5ANUA

Mth1 in complex with compound 15
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
b'ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Potent and Selective Inhibitors of Mth1 Probe its Role in Cancer Cell Survival.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 154
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5anuA00
2O5FA 1SZ3A 1NQZA 2AZWA 3GRNA 5BS6A 1VHGA 2KDWA 1Q54A 1HZTA 1V8UA 4K6EA 3AC9A 1MUTA 3J7Ye 2VNPA 2W4EA 3X0IA 1G0SA 2VNQA 1V8RA 2B2KA 5DEQA 1NFZA 4ICKA 3I9XA 2KDVA 3FJYA 1VRLA 1VK6A 3HHJA 3A6VA 3Q4IA 4NFWA 5ISYA 3ZR1A 1K26A 2YVMA 3GG6A 4HVYA 2R5WA 5ANVA 5DDGA 3A6TA 2YVNA 2A8SA 1V8NA 3SONA 5BONA 1JRKA 2A8TA 1HX3A 1V8IA 1V8MA 1XSCA 2G74A 2QJOA 1RYAA 3O8SA 3Q93A 4JZTA 1GA7A 4KG3A 5HZXA 4NFXA 1RRQA 4JZUA 1VIQA 2YVPA 5ANTA 2I8TA 2G73A 2GT4A 1X51A 3N9UA 3R03A 5FSLA 1X84A 2QKMB 1PPXA 3MCFA 4S2WA 3X0KA 3X0MA 1PUNA 4KG4A 2B0VA 2J8QA 3RH7A 1V8LA 2B06A 5FSNA 5GHJA 3X0QA 3P6YA 3X0PA 2O5WA 3Q1PA 3BM4A 5GHMA 1I9AA 2Q9PA 5FSMA 4YPRA 5IW4A 1MQWA 3FK9A 2YVOA 1SJYA 3Q2TA 2JVBA 4ZG0A 4V14A 3A6SA 5ANSA 2A8RA 3GZ5A 1VC9A 2YYHA 5FSOA 3OGAA 3P5TA 1MQEA 1QVJA 2DHOA 5GHQA 3X0JA 1V8TA 1Q27A 3I7UA 1XSBA 1KT9A 1PUQA 3ZR0A 4JZVA 1MK1A 1PPWA 3FCMA 1G9QA 5I8UA 3SMDA 3H95A 4JZSA 2FVVA 1VC8A 4HFQA 5CFIA 3EEUA 5IW5A 2DSCA 3N77A 3X0LA 4KYXA 3F13A 5ANUA 1V8WA 3I7VA 3EXQA 1KHZA 2ICKA 4C9WA 4YPHA 2DSDA 2QJTA 5C7QA 3X0NA 2DUKA 5GHNA 3GZ6A 1V8YA 1V8SA 4N1UA 3GWYA 2XSQA 3BAPA 2PQVA 4S2YA 4C9XA 2A6TA 3O6ZA 1PVFA 2RRKA 1Q33A 3KVHA 1VHZA 1OW2A 2GB5A 5DD4A 1IRYA 1X83A 1SU2A 2O1CA 4IJXA 4KTBA 4MPOA 3MDGA 3U53A 2PNYA 1MR2A 1SOIA 1R67A 4S2VA 3WHWA 2I6KA 1K2EA 3DKUA 3EF5A 3SHDA 2FMLA 3ID9A 3F6AA 1MP2A 3O52A 3O69A 1VIUA 3L85A 4N1TA 3ACAA 3X0OA 1KTGA 3COUA 1NFSA 4YOQA 5DPKA 5CFJA 2DSBA 3DUPA 3MGMA 4ILQA 1NQYA 1V8VA 1U20A 2A8PA 1RRSA 3Q91A 1JKNA 4DYWA 2GT2A 3Q2SA 5GHOA 3FFUA 5LPGA 3G0QA 3FSPA 5C8LA 5GHIA 5GHPA 3MDIA 3X0SA 3HYQA 3E57A 4S2XA 1PPVA 1VCDA 2FKBA 3O61A 5FSKA 1PUSA 3X0RA 3A6UA 1XSAA 1TUMA 5ANWA 5C7TA 3BHOA 3GZ8A 5FSIA 3QSJA 3EESA 2ICJA 1F3YA 2I8UA 2A8QA 2CL3A 3CNGA
chains in the Genus database with same CATH superfamily
2O5FA 1SZ3A 1NQZA 2AZWA 3GRNA 5BS6A 1VHGA 2KDWA 1Q54A 1HZTA 1V8UA 4K6EA 3AC9A 1MUTA 3J7Ye 2VNPA 2W4EA 3X0IA 1G0SA 2VNQA 1V8RA 2B2KA 5DEQA 1NFZA 4ICKA 3I9XA 2KDVA 3FJYA 1VRLA 1VK6A 3HHJA 3A6VA 3Q4IA 4NFWA 5ISYA 3ZR1A 1K26A 2YVMA 3GG6A 4HVYA 2R5WA 5ANVA 5DDGA 3A6TA 2YVNA 2A8SA 1V8NA 3SONA 5BONA 1JRKA 2A8TA 1HX3A 1V8IA 1V8MA 1XSCA 2G74A 2QJOA 1RYAA 3O8SA 3Q93A 4JZTA 1GA7A 4KG3A 5HZXA 4NFXA 1RRQA 4JZUA 1VIQA 2YVPA 5ANTA 2I8TA 2G73A 2GT4A 1X51A 3N9UA 3R03A 5FSLA 1X84A 2QKMB 1PPXA 3MCFA 4S2WA 3X0KA 3X0MA 1PUNA 4KG4A 2B0VA 2J8QA 3RH7A 1V8LA 2B06A 5FSNA 5GHJA 3X0QA 3P6YA 3X0PA 2O5WA 3Q1PA 3BM4A 5GHMA 1I9AA 2Q9PA 5FSMA 4YPRA 5IW4A 1MQWA 3FK9A 2YVOA 1SJYA 3Q2TA 2JVBA 4ZG0A 4V14A 3A6SA 5ANSA 2A8RA 3GZ5A 1VC9A 2YYHA 5FSOA 3OGAA 4J7HA 3P5TA 1MQEA 1QVJA 2DHOA 5GHQA 3X0JA 1V8TA 1Q27A 3I7UA 1XSBA 1KT9A 1PUQA 4J7GA 3ZR0A 4JZVA 1MK1A 1PPWA 3FCMA 1G9QA 5I8UA 3SMDA 3H95A 4JZSA 2FVVA 1VC8A 4HFQA 5CFIA 3EEUA 5IW5A 2DSCA 3N77A 3X0LA 4KYXA 3F13A 5ANUA 1V8WA 3I7VA 3EXQA 1KHZA 2ICKA 4C9WA 4YPHA 2DSDA 2QJTA 5C7QA 3X0NA 2DUKA 5GHNA 3GZ6A 1V8YA 1V8SA 4N1UA 3GWYA 2XSQA 3BAPA 2PQVA 4S2YA 4C9XA 2A6TA 3O6ZA 1PVFA 2RRKA 1Q33A 3KVHA 1VHZA 1OW2A 2GB5A 5DD4A 1IRYA 1X83A 1SU2A 2O1CA 4IJXA 4KTBA 4MPOA 3MDGA 3U53A 2PNYA 1MR2A 1SOIA 1R67A 4S2VA 2CZRA 3WHWA 2I6KA 1K2EA 3DKUA 3EF5A 3SHDA 2FMLA 3ID9A 3F6AA 1MP2A 3O52A 3O69A 1VIUA 3L85A 4N1TA 3ACAA 3X0OA 1KTGA 3COUA 1NFSA 4YOQA 5DPKA 5CFJA 2DSBA 3DUPA 3MGMA 4ILQA 1NQYA 1V8VA 1U20A 2A8PA 1RRSA 3Q91A 1JKNA 4DYWA 2GT2A 3Q2SA 5GHOA 3FFUA 5LPGA 3G0QA 3FSPA 5C8LA 5GHIA 5GHPA 3MDIA 3X0SA 3HYQA 3E57A 4S2XA 1PPVA 1VCDA 2FKBA 3O61A 5FSKA 1PUSA 3X0RA 3A6UA 1XSAA 1TUMA 5ANWA 5C7TA 3BHOA 3GZ8A 5FSIA 3QSJA 3EESA 2ICJA 1F3YA 2I8UA 2A8QA 2CL3A 3CNGA
chains in the Genus database with same CATH topology
2O5FA 1SZ3A 1NQZA 2AZWA 3GRNA 5BS6A 1VHGA 2KDWA 1Q54A 1HZTA 1V8UA 4K6EA 3AC9A 1MUTA 3J7Ye 2VNPA 2W4EA 3X0IA 1G0SA 2VNQA 1V8RA 2B2KA 5DEQA 1NFZA 4ICKA 3I9XA 2KDVA 3FJYA 1VRLA 1VK6A 3HHJA 3A6VA 3Q4IA 4NFWA 5ISYA 3ZR1A 1K26A 2YVMA 3GG6A 4HVYA 2R5WA 5ANVA 5DDGA 3A6TA 2YVNA 2A8SA 1V8NA 3SONA 5BONA 1JRKA 2A8TA 1HX3A 1V8IA 1V8MA 1XSCA 2G74A 2QJOA 1RYAA 3O8SA 3Q93A 4JZTA 1GA7A 4KG3A 5HZXA 4NFXA 1RRQA 4JZUA 1VIQA 2YVPA 5ANTA 2I8TA 2G73A 2GT4A 1X51A 3N9UA 3R03A 5FSLA 1X84A 2QKMB 1PPXA 3MCFA 4S2WA 3X0KA 3X0MA 1PUNA 4KG4A 2B0VA 2J8QA 3RH7A 1V8LA 2B06A 5FSNA 5GHJA 3X0QA 3P6YA 3X0PA 2O5WA 3Q1PA 3BM4A 5GHMA 1I9AA 2Q9PA 5FSMA 4YPRA 5IW4A 1MQWA 3FK9A 2YVOA 1SJYA 3Q2TA 2JVBA 4ZG0A 4V14A 3A6SA 5ANSA 2A8RA 3GZ5A 1VC9A 2YYHA 5FSOA 3OGAA 4J7HA 3P5TA 1MQEA 1QVJA 2DHOA 5GHQA 3X0JA 1V8TA 1Q27A 3I7UA 1XSBA 1KT9A 1PUQA 4J7GA 3ZR0A 4JZVA 1MK1A 1PPWA 3FCMA 1G9QA 5I8UA 3SMDA 3H95A 4JZSA 2FVVA 1VC8A 4HFQA 5CFIA 3EEUA 5IW5A 2DSCA 3N77A 3X0LA 4KYXA 3F13A 5ANUA 1V8WA 3I7VA 3EXQA 1KHZA 2ICKA 4C9WA 4YPHA 2DSDA 2QJTA 5C7QA 3X0NA 2DUKA 5GHNA 3GZ6A 1V8YA 1V8SA 4N1UA 3GWYA 2XSQA 3BAPA 2PQVA 4S2YA 4C9XA 2A6TA 3O6ZA 1PVFA 2RRKA 1Q33A 3KVHA 1VHZA 1OW2A 2GB5A 5DD4A 1IRYA 1X83A 1SU2A 2O1CA 4IJXA 4KTBA 4MPOA 3MDGA 3U53A 2PNYA 1MR2A 1SOIA 1R67A 4S2VA 2CZRA 3WHWA 2I6KA 1K2EA 3DKUA 3EF5A 3SHDA 2FMLA 3ID9A 3F6AA 1MP2A 3O52A 3O69A 1VIUA 3L85A 4N1TA 3ACAA 3X0OA 1KTGA 3COUA 1NFSA 4YOQA 5DPKA 5CFJA 2DSBA 3DUPA 3MGMA 4ILQA 1NQYA 1V8VA 1U20A 2A8PA 1RRSA 3Q91A 1JKNA 4DYWA 2GT2A 3Q2SA 5GHOA 3FFUA 5LPGA 3G0QA 3FSPA 5C8LA 5GHIA 5GHPA 3MDIA 3X0SA 3HYQA 3E57A 4S2XA 1PPVA 1VCDA 2FKBA 3O61A 5FSKA 1PUSA 3X0RA 3A6UA 1XSAA 1TUMA 5ANWA 5C7TA 3BHOA 3GZ8A 5FSIA 3QSJA 3EESA 2ICJA 1F3YA 2I8UA 2A8QA 2CL3A 3CNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5F A;  1SZ3 A;  1NQZ A;  2AZW A;  3GRN A;  5BS6 A;  1VHG A;  2KDW A;  1Q54 A;  1HZT A;  1V8U A;  4K6E A;  3AC9 A;  1MUT A;  3J7Y e;  2VNP A;  2W4E A;  3X0I A;  1G0S A;  2VNQ A;  1V8R A;  2B2K A;  5DEQ A;  1NFZ A;  4ICK A;  3I9X A;  2KDV A;  3FJY A;  1VRL A;  1VK6 A;  3HHJ A;  3A6V A;  3Q4I A;  4NFW A;  5ISY A;  3ZR1 A;  1K26 A;  2YVM A;  3GG6 A;  4HVY A;  2R5W A;  5ANV A;  5DDG A;  3A6T A;  2YVN A;  2A8S A;  1V8N A;  3SON A;  5BON A;  1JRK A;  2A8T A;  1HX3 A;  1V8I A;  1V8M A;  1XSC A;  2G74 A;  2QJO A;  1RYA A;  3O8S A;  3Q93 A;  4JZT A;  1GA7 A;  4KG3 A;  5HZX A;  4NFX A;  1RRQ A;  4JZU A;  1VIQ A;  2YVP A;  5ANT A;  2I8T A;  2G73 A;  2GT4 A;  1X51 A;  3N9U A;  3R03 A;  5FSL A;  1X84 A;  2QKM B;  1PPX A;  3MCF A;  4S2W A;  3X0K A;  3X0M A;  1PUN A;  4KG4 A;  2B0V A;  2J8Q A;  3RH7 A;  1V8L A;  2B06 A;  5FSN A;  5GHJ A;  3X0Q A;  3P6Y A;  3X0P A;  2O5W A;  3Q1P A;  3BM4 A;  5GHM A;  1I9A A;  2Q9P A;  5FSM A;  4YPR A;  5IW4 A;  1MQW A;  3FK9 A;  2YVO A;  1SJY A;  3Q2T A;  2JVB A;  4ZG0 A;  4V14 A;  3A6S A;  5ANS A;  2A8R A;  3GZ5 A;  1VC9 A;  2YYH A;  5FSO A;  3OGA A;  3P5T A;  1MQE A;  1QVJ A;  2DHO A;  5GHQ A;  3X0J A;  1V8T A;  1Q27 A;  3I7U A;  1XSB A;  1KT9 A;  1PUQ A;  3ZR0 A;  4JZV A;  1MK1 A;  1PPW A;  3FCM A;  1G9Q A;  5I8U A;  3SMD A;  3H95 A;  4JZS A;  2FVV A;  1VC8 A;  4HFQ A;  5CFI A;  3EEU A;  5IW5 A;  2DSC A;  3N77 A;  3X0L A;  4KYX A;  3F13 A;  5ANU A;  1V8W A;  3I7V A;  3EXQ A;  1KHZ A;  2ICK A;  4C9W A;  4YPH A;  2DSD A;  2QJT A;  5C7Q A;  3X0N A;  2DUK A;  5GHN A;  3GZ6 A;  1V8Y A;  1V8S A;  4N1U A;  3GWY A;  2XSQ A;  3BAP A;  2PQV A;  4S2Y A;  4C9X A;  2A6T A;  3O6Z A;  1PVF A;  2RRK A;  1Q33 A;  3KVH A;  1VHZ A;  1OW2 A;  2GB5 A;  5DD4 A;  1IRY A;  1X83 A;  1SU2 A;  2O1C A;  4IJX A;  4KTB A;  4MPO A;  3MDG A;  3U53 A;  2PNY A;  1MR2 A;  1SOI A;  1R67 A;  4S2V A;  3WHW A;  2I6K A;  1K2E A;  3DKU A;  3EF5 A;  3SHD A;  2FML A;  3ID9 A;  3F6A A;  1MP2 A;  3O52 A;  3O69 A;  1VIU A;  3L85 A;  4N1T A;  3ACA A;  3X0O A;  1KTG A;  3COU A;  1NFS A;  4YOQ A;  5DPK A;  5CFJ A;  2DSB A;  3DUP A;  3MGM A;  4ILQ A;  1NQY A;  1V8V A;  1U20 A;  2A8P A;  1RRS A;  3Q91 A;  1JKN A;  4DYW A;  2GT2 A;  3Q2S A;  5GHO A;  3FFU A;  5LPG A;  3G0Q A;  3FSP A;  5C8L A;  5GHI A;  5GHP A;  3MDI A;  3X0S A;  3HYQ A;  3E57 A;  4S2X A;  1PPV A;  1VCD A;  2FKB A;  3O61 A;  5FSK A;  1PUS A;  3X0R A;  3A6U A;  1XSA A;  1TUM A;  5ANW A;  5C7T A;  3BHO A;  3GZ8 A;  5FSI A;  3QSJ A;  3EES A;  2ICJ A;  1F3Y A;  2I8U A;  2A8Q A;  2CL3 A;  3CNG A; 
#chains in the Genus database with same CATH topology
 2O5F A;  1SZ3 A;  1NQZ A;  2AZW A;  3GRN A;  5BS6 A;  1VHG A;  2KDW A;  1Q54 A;  1HZT A;  1V8U A;  4K6E A;  3AC9 A;  1MUT A;  3J7Y e;  2VNP A;  2W4E A;  3X0I A;  1G0S A;  2VNQ A;  1V8R A;  2B2K A;  5DEQ A;  1NFZ A;  4ICK A;  3I9X A;  2KDV A;  3FJY A;  1VRL A;  1VK6 A;  3HHJ A;  3A6V A;  3Q4I A;  4NFW A;  5ISY A;  3ZR1 A;  1K26 A;  2YVM A;  3GG6 A;  4HVY A;  2R5W A;  5ANV A;  5DDG A;  3A6T A;  2YVN A;  2A8S A;  1V8N A;  3SON A;  5BON A;  1JRK A;  2A8T A;  1HX3 A;  1V8I A;  1V8M A;  1XSC A;  2G74 A;  2QJO A;  1RYA A;  3O8S A;  3Q93 A;  4JZT A;  1GA7 A;  4KG3 A;  5HZX A;  4NFX A;  1RRQ A;  4JZU A;  1VIQ A;  2YVP A;  5ANT A;  2I8T A;  2G73 A;  2GT4 A;  1X51 A;  3N9U A;  3R03 A;  5FSL A;  1X84 A;  2QKM B;  1PPX A;  3MCF A;  4S2W A;  3X0K A;  3X0M A;  1PUN A;  4KG4 A;  2B0V A;  2J8Q A;  3RH7 A;  1V8L A;  2B06 A;  5FSN A;  5GHJ A;  3X0Q A;  3P6Y A;  3X0P A;  2O5W A;  3Q1P A;  3BM4 A;  5GHM A;  1I9A A;  2Q9P A;  5FSM A;  4YPR A;  5IW4 A;  1MQW A;  3FK9 A;  2YVO A;  1SJY A;  3Q2T A;  2JVB A;  4ZG0 A;  4V14 A;  3A6S A;  5ANS A;  2A8R A;  3GZ5 A;  1VC9 A;  2YYH A;  5FSO A;  3OGA A;  4J7H A;  3P5T A;  1MQE A;  1QVJ A;  2DHO A;  5GHQ A;  3X0J A;  1V8T A;  1Q27 A;  3I7U A;  1XSB A;  1KT9 A;  1PUQ A;  4J7G A;  3ZR0 A;  4JZV A;  1MK1 A;  1PPW A;  3FCM A;  1G9Q A;  5I8U A;  3SMD A;  3H95 A;  4JZS A;  2FVV A;  1VC8 A;  4HFQ A;  5CFI A;  3EEU A;  5IW5 A;  2DSC A;  3N77 A;  3X0L A;  4KYX A;  3F13 A;  5ANU A;  1V8W A;  3I7V A;  3EXQ A;  1KHZ A;  2ICK A;  4C9W A;  4YPH A;  2DSD A;  2QJT A;  5C7Q A;  3X0N A;  2DUK A;  5GHN A;  3GZ6 A;  1V8Y A;  1V8S A;  4N1U A;  3GWY A;  2XSQ A;  3BAP A;  2PQV A;  4S2Y A;  4C9X A;  2A6T A;  3O6Z A;  1PVF A;  2RRK A;  1Q33 A;  3KVH A;  1VHZ A;  1OW2 A;  2GB5 A;  5DD4 A;  1IRY A;  1X83 A;  1SU2 A;  2O1C A;  4IJX A;  4KTB A;  4MPO A;  3MDG A;  3U53 A;  2PNY A;  1MR2 A;  1SOI A;  1R67 A;  4S2V A;  2CZR A;  3WHW A;  2I6K A;  1K2E A;  3DKU A;  3EF5 A;  3SHD A;  2FML A;  3ID9 A;  3F6A A;  1MP2 A;  3O52 A;  3O69 A;  1VIU A;  3L85 A;  4N1T A;  3ACA A;  3X0O A;  1KTG A;  3COU A;  1NFS A;  4YOQ A;  5DPK A;  5CFJ A;  2DSB A;  3DUP A;  3MGM A;  4ILQ A;  1NQY A;  1V8V A;  1U20 A;  2A8P A;  1RRS A;  3Q91 A;  1JKN A;  4DYW A;  2GT2 A;  3Q2S A;  5GHO A;  3FFU A;  5LPG A;  3G0Q A;  3FSP A;  5C8L A;  5GHI A;  5GHP A;  3MDI A;  3X0S A;  3HYQ A;  3E57 A;  4S2X A;  1PPV A;  1VCD A;  2FKB A;  3O61 A;  5FSK A;  1PUS A;  3X0R A;  3A6U A;  1XSA A;  1TUM A;  5ANW A;  5C7T A;  3BHO A;  3GZ8 A;  5FSI A;  3QSJ A;  3EES A;  2ICJ A;  1F3Y A;  2I8U A;  2A8Q A;  2CL3 A;  3CNG A; 
#chains in the Genus database with same CATH homology
 2O5F A;  1SZ3 A;  1NQZ A;  2AZW A;  3GRN A;  5BS6 A;  1VHG A;  2KDW A;  1Q54 A;  1HZT A;  1V8U A;  4K6E A;  3AC9 A;  1MUT A;  3J7Y e;  2VNP A;  2W4E A;  3X0I A;  1G0S A;  2VNQ A;  1V8R A;  2B2K A;  5DEQ A;  1NFZ A;  4ICK A;  3I9X A;  2KDV A;  3FJY A;  1VRL A;  1VK6 A;  3HHJ A;  3A6V A;  3Q4I A;  4NFW A;  5ISY A;  3ZR1 A;  1K26 A;  2YVM A;  3GG6 A;  4HVY A;  2R5W A;  5ANV A;  5DDG A;  3A6T A;  2YVN A;  2A8S A;  1V8N A;  3SON A;  5BON A;  1JRK A;  2A8T A;  1HX3 A;  1V8I A;  1V8M A;  1XSC A;  2G74 A;  2QJO A;  1RYA A;  3O8S A;  3Q93 A;  4JZT A;  1GA7 A;  4KG3 A;  5HZX A;  4NFX A;  1RRQ A;  4JZU A;  1VIQ A;  2YVP A;  5ANT A;  2I8T A;  2G73 A;  2GT4 A;  1X51 A;  3N9U A;  3R03 A;  5FSL A;  1X84 A;  2QKM B;  1PPX A;  3MCF A;  4S2W A;  3X0K A;  3X0M A;  1PUN A;  4KG4 A;  2B0V A;  2J8Q A;  3RH7 A;  1V8L A;  2B06 A;  5FSN A;  5GHJ A;  3X0Q A;  3P6Y A;  3X0P A;  2O5W A;  3Q1P A;  3BM4 A;  5GHM A;  1I9A A;  2Q9P A;  5FSM A;  4YPR A;  5IW4 A;  1MQW A;  3FK9 A;  2YVO A;  1SJY A;  3Q2T A;  2JVB A;  4ZG0 A;  4V14 A;  3A6S A;  5ANS A;  2A8R A;  3GZ5 A;  1VC9 A;  2YYH A;  5FSO A;  3OGA A;  4J7H A;  3P5T A;  1MQE A;  1QVJ A;  2DHO A;  5GHQ A;  3X0J A;  1V8T A;  1Q27 A;  3I7U A;  1XSB A;  1KT9 A;  1PUQ A;  4J7G A;  3ZR0 A;  4JZV A;  1MK1 A;  1PPW A;  3FCM A;  1G9Q A;  5I8U A;  3SMD A;  3H95 A;  4JZS A;  2FVV A;  1VC8 A;  4HFQ A;  5CFI A;  3EEU A;  5IW5 A;  2DSC A;  3N77 A;  3X0L A;  4KYX A;  3F13 A;  5ANU A;  1V8W A;  3I7V A;  3EXQ A;  1KHZ A;  2ICK A;  4C9W A;  4YPH A;  2DSD A;  2QJT A;  5C7Q A;  3X0N A;  2DUK A;  5GHN A;  3GZ6 A;  1V8Y A;  1V8S A;  4N1U A;  3GWY A;  2XSQ A;  3BAP A;  2PQV A;  4S2Y A;  4C9X A;  2A6T A;  3O6Z A;  1PVF A;  2RRK A;  1Q33 A;  3KVH A;  1VHZ A;  1OW2 A;  2GB5 A;  5DD4 A;  1IRY A;  1X83 A;  1SU2 A;  2O1C A;  4IJX A;  4KTB A;  4MPO A;  3MDG A;  3U53 A;  2PNY A;  1MR2 A;  1SOI A;  1R67 A;  4S2V A;  2CZR A;  3WHW A;  2I6K A;  1K2E A;  3DKU A;  3EF5 A;  3SHD A;  2FML A;  3ID9 A;  3F6A A;  1MP2 A;  3O52 A;  3O69 A;  1VIU A;  3L85 A;  4N1T A;  3ACA A;  3X0O A;  1KTG A;  3COU A;  1NFS A;  4YOQ A;  5DPK A;  5CFJ A;  2DSB A;  3DUP A;  3MGM A;  4ILQ A;  1NQY A;  1V8V A;  1U20 A;  2A8P A;  1RRS A;  3Q91 A;  1JKN A;  4DYW A;  2GT2 A;  3Q2S A;  5GHO A;  3FFU A;  5LPG A;  3G0Q A;  3FSP A;  5C8L A;  5GHI A;  5GHP A;  3MDI A;  3X0S A;  3HYQ A;  3E57 A;  4S2X A;  1PPV A;  1VCD A;  2FKB A;  3O61 A;  5FSK A;  1PUS A;  3X0R A;  3A6U A;  1XSA A;  1TUM A;  5ANW A;  5C7T A;  3BHO A;  3GZ8 A;  5FSI A;  3QSJ A;  3EES A;  2ICJ A;  1F3Y A;  2I8U A;  2A8Q A;  2CL3 A;  3CNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...