5ANUA

Mth1 in complex with compound 15
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Potent and Selective Inhibitors of Mth1 Probe its Role in Cancer Cell Survival.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 154
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5anuA00
3KVHA 5GHNA 5ANWA 1SZ3A 3X0LA 3HHJA 2G74A 3O52A 1V8SA 3I7VA 1NQZA 5C7TA 3X0RA 4NFWA 1G0SA 1K26A 3O6ZA 1RYAA 2ICKA 1SU2A 1PUQA 3N77A 2FVVA 3FFUA 5HZXA 3A6UA 3I7UA 2KDWA 1U20A 3G0QA 2PNYA 3HYQA 5FSLA 4JZUA 5C8LA 1VIUA 1XSBA 5DD4A 3U53A 2I8UA 2A8SA 5DDGA 4HVYA 3X0IA 1VK6A 3J7Ye 5DPKA 3SMDA 5IW5A 3X0KA 1V8LA 3DUPA 1JRKA 3H95A 5GHPA 1Q54A 5CFIA 4YPHA 4MPOA 4ZG0A 1RRQA 1V8RA 3F13A 3O8SA 1MUTA 2DSCA 3N9UA 4S2WA 3X0QA 4ILQA 1VHZA 1V8WA 2VNQA 3ZR0A 2DSDA 3ID9A 1I9AA 2CL3A 3BAPA 1MQWA 1JKNA 1NFZA 2JVBA 4C9XA 2AZWA 4JZSA 5ANVA 2DHOA 3X0MA 3X0JA 1PUNA 2Q9PA 5ANTA 1K2EA 5I8UA 1MQEA 3Q2TA 3FSPA 1SOIA 5FSKA 3GZ6A 1X84A 3Q93A 2A8RA 4HFQA 5FSNA 1NFSA 3A6VA 1GA7A 3X0PA 1X51A 2B06A 2O1CA 3Q91A 4KG3A 1XSAA 1PPVA 3X0OA 3WHWA 2QKMB 5IW4A 2G73A 2I8TA 3Q1PA 1KTGA 3QSJA 5FSIA 1Q27A 5ANUA 3A6SA 5GHQA 2QJOA 3EXQA 1G9QA 2ICJA 4KTBA 3MCFA 3Q4IA 5C7QA 1RRSA 3GWYA 2A8QA 4N1TA 1OW2A 1VRLA 2W4EA 3FJYA 3MDIA 1TUMA 1HX3A 2YVMA 5GHOA 1NQYA 1KHZA 3OGAA 4V14A 5GHMA 1V8VA 2VNPA 5ANSA 1VCDA 5FSMA 3COUA 4JZVA 3BHOA 3P6YA 1Q33A 2A8TA 4JZTA 4YOQA 1V8YA 1MP2A 2I6KA 2DUKA 3FCMA 2GT4A 3CNGA 3GZ8A 1PPXA 3MGMA 4DYWA 1VIQA 5BONA 3O69A 2PQVA 3L85A 1MR2A 2DSBA 2O5FA 2QJTA 3Q2SA 1PVFA 4IJXA 1PUSA 1V8UA 1R67A 2J8QA 3ACAA 3BM4A 2B2KA 3SONA 3RH7A 2FKBA 3P5TA 4KYXA 3GG6A 1KT9A 4N1UA 1HZTA 2A6TA 4YPRA 2B0VA 2O5WA 4C9WA 1V8NA 3DKUA 3R03A 3F6AA 3FK9A 1V8TA 5GHJA 5FSOA 2A8PA 3GZ5A 2XSQA 3A6TA 4ICKA 3ZR1A 1MK1A 2RRKA 3GRNA 3I9XA 3MDGA 2YVNA 3SHDA 5BS6A 2YVPA 3AC9A 4KG4A 1VC8A 4S2XA 2YVOA 1SJYA 5LPGA 2YYHA 3EEUA 4S2YA 3X0NA 2GB5A 1F3YA 2KDVA 4NFXA 1VC9A 1VHGA 1QVJA 5DEQA 5CFJA 1XSCA 2FMLA 3E57A 4K6EA 4S2VA 2R5WA 5GHIA 5ISYA 1V8MA 3EESA 3O61A 3EF5A 1IRYA 2GT2A 3X0SA 1X83A 1PPWA 1V8IA
chains in the Genus database with same CATH superfamily
3KVHA 5GHNA 5ANWA 1SZ3A 3X0LA 3HHJA 2G74A 3O52A 1V8SA 3I7VA 1NQZA 5C7TA 3X0RA 4NFWA 1G0SA 1K26A 3O6ZA 1RYAA 2ICKA 1SU2A 1PUQA 3N77A 2FVVA 3FFUA 5HZXA 3A6UA 3I7UA 2KDWA 1U20A 3G0QA 2PNYA 3HYQA 5FSLA 4JZUA 5C8LA 1VIUA 1XSBA 5DD4A 3U53A 2I8UA 2A8SA 5DDGA 4HVYA 3X0IA 1VK6A 3J7Ye 5DPKA 3SMDA 5IW5A 3X0KA 1V8LA 3DUPA 1JRKA 3H95A 5GHPA 1Q54A 5CFIA 4J7GA 4YPHA 4MPOA 4ZG0A 1RRQA 1V8RA 3F13A 3O8SA 1MUTA 2DSCA 3N9UA 4S2WA 3X0QA 4ILQA 1VHZA 1V8WA 2VNQA 3ZR0A 2DSDA 3ID9A 1I9AA 2CL3A 3BAPA 1MQWA 1JKNA 1NFZA 2JVBA 4C9XA 2AZWA 4JZSA 5ANVA 2DHOA 3X0MA 3X0JA 1PUNA 2Q9PA 5ANTA 1K2EA 5I8UA 1MQEA 3Q2TA 3FSPA 1SOIA 5FSKA 3GZ6A 1X84A 3Q93A 2A8RA 4HFQA 5FSNA 1NFSA 3A6VA 1GA7A 3X0PA 1X51A 2B06A 2O1CA 3Q91A 4KG3A 1XSAA 1PPVA 3X0OA 3WHWA 2QKMB 5IW4A 2G73A 2I8TA 3Q1PA 1KTGA 3QSJA 5FSIA 1Q27A 5ANUA 3A6SA 5GHQA 2QJOA 3EXQA 1G9QA 2ICJA 4KTBA 3MCFA 4J7HA 3Q4IA 5C7QA 1RRSA 3GWYA 2A8QA 4N1TA 1OW2A 1VRLA 2W4EA 3FJYA 3MDIA 1TUMA 1HX3A 2YVMA 5GHOA 1NQYA 1KHZA 3OGAA 4V14A 5GHMA 1V8VA 2VNPA 5ANSA 1VCDA 5FSMA 3COUA 4JZVA 3BHOA 2CZRA 3P6YA 1Q33A 2A8TA 4JZTA 4YOQA 1V8YA 1MP2A 2I6KA 2DUKA 3FCMA 2GT4A 3CNGA 3GZ8A 1PPXA 3MGMA 4DYWA 1VIQA 5BONA 3O69A 2PQVA 3L85A 1MR2A 2DSBA 2O5FA 2QJTA 3Q2SA 1PVFA 4IJXA 1PUSA 1V8UA 1R67A 2J8QA 3ACAA 3BM4A 2B2KA 3SONA 3RH7A 2FKBA 3P5TA 4KYXA 3GG6A 1KT9A 4N1UA 1HZTA 2A6TA 4YPRA 2B0VA 2O5WA 4C9WA 1V8NA 3DKUA 3R03A 3F6AA 3FK9A 1V8TA 5GHJA 5FSOA 2A8PA 3GZ5A 2XSQA 3A6TA 4ICKA 3ZR1A 1MK1A 2RRKA 3GRNA 3I9XA 3MDGA 2YVNA 3SHDA 5BS6A 2YVPA 3AC9A 4KG4A 1VC8A 4S2XA 2YVOA 1SJYA 5LPGA 2YYHA 3EEUA 4S2YA 3X0NA 2GB5A 1F3YA 2KDVA 4NFXA 1VC9A 1VHGA 1QVJA 5DEQA 5CFJA 1XSCA 2FMLA 3E57A 4K6EA 4S2VA 2R5WA 5GHIA 5ISYA 1V8MA 3EESA 3O61A 3EF5A 1IRYA 2GT2A 3X0SA 1X83A 1PPWA 1V8IA
chains in the Genus database with same CATH topology
3KVHA 5GHNA 5ANWA 1SZ3A 3X0LA 3HHJA 2G74A 3O52A 1V8SA 3I7VA 1NQZA 5C7TA 3X0RA 4NFWA 1G0SA 1K26A 3O6ZA 1RYAA 2ICKA 1SU2A 1PUQA 3N77A 2FVVA 3FFUA 5HZXA 3A6UA 3I7UA 2KDWA 1U20A 3G0QA 2PNYA 3HYQA 5FSLA 4JZUA 5C8LA 1VIUA 1XSBA 5DD4A 3U53A 2I8UA 2A8SA 5DDGA 4HVYA 3X0IA 1VK6A 3J7Ye 5DPKA 3SMDA 5IW5A 3X0KA 1V8LA 3DUPA 1JRKA 3H95A 5GHPA 1Q54A 5CFIA 4J7GA 4YPHA 4MPOA 4ZG0A 1RRQA 1V8RA 3F13A 3O8SA 1MUTA 2DSCA 3N9UA 4S2WA 3X0QA 4ILQA 1VHZA 1V8WA 2VNQA 3ZR0A 2DSDA 3ID9A 1I9AA 2CL3A 3BAPA 1MQWA 1JKNA 1NFZA 2JVBA 4C9XA 2AZWA 4JZSA 5ANVA 2DHOA 3X0MA 3X0JA 1PUNA 2Q9PA 5ANTA 1K2EA 5I8UA 1MQEA 3Q2TA 3FSPA 1SOIA 5FSKA 3GZ6A 1X84A 3Q93A 2A8RA 4HFQA 5FSNA 1NFSA 3A6VA 1GA7A 3X0PA 1X51A 2B06A 2O1CA 3Q91A 4KG3A 1XSAA 1PPVA 3X0OA 3WHWA 2QKMB 5IW4A 2G73A 2I8TA 3Q1PA 1KTGA 3QSJA 5FSIA 1Q27A 5ANUA 3A6SA 5GHQA 2QJOA 3EXQA 1G9QA 2ICJA 4KTBA 3MCFA 4J7HA 3Q4IA 5C7QA 1RRSA 3GWYA 2A8QA 4N1TA 1OW2A 1VRLA 2W4EA 3FJYA 3MDIA 1TUMA 1HX3A 2YVMA 5GHOA 1NQYA 1KHZA 3OGAA 4V14A 5GHMA 1V8VA 2VNPA 5ANSA 1VCDA 5FSMA 3COUA 4JZVA 3BHOA 2CZRA 3P6YA 1Q33A 2A8TA 4JZTA 4YOQA 1V8YA 1MP2A 2I6KA 2DUKA 3FCMA 2GT4A 3CNGA 3GZ8A 1PPXA 3MGMA 4DYWA 1VIQA 5BONA 3O69A 2PQVA 3L85A 1MR2A 2DSBA 2O5FA 2QJTA 3Q2SA 1PVFA 4IJXA 1PUSA 1V8UA 1R67A 2J8QA 3ACAA 3BM4A 2B2KA 3SONA 3RH7A 2FKBA 3P5TA 4KYXA 3GG6A 1KT9A 4N1UA 1HZTA 2A6TA 4YPRA 2B0VA 2O5WA 4C9WA 1V8NA 3DKUA 3R03A 3F6AA 3FK9A 1V8TA 5GHJA 5FSOA 2A8PA 3GZ5A 2XSQA 3A6TA 4ICKA 3ZR1A 1MK1A 2RRKA 3GRNA 3I9XA 3MDGA 2YVNA 3SHDA 5BS6A 2YVPA 3AC9A 4KG4A 1VC8A 4S2XA 2YVOA 1SJYA 5LPGA 2YYHA 3EEUA 4S2YA 3X0NA 2GB5A 1F3YA 2KDVA 4NFXA 1VC9A 1VHGA 1QVJA 5DEQA 5CFJA 1XSCA 2FMLA 3E57A 4K6EA 4S2VA 2R5WA 5GHIA 5ISYA 1V8MA 3EESA 3O61A 3EF5A 1IRYA 2GT2A 3X0SA 1X83A 1PPWA 1V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVH A;  5GHN A;  5ANW A;  1SZ3 A;  3X0L A;  3HHJ A;  2G74 A;  3O52 A;  1V8S A;  3I7V A;  1NQZ A;  5C7T A;  3X0R A;  4NFW A;  1G0S A;  1K26 A;  3O6Z A;  1RYA A;  2ICK A;  1SU2 A;  1PUQ A;  3N77 A;  2FVV A;  3FFU A;  5HZX A;  3A6U A;  3I7U A;  2KDW A;  1U20 A;  3G0Q A;  2PNY A;  3HYQ A;  5FSL A;  4JZU A;  5C8L A;  1VIU A;  1XSB A;  5DD4 A;  3U53 A;  2I8U A;  2A8S A;  5DDG A;  4HVY A;  3X0I A;  1VK6 A;  3J7Y e;  5DPK A;  3SMD A;  5IW5 A;  3X0K A;  1V8L A;  3DUP A;  1JRK A;  3H95 A;  5GHP A;  1Q54 A;  5CFI A;  4YPH A;  4MPO A;  4ZG0 A;  1RRQ A;  1V8R A;  3F13 A;  3O8S A;  1MUT A;  2DSC A;  3N9U A;  4S2W A;  3X0Q A;  4ILQ A;  1VHZ A;  1V8W A;  2VNQ A;  3ZR0 A;  2DSD A;  3ID9 A;  1I9A A;  2CL3 A;  3BAP A;  1MQW A;  1JKN A;  1NFZ A;  2JVB A;  4C9X A;  2AZW A;  4JZS A;  5ANV A;  2DHO A;  3X0M A;  3X0J A;  1PUN A;  2Q9P A;  5ANT A;  1K2E A;  5I8U A;  1MQE A;  3Q2T A;  3FSP A;  1SOI A;  5FSK A;  3GZ6 A;  1X84 A;  3Q93 A;  2A8R A;  4HFQ A;  5FSN A;  1NFS A;  3A6V A;  1GA7 A;  3X0P A;  1X51 A;  2B06 A;  2O1C A;  3Q91 A;  4KG3 A;  1XSA A;  1PPV A;  3X0O A;  3WHW A;  2QKM B;  5IW4 A;  2G73 A;  2I8T A;  3Q1P A;  1KTG A;  3QSJ A;  5FSI A;  1Q27 A;  5ANU A;  3A6S A;  5GHQ A;  2QJO A;  3EXQ A;  1G9Q A;  2ICJ A;  4KTB A;  3MCF A;  3Q4I A;  5C7Q A;  1RRS A;  3GWY A;  2A8Q A;  4N1T A;  1OW2 A;  1VRL A;  2W4E A;  3FJY A;  3MDI A;  1TUM A;  1HX3 A;  2YVM A;  5GHO A;  1NQY A;  1KHZ A;  3OGA A;  4V14 A;  5GHM A;  1V8V A;  2VNP A;  5ANS A;  1VCD A;  5FSM A;  3COU A;  4JZV A;  3BHO A;  3P6Y A;  1Q33 A;  2A8T A;  4JZT A;  4YOQ A;  1V8Y A;  1MP2 A;  2I6K A;  2DUK A;  3FCM A;  2GT4 A;  3CNG A;  3GZ8 A;  1PPX A;  3MGM A;  4DYW A;  1VIQ A;  5BON A;  3O69 A;  2PQV A;  3L85 A;  1MR2 A;  2DSB A;  2O5F A;  2QJT A;  3Q2S A;  1PVF A;  4IJX A;  1PUS A;  1V8U A;  1R67 A;  2J8Q A;  3ACA A;  3BM4 A;  2B2K A;  3SON A;  3RH7 A;  2FKB A;  3P5T A;  4KYX A;  3GG6 A;  1KT9 A;  4N1U A;  1HZT A;  2A6T A;  4YPR A;  2B0V A;  2O5W A;  4C9W A;  1V8N A;  3DKU A;  3R03 A;  3F6A A;  3FK9 A;  1V8T A;  5GHJ A;  5FSO A;  2A8P A;  3GZ5 A;  2XSQ A;  3A6T A;  4ICK A;  3ZR1 A;  1MK1 A;  2RRK A;  3GRN A;  3I9X A;  3MDG A;  2YVN A;  3SHD A;  5BS6 A;  2YVP A;  3AC9 A;  4KG4 A;  1VC8 A;  4S2X A;  2YVO A;  1SJY A;  5LPG A;  2YYH A;  3EEU A;  4S2Y A;  3X0N A;  2GB5 A;  1F3Y A;  2KDV A;  4NFX A;  1VC9 A;  1VHG A;  1QVJ A;  5DEQ A;  5CFJ A;  1XSC A;  2FML A;  3E57 A;  4K6E A;  4S2V A;  2R5W A;  5GHI A;  5ISY A;  1V8M A;  3EES A;  3O61 A;  3EF5 A;  1IRY A;  2GT2 A;  3X0S A;  1X83 A;  1PPW A;  1V8I A; 
#chains in the Genus database with same CATH topology
 3KVH A;  5GHN A;  5ANW A;  1SZ3 A;  3X0L A;  3HHJ A;  2G74 A;  3O52 A;  1V8S A;  3I7V A;  1NQZ A;  5C7T A;  3X0R A;  4NFW A;  1G0S A;  1K26 A;  3O6Z A;  1RYA A;  2ICK A;  1SU2 A;  1PUQ A;  3N77 A;  2FVV A;  3FFU A;  5HZX A;  3A6U A;  3I7U A;  2KDW A;  1U20 A;  3G0Q A;  2PNY A;  3HYQ A;  5FSL A;  4JZU A;  5C8L A;  1VIU A;  1XSB A;  5DD4 A;  3U53 A;  2I8U A;  2A8S A;  5DDG A;  4HVY A;  3X0I A;  1VK6 A;  3J7Y e;  5DPK A;  3SMD A;  5IW5 A;  3X0K A;  1V8L A;  3DUP A;  1JRK A;  3H95 A;  5GHP A;  1Q54 A;  5CFI A;  4J7G A;  4YPH A;  4MPO A;  4ZG0 A;  1RRQ A;  1V8R A;  3F13 A;  3O8S A;  1MUT A;  2DSC A;  3N9U A;  4S2W A;  3X0Q A;  4ILQ A;  1VHZ A;  1V8W A;  2VNQ A;  3ZR0 A;  2DSD A;  3ID9 A;  1I9A A;  2CL3 A;  3BAP A;  1MQW A;  1JKN A;  1NFZ A;  2JVB A;  4C9X A;  2AZW A;  4JZS A;  5ANV A;  2DHO A;  3X0M A;  3X0J A;  1PUN A;  2Q9P A;  5ANT A;  1K2E A;  5I8U A;  1MQE A;  3Q2T A;  3FSP A;  1SOI A;  5FSK A;  3GZ6 A;  1X84 A;  3Q93 A;  2A8R A;  4HFQ A;  5FSN A;  1NFS A;  3A6V A;  1GA7 A;  3X0P A;  1X51 A;  2B06 A;  2O1C A;  3Q91 A;  4KG3 A;  1XSA A;  1PPV A;  3X0O A;  3WHW A;  2QKM B;  5IW4 A;  2G73 A;  2I8T A;  3Q1P A;  1KTG A;  3QSJ A;  5FSI A;  1Q27 A;  5ANU A;  3A6S A;  5GHQ A;  2QJO A;  3EXQ A;  1G9Q A;  2ICJ A;  4KTB A;  3MCF A;  4J7H A;  3Q4I A;  5C7Q A;  1RRS A;  3GWY A;  2A8Q A;  4N1T A;  1OW2 A;  1VRL A;  2W4E A;  3FJY A;  3MDI A;  1TUM A;  1HX3 A;  2YVM A;  5GHO A;  1NQY A;  1KHZ A;  3OGA A;  4V14 A;  5GHM A;  1V8V A;  2VNP A;  5ANS A;  1VCD A;  5FSM A;  3COU A;  4JZV A;  3BHO A;  2CZR A;  3P6Y A;  1Q33 A;  2A8T A;  4JZT A;  4YOQ A;  1V8Y A;  1MP2 A;  2I6K A;  2DUK A;  3FCM A;  2GT4 A;  3CNG A;  3GZ8 A;  1PPX A;  3MGM A;  4DYW A;  1VIQ A;  5BON A;  3O69 A;  2PQV A;  3L85 A;  1MR2 A;  2DSB A;  2O5F A;  2QJT A;  3Q2S A;  1PVF A;  4IJX A;  1PUS A;  1V8U A;  1R67 A;  2J8Q A;  3ACA A;  3BM4 A;  2B2K A;  3SON A;  3RH7 A;  2FKB A;  3P5T A;  4KYX A;  3GG6 A;  1KT9 A;  4N1U A;  1HZT A;  2A6T A;  4YPR A;  2B0V A;  2O5W A;  4C9W A;  1V8N A;  3DKU A;  3R03 A;  3F6A A;  3FK9 A;  1V8T A;  5GHJ A;  5FSO A;  2A8P A;  3GZ5 A;  2XSQ A;  3A6T A;  4ICK A;  3ZR1 A;  1MK1 A;  2RRK A;  3GRN A;  3I9X A;  3MDG A;  2YVN A;  3SHD A;  5BS6 A;  2YVP A;  3AC9 A;  4KG4 A;  1VC8 A;  4S2X A;  2YVO A;  1SJY A;  5LPG A;  2YYH A;  3EEU A;  4S2Y A;  3X0N A;  2GB5 A;  1F3Y A;  2KDV A;  4NFX A;  1VC9 A;  1VHG A;  1QVJ A;  5DEQ A;  5CFJ A;  1XSC A;  2FML A;  3E57 A;  4K6E A;  4S2V A;  2R5W A;  5GHI A;  5ISY A;  1V8M A;  3EES A;  3O61 A;  3EF5 A;  1IRY A;  2GT2 A;  3X0S A;  1X83 A;  1PPW A;  1V8I A; 
#chains in the Genus database with same CATH homology
 3KVH A;  5GHN A;  5ANW A;  1SZ3 A;  3X0L A;  3HHJ A;  2G74 A;  3O52 A;  1V8S A;  3I7V A;  1NQZ A;  5C7T A;  3X0R A;  4NFW A;  1G0S A;  1K26 A;  3O6Z A;  1RYA A;  2ICK A;  1SU2 A;  1PUQ A;  3N77 A;  2FVV A;  3FFU A;  5HZX A;  3A6U A;  3I7U A;  2KDW A;  1U20 A;  3G0Q A;  2PNY A;  3HYQ A;  5FSL A;  4JZU A;  5C8L A;  1VIU A;  1XSB A;  5DD4 A;  3U53 A;  2I8U A;  2A8S A;  5DDG A;  4HVY A;  3X0I A;  1VK6 A;  3J7Y e;  5DPK A;  3SMD A;  5IW5 A;  3X0K A;  1V8L A;  3DUP A;  1JRK A;  3H95 A;  5GHP A;  1Q54 A;  5CFI A;  4J7G A;  4YPH A;  4MPO A;  4ZG0 A;  1RRQ A;  1V8R A;  3F13 A;  3O8S A;  1MUT A;  2DSC A;  3N9U A;  4S2W A;  3X0Q A;  4ILQ A;  1VHZ A;  1V8W A;  2VNQ A;  3ZR0 A;  2DSD A;  3ID9 A;  1I9A A;  2CL3 A;  3BAP A;  1MQW A;  1JKN A;  1NFZ A;  2JVB A;  4C9X A;  2AZW A;  4JZS A;  5ANV A;  2DHO A;  3X0M A;  3X0J A;  1PUN A;  2Q9P A;  5ANT A;  1K2E A;  5I8U A;  1MQE A;  3Q2T A;  3FSP A;  1SOI A;  5FSK A;  3GZ6 A;  1X84 A;  3Q93 A;  2A8R A;  4HFQ A;  5FSN A;  1NFS A;  3A6V A;  1GA7 A;  3X0P A;  1X51 A;  2B06 A;  2O1C A;  3Q91 A;  4KG3 A;  1XSA A;  1PPV A;  3X0O A;  3WHW A;  2QKM B;  5IW4 A;  2G73 A;  2I8T A;  3Q1P A;  1KTG A;  3QSJ A;  5FSI A;  1Q27 A;  5ANU A;  3A6S A;  5GHQ A;  2QJO A;  3EXQ A;  1G9Q A;  2ICJ A;  4KTB A;  3MCF A;  4J7H A;  3Q4I A;  5C7Q A;  1RRS A;  3GWY A;  2A8Q A;  4N1T A;  1OW2 A;  1VRL A;  2W4E A;  3FJY A;  3MDI A;  1TUM A;  1HX3 A;  2YVM A;  5GHO A;  1NQY A;  1KHZ A;  3OGA A;  4V14 A;  5GHM A;  1V8V A;  2VNP A;  5ANS A;  1VCD A;  5FSM A;  3COU A;  4JZV A;  3BHO A;  2CZR A;  3P6Y A;  1Q33 A;  2A8T A;  4JZT A;  4YOQ A;  1V8Y A;  1MP2 A;  2I6K A;  2DUK A;  3FCM A;  2GT4 A;  3CNG A;  3GZ8 A;  1PPX A;  3MGM A;  4DYW A;  1VIQ A;  5BON A;  3O69 A;  2PQV A;  3L85 A;  1MR2 A;  2DSB A;  2O5F A;  2QJT A;  3Q2S A;  1PVF A;  4IJX A;  1PUS A;  1V8U A;  1R67 A;  2J8Q A;  3ACA A;  3BM4 A;  2B2K A;  3SON A;  3RH7 A;  2FKB A;  3P5T A;  4KYX A;  3GG6 A;  1KT9 A;  4N1U A;  1HZT A;  2A6T A;  4YPR A;  2B0V A;  2O5W A;  4C9W A;  1V8N A;  3DKU A;  3R03 A;  3F6A A;  3FK9 A;  1V8T A;  5GHJ A;  5FSO A;  2A8P A;  3GZ5 A;  2XSQ A;  3A6T A;  4ICK A;  3ZR1 A;  1MK1 A;  2RRK A;  3GRN A;  3I9X A;  3MDG A;  2YVN A;  3SHD A;  5BS6 A;  2YVP A;  3AC9 A;  4KG4 A;  1VC8 A;  4S2X A;  2YVO A;  1SJY A;  5LPG A;  2YYH A;  3EEU A;  4S2Y A;  3X0N A;  2GB5 A;  1F3Y A;  2KDV A;  4NFX A;  1VC9 A;  1VHG A;  1QVJ A;  5DEQ A;  5CFJ A;  1XSC A;  2FML A;  3E57 A;  4K6E A;  4S2V A;  2R5W A;  5GHI A;  5ISY A;  1V8M A;  3EES A;  3O61 A;  3EF5 A;  1IRY A;  2GT2 A;  3X0S A;  1X83 A;  1PPW A;  1V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...