5ANPA

Crystal structure of the ba41 protein from bizionia argentinensis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
145
structure length
145
Chain Sequence
b'QFTIPEVPKEQTSVYDYAELLSAAEKASLENKLIKYSDTTSTQIVVVIIPSTNGENINYLGAQWGEKWGIGQAKEDNGVLIILALNDKRIAINTGYGVEHLLTDAMSKRIIELDITPFFKRKDYPGGLDRGADAIFEVLTGEYQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BA41
publication title Structural and functional characterization of a cold adapted TPM-domain with ATPase/ADPase activity.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
total genus 53
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 5anpA00
2MPBA 3PVHA 2LT2A 2KW7A 5ANPA 4OA3A 3PW9A 3PTJA 2KPTA
chains in the Genus database with same CATH superfamily
1QY9A 4Q2HA 4JBDA 3FVEA 4K7XA 5M47A 3W5WA 3IGHX 2Q9HA 4OA3A 1GQZA 1SDJA 1W62A 2AZPA 4PY9A 2ZXOA 1W61A 1YM5A 1IR6A 2QB8A 2KPTA 1U1VA 2ZXPA 2GKEA 1T6KA 2OTNA 1K20A 3EJXA 4K8LA 2QB7A 3PTJA 3ICJA 1U0KA 2MPBA 2ZVFA 4DUNA 1K23A 2YMAA 1WPMA 2PW0A 2Q9JA 2LT2A 1BWZA 1TM0A 4IJZA 5ANPA 2IW4A 1S7JA 2GKJA 5H2GA 5HA4A 2EB0A 3G7KA 4LS9A 5IWEA 2HAWA 4RPAA 4JCIA 1WPPA 4JD7A 2PVZA 2H9FA 1XUAA 4GL6A 4IK0A 3PW9A 5H2YA 3EKMA 1QYAA 2ENXA 4JUUA 4J9XA 3EDNA 4LG3A 1I74A 4J9WA 4K7GB 2ZXRA 3PVHA 2QB6A 1U1WA 3WQZA 3DEVA 1U1XA 3G98A 2KW7A 4Q60A 1XUBA 4LB0A
chains in the Genus database with same CATH topology
1QY9A 4Q2HA 4JBDA 3FVEA 4K7XA 5M47A 3W5WA 3IGHX 2Q9HA 4OA3A 1GQZA 1SDJA 1W62A 2AZPA 4PY9A 2ZXOA 1W61A 1YM5A 1IR6A 2QB8A 2KPTA 1U1VA 2ZXPA 2GKEA 1T6KA 2OTNA 1K20A 3EJXA 4K8LA 2QB7A 3PTJA 3ICJA 1U0KA 2MPBA 2ZVFA 4DUNA 1K23A 2YMAA 1WPMA 2PW0A 2Q9JA 2LT2A 1BWZA 1TM0A 4IJZA 5ANPA 2IW4A 1S7JA 2GKJA 5H2GA 5HA4A 2EB0A 3G7KA 4LS9A 5IWEA 2HAWA 4RPAA 4JCIA 1WPPA 4JD7A 2PVZA 2H9FA 1XUAA 4GL6A 4IK0A 3PW9A 5H2YA 3EKMA 1QYAA 2ENXA 4JUUA 4J9XA 3EDNA 4LG3A 1I74A 4J9WA 4K7GB 2ZXRA 3PVHA 2QB6A 1U1WA 3WQZA 3DEVA 1U1XA 3G98A 2KW7A 4Q60A 1XUBA 4LB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPB A;  3PVH A;  2LT2 A;  2KW7 A;  5ANP A;  4OA3 A;  3PW9 A;  3PTJ A;  2KPT A; 
#chains in the Genus database with same CATH topology
 1QY9 A;  4Q2H A;  4JBD A;  3FVE A;  4K7X A;  5M47 A;  3W5W A;  3IGH X;  2Q9H A;  4OA3 A;  1GQZ A;  1SDJ A;  1W62 A;  2AZP A;  4PY9 A;  2ZXO A;  1W61 A;  1YM5 A;  1IR6 A;  2QB8 A;  2KPT A;  1U1V A;  2ZXP A;  2GKE A;  1T6K A;  2OTN A;  1K20 A;  3EJX A;  4K8L A;  2QB7 A;  3PTJ A;  3ICJ A;  1U0K A;  2MPB A;  2ZVF A;  4DUN A;  1K23 A;  2YMA A;  1WPM A;  2PW0 A;  2Q9J A;  2LT2 A;  1BWZ A;  1TM0 A;  4IJZ A;  5ANP A;  2IW4 A;  1S7J A;  2GKJ A;  5H2G A;  5HA4 A;  2EB0 A;  3G7K A;  4LS9 A;  5IWE A;  2HAW A;  4RPA A;  4JCI A;  1WPP A;  4JD7 A;  2PVZ A;  2H9F A;  1XUA A;  4GL6 A;  4IK0 A;  3PW9 A;  5H2Y A;  3EKM A;  1QYA A;  2ENX A;  4JUU A;  4J9X A;  3EDN A;  4LG3 A;  1I74 A;  4J9W A;  4K7G B;  2ZXR A;  3PVH A;  2QB6 A;  1U1W A;  3WQZ A;  3DEV A;  1U1X A;  3G98 A;  2KW7 A;  4Q60 A;  1XUB A;  4LB0 A; 
#chains in the Genus database with same CATH homology
 1QY9 A;  4Q2H A;  4JBD A;  3FVE A;  4K7X A;  5M47 A;  3W5W A;  3IGH X;  2Q9H A;  4OA3 A;  1GQZ A;  1SDJ A;  1W62 A;  2AZP A;  4PY9 A;  2ZXO A;  1W61 A;  1YM5 A;  1IR6 A;  2QB8 A;  2KPT A;  1U1V A;  2ZXP A;  2GKE A;  1T6K A;  2OTN A;  1K20 A;  3EJX A;  4K8L A;  2QB7 A;  3PTJ A;  3ICJ A;  1U0K A;  2MPB A;  2ZVF A;  4DUN A;  1K23 A;  2YMA A;  1WPM A;  2PW0 A;  2Q9J A;  2LT2 A;  1BWZ A;  1TM0 A;  4IJZ A;  5ANP A;  2IW4 A;  1S7J A;  2GKJ A;  5H2G A;  5HA4 A;  2EB0 A;  3G7K A;  4LS9 A;  5IWE A;  2HAW A;  4RPA A;  4JCI A;  1WPP A;  4JD7 A;  2PVZ A;  2H9F A;  1XUA A;  4GL6 A;  4IK0 A;  3PW9 A;  5H2Y A;  3EKM A;  1QYA A;  2ENX A;  4JUU A;  4J9X A;  3EDN A;  4LG3 A;  1I74 A;  4J9W A;  4K7G B;  2ZXR A;  3PVH A;  2QB6 A;  1U1W A;  3WQZ A;  3DEV A;  1U1X A;  3G98 A;  2KW7 A;  4Q60 A;  1XUB A;  4LB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...