC 3F7RA 1A1NA 1MSPA 1W9XA 4JFFD 3NJFA 3ZIMA 5I0WA 2YD1A 2Q2LA 5KN5B 4X9BA 5E1IA 3GSOB 2Z4TA 4HUCA 4UCFA 3I75A 1Z9LA 2ZF9A 4GQRA 3NCEB 4HKJB 4P0DA 1QWUA 3L54A 4QY8A 1CUOA 1INEL 1ZTMA 3C09C 4LSDA 1F13A 2MH4A 3C60B 5CJXA 4MA3B 2O6FA 1BQLH 5CFAA 2X9YA 3UBGA 1FFPA 3LS4H 1G7LB 3RKPA 4G7RB 2G9HB 4WSKA 3T0EE 3RVXD 1H9DA 3UACA 3KPSE 5AUMA 1ID2A 5BMFH 1U3ZA 3TZVA 4U1JB 4X8JA 1D9KC 1F2QA 4F9LA 1NM4A 1TQBC 1MNUH 2DOCA 1S9KC 1ZHBA 1V3KA 4I85A 5D2NA 4P9HL 2YMXL 4ODTH 1WSST 4YDJA 3S36L 1GCFA 1OSEA 1DSFH 4PRPE 4PV1C 1BQLL 4XXWC 3IDJB 3TWCL 1N6QL 4ES9A 2V17H 3GXFA 1S9VB 2V37A 3TA3A 3VSUA 1YYLH 1WIPA 4GLRH 4PJHF 5C97A 2F53A 5DC9B 2FQFA 5G4MA 4K8RL 5FM4A 5FO7B 2VXUH 2KI6A 3VRLF 5EN2A 4G1MA 5HD8D 5ITFB 4IBYA 3QUZC 2XXFA 5I1EL 4HWEH 1EHLH 3UXFA 4HUWA 3PGCB 3RZCB 1NMBH 1USQA 2RIKA 4G6JH 4G7YL 2X1WL 4QRRE 5JR1H 4GUQA 1ULVA 3Q1SL 1DANT 1KFAH 2BX5A 2FLMA 3N44B 4OGQC 4QRUB 5D1ZB 5IBUG 3MV11 5T33H 3P30L 3REWA 4DVBA 1JK8A 4XMLL 4OM0L 3T3ME 2MEJB 5DTFB 4X6DE 4FMKA 1LQBC 1F11A 2FHBA 2L4OA 3HR6A 2DQTH 4TUUA 3ZQ9A 5MHSD 1JZ7A 3D8MA 3UEZA 5KVFH 4HS6A 4NYLA 3V6OE 2X4UB 5I1DA 2MOVA 3HC4L 4JFXA 4IHOB 4HWNA 2ZXWB 3B9KD 4Z8FL 2DLEA 3ALXA 4NM4H 5CWSB 2Y25A 1YEDB 3U4AA 4CSSA 3VD7A 4Z7NB 4TM9A 3NFPB 2WQUA 4LEOB 4L8BB 1UYWH 3HBPA 3N1QC 2FSEA 5FYJU 1H5BB 1TJXA 4F9LC 5C9KA 4G6AD 2K4WA 3PE9A 3PNWA 4E36A 2HRGA 3C5ZA 3DV4A 2H26B 5A6IA 4LU5L 4IOIB 5BZWB 5F72S 5FA3B 3Q8BA 1HCYA 3H9SE 3AMKA 4DEPC 4NM4L 3EJRA 1IGFL 5I23A 4HKXB 5JORA 5AOIA 3CXHJ 1SDDA 1TTUA 4Z0XB 3K6DA 2ZYSA 2YPLA 1I8UA 2BY1A 1UEMA 4EKXA 3PHAA 1XGYH 1O7DC 2CDEA 2H3NB