5ANPA

Crystal structure of the ba41 protein from bizionia argentinensis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
145
structure length
145
Chain Sequence
QFTIPEVPKEQTSVYDYAELLSAAEKASLENKLIKYSDTTSTQIVVVIIPSTNGENINYLGAQWGEKWGIGQAKEDNGVLIILALNDKRIAINTGYGVEHLLTDAMSKRIIELDITPFFKRKDYPGGLDRGADAIFEVLTGEYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a cold adapted TPM-domain with ATPase/ADPase activity.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords BA41
total genus 53
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 5anpA00
4OA3A 5ANPA 2LT2A 2KPTA 3PW9A 2KW7A 3PVHA 2MPBA 3PTJA
chains in the Genus database with same CATH superfamily
3W5WA 1SDJA 4LG3A 4Q2HA 1K20A 1IR6A 1BWZA 1QYAA 1T6KA 2EB0A 4K8LA 4K7XA 4DUNA 4LB0A 2ZXRA 1I74A 2YMAA 5H2GA 2LT2A 3PW9A 3WQZA 4JBDA 2ZXOA 2Q9JA 4Q60A 1W62A 3G98A 4IJZA 4OA3A 3PVHA 2MPBA 2QB7A 3DEVA 4J9WA 4IK0A 1WPMA 3EJXA 4JCIA 2KPTA 1W61A 1U1XA 4JD7A 2GKJA 1XUAA 5H2YA 2QB8A 1U1VA 2ZXPA 5M47A 2HAWA 2ZVFA 4LS9A 5HA4A 1QY9A 4K7GB 1U1WA 2KW7A 1U0KA 3G7KA 1GQZA 4J9XA 5ANPA 4RPAA 2OTNA 3ICJA 2PW0A 2AZPA 2IW4A 4JUUA 2Q9HA 3PTJA 1WPPA 3IGHX 2ENXA 1YM5A 2QB6A 1S7JA 1XUBA 1K23A 1TM0A 4PY9A 2PVZA 2GKEA 3EDNA 4GL6A 3FVEA 5IWEA 2H9FA 3EKMA
chains in the Genus database with same CATH topology
3W5WA 1SDJA 4LG3A 4Q2HA 1K20A 1IR6A 1BWZA 1QYAA 1T6KA 2EB0A 4K8LA 4K7XA 4DUNA 4LB0A 2ZXRA 1I74A 2YMAA 5H2GA 2LT2A 3PW9A 3WQZA 4JBDA 2ZXOA 2Q9JA 4Q60A 1W62A 3G98A 4IJZA 4OA3A 3PVHA 2MPBA 2QB7A 3DEVA 4J9WA 4IK0A 1WPMA 3EJXA 4JCIA 2KPTA 1W61A 1U1XA 4JD7A 2GKJA 1XUAA 5H2YA 2QB8A 1U1VA 2ZXPA 5M47A 2HAWA 2ZVFA 4LS9A 5HA4A 1QY9A 4K7GB 1U1WA 2KW7A 1U0KA 3G7KA 1GQZA 4J9XA 5ANPA 4RPAA 2OTNA 3ICJA 2PW0A 2AZPA 2IW4A 4JUUA 2Q9HA 3PTJA 1WPPA 3IGHX 2ENXA 1YM5A 2QB6A 1S7JA 1XUBA 1K23A 1TM0A 4PY9A 2PVZA 2GKEA 3EDNA 4GL6A 3FVEA 5IWEA 2H9FA 3EKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OA3 A;  5ANP A;  2LT2 A;  2KPT A;  3PW9 A;  2KW7 A;  3PVH A;  2MPB A;  3PTJ A; 
#chains in the Genus database with same CATH topology
 3W5W A;  1SDJ A;  4LG3 A;  4Q2H A;  1K20 A;  1IR6 A;  1BWZ A;  1QYA A;  1T6K A;  2EB0 A;  4K8L A;  4K7X A;  4DUN A;  4LB0 A;  2ZXR A;  1I74 A;  2YMA A;  5H2G A;  2LT2 A;  3PW9 A;  3WQZ A;  4JBD A;  2ZXO A;  2Q9J A;  4Q60 A;  1W62 A;  3G98 A;  4IJZ A;  4OA3 A;  3PVH A;  2MPB A;  2QB7 A;  3DEV A;  4J9W A;  4IK0 A;  1WPM A;  3EJX A;  4JCI A;  2KPT A;  1W61 A;  1U1X A;  4JD7 A;  2GKJ A;  1XUA A;  5H2Y A;  2QB8 A;  1U1V A;  2ZXP A;  5M47 A;  2HAW A;  2ZVF A;  4LS9 A;  5HA4 A;  1QY9 A;  4K7G B;  1U1W A;  2KW7 A;  1U0K A;  3G7K A;  1GQZ A;  4J9X A;  5ANP A;  4RPA A;  2OTN A;  3ICJ A;  2PW0 A;  2AZP A;  2IW4 A;  4JUU A;  2Q9H A;  3PTJ A;  1WPP A;  3IGH X;  2ENX A;  1YM5 A;  2QB6 A;  1S7J A;  1XUB A;  1K23 A;  1TM0 A;  4PY9 A;  2PVZ A;  2GKE A;  3EDN A;  4GL6 A;  3FVE A;  5IWE A;  2H9F A;  3EKM A; 
#chains in the Genus database with same CATH homology
 3W5W A;  1SDJ A;  4LG3 A;  4Q2H A;  1K20 A;  1IR6 A;  1BWZ A;  1QYA A;  1T6K A;  2EB0 A;  4K8L A;  4K7X A;  4DUN A;  4LB0 A;  2ZXR A;  1I74 A;  2YMA A;  5H2G A;  2LT2 A;  3PW9 A;  3WQZ A;  4JBD A;  2ZXO A;  2Q9J A;  4Q60 A;  1W62 A;  3G98 A;  4IJZ A;  4OA3 A;  3PVH A;  2MPB A;  2QB7 A;  3DEV A;  4J9W A;  4IK0 A;  1WPM A;  3EJX A;  4JCI A;  2KPT A;  1W61 A;  1U1X A;  4JD7 A;  2GKJ A;  1XUA A;  5H2Y A;  2QB8 A;  1U1V A;  2ZXP A;  5M47 A;  2HAW A;  2ZVF A;  4LS9 A;  5HA4 A;  1QY9 A;  4K7G B;  1U1W A;  2KW7 A;  1U0K A;  3G7K A;  1GQZ A;  4J9X A;  5ANP A;  4RPA A;  2OTN A;  3ICJ A;  2PW0 A;  2AZP A;  2IW4 A;  4JUU A;  2Q9H A;  3PTJ A;  1WPP A;  3IGH X;  2ENX A;  1YM5 A;  2QB6 A;  1S7J A;  1XUB A;  1K23 A;  1TM0 A;  4PY9 A;  2PVZ A;  2GKE A;  3EDN A;  4GL6 A;  3FVE A;  5IWE A;  2H9F A;  3EKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...