5AOBA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
RLRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLKDHVPRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
molecule keywords ESTERASE
source organism Thermogutta terrifontis
molecule tags Hydrolase
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aobA00
4H7DA 1T2NA 4G4JA 2XUIA 1QFSA 1S8OA 4FMPA 4KR0A 3VDXA 5HQ3A 5FDFA 3IUMA 1F0PA 7YASA 4BCCA 3F98A 5LIPA 1USWA 2XMSA 5AOAA 2XLCA 2X5XA 4PNZA 2VT7A 4J0JA 3G9TA 3B5EA 4QLOA 5DNUA 1AMNA 4HXFB 2RHWA 2CEKA 4UBLA 3FSGA 2XMZA 1DT3A 4BZWA 3SX4A 5JIBA 1E8NA 4K6GA 3BXPA 4J0IA 3I28A 2ZJ7A 4AX4A 5EHQA 3H18A 1TKRA 3E3AA 4X71A 4ARAA 3OPMA 1BCSA 1C7IA 4CCYB 1XKTA 4W1PA 4C6HA 4Q3KA 2GYWA 1W4LA 4LXHA 4CIAA 1K63A 4M0FA 4IH9A 2Y1KA 2ZYRA 1EH5A 3FYUB 5EHXA 1Z68A 4ZXFA 2WJ4A 5YASA 3R3WA 3T4UA 4FKBA 2PM8A 4KAAA 5ALVA 3AIOA 5ALRA 5ALYA 2G63A 4WJLA 4W1RA 1CQWA 3KDAA 3EF3A 4NMWA 4EBBA 4U2GA 2Z8ZA 1L7AA 4PSCA 4N8SA 2ECFA 1CV2A 3WKEA 3WL8A 1WPXA 3R3XA 1UK9A 1QOZA 1PFQA 3FLEA 3E1GA 5CXXA 3OOSA 3FOBA 1A88A 1EI9A 1YAJA 3BIWA 4MWTA 2WKWA 2ZJFA 4OD0A 2C58A 5BWCA 5ALWA 4DYHA 4UHFA 2QS9A 3TJMA 4X3CA 5JZBA 4JYMA 1R50A 2RGUA 3D4LA 2GZSA 4QEKA 2B61A 4BVKA 5CURA 5BOVA 2JGIA 1UKBA 4DIUA 3F9CA 4XJVA 3HYSA 1YB6A 4KRXA 3AZOA 1KU0A 1CUHA 4GHWA 4OCZA 2OPHA 4LYEA 4CFSA 1QZ3A 1MJ5A 3A2MA 3HC7A 1I6WA 5AI4A 5AICA 3R0VA 4WY8A 2PPLA 3C6ZA 4KE6A 4PSUA 5FV4A 3E0XA 3JW8A 4BBZA 4DMFA 3H2GA 2EDCA 2YYSA 4FBLA 3A6ZA 3I2IA 5JARA 5AM4A 1WM1A 4N8DA 3K6KA 2LIPA 2QXTA 4RNCA 5ALIA 1EB8A 1UXOA 3FWHA 4W9RA 3O95A 5AO9A 3R3VA 1N5MA 3C8HA 2WILA 5DWDA 2WUEA 3DD5A 1G66A 2QT9A 4J7AA 4BCBA 3WK8A 4DNOA 3FCYA 4BP8A 2HU5A 5AK5A 4C89A 2ZVDA 2GBCA 3FLAA 3R3YA 1U4NA 5C81A 4KACA 3VJMA 3D2BA 4HVTA 2PBLA 4B84A 3G9UA 4ZV7A 3DS8A 3G0BA 2VJBA 2J3DA 3NWOA 2PU7A 2DQZA 5A62A 2D0DA 5ALHA 3D5EA 4BRZA 2GBFA 1KU6A 1W76A 1IUPA 2O7RA 1XRLA 4FLEA 2WTNA 4Q05A 5C7YA 5JD5A 2B4KA 2WU3A 3QMMA 3WZMA 1MAAA 2B20A 1AC5A 1THTA 1QIEA 3FBWA 4G8BA 5JADA 3QITA 1H2XA 3O4IA 3D7RA 2BKLA 3FVTA 2HA4A 4QWWA 1JMKC 3D3NA 1QTIA 4L9AA 2OXEA 3G9XA 5ALSA 5ALTA 1ZD3A 3QPAA 1LPNA 2O2HA 1EDEA 1EB9A 1AX9A 1JU3A 1A8UA 2PU5A 5ALOA 4KE9A 5JAPA 4AN0A 2XMDA 4BP9A 3WA7A 1VA4A 4HTAA 4LHEA 3RK4A 1XQYA 5JAHA 4YK7A 4AO6A 3H2KA 3I6YA 5ALNA 3NUZA 1UK8A 4AMZA 2EEPA 5LYYA 4XX1A 4MWSA 1XZGA 4MYSA 5LZ4A 1Q83A 1MTZA 2OGSA 3BIXA 1PJAA 3C5WP 1CQZA 3DQZA 3EQ7A 4LYDA 4X6XA 5JYCA 5DTIA 3N2ZB 1XQVA 3AIMA 5E2IA 3VISA 4P93A 2BJHA 2Z8XA 1AQLA 1YR2A 3I2KA 4YPVA 3QBJA 2H1IA 1CUVA 1L7RA 1JFRA 5HK9A 1ZGBA 1LLFA 1UFOA 4KE7A 2PSJA 5CMLA 5HFAA 3ZLUA 3ESBA 4AZ3A 1DX4A 1Y37A 3PFBA 3WWPA 1K5PA 4E46A 3B3QA 3IVMA 5JANA 2GYVA 2HU7A 3AFIA 4KAJA 4OU4A 1F0NA 2G4LA 2VAVA 5DYTA 2QXUA 2QTBA 3DOHA 1Y7IA 5CRIA 1LGYA 4B6GA 4JYPA 5DYWA 4HS9A 3WA6A 2G5PA 3DEAA 4C87A 2JGKA 5EIAA 1NU8A 1QJ4A 4FDMA 5AKJA 2V9ZA 3I2FA 2BGRA 1EA5A 3HEAA 4ITVA 4J0GA 2JGEA 1QIJA 1H22A 3GZJA 3K9BA 2O2IA 4X6YA 3QM1A 4FHZA 4RGYA 3M81A 1ODTC 1XKLA 3CN9A 4Y2VA 3WYNA 4Q34A 3DLTA 3GBSA 1ZI9A 2XUPA 3U0VA 1GPNA 1QIFA 5E4JA 4U2EA 5FKJA 3MVEA 3FYTA 1JJFA 2XUOA 1XLWA 2XMCA 4BTLA 3F67A 1FSSA 4ARBA 3WK9A 4Q82A 3HJUA 2HADA 2OAGA 2W6CX 5IVHA 4J0CA 2JBWA 3FLBA 4G8DA 3I2JA 2WFLA 1YCDA 2WUDA 2C7BA 1GZ7A 3QYJA 4IH1A 1JMYA 4AO8A 4X93A 1Y7HA 3DL4A 5AKZA 3H19A 1ZD2P 5C8ZA 3H17A 1K4YA 3DYVA 3UMJA 1LPAB 1M33A 3UUFA 3WKCA 5K3BA 3QH4A 1VZ3A 2PX6A 4G4IA 4UFOA 1HPLA 4X95A 2XMBA 4E14A 3RKSA 4IO0A 4UHEA 1SCKA 2C4HA 2DCMA 3GFFA 1XZAA 4OB7A 3C87A 4AO7A 4GBGA 4RPCA 3WQHA 2OGTA 1QIMA 2JEYA 1BN7A 4HAIA 1F6WA 4J0KA 4WDQA 3WWEA 4H77A 3NGMA 5AI0A 2IX9A 4QA9A 2OCKA 3ZV7A 2IITA 1YASA 4K6KA 4DNPA 3ZWQA 1CUWA 3V1LA 2WUGA 3IUJA 3TRDA 4K6HA 1WB6A 4CG2A 1N1MA 2AJCA 1ZIXA 5KWIA 4Q3LA 2C0QA 4S0XA 1TRHA 1BN6A 1DWQA 4IH4A 4K2AA 3ANSA 3O4HA 2VT6A 3CXUA 5FRDA 1U8EA 5K3CA 4EY8A 2AJLI 2BUCA 5A2GA 1UOQA 5FPQA 4CCYA 5T4HA 5D3KA 3F97A 4JUIA 3IUNA 1BCRA 5FP0A 1GKKA 4UBKA 2AXEA 1J07A 2Z3WA 3C6XA 3L1IA 2VAXA 3VJLA 3C45A 4U2CA 4CI9A 2WFMA 2W22A 5SYMA 4KE8A 3G0CA 5AKYA 3ZLVA 4DMHA 1E3QA 1CPYA 4IQ4A 4UBOA 3ED1A 3W9BA 4G4GA 3WL7A 4OB8A 3IIIA 3H2HA 2QUAA 2D5LA 1WB5A 3ZLTA 4UHCA 4X00A 4CIBA 1LZLA 4ROTA 4YX9A 3WKDA 5AI5A 2I03A 3YASA 4ZRDA 1EK1A 5JAOA 4A5SA 1N5RA 2QVBA 3WLAA 5I7UA 5FUMA 5ALFA 2CB9A 3RM3A 4F60A 4OYLA 5EHNA 5HCUA 2AJDA 4GWLA 2XUFA 4Y2JA 4BB0A 4DSZA 1P0PA 3AINA 1XRPA 5C8VA 1LNSA 5E4TA 2I3ZA 1IZ8A 4HXGA 3LCRA 5ALJA 1ZD5A 2V96A 1R9NA 2XE4A 5KWJA 1MN6A 4WY5A 2NW6A 4NS4A 3X3HA 1XFDA 2Q0XA 2HL6A 2VA9A 3QPDA 1EDDA 3GELA 5ESRA 1DT5A 5CH5A 1ODCA 2QOEA 2PVSA 5AKIA 5JASA 2AJ8A 1UK6A 3W9UA 1MNAA 4OSEA 5HKBA 1TIBA 3ESAA 4ZV9A 4QDTA 1LBSA 3IURA 4TGLA 1UOPA 4BVJA 4BC0A 2XUQA 5T4FA 1HDEA 3V48A 3JYHA 4P92A 2BCEA 1ACJA 1XLUA 4AQDA 4H7JA 1CUXA 1GKLA 2RI6A 2XI4A 4W1QA 2Z5GA 3SC2A 3QPCA 2XT0A 1SOMA 1B6GA 1HLGA 2VTVA 2ES4A 3Q8WA 5HKAA 3AJAA 4UFNA 1MX1A 3WWOA 5LLSA 4KEAA 2XUJA 2ACEA 2XMRA 4P9NA 5ALXA 3M83A 4N5IX 2QM0A 2JGMA 2XMGA 3C8DA 3STVA 3UUEA 4QZVA 2WHQA 5BV7A 1BROA 1WHTA 3M82A 5LZ5A 4X90A 1VOTA 2FX5A 2GZRA 5IH7A 2XQIA 1ZI8A 5ALEA 1EVEA 4Y2TA 1MNQA 5EHZA 1XZMA 3VVMA 1K6EA 1GQSA 1DQZA 1VZ2A 1WB4A 2WIKA 4QDOA 1A7UA 3DCNA 1XZHA 1VJ5A 3CCCA 2UZ0A 1ZGCA 3V1KA 5JAUA 1QIGA 3FAKA 2K2QB 1ORVA 1T4MA 2WHRA 1QFMA 2DHCA 2BAGA 4BTVA 3A2NA 1XZDA 4TPKA 2XQFA 4MEAA 4CCWA 5ALLA 1JJIA 3IUQA 4M0MA 1CUGA 1LPMA 2WG2A 3I6ZA 5AP9A 4DSAA 3ILSA 3ZI7A 4FOLA 4EZIA 5EIEA 4W1SA 2GYUA 1MX5A 2HM7A 4G1FA 3FCXA 5ISMA 1FJ2A 4GEGA 4RE6A 1E89A 4XVCA 3TEJA 5AIBA 1HKHA 2JIDA 1H2ZA 4GXNA 4L72A 4OPMA 5LZ7A 3OC0A 1H2WA 4B85A 5AKHA 4GLBA 5K3EA 5SYNA 1VXRA 2WTMA 4H35A 4OYYA 3STTA 4BDSA 3D0KA 3PI6A 3QVMA 1TK3A 2FUKA 4TVKA 1UWCA 3IBTA 2XUHA 1L7QA 1QTRA 4GW3A 2R11A 5I9IA 1YA8A 4Y7DA 4ZI5A 3RARA 1BRTA 4G8CA 5CH8A 3D2AA 3I1YA 4EY7A 1UT6A 3V9AA 1BEZA 3IULA 5AI6A 1A8SA 5K5EA 1BS9A 1QIDA 1YSCA 1HQDA 5A7GA 2BGNA 1JKMA 3BWXA 2HHAA 2QJRA 3IB3A 4U2DA 1OXMA 3DKKA 3S2ZA 4X6UA 1N8SA 3FVRA 2JGLA 4Q3OA 3STYA 3O4GA 2WJ6A 4BATA 3FSGD 3SWWA 4A16A 1C7JA 1YA4A 1P0IA 5LZ9A 2VJCA 3N0TA 3HLKA 4B7ZA 3A2LA 5AKGA 1W52X 4MQMA 3HABA 4EY5A 4HZGA 4G9GA 3AIKA 4I3FA 4AXBA 3MGAA 3KXPA 2XUGA 2EDAA 1CR6A 3G0DA 3PE6A 5AKEA 5AOCA 3WK6A 1CIJA 1QLWA 4BZZA 3HSSA 1QIIA 2WG0A 1GGVA 3DYIA 2X76A 5FLKA 3EQ9A 3MUNA 3V1MA 5H3HA 3MUOA 3VVLA 1U65A 2HA0A 1HBJA 3WIOA 5LKRA 4FLFA 3F8SA 4KJXA 2WHPA 1LPSA 3ICVA 1MU0A 1DQYA 4DLNA 4WCVA 2PL5A 3W04A 1ODSA 3WK5A 2ZSIA 4EHBA 5DYYA 3WWDA 2PSHA 2FJPA 5LZ8A 4XIIA 1ZOIA 3DJYA 5AM0A 5HFNA 3W05A 4OU5A 1FFDA 4UBMA 2OCGA 5AIAA 1J2EA 4UHBA 3G02A 5CT4A 4B81A 1LPBB 2HA7A 3WK7A 2CZQA 1EVQA 4B83A 1XZLA 2QRUA 3L1HA 3O0DA 1XRQA 4PV7A 5JALA 4C01A 1ZJ5A 2GBIA 2H7YA 2JGFA 1NX9A 3LS2A 3WJ1A 5K3FA 2Y6UA 1W1IA 3WZLA 4LIPD 4B0PA 1MX9A 1O6GA 1AZWA 5A7FA 3BDVA 4HRXA 4V2IA 4Y2SA 1ZJ4A 3WMRA 2VATA 4I4CA 1BE0A 4D9JA 2VQ6A 1EK2A 1VLQA 4N5HX 2ZYHA 2HA5A 3HACA 2WM2A 2J4FA 2J4CA 5ALGA 4EUSA 3B12A 4PF1A 3AZPA 4BAUA 2O7VA 1E66A 4UBNA 2H7XA 1J06A 4JEIA 3AZQA 5AOBA 1CVLA 3KWJA 5KREA 3BF7A 1W6RA 3STXA 1GQRA 1NU6A 3K2IA 1GXSA 1GPLA 4F0JA 1H23A 4B80A 5IKXA 2WJ3A 1ZIYA 3T52A 1H2YA 1UOOA 2QR5A 4GECA 4MQLA 3D2CA 4K5QA 5A6VA 1WCYA 1KEZA 2P8SA 5HF9A 4Y2YA 5CW2A 3W06A 2X8BA 4X91A 2DHDA 5AM3A 3PFCA 1EX9A 5CT6A 1CUIA 4QDUA 2OQIA 3V1NA 1MO2A 2Y2UA 1E8MA 2JF0A 2DR0A 1TAHA 3H2IA 5JZ9A 4FTWA 4PW0A 1CFJA 2C5FA 4UPDA 4BE4A 2CBGA 3DL7A 5HF6A 4PQEA 2RHTA 3KWFA 1XZIA 4BDTA 5CTAA 4DGQA 1OCEA 2Z3ZA 1TCBA 3G7NA 2WQZA 2WSLA 3WKAA 5LKAA 3R40A 3O4JA 3E4DA 3QMWA 4PO3X 4MXDA 2OCLA 4MYDA 1QGED 4AN1A 3FYUA 5BWBA 2CMFA 2WG1A 3OG9A 4WFIA 1IMJA 1OILA 1FFEA 1JU4A 2C5GA 4ZWNA 5AM2A 4C4XA 2XB6A 3WK4A 2ZYSA 1BEEA 3M3DA 1JT2A 2RONA 1XZEA 4H7HA 4CG3A 3WI7A 2OLEA 1AUOA 1G42A 3G8YA 2BFNA 3FNBA 4FNGA 3G0IA 1AGYA 5AJHA 1CUJA 4AMYA 4OUKX 3ESCA 4GI1A 4MEBA 5I8PA 2IIVA 2H9YA 2VJAA 3PUIA 5DLPA 3WL6A 2ONCA 2BUAA 2WU4A 2RIPA 4J0HA 1MPXA 4Y2UA 5IVKA 1O6FA 1TQHA 2E3JA 1XZJA 2ZJ6A 4AZ0A 1UK7A 1VKHA 1IUOA 2HFKA 3C6YA 1W75A 5IVDA 4WFJA 4J3JA 2Y2VA 1CUCA 2QMQA 1ORWA 3FYUC 3BF8A 4QDXA 3OM8A 3PF8A 4BRSA 3GUUA 3F96A 3DKRA 2ORYA 4DNQA 4L0CA 5AI8A 5HQ3B 1TCAA 4G9EA 2CUTA 2OAEA 1CUZA 2HDWA 4QNNA 5DTJA 1GPKA 1WPRA 4JH0A 5FPPA 5ALMA 2ZYIA 2QZPA 1HL7A 3I2HA 3KSRA 4RE5A 1Q84A 1YS2X 3IA2A 4Y2QA 1EHYA 2AJBA 5E4YA 5ALDA 1VE7A 3G0GA 4JNCA 4AB1A 5LP1A 1PV1A 4UHHA 4ZREA 2PUHA 1YAHA 2G5TA 4QE3A 1Q0RA 2FJ0A 2VJDA 2XUAA 4EY6A 5AK6A 5JD6A 3R41A 3C6BA 2QKYA 2OQVA 5ALPA 3G9ZA 1VE6A 4LKOA 4DMKA 1R88A 1ETHA 4YASA 1P0QA 4HXEB 5EI5A 2HA3A 4DNFA 4G5XA 3O9MA 4DM7A 4ZGBA 4GDMA 2WLSA 1ZI6A 1XRMA 4QDZA 3DNMA 5CXUA 2DFPA 1CUYA 4E15A 1E5TA 1YS1X 1IUNA 3WIBA 4EY4A 1DTEA 3I1IA 4DTCA 4C4YA 3ANTA 1QO7A 4J0DA 3EQ8A 3EIOA 2QJWA 5JATA 3RLIA 4U2BA 4UBJA 2BUBA 1VXOA 1XZKA 1CUSA 1R1DA 2OCIA 4BCDA 2XQJA 5DNVA 1A8QA 1QE3A 3WJ2A 1SFRA 4A23A 4P08A 3KD2A 4KAFA 4O08A 2V97A 1XZFA 2B9VA 4B9EA 4KRYA 5AKXA 4BAGA 1LZKA 3C70A 3LP5A 4FLMA 5T4EA 3DOIA 2GBGA 2HRRA 5DNWA 3H1AA 1XQWA 5K3AA 4F21A 1MAHA 3BE8A 1R9MA 1DWOA 1QIHA 4X92A 2WFZA 2JEZA 4BE9A 2ZSHA 5EGNA 1CRLA 1FFAA 3H1BA 4Y2PA 3VJKA 5ALUA 5CH3A 1WHSA 3BDIA 3OURA 4IHAA 3A70A 4KYVA 2QUBA 1XROA 2XUKA 2I78A 1ISPA 4B9AA 3WYDA 1U2EA 1SCQA 3VXKA 1Q0ZA 5AM1A 1AURA 4INZA 1ACLA 5CT9A 5C8XA 4FFWA 4BAZA 1XQXA 4PSDA 1CUAA 1DU4A 4NVRA 3LLCA 2PUJA 1G5FA 4CG1A 3HI4A 2WIDA 4Q1VA 3JWEA 5HF5A 3KOOA 1B41A 4HRYA 4H7FA 4Z49A 3DDUA 2OG1A 1RYYA 3OTQA 4FBMA 1XZBA 4NZZA 1QONA 5AKKA 1JJBA 5AKLA 2OGZA 4H7KA 1UKCA 2V98A 4Y2XA 4H0CA 1R3DA 2PSEA 3U1TA 3WWCA 3ICWA 5CT8A 2ACKA 3STWA 1WOMA 4FWBA 5AH0A 4EA6A 5HZGA 4DMCA 1XRNA 2YH2A 4H18A 3CN7A 1CUUA 2HA2A 2CJPA 3O9VA 3R3UA 1AKNA 1DWPA 3W2TA 2O2GA 4X94A 5D3ZA 1JI3A 1X2BA 1GT6A 4WFKA 3C5VA 4F5ZA 2HA6A 2R8BA 1CLEA 1SC9A 2WIFA 5EFZA 4M0EA 5CBKA 3AUKA 1IZ7A 1X70A 2PSDA 3P2MA 1K8QA 3BL8A 1DINA 1LPPA 1G4HA 1EXWA 1XLVA 5IVIA 1X2EA 4BYMA 3QZUA 5J3JA 2WIJA 2WIGA 3PDCA 5EIHA 1IVYA 3WL5A 2YASA 1ZD4A 3H0CA 4QLAA 3D59A 1QO9A 3HRHA 2Y6VA 1J1IA 2XLBA 1UKAA 3AILA 2XMQA 3PUHA 1CUEA 4QWMA 2YXPX 1THGA 5ALKA 1XRRA 2HU8A 5FXMA 5KBYA 3QMVA 3ZPXA 1BU8A 3R3ZA 2XUDA 4X85A 1MT3A 1YB7A 5HF8A 2JGJA 2H7CA 4WDRA 4Y9SA 2DSNA 5JD4A 4J03A 5AI9A 3BJMA 4H7EA 4U2FA 3ESDA 1EINA 5A71A 4Y2RA 1QIKA 5D6OA 1DX6A 3C43A 2WUFA 4B82A 1D07A 2XQKA 3LIIA 1FFBA 1C4XA 1F8UA 4C4ZA 2VEOA 4X7BA 1RWQA 1VA5A 1CUFA 2WHPB 4B0OA 4ETWA 1LPOA 1LBTA 1CUDA 1UZAA 3VKFA 3WKBA 4FFVA 4UBIA 1EDBA 5DJ5A 2VF2A 2PSFA 3HZOA 5F4ZA 1XZCA 4BVLA 4UUQA 6YASA 4UHDA 2XQGA 5AM5A 3TGLA 3EBLA 5K3DA 4MJ3A 4LXGA 2CKMA 3SK0A 3H2JA 3Q0TA 1ZICA 2XDWA 3CCBA 5ALZA 3H04A 5A7HA 3STUA 3BJRA 1RP1A 2DHEA 4OB6A 5K3FB 5AHXA 2WFLB 4LXIA 3I2GA 1TCCA 5AK3A 5AK4A 5LZ2A 1P0MA 2HFJA 4I19A 2HRQA 4C88A 2PKYX 2C0PA 4X97A 5FOQA 3PICA 5HK8A 3GROA 4H7IA 3IDAA 2I3DA 5JZSA 1CEXA 3LIPA 5CT5A 1E8DA 4W63A 4EB0A 4L3WA 1SCIA 2J3QA 3HXKA 3PF9A 5T4BA 2HIHA 3GA7A 1CUBA 2VSQA 4XWGA 3L1JA 4FNMA 3S8YA 1R4ZA 2ROQA 1FFCA 3I6MA 4N8EA 2DQYA 4UFPA 4BC1A 5D7BA 4E11A 2RAUA 3NOXA 5ALQA
chains in the Genus database with same CATH superfamily
3QU4A 2XODA 4RLHA 3P4UA 2OBLA 2XUIA 4F9GA 4FMPA 4RSRA 4HO1X 1YC5A 2VDOB 5JQGA 1BX1A 4RSGA 1OGJA 2CVZA 3IUMA 3J7TA 3ZZTA 4UVEA 2I34A 2AK3A 1TAQA 1USWA 2XMSA 3JQ9C 4REQB 3GDFA 3U7QA 1M8GA 2XLCA 4HWRA 5EKUA 2VDQB 4FT4A 3SAJA 2QSZA 2YUIA 3PBKA 3G9TA 1NMQA 3BRSA 1GU1A 4HXFB 2PD4A 4FZ3A 3OHPA 4XASA 1F4LA 3MM4A 3RV4A 4G0WA 4LHVA 3DL0A 4UBLA 2ZYGA 3FSGA 4ES6A 2ZQZA 5EIWA 4PRZA 3W90A 2AQ8A 1T13A 4BZWA 3GFSA 1RYBA 1QS0A 3BWMA 1A5TA 3ONEA 2IVFA 4CKBA 4EG0A 5DWVA 3I28A 3QKIA 3TX6A 1NZFA 5HCIA 4AX4A 4GPZA 3DZJA 3H18A 3AV0B 1SC1A 4R6XA 4K7JA 3E3AA 4G0PA 4CW7A 2R4UA 4HBGA 3CNOA 5K20A 2OCXA 3LWNA 3A6HA 4N5MA 5AK4A 5JYBA 3RVBA 4MIKA 3KKPA 4XUCA 3G8DA 1YS6A 5CB6A 1GTRA 3NHJA 1Z6XA 2PQ2A 2YBDA 1QPBA 1V11B 4AF7A 1HYGA 4C6HA 3SF0A 1XNJA 4RCZA 4ENPA 1I33A 3RW9A 1T24A 3E0QA 2GCPA 4L8VA 3AVOA 9GPBA 5C4GB 1QV9A 2FPLA 3TNYA 4M0FA 1U2QA 4IH9A 3RC9A 3RTAA 2Z2XA 3FRHA 4FK8A 3SLRA 3NMUF 1RRFA 3BMCA 1WXGA 4WBSA 3SI7A 2Z2JA 4ZJZA 1Y9ZA 1D8AA 3HM9A 1U6IA 2OL4A 4UARA 1XU7A 2GN6A 1K06A 3GN2A 4R16A 3FFBA 2GUWA 4NZ9A 3T61A 3I42A 2BEJA 2VBCA 3OSZA 4QNMA 5MFZA 3FVQA 1NR7A 1SUEA 3NAQA 4EA9A 5AVSA 4A0HA 1W1WA 3T4UA 2Q2VA 3FR7A 3FLMA 5ALVA 1LK0A 1SXJB 5ALRA 1S02A 3NH6A 1T9HA 4FFNA 5B6IA 2VZEA 4E09A 4C6TA 1ZNYA 4TLAA 1VPEA 1XQ6A 3WB9A 4JB0A 1I7QB 2P2LA 1L4HA 4HDKB 3WBBA 4CHTA 5K6RA 4PPYA 1HDYA 1FNDA 5E6RB 2KJQA 2ZSUA 3AGQA 5CYOA 4EBBA 5AHKA 1XK7A 4U2GA 1A9TA 5EZ6B 3H8VA 1Z7EA 4B7AA 4HNTA 4BTEA 4PSCA 1FLNA 3K8ZA 4BO2A 1I01A 2EZ9A 3EWAA 4N8SA 2P8JA 3N0XA 5J5CA 3Q3VA 1KXJA 5BR4A 1LQTA 4Z5XA 2VXYA 4WLOA 3F49S 4WACA 2HRDA 1OTHA 1UC5B 2AOXA 2C9OA 3EEFA 4WCFC 2PX3A 2VRCD 1QOZA 2JCVA 2IK8A 3DHEA 1C7QA 3E1GA 3FLEA 1N2CB 1OC2A 3C74A 3HA2A 5CXXA 2V59A 3OOSA 5IN4A 3T5MA 4PAWA 1A88A 1YAJA 1H6AA 2QLNA 3FMPB 3GMIA 2WKWA 1ZHFA 2X19A 4Q1DA 5DN6D 2ZIVB 2IKQA 1E20A 2ZJFA 2ZYVX 2Q2NA 3R7NA 3TL2A 1B8VA 4Q3DA 2P5UA 5M04A 2GM4A 4M21A 2P40A 2VTBB 2PMKA 4E4YA 5ALWA 3KZKA 4DV7B 4DCMA 1COZA 4U7TB 2FCAA 3LCJA 4X63A 4URVR 5IKPA 4UHFA 2F9MA 1QHNA 1Z22A 2QS9A 4RWZA 3K53A 1NJ2A 4OAPA 4BFLA 5L3VA 1XTZA 3E61A 5IRCD 2DUNA 2JIQA 4UNNA 4YBRA 4IIJA 4R8VA 4Z4GA 1F48A 3KLBA 1GYQA 4HKTA 3AHHA 3EZ2A 5F7ZA 3RLFA 5CA1F 3WIUA 2DH6A 1L5MA 2QVCA 2YCLA 3TQRA 4F9FA 2GZSA 1J2TA 1S3GA 7GPBA 5JU6A 4MP3A 2B61A 3L0DA 3UWSA 3PP8A 1T0HB 4G56A 4LQ4A 5CURA 5BOVA 2QVXX 2WMDA 4F2PA 5AW2A 1W36D 2YHBA 3U4GA 1DOAA 1XR3A 2GJ9A 2ZIXB 3HYSA 3TLGB 2E49A 3W8FA 2JIOA 1MRNA 2B6HA 3JQDA 2ATIA 5LQDA 2ZCVA 4DIBA 1B00A 1UXKA 3FOCA 5DTEA 1ID1A 1KU0A 1UC4B 1CUHA 3RIYA 2VYQA 3FNIA 5KVSA 4LYEA 5DLQC 2V45A 4OHBA 3H9EO 1MJ5A 1XTQA 4IVRA 5C7LO 1U94A 1DUSA 3R7BA 3U44A 1H1LB 3LPCA 5A3QA 3LT1A 3S2UA 2AOTA 1HE8B 3IFSA 3P9RA 3THSA 4V0SA 4DRXA 5BQ3A 5FO1A 2R5WA 2PUVA 3CG0A 4FW8A 1XP8A 2J8ZA 3CTMA 3K1AB 4R0NA 5K3SA 3E0XA 4D97A 2HF2A 1Z4QA 2EDCA 2QR3A 4N76A 2VDNB 5DISB 1J97A 1E5VA 1ZG3A 3FUTA 2WAOA 5JARA 1GZ5A 2C5EA 2I4TA 2CXOA 1YS7A 4RNCA 1XNHA 2R751 1JJAA 1X8JA 3DEIA 3FZEA 4E03A 4N9WA 4RHUA 4EITA 1E61A 3S44A 4C7OB 3ZUPA 4PN7A 3K0KA 3TAHA 4OVKA 3IAS1 4G0QA 2HMUA 3QPBA 4E5MA 2ID8A 3A10A 3NLLA 2ZRBA 3EXIA 4G84A 4C7KA 2I4MA 2ZR0A 3SXUA 2CL0X 3A1DA 5K0EA 4EVIA 2BKEA 3JQFA 3OO0A 5MHTA 4CM9D 4DCPA 1M3SA 3NBAA 3NU1A 1E2UA 3ZZ0A 3KPYA 3QFFA 4D1YA 2ZPTX 2XXAA 2CLHB 5DWDA 1G8PA 4IYJA 2R8XA 2YMPA 1A98A 3PXXA 1F9EA 1O08A 1PD0A 2ZWIA 3ETGA 3HVHA 3IPXA 1V71A 4TV8A 4BCBA 2FR1A 3EMDA 4HDMA 4BP8A 5A3JA 721PA 1PV4A 1OH7A 4LXTA 1DC6A 1X19A 3CINA 3LC2O 5EUMA 3P0FA 2P6UA 2D59A 3WLMA 1UUFA 1LFAA 4YV0A 3KLMX 2JI8A 1SD5A 1CJUC 1XXLA 3DWGA 3DMHA 4NC9A 1NJ8A 2JCXA 1S7GA 4LNUA 5FT9A 3HJTA 1RTKA 2ZWAA 1VE9A 1Y4ZA 3MFYA 3U6BA 4HVTA 2PBLA 1IM5A 3LY5A 2WINI 1GSAA 2LCIA 1KOJA 1Y1TA 2R60A 1ZN9A 3E5HA 3TF5A 1LX6A 4ZV7A 3DS8A 2R9VA 1RWNA 5ILGA 4TRRA 2LW7A 2VJBA 1BOOA 3A06A 4DWJA 5HQTA 3VZDA 1FK8A 2V4MA 4RVCA 4F12A 2UVPB 4NYMR 4QRHA 1ZJZA 3PHCA 3NKVA 2JDID 2ZAGA 3ZDAA 3NI2A 2DQZA 2ET6A 4I55B 4YQEA 1BMFD 1R00A 5ALHA 3VU3A 4HQRA 1HTWA 5HKOA 3GLFB 1CY1A 1SQGA 4PLTA 5DYNA 3D8SA 5BPFA 2B7LA 2P30A 2ZR9A 4KFUA 2H65A 5FNVB 4F72A 1X9HA 1IHXA 1J6UA 1UJBA 2GBFA 3A1UA 1KU6A 1W76A 2R62A 3I01M 4FWIB 3T9FA 1XZ8A 3KX2A 3KYDA 3NHYA 4MQEA 2I1LA 3VC3A 5C7YA 1XJ5A 2B4KA 5JD5A 1P0CA 2BKXA 4KRFA 1GQYA 4FDLA 3WZMA 2B20A 1MH1A 3UG6A 3FTQA 1X1SA 1G3MA 1ZH6A 3NORA 2Y4OA 1KEKA 3MLEA 3HBLA 4EGAA 3QENA 4G8BA 1EK6A 2QP9X 3AETB 4ALMA 4BX3A 5B4TA 1H2XA 4POOA 3NC0C 2PAAA 2JHFA 1NBWB 1JX6A 3I3OA 3PRKE 4CLRB 4D42A 3T3EA 2HA4A 1QGUB 4LF6B 3VNRA 1FMTA 2ODPA 3JQGB 3Q9NA 3L43A 1A04A 5G1PA 1WOYA 2OXEA 4QDKA 1CIPA 1YMQA 2FW6A 2V6FA 3E53A 4I4IA 3K0CA 5ALSA 1W1UA 5ALTA 2UZ1B 4HTFA 4AJ2A 4GM0A 3QPAA 4LOKA 3PTZA 1BWSA 2FZCA 3PGA1 3AX6A 4M1KA 1LPNA 4OP2A 4S1OA 4IMIB 1EDEA 3K9FC 2O4UX 1AX9A 1XLTA 3TPZA 1LI7A 3EWIA 3DH0A 1C1YA 1E7QA 1SHUX 1VIAA 1O95D 3U3RA 1DBWA 2P1DA 2I76A 2XMDA 2ZWVA 4Q48A 1N92A 1USKA 4JS0A 4BGDA 3IQEA 4HTAA 3DBHB 1DE0A 1FF9A 1SXJD 1T3TA 4GICA 5CHEA 3CJRA 1ISMA 1SQ0A 4KYIB 1FQWA 5TEWA 4J9VA 4F1KA 2AVDA 3E8SA 1M8KA 3I6YA 3JALB 3MJRA 3DDHA 1E3DA 4ZO9A 4C4RA 5JAQA 5LA6F 5BXQC 4TL9A 1U9YA 1ZHHA 4HZUB 2GEJA 3EXHC 3RB8A 5AQEA 4AMZA 1RJEA 5KNBH 5EUQB 3VX3A 4K1XA 4KODA 4LJAA 3EC1A 3GJ0A 1MEEA 2WK1A 4H0FA 4O4LA 1U2GC 4RK0A 4Z9AA 2GDZA 1XF9A 2P4HX 1NBMA 4HEHA 5IDQA 2VJPA 4LVNA 3F5FA 5JFOA 1PNVA 4FX2A 2P62A 4B3CA 2M6RA 4EA7A 2ZJAA 5H4GA 2DBQA 5COBA 1UZNA 3PQEA 2JZOA 4AJPA 2E48A 2QUJA 1Y6GA 1YL6A 1ZISA 2OWDA 3AVXA 2OGSA 4EELA 4XWWA 3BIXA 3C5WP 1OXVA 2DPLA 3EQ7A 4NCAA 2JH8A 4RZIA 3CX4A 3RYFA 5JYCA 4EKIA 4DVJA 2RH4A 3N2ZB 4A0GA 2GD6A 5ENZA 1Y3HA 3TB6A 3EGEA 4OQPA 5DSZA 1E9DA 5JH7A 2ZUVA 4JJIA 5K0SA 3W6OA 3X1JA 3GLFE 4P93A 4WERA 3FZNA 4FN5A 3LQ4A 4CTNA 1K7YA 3IO3A 4UU0A 4NOMA 5FJJA 2QVLA 1OW3B 3VU8A 3A4IA 3DZBA 4RGBA 1E4EB 4LNAA 1FYXA 4X84A 4U1RA 4YJGA 5IK2D 3I2KA 2FMFA 5IAEA 3E27A 4H3SA 5AXBA 1ULUA 4MW4A 4J7XA 4ZEOA 3RUEA 4YY3B 4XJTA 1L7RA 4RLFA 2QWXA 3NYRA 4FEEA 5EKXA 1FJXA 2DFLA 5HK9A 1ZGBA 2X1VA 3O26A 3QTTA 1NBHA 2RGNC 5FBKA 5F1PA 1GA6A 2RIRA 2AMYA 1QHHB 2VNKA 3K3PA 4GOXA 2VQ3A 2PSJA 1HEIA 3HNOA 3PKJA 4P4GA 5CMLA 5TF4A 4J7CA 1VP3A 1AU9A 3ZLUA 1EUYA 1KRWA 3ESBA 3UJCA 3HB9A 4K9SA 1YR8A 3BK1A 3DWFA 5JCOC 3QI7A 2CYCA 5C46F 3WWPA 1K5PA 3B60A 2Q1YA 4KUGA 3EDYA 4FD2A 1S2DA 5FOSA 4C3OB 2P4QA 2RAFA 4KR3A 2IHUA 5JANA 3JQCA 2BGMA 3H2SA 1GG9A 3KUXA 4C7MA 1XKXA 2COUA 1GCOA 3OIDA 1RQ7A 4FZRA 3K9QO 1P4HA 3KDPA 4AS1A 5DBHX 4UUNA 2QXUA 5A05A 2VYND 1GPMA 1SVMA 1TIPA 4LBZA 5BWLA 2W2OA 2C78A 3NHWA 4K9OA 2EKZA 5KINB 2G5CA 3LWDA 2IZ6A 3KZMA 4JYPA 5B2ZA 5SZIA 2AR9A 1YJXA 3ULKA 4HS9A 4KWHA 5TE9A 3WA6A 2G5PA 5B7PA 3DEAA 4C87A 4HAWA 3VO1A 2JGKA 2AZ4A 4M9QA 4YMHA 3GFTA 3NVKI 4XYMA 1XZQA 3SKYA 3CBQA 3NM5A 1NU8A 4GLLA 5CA0F 3CRRA 1NVTA 1QJ4A 4FDMA 4HWPA 4GKVA 5KKCA 4L74A 4XJSA 5BORA 3CR7A 5AKJA 5JRZA 1P17A 4GRDA 4A2QA 4GSLA 5BWNA 1IWOA 1A3CA 3GOQA 3UGQA 2B37A 5IAOA 5KJ6A 4E4TA 2O5CA 3UC5A 4MRPA 3PVCA 1FS4A 1PSZA 5IBRA 3RS8A 1QRTA 4M2LA 1PS0A 4LCBA 3G2LA 2Q49A 3BTSA 3HXMA 4YPOA 1AV6A 4O8ZA 4E07A 5IASA 2QM8A 4IDNA 1HK7A 4BX0A 2CLFB 5LQSA 3K9BA 2V3CC 1WSBA 4H4CA 2JJMA 4J6EA 5DBIA 4EHFA 1OIWA 5KEIA 1P7PA 1WV1A 2IW1A 3E5NA 1TPYA 3M81A 3UXYA 3ZU3A 2C3PA 2VDRB 1HDRA 1JLSA 4JVOA 2PJRA 3BDAA 4Y2VA 3WYNA 4FHGA 4TTQA 4DLYA 1IEXA 5EZYF 4Q34A 3GBSA 3WL4A 1GQ2A 1SUCA 4R3WA 3FJOA 1K6XA 4RS3A 2HR1A 4OJQA 1I8TA 3T5DA 5FKJA 3MVEA 1Y4SA 3FYTA 1RJ9A 4Q4AB 4QBHA 4QUHA 5ULLA 3C97A 2WNSA 1JJFA 1VCOA 3F9IA 3RYHB 1H4QA 3A3NA 4ZT2A 4NU6A 1C9DB 2CB0A 3WV4A 1IOVA 3HFJA 2IY9A 4LHZA 1UBHS 3WK9A 4D79A 3UY4A 4C4OA 4E5SA 5C9ZA 1AUXA 3N58A 1EFHA 3I0MA 3KOYA 1IHUA 2NVWA 1BDJA 1EX7A 4JQSA 2XCTB 3MWLA 4W5JA 3MAJA 4NONA 4PQYA 5KU1A 5IYZF 1Z7YA 3RFTA 1LDMA 2YJGA 1M7HA 3WC4A 3OI7A 4WZBA 1OKKD 3UAWA 2Q27A 3JVEA 1P1JA 3CPJB 4WK2B 3N07A 5EJGA 3RRZA 4GKBA 3VMMA 2R8RA 3ZHYA 2ALJA 2D1TA 4O4JB 3IQZA 3QYJA 1YL5A 4QRIA 1J2UA 1UAGA 3KB2A 4KDRA 4RO0A 3KSMA 2DXIA 3I9LA 3ET4A 1PWYE 4RLSA 3O4RA 4M55A 4TROA 4YP9A 2QTVB 1A9SA 2FUG6 3MSCA 5AKZA 4RTNA 1Q0TA 4GS5A 5E4FA 2ORED 1NLMA 1KZHA 4AMGA 5C8ZA 2IS4A 3LBFA 4U0JA 3DYVA 1E9SA 2I1VB 4A1OA 3HKDB 1M2OA 2XT6A 3ZNOA 3LYLA 2C9BA 4A1FA 4YLYA 3I76A 1JDZA 1KZ4A 2IXEA 4TYMA 3IA7A 5AHRA 5J2TF 1FYFA 1FW8A 1M9NA 3DA8A 2QRHA 2QDKA 4Z1OA 1G6OA 2BFPA 3K09A 4MW9A 1GSOA 2A1UA 4QGGA 2P3SA 5TQ0A 4XGQA 1N2EA 2CE7A 1W94A 3WY9A 5J5VA 2VCHA 3MMSA 4PYNA 3KLOA 2HIAA 3LBIA 5KKAA 2I54A 1TQDA 2C83A 5IKMA 1LEHA 2ODBA 3D4OA 1YHNA 1E79D 4UFOA 5GV7A 1QP4A 4TXJA 4RKQA 1JW9B 4RVGA 4WBNB 1QMGA 3UC9A 3K9GA 2IE8A 4JQCA 4FZJA 1ORDA 1G6KA 2CW5A 2P9EA 3T0GA 4B4KA 3K0AA 1ST3A 1Y48E 3L8GA 2C5HA 4KO3S 1ZESA 2CXHA 4O4IA 2SBTA 1XJ0A 3IP3A 4CZ2A 1AB6A 3IQIX 2HCFA 4M7OA 1N5DA 3E7XA 1E2HA 1N9ZA 2J5QA 4GBGA 2WD7B 4RPCA 2EGHA 3AY6A 1M1XB 1QIMA 4NMLA 5E38A 4RW0A 2JEYA 4HAIA 1XNGA 3G2PA 1B7GO 1XCMA 3WLHA 1USIA 3OBBA 1LK5A 1U5BB 4Q47A 1JHZA 1R6BX 1V5EA 3GPIA 4H77A 1B14A 4OF4A 4LTDA 3RTEA 1DKRA 3ZK9A 4MI9A 3PXEA 3UBMA 3ABIA 2WHEA 3IPAA 4NDAA 1Q77A 2YX1A 1L4FA 2D2FA 2OCKA 4H3KB 2J31A 2IITA 1UMKA 3VKWA 3FTFA 3NBFA 3H9BA 1RE1A 1SVIA 1Q20A 1B23P 4DNPA 4Q6BA 4HWSA 4ND1A 4QFDA 3O4VA 2E4UA 4QUAA 2W6PA 4XE5A 4PN3A 4OGGA 3EVGA 3IUJA 2O20A 4B1FA 5G0UA 1UADA 1OVMA 2CNKA 2GEKA 2BZ0A 4H6WA 1H5UA 3C6QA 5AT1A 4NCJA 1RPTA 3ZD8A 4CKCA 5KNDA 2FFHA 4BLUA 1K3UB 4GOND 2DBVO 4RVFA 4HZIA 4UHJA 1Z25A 2C0QA 2VXOA 4FOSA 1SVOA 1OXSC 3GJ5A 2G8NA 4IH4A 5HDBB 4QBTA 3ANSA 3DMTA 1O9HA 2J3MA 2VP3A 3DMDA 3BMOA 2BHTA 3FDFA 4IWNA 2ZQYA 3JRWA 4Y6PA 3E9MA 5F3RA 1MO5A 4F71A 4UCQA 3F47A 1ZPDA 1QGDA 1NX6A 2AJLI 3G7UA 4LS3A 3L04A 5DGHA 3EY4A 3REGA 2QRNA 4X1IB 1WXWA 3U4CA 3GRFA 1NRJB 1NW3A 2K6GA 3D31A 1E58A 3LDGA 1RYFA 3FR8A 1XTPA 4H6PA 2N1BA 5FPQA 4E70A 4HV4A 3Q2KA 4RX1A 1PWZA 5BSMA 2C0CA 4NQZA 4ARUA 3QVJA 5AJWA 4LF7B 1LDEA 3RHZA 3VZBA 1LRKA 1OROA 1VL6A 3F97A 3PNVA 4DV4B 1PWEA 2BTEA 2VQFB 3C24A 1JXAA 1J0DA 4KBYA 2GA9A 2BEUA 2X8WA 4FGZA 4P53A 4HDRA 1DLJA 3I34X 2WU0A 4ZKDA 4PBTA 1UMCB 2ZJ0A 2NTNA 4LF8B 4NDZA 4CT4B 2I7DA 2JFGA 1WLYA 4CUKA 3I5XA 3FE2A 1J07A 4L5BA 3P5BA 4L85A 3WNVA 4GOKA 5FULA 5DYGA 1J22A 4UNRA 2VOJA 3DCJA 3QE3A 2E4YA 3NKFA 2O8EB 4LOJA 1A2BA 2YV2A 3DBVO 1L4MA 2G6TA 4X8HA 2HB6A 4LWZA 3T9DA 4OKSA 4FZVA 4U02A 4CCAA 1U2DA 4R9RA 4F6RB 2O8FA 3SCZA 1CHNA 3IV7A 4F8EA 2GK3A 4DY6A 2GZHA 5KX5B 3V4VB 2H18A 2WV7A 4QUGA 3MD9A 1KR2A 3OT4A 4BEWA 2VAXA 1HGXA 2XEXA 3L4BA 5EJ5A 1QHXA 1CF2O 2QW8A 4TMWA 3KJXA 5E0KB 5H70A 1WX1A 3B9RA 4C08A 5TV2A 2VDJA 4KE8A 1RRMA 1C3EA 2FP3A 1EWKA 1W46A 4EJSB 1Z4NA 4KWCA 4ZO8A 4EF6A 2C7OA 3AJRA 4G4GA 3RFCA 3UFXB 1T3ZA 5I7SA 5AJUA 3U19A 1MJHA 2AWNA 2QU8A 4OB8A 2P79A 1M2JA 5CLFA 1A69A 3IIIA 4R7ZA 3ZQ4A 4H15A 4NE2A 3TSWA 2C54A 4KCGA 1YJAA 4OQXA 4PC6A 3OH8A 1VFPA 3I9FA 4OX9B 1HRKA 1W5EA 2C8KA 2P5TB 3FUCA 3WNBA 3WJAA 5KTRA 4BFWA 1N6PA 2MJLA 4M9XA 2VTDA 1ZK4A 1SHJA 2B6NA 3NRJA 4HNSA 4X00A 1E3WA 2O8BA 5CVCA 4ROTA 3D8TA 3VBEA 5AI5A 2I03A 3KQUA 1OV4A 1AS0A 1SULA 4JI2B 3QJYA 4OGLA 4R2HA 2EW1A 4HDCA 3KV1A 2KWIA 1IN7A 3TZ6A 2O3TA 2BH2A 2FZKA 3REFA 1N5RA 1YR6A 1H42A 1KOLA 2QVBA 3U16A 2HBYA 3L82B 4S1VA 1D7OA 2P68A 5HRAA 5KIAA 5FUMA 1XTUA 3OZAA 1RWVA 3HPQA 3INTA 2CB9A 2V7XA 2C9DA 3W1WA 3WLLA 1WD7A 4TSRA 2CYBA 3RM3A 1CJCA 2AZDA 4OYLA 1JHVA 2IFTA 2BFEB 2FN7A 3H1TA 3KVYA 4RYLA 5E2AA 3FWPA 4N48A 1ZS9A 1N3BA 2LTAA 3AINA 1RSZA 3HJBA 3DMPA 3LQQA 4PXSA 4WV3A 1LLCA 3TLBA 3U3ZA 3V3KA 4ENRA 4WMLA 8ABPA 1LNSA 4NP6A 1ZZGA 2VDUE 1GUAA 3K0BA 5EA2A 2AZMA 1OIVA 1I2DA 3LPDA 1SHTX 5K3OA 3UMSA 2W6IA 4B47A 1H6CA 4XI9A 4EI8A 1ADGA 1N77A 1A9QA 4GNKA 4GPEA 3BFPA 5IC6A 2XE4A 2HV8A 1MN6A 1TM4E 1Y82A 4LY3A 2PKRA 1RAHA 2F62A 5F5XA 1RLTA 4TSFA 2CNLA 2IPAB 1UJ6A 2EWWA 4US2R 1RI2A 4C6SA 2EIXA 2VA9A 3QPDA 5JXJA 1PZFA 4E6EA 2AUMA 3G5MA 4KR7A 4OXRA 3GELA 1TUBB 1WU8A 3FTDA 3RSQA 2I6GA 3CUEF 3BXEA 3JWGA 2IHYA 4GO1A 2DTEA 2W6ZA 4RF4A 1SG9A 4KQFA 1XDBA 5MN6A 5AKIA 4R2MA 5JASA 4ER5A 5U9CA 1F6DA 4D3DA 1O89A 4H6XA 5BV1A 1BFUA 1NI3A 1MNAA 1NP6A 4BUJA 3SICE 1R5BA 4AQYB 1U8UA 1M5UA 1I80A 3K6SB 2PUTA 4N0EA 4HJRA 4QM7A 3OTIA 4WKOA 3OZSA 4UE2A 2P9BA 1SBCA 2RGEA 3EHEA 1FDUA 4QDTA 2PMEA 2IIQA 4X5OA 5CDUA 4LECA 4CKBB 2EG9A 1TM7E 3UMBA 4ZGWA 2OC4A 1UOPA 4BVJA 4LYFA 2XUQA 3F3YA 2OUKA 4ZARA 4Q7LA 2J6IA 4R84A 3E03A 1SNYA 3GJ4A 2BCEA 3HMKA 3MILA 4L9SA 1ACJA 2JAOA 3ASVA 3PRJA 4BKPA 2V0GA 1XD8A 2LUOA 2JAUA 3IIKA 1G7CA 2RB4A 3A4LA 1HE2A 3ITKA 3QXXA 4BGIA 4BO7A 5IZCA 3UPUA 1Y5LA 1AK1A 2RI6A 1G8MA 2XI4A 3DFIA 3HQ4O 5LQCA 1KAQA 2PUAA 3SC2A 2E2WA 3F3KA 1CR4A 1ZA1A 1Z2DA 3ETCA 1CK4A 1ESDA 1EGMB 2PANA 2XT0A 3DUFB 2I4RA 4M9SA 4KLNA 2QZ4A 3Q3CA 5E7JA 1ABEA 1F4VA 4DSTA 1NW7A 2ES4A 4D4IA 1TECE 1X1AA 3JAMA 4MAFA 3Q8WA 3S5UA 3TD2A 4IZ6A 1YK0A 3SBEA 2SKEA 3LGSA 4ABYA 3WGMA 4BPRA 3CCFA 3RTBA 3AJAA 1QCZA 5AHWA 1MX1A 1OF1A 1RR6A 3I9V6 4ZT6A 4KBGA 2XTAA 3DO5A 4RF3A 4WXEA 5K0TA 3AQ4A 4O4HA 1XTBA 2XMRA 4C2TA 4BVHA 4MO2A 4BU0A 1LS6A 2EVWX 2IZZA 2J08A 2QD1A 4HH0A 3ZW7A 3SQXA 4B6OA 3IIJA 4Y18A 4Z3KA 1YZNA 4B8ZA 2QM0A 3LM8A 3OQPA 2X0FA 2GLUA 3WBFA 2DWQA 3Q6IA 1YFLA 3VV3A 1OD6A 2Y0BA 2ZROA 3DXFA 4QBGB 2XB9A 1MB4A 5IZ4A 2CV1A 4L0DA 4QZVA 2IH2A 1E2KA 2WHQA 3BXXA 4KX3A 1OA0A 1H8HD 1WHTA 4MQ5A 3M82A 4RKFA 3UWKA 4AMBA 2IU0A 2Q3MA 2IYVA 4Q0MA 2WWIA 2FX5A 3GG9A 5HDQA 3WO1A 2PDAA 4CF7A 4JGIA 3HP7A 2V6MA 2VHCA 4H4DA 4YMVA 5ALEA 3ZVRA 1LF5A 2F7SA 2JLWA 3SQOA 1N2SA 3WHLA 1X87A 1FMFA 1QANA 1YVDA 3REQA 1TEHA 1BS2A 2HMTA 1HETA 2V8BA 3NFRA 5I3CA 2VPWA 3UMVA 2N42A 3DCNA 4NV1A 1VJ5A 1Y3BE 3VH4A 3CCCA 2UZ0A 3CLHA 1NL3A 5L9AA 2ZYWX 1KSJA 4BBJA 4G81A 1GNSA 2EERA 2I8CA 3O8DA 3OIFA 4DHEA 5JAUA 2G4VA 5CB8A 2E7ZA 2P4UA 2R96A 3DOEA 1T4MA 1IG3A 3A25A 2RGWA 3GT3A 3RVLA 2JAXA 4G0MA 4RPKA 5BMVF 2WAAA 1QHSA 4O2AF 1JMVA 3EF0A 4B09A 3A2NA 4TZ6A 3S70A 4WESB 3MFQA 4M0KA 4TPKA 3ORRA 2QX7A 1N6NA 5ALLA 3TGPA 3S68A 3DGEC 2XIQA 2P35A 3HVIA 1PX2A 3IUQA 2IDKA 2W37A 5K45A 3GAAA 2K7ZA 3TW4A 3TRHA 4IIJB 4M0DA 3TOXA 4LGVA 3ZZNA 3MBOA 2PO7A 3SLGA 4IFIA 5ER6A 1RI4A 2WDZA 4FOLA 2IC5A 3TG2A 1VL1A 1DRJA 3FKJA 3K94A 1VL2A 2FP4B 5KNLA 1KI8A 2Y1LA 5BYBA 3NXSA 1Q0LA 3IR6A 1LW6E 2HM7A 1LXCA 5ISMA 4KXNA 2BISA 1FJ2A 4OXIA 4RE6A 3WWZA 1PL0A 1R9GA 4KX5A 5AIBA 3TEJA 3V6MA 1HKHA 5BPHA 4L5AA 1G291 5JBNA 1E4VA 1G8JA 1H2WA 3OC0A 3CE9A 1U28A 3JWIA 3X1YA 1QFJA 2O2EA 1E18A 1ORTA 3BG5A 1RLMA 2H0AA 3PCTA 2AMVA 2AOTB 2FZEA 4DRXB 5ICFA 1O4WA 1FCJA 3VHXA 3KTAA 4OYYA 1O54A 3STTA 4MCIA 2E55A 1WXHA 2WA2A 2WM3A 1O96A 5IUJC 2H5LA 4D46A 2SICE 1KJWA 4D3XA 3OLWA 3TOSA 3QVMA 1IXYA 4K2HA 5CLHA 4ZQIA 1QAQA 4HAXA 1Y8QB 3H5RA 1UJCA 4TVKA 3C3PA 3RD5A 2QB5A 1L5NA 4JXKA 1KIFA 4G0XA 5DPMA 2JJ2A 3BPSA 1BW9A 1L7QA 2QTTA 2V54A 2G83A 3AO0B 4AFNA 4YDSA 2JI7A 4AULA 1SURA 2IY7A 2JJ8A 3EXIB 3VPHA 2IYNA 2CD9A 4GW3A 4D0NA 3HM2A 4M7RA 4MIYA 3SXUB 4DJJA 1XDWA 3L84A 3D6HA 2P27A 2GYYA 2J48A 3W2HA 1EFRD 3FDIA 3OJOA 5CUQA 1LJ8A 3GDOA 1CR2A 2C9YA 3ZU5A 2XXAB 2W2KA 5CH8A 1Y8CA 2GF2A 2J46A 1F7VA 1EFVA 1U98A 2EXXA 2QG6A 1Y34E 4EY7A 1PI3A 1I30A 2D62A 3ETHA 2ECOA 1QC5A 1UQRA 4OHRA 1KPGA 1RYMA 2AWOA 2PGAA 1WW3A 1J8DA 2VYFA 4XPIB 4F3NA 1YI1A 1IULA 3ANLA 1GA4A 2Y0PA 4ILEA 5AI6A 5KSPA 4BMNA 4EHAA 4ZCLA 3R23A 5K5EA 5T41A 4RGQA 1H3EA 3GJ7A 1YSCA 4MRVA 2Y1CA 3LGXA 4ERNA 3PUKA 3OCVA 3HCAA 2UYYA 4A6XA 4B3BA 1OA1A 1QHEA 3FHOA 4UEKA 1NXSA 1KMIY 1QH0A 3IB3A 2C2BA 3OA2A 3OX2A 3MK31 3CA8A 4C06A 2XRZA 4MGEA 4BB6A 4HAUA 4E94A 3EH1A 5EMMA 3ZTYA 3ILXA 1UXJA 1YRLA 4P84A 4Q9HA 5ECGC 3ZE1B 4AJ4A 3Q85A 3OMXA 2HRZA 2JCYA 1DGQA 1NW5A 3OJXA 3QYPA 4DIKA 4DQ0A 5I7HA 1TW2A 1URPA 2JGLA 3IQWA 5EE5B 3OQOA 1NT4A 3H7IA 4C29A 4FGUA 2A9OA 5HOEA 3NFYA 1THMA 4B7XA 2OB1A 1A9OA 1J00A 1W0CA 3FSGD 2BD0A 3CX3A 3KYDB 4AJHA 1M2WA 3E5RA 2DY1A 2RH9B 3CH6A 2ZSEA 2F1KA 4Q1AA 5LZ9A 2VJCA 3IKLA 3MJEA 4BO1A 4KN8A 4F1JA 1YS4A 4MYCA 2E1PA 3QOWA 4UU8A 1S9DA 2NQ8A 3P8ZA 2FTKE 5FA5A 2CNOA 5TMEA 1EZ4A 5ADHA 3SQMA 1YA6A 1N25A 1RW4A 3SU8A 5B55A 1OMOA 4G4SO 3EEIA 5I5EA 3HABA 4UXIA 5B3JC 4EY5A 4KH1A 4L75A 4RD2A 2FOIA 3HCRA 1TYAE 2OV3A 3CH5A 3NNSA 4I55F 4X3OA 1PHRA 4C0SA 1U63A 2H1CA 2C97A 2CLSA 1HF3A 3M89A 4HTFB 2O8DB 5A4MS 4ND6A 2DU8A 4RHTA 4I2VA 2FPPA 3EN0A 3OKAA 4MUIA 1V3VA 2DKOA 2PX5A 5ECWA 3EZNA 5EY5B 1OYYA 5FNVF 2Q3LA 5LQKA 2O19A 1GPWB 2YDYA 3WAJA 1NN5A 2WWHA 2Z0MA 3OEYA 2JD0A 3NGXA 3U7GA 1E1MA 2WWRA 3HLYA 1NM5C 1W5FA 1FY2A 2EDAA 2XUGA 3QW2A 4HH3C 4TKVB 1E3JA 3GLHA 1D1TA 4MV3A 3LY7A 3PE6A 1V5GA 2OXFA 3B1KA 2ZRQA 5CCDA 4C43A 1CIJA 1K8RA 3IEIA 4IXDA 4BZZA 3V8QA 5HIMA 4CMKA 3CH4B 1P8AA 1WVIA 1GGFA 1QIIA 3PJFA 1PN3A 1U6KA 4YFVA 5BP7A 1A1VA 3IGFA 5CYPA 2WG0A 2J6HA 3BHMA 1ZQ9A 5EFOA 3W3AA 3UH0A 5FLKA 1P45A 1KVSA 4Z0HO 4HH4A 3R9WA 1U31A 2I2BA 3L7AA 2CK3A 4I8DA 5H68A 1OWPA 5JZOA 4O4LB 4W5RA 3QLUA 5H3HA 4PLPA 4MLPA 1X7WA 1X1BA 2ISQA 3PA6A 4H0NA 4OHCA 3ELWA 2JJ1A 4D9EA 5IAAA 3H9UA 3QBDA 4UZFA 3GAMA 3HN7A 4R1QA 2ZE8A 1IIRA 4LBVA 4WVFA 3KHSA 1WUTA 1FSFA 5CPFA 3F8SA 3WLNA 4R7GA 3W5DA 3I4LA 4E22A 2GKOA 2ISSD 3B52X 2GN1A 5B2FA 4FE4A 5IANA 1KYQA 1LPSA 3MGBA 4JROA 1Y4UA 2J7PA 4WX2B 3CLUC 3TX2A 1W88A 3K2BA 2YV1A 2ZRHA 4FMCF 2NV2B 3BQMB 4QELA 5JH7B 3ME5A 1JGTA 1OZ0A 2VT2A 2PT6A 4N0PA 2PSHA 5ESWA 2IYRA 1LNZA 3E22A 5LZ8A 3OD5A 2OGUA 1NBIA 4IF4A 1OXUA 4LY9A 3GRRA 4LAFA 3EARA 4JUBA 4LRXA 4NZMA 5HFNA 3W05A 1TZMA 3W4IA 5KQSA 1IU9A 1L5QA 1Y1RA 4UNPA 3MTJA 4UBMA 2OCGA 1UFRA 4D45A 4DLXA 3V4OA 1DG9A 1UWVA 4HUQA 1JVBA 3Q9LA 1D6SA 4MWCA 2VPQA 4CQLB 3FPSA 4GUAA 2X0IA 1LPBB 4W5TA 1EVQA 1HZZA 2P5YA 2FF5A 1NF2A 2NZ2A 3IPRA 4RS4A 1AQIA 1XZLA 1NE7A 2NZJA 2FWBA 3LH5A 3O0DA 5GJCA 1OZFA 4C4SA 1DG3A 3GW8A 1XRQA 4C4AA 1ND6A 3JR7A 5JALA 3HR8A 3OZUA 2HSGA 2J45A 4C01A 4CMCA 2EKQA 1RHJA 2GEBA 1H65A 2GBIA 5AJTA 2IHBA 1ZQ1A 2ACVA 1DEOA 1CZUA 2P2ZA 4HAVA 4Z7OB 3LS2A 2D6FA 1LLQA 4HN9A 1Z3CA 1I3MA 1HG1A 1R0CA 3WJ1A 2CKDA 2HQSA 1XU4A 4IQGA 5FBLB 5AVWA 1KQNA 3Q3JB 4HQOA 1QBGA 3T4PA 1QM5A 4D8UA 4LFBB 4LGYA 4Y2SA 3GJTA 4EI7A 4ZRNA 3IAXA 5EJ2A 1NI4A 4EHHA 4IJVA 2VWQA 4W5HA 1BE0A 1M0WA 3QXGA 4HDAA 3NIBA 3OX3A 4MGKR 2OFXA 2C8LA 4NYIR 4P86A 4U2KA 4I7EA 4XCXA 3ZDEA 1KMQA 2N3ZA 1U2ZA 3I0ZA 4Q66C 2HRBA 3M1YA 3C4JA 2O1XA 3ZHTA 2PBRA 2JD2A 3A1EA 5FTKA 4AYXA 1N6OA 2H48A 1MIOA 2W2QA 1KFKB 3V3TA 1VLHA 3QNMA 4K9QA 4JXZA 3BL6A 3I12A 5ALGA 1T5TA 4EUSA 3UAYA 4IV5A 5A1TA 2CY0A 5LNK6 2B1JA 1P61B 2CC2A 3B12A 4W5QA 3ZJ4A 1DQPA 3DYBA 4NV0A 5B3AA 4BFYA 1DC8A 3JATA 5IP5A 3DR5A 1P1FA 4RORA 2BBOA 3U4DA 2JH3A 4B87A 4YXFA 3ADOA 5KOHA 3QUQA 2R6DA 4JQZA 5IH3A 4QPNA 5CFNA 4RULA 3D6MA 4Z9YA 2QL9A 3J80A 4D44A 4XWOA 3A9CA 5FFNA 1OLSB 3O74A 1PR3A 4D4HA 2WJZB 3C15C 1X9GA 5BO5A 5J58A 1C2TA 1AKWA 2V5AA 3BE5A 4Y2GA 5FOUA 4HVCA 4ZQGA 2PKXA 2YZGA 3WOHA 2VBFA 1LU9A 2NACA 3C39A 3G8BA 4B80A 1ZIYA 4ZYTA 3ZGYA 1H2YA 1FP4A 2PIDA 2Z9BA 1NVUQ 2V0NA 3CZ5A 1RJ9B 1DC7A 3D2CA 4MQLA 4QEDA 4A0FA 4YV2A 4K5QA 3Q7TA 3RJMA 3UVEA 2ODAA 3T3DA 2FGJA 1Z0DA 1T4DA 1OYVA 3B3FA 1T35A 1W36C 5LDGA 3OIYA 5HF9A 4D9FA 4X7MA 1J0EA 2OR3A 1EG2A 4CV1A 5F23A 5M29A 4RTQA 1L1QA 1DAKA 4Y2YA 5CW2A 2XXBA 3H9QA 4DA0A 1B1CA 3X2SA 1E2EA 4X91A 4YREA 2DHDA 3V4RA 1ZR4A 2IUTA 3OD1A 1A5AB 4YBZA 1EX9A 2HOQA 4GRIA 2RFLA 3CUKA 1ULTA 1H94A 2WMOB 3H0EA 5CT6A 4QDUA 5SY6A 1R8YA 2ZPUA 2QTCA 4WZBB 4US1R 4XARA 3TKAA 4QICA 3U7EB 3U7JA 4CDRA 4DDWA 1TT7A 3BFXA 5IM4F 2JF0A 3SDZA 2W42A 1VL5A 2BYTA 5EVJA 4FTWA 5GZ1A 1J5EB 1CFJA 2ADMA 1QRRA 4D7AA 4WD3A 1WUHS 2VNAA 4FPXA 4GPTA 1U0BB 2CBGA 2CHVA 5EHGA 1E6WA 1GTJ1 3MZ0A 1I4TD 2PH3A 5HHTA 4NYJQ 1TJ3A 1TEVA 3C3KA 4ONEA 3KWFA 2TMGA 1XTVA 2X1HA 3ZDDA 1DNPA 1OFUA 3FMVA 4AWBA 2J32A 1TCBA 2IBMA 1Y9EA 2IZ7A 2WQZA 1LKZA 4RK1A 4MS3A 4CDNA 1HRDA 1KI6A 2OG2A 5ERGB 4CMGA 1II0A 5A5GA 4KITB 5TQ0B 1GTZA 5DHTA 3QOYA 4YUVA 2R00C 2B36A 3QMWA 2PE5A 5L40A 3GBPA 5TJ9A 2OCLA 4L5YA 4NL4H 4MYDA 3EZYA 3GLGA 2A9VA 4JSRA 2D13A 3N8KA 1MZPA 3M5CA 2HHHB 3DZFA 4LWOA 1V8DA 2VXCA 5IDWA 4E13A 2XOXA 4OHUA 2QRJA 3TAUA 4A8JA 2WG1A 2QTAA 2QRVA 3K20A 1O6ZA 1QDEA 2H51A 1KZYC 3NYIA 2VHVA 4G36A 5AW9A 4XYBA 4E7PA 4KQXA 3DO6A 2C7PA 2Z1DA 4XYEA 4DFDA 2O5EA 3FN4A 2J0SA 1JU4A 2YVAA 2C5GA 4NZPA 1ZITA 3AWDA 4IDOA 4RFLA 5BSRA 1XF1A 4LXUA 3C3WA 3T9CA 4UCWA 3KL4A 5D87A 3EVCA 1C8VB 1MO3A 2HH9A 2ZYSA 3C85A 4CIXA 4DCUA 1CULC 1U9CA 1NBMD 5KYWA 1P2GA 3LPLA 1XZEA 1XYVA 2J3HA 2HKIA 3JZMA 4HQLA 3WRXC 5FAKA 1ECCA 2I4IA 1SXPA 1CNFA 3ZH2A 3CRQA 3MNFA 3ZEIA 1P5RA 2E4ZA 4IHJB 3IEPA 4D9CA 4MUNA 1IC6A 4XDHA 5LCXA 1Z6QA 1KJ8A 3BJZA 4Q01A 5FBWB 3TSYA 5C8YF 3FROA 1WZIA 1ULAA 3CF4G 3VVCA 9MHTA 3C7CB 3GFPA 3HH8A 2VRBA 4MRMB 3V42A 4DRZA 5JYDA 3WDSA 4WECA 2BVNA 1R8XA 1KO5A 2I0FA 4GI1A 5JWOA 3M6WA 4MEBA 2JPDA 1HDXA 1U9IC 5I8PA 3ZVKA 3U48A 3EA4A 1JQ3A 3TSCA 3PUIA 3UN1A 1N4AA 2CXUA 1XYYA 3LWZA 3WL6A 1E62A 5BMOA 2DM6A 2ONCA 3LY9A 3MOIA 2QAGA 2WU4A 2RIPA 4IBOA 4LISA 3OVMA 2V9CA 4ZK6A 3DZHA 4J8PA 4WZBE 4R2WA 4Y2UA 1J25A 5IVKA 3OUZA 1JG3A 1GLNA 2ZBEA 3BMOB 3PPIA 4FE3A 3R7WA 1AKMA 5DSTA 3U7RA 1U3GA 2ZJ6A 3C3BA 5TNXA 1UK7A 2OZLB 2RJ3A 1QGOA 1E6EA 3WTCA 4PC3A 4LCEA 521PA 3L7OA 4M7WA 2FLKA 4XM2A 1DAIA 4D82A 2O2SA 1U99A 5IF3A 3C6YA 2XWSA 4HFRA 4YRIA 2RC6A 3CEMA 4D81A 2C1EA 4ZO6A 3ZHCA 2B7CA 5KYVA 2XITA 3BF8A 4E3WA 4MPRA 3Q7RA 1C2YA 1ZCJA 1O95C 2QVYX 3JV7A 3ZK8A 1AS3A 3KHUA 5DGCA 4E1BA 2YN4A 5H7XA 3A1SA 2BTOA 4JSYA 4YMWA 3GUUA 3PNBA 2Y3IA 5FTWA 4BRSA 2ZVJA 2IY8A 1FFXA 3DKRA 2MSDB 3EE6A 3GV0A 5K09A 5DGIA 1QV6A 4HADA 4BKRA 1SXJC 2R1VB 5ELXA 2G9VA 4RYDA 3LE8A 2QLMA 3OPYA 3H5AA 6REQA 4QNNA 4DT1A 5JS1A 2GEVA 2O8FB 5ALMA 1GUZA 1LDBA 2REXB 5DT9A 4GOLD 3AFOA 2QZPA 1UBKS 2DSTA 1JSRA 3KSRA 2UUBB 2ZBQA 3ND7A 1C30A 4ZYWA 5E9WA 3N74A 5FOWA 2J0EA 3HBFA 4ASUA 4TKZA 3VH2A 1M2VA 1PGJA 1EHYA 1G21A 1SHZA 2Q6OA 2O7SA 2X23A 3A9UA 3MWJA 3QBEA 3IKJA 1GNPA 4X1KA 1A2OA 2HEGA 4WNAA 1DKLA 1GOTA 2QN8A 2OD7A 1SKBA 3ZWBA 4BNUA 2Q4RA 2GS9A 2F67A 3GZNA 2D1YA 4LDNA 5C1BA 4TLLB 4RQBA 4TXMA 2A5JA 2Q6KA 3L5OA 3L7MA 4YP5A 5FFMA 3QKTA 2SHKA 4JNCA 4QOFA 1CE8A 1ZRHA 2AF3C 1OH5A 2VSOA 2CDRA 4UTOA 3MB5A 2BM8A 2HDNB 1TJNA 3NYWA 5EOVA 4EB3A 3KU4A 4ZYXA 4UHHA 3RNOA 2EEZA 5MN5A 1N7JA 3GMSA 3ZQJA 1YAHA 1W8DA 2G5TA 2C84A 1B76A 1E3WB 3KLNA 4QE3A 2O8BB 1HORA 3RREA 3M4JA 1OFUX 1YC2A 4GL4A 5D3MA 1TOAA 3T9EA 4MUKA 3JYQA 3ZN2A 2XRFA 3AHCA 2O23A 5FBRB 5JD6A 1RXVA 3SVZA 3C6BA 2OQVA 1JSLA 1NR1A 2W2TA 5A3SA 4OHZA 4JP8A 2FZVA 1JG7A 2ZBRA 4TLDA 4FQ7A 3ENNA 3ZHUA 5M7EA 1MDBA 2IUYA 1N36B 4LKOA 4OI4A 3W8RA 3KCQA 3H1FA 3HS3A 5HNKA 4YJKA 3QGMA 5C34B 3VNSA 4E3ZA 3CSSA 2BCGY 3SEFA 3CPHA 4MUFA 4HXEB 4BFXA 3DAFA 5JUWA 4UTPA 1Z07A 4FSDA 5DCUA 1U2PA 2XVXA 1WXEA 5K8TA 2FMIA 4KFCA 3V00A 2VHWA 4K9KA 5GONA 5LLTA 3IOMA 4QDZA 5B1YA 5EJ9A 3K70B 1XDGA 1PX0A 1UBMS 1XWFA 3QTBA 3FOAA 2WJGA 3NZEA 5GVRA 4D9GA 2C1XA 5CXUA 1F17A 1R6XA 4AN4A 3CMCO 1XCBA 1E0SA 1ZH4A 3NGLA 4D0GA 4EFLA 4CKWA 5ITWA 3R7LA 2VQEB 3VU0A 3L7LA 1RXYA 1YS1X 3N3BC 1A8IA 2P6NA 1IUNA 3OE4A 3C7AA 4N39A 3OLQA 4D02A 2V7PA 5CIQA 3WIBA 1F2TB 1N9GB 4EY4A 3CISA 1Z4OA 1U8TA 4OV6B 1X38A 3ANTA 3OQ1A 4LFAB 2BEWA 1VBMA 2Q6LA 2RHGB 4L4ZA 1JB1A 1E6KA 2OAQ1 3PQ8A 3R77A 2OENG 4BKUA 4EPXA 5JECA 2DEUA 3G2NA 1NASA 2RGYA 1VXOA 2XCOA 1TJ4A 1MD9A 1ZMOA 5HQJA 1OASA 2XQJA 1PG2A 2FU5C 5FIUA 4TV9A 1NQTA 2WWGA 3AVYA 2W6OA 4M1OA 4A23A 4P08A 3O4FA 1IVSA 2IEIA 4RA6A 4YR9A 4YN3A 1CY6A 2IHZA 4PZZA 3EOZA 1K88A 3O2QB 5LB4A 3D5TA 4KAFA 5TMPA 1VIDA 3EVNA 1M2NA 2B9VA 4HVLA 3SLKA 1BDMA 2H16A 4EVQA 2XADA 3E5MA 3KYBA 5AKXA 4ZT7A 1M6VA 2PX2A 1W4ZA 3NIDB 2WYOA 4LE1A 4ZVOA 3RRNA 3RVKA 5HM8A 5T4EA 1CJSA 1UPUA 3DOIA 4UUOA 1IRXA 3E9NA 4PICA 2GBGA 5JQGF 5JCXA 5IJWA 1IUKA 3OIGA 4DSUA 4EM6A 2BRUC 4FFPA 1U3UA 3HDYA 1O7JA 5DNWA 1VB3A 3PT5A 2K4MA 2DUMA 3BXGA 4TWIA 7ABPA 3OETA 3OP4A 1ZUIA 5K3AA 3SC2B 3VOBA 1KJIA 1MAHA 3BE8A 1X8XA 1R9MA 1KH3A 3ZKWA 2EJWA 2F43B 4OY3A 3HXOA 1E0AA 1QIHA 4RHFA 2WFZA 1VCNA 4RUKA 5TT0A 1H05A 2E9SA 2JEZA 2ZSHA 4FUTA 4BMYA 3OF5A 5KQGA 4LRQA 4EECA 1M5TA 2ODQA 3WHIA 4MRRA 5EINA 2B69A 3PNLA 2PS9A 3M2PA 3BC1A 3OE7A 4O6VA 1WHSA 4O4HB 3BWCA 4P35A 2MSLA 1L7PA 3OEHD 4WXHA 4DV1B 2EP7A 4POAA 4IHAA 1IPFA 5B5SA 4YWJA 3KSAC 3A70A 3LAWA 4IVQA 4B3GA 2P7HA 4R8MA 3SVTA 2FWIA 3TQHA 3LDUA 2VH2A 2R6CA 2GHTA 1NJFA 1PT7A 1H2EA 2I78A 1FFHA 2RBEA 4TM8A 3VDQA 4MDEA 1Q91A 3CW8X 1PT6A 3HPRA 7MDHA 1DMSA 2X15A 1HT2E 1E7YA 1WHTB 4JT9A 3WFJA 2IEYA 3GPLA 5DT2A 5HXAA 3GA0A 3HTXA 1JWAB 1ONPA 1Q0ZA 5AM1A 4ZN6A 1AURA 3QXSA 1DBPA 1NRWA 3KFLA 5C8XA 6ADHA 4JLVA 4IX9A 5JE8A 4D26A 1ULZA 4EI2A 3UJ7A 2HJWA 5J1TB 2DULA 1ILWA 2DRIA 4TTAA 1CDDA 2BEVA 1Z0AA 4EATA 2CV0A 4NVRA 3W3ZB 1J1UA 3F4LA 1SH7A 4J16C 3ZBTA 5KO2A 1XPRA 5BNIA 5EPUA 2F6RA 4UEQA 3IR7A 1TFUA 4YRFA 3FPFA 5KSWB 3EVEA 1HMYA 2KBEA 1AK9A 1RYEA 2B4AA 2CSUA 3QKSA 4IDCA 2XB2A 4QXOA 3M6UA 1BJKA 4KPUA 2R2AA 3AR9A 2YICA 1ENYA 3PQCA 5JS7A 3KUCA 2VF7A 4HWTA 3WZ2A 2AI2A 1RHKA 2CLLB 2RGNA 3UFBA 1X7YB 3FCEA 3WGZA 3DVRX 3IESA 4IX1A 2H2FA 1YFJA 4YAOA 3LK6A 3GFVA 2CDAA 2DWCA 1C1DB 1V9SA 1XE3A 3I5YA 4N1AA 5HGJA 4FI3C 4HG2A 1QQBA 3URKA 1VC2A 3VOSA 3LRXA 4LJLA 2AL7A 3V9PA 4H59A 4ZT5A 3TYXA 4KR2A 1PHPA 4CIDA 1R8QA 2YOHA 2IU6A 1XZBA 2B4YA 3O8QA 3F2IA 4OHOA 5KHOC 5AKLA 1A77A 1PRYA 1Q0PA 1E96A 2EV9A 2Q46A 3FPEA 5LIRA 5HA5A 2M9MA 4Q7KA 4QUBA 1QKIA 3M8KA 4TS9A 4AKIA 3Q41A 1M75A 1JKFA 4GZ6A 5JLAA 1W19A 1Q1EA 3TMKA 5BMVA 3G2OA 4NBKA 1LY1A 2RC5A 4YCDA 3R75A 1Z47A 1T4GA 1JSXA 1L5WA 1R3DA 2PSEA 4EB6A 3SYTA 4Q16A 1TA4A 4GX5A 4XDGA 5CT8A 4YMIA 2H1RA 2RGRA 4AJ9A 1FZTA 3STWA 1D2MA 3LLSA 4FWBA 4RV5A 5AH0A 1H6DA 1CF4A 5HZGA 3LUBA 1COWD 2ZLBA 5FFFA 1J8MF 2OSVA 4TRJA 4DMCA 1TQ4A 1XRNA 2YH2A 2YC4C 3V5NA 4BX9A 5KOYA 2EARA 3CSUA 1OI3A 3VHXB 3CN7A 5F2KA 3QU9A 5CEFA 1XZPA 1O96B 4R2JA 1RDFA 4MGYR 1TUGA 4IIJF 2CJPA 2GCIA 1YFZA 4FJ1A 2G77B 3KQSA 4A82A 3LQKA 2HK8A 4DBLC 1STOA 4MITA 5FI0B 3ZCTA 2Z5VA 4L73A 1BYUA 1RTTA 2R25B 2UYQA 4NLLA 3U13A 2ZULA 2AE2A 4ZDIA 4X7PA 1BW9B 2GAIA 1VG0B 3WGLA 3BK2A 1GT6A 1WSDA 1YZUA 2XE7A 4UXJA 1V8OA 2DGDA 4B3DA 3A4NA 3C5VA 3ROPA 3WMGA 1BG6A 3LK7A 1YHZA 1NVBA 5INTA 5L7YA 1FJHA 1Y33E 4IDPA 3RABA 4I50A 4JA2A 2KI5A 3AHEA 4HEJA 3DULA 4GX0A 1G63A 4TTTS 2PZFA 1ZM7A 4M0EA 1EJBA 4YRPA 5TVKA 1WA5A 4QVGA 3SJZA 3X1DA 4G63A 1YR7A 3C7TA 1ESZA 1X70A 5IEBA 1ZJ6A 2PJUA 3UKDA 5CIYA 3BL8A 1DINA 1UEXC 4RF2A 2LNDA 1G4HA 2E0IA 2MHCA 5HJ2A 3RAEC 1JIIA 3K70D 1B74A 2PAFA 1S4QA 2OA0A 1QGYA 1WPGA 4R2XA 4D9NA 3L7KA 4HX9A 3FNGA 4FQ8A 2P9QA 2IUUA 2TMKA 4HGQA 1I14A 2FVXA 3FHLA 2GAFA 1GG2A 4EGFA 4RD4A 1RWWA 1Z7WA 2NPOA 1J49A 5A4FS 1IXZA 3V2HA 2H9IA 5IC5A 5J3JA 1DV1A 3ANYB 1AV7A 1CQIA 3H7AA 4Y2HA 5JZMA 5F9FA 4BMPB 1PNOA 4ESEA 4II2A 1ZM2A 2XNCA 2Q0QA 5DM70 4F5EA 2G4CA 2HW8A 2C61A 1WCIA 4JJ7A 1KNQA 1YR1A 2ACWA 2ZBGA 3GLSA 1ZD4A 3BX1A 3PFGA 1T6XA 1KQGA 3DMNA 2EJUA 4BKMA 1T1IA 1NIPA 1Z88A 4TWRA 3ORFA 4BLQA 3AKDA 4DC0A 2Q5QA 3D2LA 1OI4A 4JLUA 5IUNC 3ITDA 4WLNA 3NBXX 5ILOA 4TV8F 1HSZA 2IF0A 3CFYA 3I64A 4FOPA 3D9QX 4OI0A 2P91A 1NA5A 1P73A 3CONA 3E2IA 5HKLA 1A9XB 1VQ1A 3KALA 1PJ8A 1NFQA 2HIMA 4PCUA 4HQKA 2PXAA 1DFHA 3ND8A 5B4UA 3BJEA 5HS6A 5ABPA 4M0LA 4P83A 3I4CA 2GZ1A 5I01A 4CTMA 3GUVA 4LEIA 4R1TA 2XMQA 2YZMA 3E3MA 1C9YA 5A0FA 4NF2A 5C2JB 1GAJA 2R8YA 1IJFA 1WETA 2CZCA 2HV9A 1F6BA 2ETXA 4KP7A 4PX3A 5E8RA 4R5HA 3VC7A 4A5OA 1TMKA 4HNVA 1IIBA 2D3TA 3DE6X 3EGDB 3HN2A 2CBZA 2ZTLA 2LRHA 3PEEA 4EKDA 5LYJB 2KMLA 1XRRA 3BM5A 4IEIA 2OSBA 1Q7GA 2DHRA 2FV8A 8AT1A 2P2NA 3SYNA 1QV7A 3A3KA 3PK0A 4OHMA 1ONBA 1J20A 4QPCA 5FOVA 2W70A 3QMVA 2FPPB 3H4TA 1BDHA 5LBIA 1E3EA 1UPBA 2JFHA 5E6SA 3WAGA 1Z7BA 4I1RA 1D9XA 1MGPA 1YRBA 2QE7A 3BXHA 1MJFA 4PINA 4Q9JA 3UHAA 1MT3A 2ZAMA 3EOBI 3RS2A 3U61B 1REQA 3M3PA 1I7SB 5KJ1A 4MW7A 3LP6A 1G2OA 2FA9A 3FHCB 3P0JA 4A0SA 2O8EA 2PH7A 1LV7A 5DM1A 1BD3A 4HNGA 3DTVB 4MRAA 4Y9SA 2G28A 2ZU0C 2CLMB 4UU7A 2CZGA 4D96A 1IOLA 4GC9A 4I3HA 5JHHB 2NSHA 2PZJA 2W9XA 2PR7A 3KSDO 3O38A 4J03A 3TBHA 3VYVA 2XDQB 3G7SA 2GMWA 5L45A 1QZZA 1QO0D 4MWOA 3Q8LA 4PYIA 4Q3CA 1II8A 4H7EA 1GGMA 4PLGA 1RFLA 2CHEA 3OJCA 4PO9A 1Z06A 2JARA 4U2FA 5EE3A 1PR9A 1XVVA 4YI5A 1FYEA 3ZY6A 3PR1A 4JUDX 3PIRA 2BFCA 2DQSA 5HPYB 5KHAA 2V4ZA 4L76A 1SUAA 3NVMB 1OE0A 2YYYA 2VP9A 1VECA 1GKYA 1HG0A 1MG0A 1WKCA 2IF2A 3HL4A 3GDGA 4FCTA 5D5QA 4IV8A 3VU1A 4X61A 4ZTUB 1G9SA 3HJNA 4BQSA 3GAFA 1D07A 3NATA 4WA8A 5J4KA 5EP1A 2BZSA 1NYTA 2H2HA 4LMBA 2JCBA 4DWWA 4C2AA 1C4XA 1F8UA 2AKYA 2GHIA 4C4ZA 1VA5A 1TVKB 2VBGA 4KXVA 4ETWA 1J0BA 1LPOA 2Z8YA 4QU9A 3MHPA 5K4AA 3OT5A 1UZAA 3KE8A 3EC2A 4EPVA 1YZKA 1AG9A 1HDZA 2XKAA 2LKCA 2XJ9A 5AW6A 1J9GA 3B9BA 1N57A 2AW5A 3O1HB 4PRYA 4P38A 1V37A 3ZGVA 1CY7A 3E22B 1HV8A 3IJ5A 1O0SA 4QXPA 1L7VC 2IYTA 3R9XB 2GARA 3W5AA 1IBMB 2XWJI 3BL5A 5F4ZA 1XZCA 2NTEA 1DBRA 2TS1A 3DKPA 3FFTA 3B36A 4O4LF 4BVLA 3QEOA 2Q5FA 5M34A 4KC0A 5A5DA 4RKYA 4OBXA 2NAFA 1A9PA 3EBLA 1TC1A 3EMVA 4HUQB 4QQFA 5K3DA 5C0OE 3TDKA 5A9SB 1GAXA 3P9YA 2CKMA 3B6MA 4LOAA 2RHCA 1NXQA 4EX7A 1CCWA 4XQGA 1VHWA 3D8UA 3L4EA 4O2RA 3H2JA 1WZEA 2VHQA 5JS2A 4JI0B 1I7DA 1LBIA 3U26A 2FSUA 2ZRJA 3PLAE 1T1JA 1QK4A 4O2BA 4E51A 1ZAYA 1MJGA 5DDIP 4ZZ1A 4M8KA 3V4LA 2IBTA 1EHCA 2HPZA 3ANXA 2CMDA 4U9UA 1NOJA 3MMXA 2WWVD 1IWPB 3Q8XB 5J43A 4X9XA 3T12A 4JKOA 4RDCA 4DDHA 3HBMA 4NIMA 4HGYA 5K8LA 4J1QA 3K92A 1RP1A 1NF3A 2G40A 1X1DA 4GD3Q 2DHEA 2XGJA 1LBEA 1PWHA 7AT1A 1ML4A 3BWVA 2VN8A 3D6AA 2GZMA 2IYLD 3O8OA 3TIGA 2WFLB 3O21A 1NURA 4MR7B 5CGQB 1A2KC 1A27A 1PDWA 1SOVA 5CVTA 5JEEA 2MSWA 5FQNA 4YXWD 3B1XA 3CVXA 1TCCA 4ZQEA 1DKUA 4BNTA 3UJ6A 5LZ2A 1QP7A 3GLHE 1BXZA 1GSIA 2FFJA 3Q2IA 3I09A 1YRWA 1NI4B 4HFJA 3RRBA 3FSJX 3PICA 4MUHA 5HK8A 4L8FA 1V7QA 3L8YA 2M2IA 4L02A 5IT9A 1GEGA 3ASUA 5JZSA 3KQWA 5CT5A 1AQNA 4FINA 3AYZB 2WTAA 5TJHA 5H0IA 3FYCA 1BDBA 3WX0A 3D7SA 1Z62A 2X42A 3Q2OA 1E8DA 4W63A 1U4OA 2Q5CA 3L6BA 4PG8A 1TYDE 1MIOB 4GR9A 4DARA 3DDNA 2J87A 1SK8A 4QJIA 1I32A 5JLJA 4RM2A 5T57A 3PF9A 3ZDRA 3BMQB 1OYWA 3GEDA 5JDIA 4URXR 2GF0A 3T1YB 1WE2A 3AKCA 3SGLA 1VHLA 3EPRA 1Z0KA 2IU4A 1M2FA 1MOPA 5HIIA 2B4TO 4JGBA 4M60A 3LLUA 1O3YA 5U4XA 1FQJA 3SSOA 3DFKA 3WVNA 4BMSA 2DPXA 2FEOA 4Y6SA 1VKRA