5AOBA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
b'RLRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLKDHVPRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
molecule tags Hydrolase
source organism Thermogutta terrifontis
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aobA00
2O7VA 1TAHA 4WFIA 4FHZA 5HK8A 1VE6A 5EHXA 4C87A 1P0MA 4J0HA 1AZWA 3H0CA 4FLFA 3LIIA 5DNUA 1JFRA 4CCYB 3FBWA 4E11A 5CT6A 1JJIA 4QDZA 2WU3A 1WB4A 3O9VA 1JU3A 4H35A 1W76A 4X6YA 3R3YA 2HA3A 3ANTA 1BS9A 3WIOA 5CH8A 2XUKA 2ZYIA 4QDUA 4BRZA 3WA7A 1XZKA 2EDCA 3PF9A 4MYSA 2FUKA 2OGZA 3PUIA 5AKXA 5C7YA 3C43A 3F8SA 1CUGA 5J3JA 3F98A 3VVMA 5ALVA 2V9ZA 3QM1A 5DYYA 2XUOA 4HS9A 1X70A 2XLBA 3LCRA 1MTZA 3FNBA 2BAGA 1TCAA 4ITVA 2XQJA 1U8EA 4G1FA 5AP9A 4RNCA 1LZLA 3I28A 4W1RA 2QXUA 2PU7A 3FWHA 3ZLVA 3MUNA 1EVQA 1NU6A 4B6GA 2WJ3A 3ED1A 3E4DA 2C4HA 5K3EA 4G5XA 3IIIA 2QT9A 3STXA 1QIKA 2ES4A 5ALHA 2G63A 2OLEA 5AM1A 1IZ7A 4L0CA 5YASA 4BAUA 1XKTA 2XUPA 4AO7A 3BDVA 2HA7A 4H7FA 1TCBA 3DYIA 2WFLA 1B6GA 2J3QA 1U65A 4Q34A 3MVEA 3ESAA 1QIEA 1XRPA 4GBGA 4FDMA 4ZXFA 1LGYA 1XZMA 1ZD4A 2HU7A 3A2NA 1J2EA 4N8EA 2OCLA 4OPMA 4BATA 2OXEA 6YASA 3D2AA 5JARA 4CIBA 2YASA 3B12A 5FKJA 3QPCA 2B20A 3QMVA 3AZPA 4D9JA 1XLUA 4G8DA 3DL7A 3G7NA 3G0IA 3WK6A 4G4JA 4BYMA 4I19A 2RHTA 5FPPA 4C4XA 4L72A 4KJXA 3H2GA 1CEXA 3V1KA 4X94A 5HFAA 3IUMA 5KWJA 3DOHA 4W1SA 1ZICA 4LXHA 4PNZA 5CT5A 1K4YA 1YR2A 4U2DA 3HI4A 2ZYSA 4N8DA 3IVMA 4AZ3A 3WL5A 4DMFA 3B5EA 2RHWA 4GW3A 5ALFA 3VJKA 3M81A 1FSSA 2ONCA 5JD5A 1WOMA 2YYSA 4YK7A 3AZQA 5ALWA 5DLPA 3WK5A 4CIAA 4PO3X 3ZPXA 5EFZA 1CIJA 2J3DA 3TEJA 3C6BA 1VA4A 3F97A 3U0VA 1TQHA 4X71A 1NU8A 4BCDA 2WG0A 1TK3A 2VT6A 5ALNA 4UHHA 3ZLUA 2QZPA 4FFVA 4FBLA 1F0NA 1ACJA 2OCKA 1VKHA 3BE8A 4UHEA 1FFAA 3GZJA 5T4FA 1W52X 2DSNA 3HEAA 1SOMA 4BTVA 1GXSA 5I9IA 2XQKA 2VEOA 2C58A 1AQLA 2C5GA 2XUFA 1WPXA 1GQSA 4E46A 1ODSA 1MJ5A 7YASA 4TVKA 3R3XA 1FFEA 4BB0A 3STTA 5ALZA 2CB9A 2WUGA 3N2ZB 1EDDA 3STYA 3STVA 3VJLA 3DYVA 4HTAA 2AJLI 4X93A 3M82A 3WKBA 4O08A 2GYWA 4UHCA 3BDIA 1ISPA 3WZMA 4V2IA 3M83A 3ICWA 4DIUA 5DYWA 3I6MA 2PUJA 5LZ9A 3SWWA 4OU4A 2CUTA 3H19A 2R11A 3V9AA 4BVKA 3OG9A 3R3VA 1O6GA 5CURA 5AI9A 4X97A 3WWCA 1WM1A 1DT3A 5A7HA 1UZAA 2QMQA 5FV4A 1IZ8A 3C8DA 2RGUA 1XRQA 5AI6A 2DCMA 2VJDA 3FLAA 4ZWNA 3VDXA 4Q3KA 2WG1A 1R88A 1CUWA 1LPMA 1XZHA 2VATA 2WU4A 1W1IA 3OOSA 1G4HA 1H23A 3WL8A 3A2MA 2PX6A 2BUCA 4K5QA 3T52A 5CXXA 4GEGA 4EBBA 5BWBA 5LLSA 2RIPA 4U2EA 4HZGA 1QGED 4FKBA 4PF1A 2K2QB 2Z3ZA 4K6KA 5CT4A 4C4ZA 5LYYA 3EIOA 3WWPA 4Y2QA 4H7IA 4YX9A 1QIIA 1UK7A 3HYSA 2XMZA 4AZ0A 2BFNA 4X92A 5HKBA 4G8BA 2C7BA 3QPAA 2ZJFA 4H7HA 1K63A 4RE6A 2WIJA 1CUDA 2BUAA 1ZIXA 4UHFA 4DMCA 1XQYA 3BF8A 2BGNA 1YA4A 2FJPA 2XUGA 3FSGA 2GBCA 5FLKA 5FDFA 4QA9A 2XLCA 4W1PA 4F5ZA 2NW6A 4FTWA 2HA5A 4L3WA 1PV1A 1XZLA 4BP8A 4BVJA 1LPNA 4B0OA 2WQZA 1CPYA 4BC0A 5EIHA 5K3CA 5HCUA 4Y2PA 2DQYA 3GA7A 4G9EA 4DNQA 4G4GA 1XRMA 2WHPA 4K6HA 1QO9A 1VJ5A 3CN9A 1ZOIA 1XQVA 3R0VA 4KRXA 5EGNA 1YS1X 5AO9A 2OAEA 3ZWQA 3H2HA 3WK8A 4GXNA 5JAOA 1MNQA 3EBLA 2XUDA 3L1HA 1UK6A 1XZEA 4F60A 2ACKA 4BCCA 5LZ7A 4BE4A 2QXTA 5D7BA 1JJFA 3C70A 3VVLA 2WFZA 3RARA 5CW2A 3I6YA 2WSLA 4E14A 1AGYA 4EY4A 4Y2RA 4WCVA 5JYCA 2XMDA 3V1MA 5JATA 1QE3A 5JASA 5LKRA 2VAXA 4MWSA 2XQGA 5DTJA 1J1IA 2P8SA 2QOEA 3B3QA 3NUZA 2GZRA 4OUKX 4UHBA 4EA6A 2O2IA 3R3ZA 3VJMA 1YS2X 2YH2A 4UPDA 5C8XA 3A70A 1ZI8A 3C5VA 3EQ8A 2YXPX 1SC9A 5ALUA 1J06A 1LPOA 1JU4A 1CUZA 5ALYA 4IH4A 2XMQA 5IVHA 3FYUA 1CLEA 1DQYA 2JF0A 4J0IA 5JD6A 3H1BA 4DMKA 1H2YA 3DOIA 1R9NA 2XMCA 2OAGA 1P0PA 4Y2UA 2J4FA 4WJLA 1L7QA 5CTAA 3AINA 2I3DA 3DS8A 4K2AA 2CBGA 2ZJ6A 5AKLA 1ZD5A 1JMYA 1W4LA 2QJRA 3BIXA 3CXUA 3Q8WA 3VISA 2CKMA 3R41A 1AURA 4HRXA 3I6ZA 3STUA 2VTVA 3YASA 1XQXA 3ICVA 4LYEA 2WHQA 1E8DA 4TGLA 2HU8A 2XI4A 3LLCA 5KREA 3TRDA 4EZIA 1EH5A 4EUSA 1QIFA 5AM5A 3FLBA 2PL5A 4F21A 1THTA 2DHCA 5JALA 4ZV7A 3DLTA 1HDEA 3DKKA 3H1AA 3X3HA 2VJCA 3OC0A 4KAAA 4P08A 2QTBA 3K6KA 4EY7A 2HA4A 4KE8A 4KEAA 3W06A 2AXEA 4B85A 2HRQA 4QWWA 1C7JA 3CN7A 1XZDA 1LPBB 3H2KA 1QTRA 5A7FA 3QMMA 2ZVDA 4J03A 5K3BA 1U4NA 4X95A 2OCIA 5DNVA 4FLEA 3QZUA 1YAHA 2PSEA 1TRHA 2H9YA 1S8OA 1LPAB 4MXDA 2XUHA 5EHNA 1X2BA 4X00A 3S2ZA 2GZSA 1C4XA 1MO2A 3C45A 5DWDA 5EI5A 5DTIA 4ZI5A 2HA2A 3W9UA 1GKKA 3G9TA 4EY5A 2QKYA 5ALDA 4MWTA 4H18A 1EX9A 3ZI7A 5K3FA 4ZGBA 3AUKA 5AM2A 4WDRA 4LXGA 5ESRA 4NVRA 1L7AA 2WTMA 3U1TA 5BWCA 2H7XA 4WY5A 5JAPA 4DYHA 1OXMA 3CCCA 4BP9A 1XROA 1CUFA 3HRHA 5I7UA 4CCYA 4Q3LA 1IUOA 3FAKA 2XUQA 3O4GA 1Q83A 3PI6A 1HQDA 1XLWA 2HHAA 3BXPA 1TIBA 4UFNA 1OILA 1ZD2P 3D2CA 3OPMA 3AZOA 3WIBA 3OURA 1QLWA 4N8SA 1CUYA 2PM8A 2BUBA 2WFMA 3AIOA 1R4ZA 4P9NA 4GDMA 2DFPA 1YAJA 1UFOA 2O2GA 1WCYA 2WIDA 3BIWA 1MX5A 4DTCA 4MQMA 3O4IA 4J7AA 4DNPA 5ALPA 4JYMA 2XMGA 2VSQA 1EB8A 1H2WA 4AB1A 1GPLA 1DWOA 1XFDA 2X8BA 3V48A 3EQ9A 5DYTA 2IX9A 2AJ8A 3O4HA 4M0MA 5FOQA 2X76A 3WWOA 3AJAA 3W04A 3WWEA 3WKEA 1QOZA 4BZZA 4DM7A 4BAZA 4G4IA 1UKBA 3I2GA 2UZ0A 5EHQA 1XZBA 1FJ2A 2WKWA 1THGA 4XWGA 4RGYA 1GZ7A 1ORVA 4G8CA 3QMWA 1E5TA 1H2XA 1E8NA 2JGLA 4UHDA 3IBTA 1EVEA 3G0BA 3WJ2A 5ALQA 1BCSA 5A62A 5E4JA 2ROQA 2GYVA 5AOCA 3FOBA 5C8VA 2FX5A 1GGVA 3I2HA 3N0TA 4ETWA 5CXUA 4C89A 3WLAA 5T4BA 4N5IX 4W9RA 4UBNA 4AN0A 3WL7A 2HM7A 2C0QA 1EI9A 4C4YA 4Y7DA 4J0KA 1GPNA 1UOPA 1SCIA 1ZJ5A 4KE9A 3OM8A 4NZZA 2Z8ZA 3G8YA 3BJMA 2PSDA 5ALJA 1DU4A 1AC5A 1UK8A 4CG1A 3H2JA 2WLSA 1QJ4A 5BOVA 4GWLA 2Y2VA 3CCBA 3C6YA 4AN1A 5HF9A 1CUAA 4UFOA 2W22A 4ROTA 3IULA 1YB6A 2Q0XA 3WKDA 5FUMA 3AIKA 2PVSA 3WI7A 3G0CA 5AK4A 2VF2A 3IDAA 1MNAA 4QEKA 4M0FA 3NGMA 5D3ZA 2C0PA 2V96A 3D3NA 1VLQA 1CUXA 5KWIA 3W9BA 4DGQA 3VXKA 1HPLA 3FSGD 3C6XA 1MX9A 4HXGA 2XUIA 4MJ3A 1N8SA 3DQZA 4Q1VA 1ZGBA 2XE4A 1CUHA 4DSZA 1G42A 5K5EA 3G9UA 3JW8A 4DNFA 4OB7A 4GECA 4X3CA 1UXOA 2OPHA 1SFRA 4AXBA 2JEZA 1YASA 2B9VA 5DNWA 5AOBA 4J0DA 4A5SA 1RYYA 5ALRA 5H3HA 1IUPA 3H2IA 3NWOA 5IVIA 1GPKA 2VJBA 5C8ZA 1FFBA 1VOTA 3HACA 1QIMA 3FLEA 3RK4A 4EB0A 4Y2TA 4Y9SA 1YCDA 1EXWA 4UBKA 4IH9A 3QPDA 4X91A 1JKMA 2GBGA 1E3QA 2PBLA 3BF7A 3MGAA 3G02A 3IURA 4XIIA 5K3FB 3G9ZA 3UMJA 4Y2JA 2QUBA 1EA5A 5LIPA 1I6WA 1DT5A 2E3JA 1QIGA 2XB6A 4OSEA 4QLAA 5SYNA 2OG1A 2WFLB 5ALMA 3FVRA 3LS2A 3QVMA 4UBMA 3KWFA 4AX4A 4B9AA 4ZREA 1ZI6A 4H7JA 1SCQA 5AKHA 3SX4A 1H22A 2Y1KA 3KOOA 1HL7A 4Z49A 5ALGA 2CMFA 5KBYA 1PJAA 4UBLA 3WA6A 4F0JA 2QM0A 2ZYRA 4I4CA 1HLGA 4IHAA 3RM3A 2V97A 3KDAA 1ETHA 3HJUA 5AKJA 2WUEA 2PSFA 3T4UA 5AOAA 4Y2XA 3GUUA 3WKAA 4B82A 2ZYHA 2VT7A 2HL6A 3DKRA 2QJWA 5LKAA 1DQZA 1A8UA 4C88A 3ILSA 2XMRA 2DR0A 4OB6A 3IUQA 5IKXA 2WILA 5D6OA 1WB6A 1VE7A 5AKIA 4L9AA 2RI6A 2BCEA 1E66A 5AKGA 2AJCA 2HRRA 4BDTA 1P0IA 5IVDA 1EINA 3MUOA 2I03A 1BCRA 1CUCA 4OCZA 3D59A 5F4ZA 3C5WP 2VJAA 5CH3A 1VXRA 4QDOA 1J07A 1MPXA 3PDCA 1CUUA 4BTLA 1CVLA 5D3KA 2HDWA 2XQFA 1CR6A 2X5XA 3LP5A 3G9XA 4BAGA 1L7RA 4WFKA 3RKSA 2DHEA 1VZ3A 5JANA 1AX9A 3C6ZA 1W6RA 3KSRA 1QIJA 1WHTA 4QLOA 4ZV9A 1N5MA 1ZIYA 4FLMA 4BE9A 3GBSA 1CQZA 4B81A 3IB3A 4DLNA 4QNNA 1QO7A 5LZ8A 1CUVA 5AM4A 4JEIA 3H17A 3K9BA 4AQDA 4KYVA 2JGFA 1QONA 3AFIA 1MAHA 4X6XA 1P0QA 3I2IA 4FWBA 4FOLA 1B41A 5I8PA 2JGIA 1T4MA 4OD0A 5AKYA 4WDQA 1IMJA 5AK3A 5A6VA 3C87A 3WYDA 2D5LA 4P92A 1BEEA 4J3JA 4EY8A 3DEAA 2I3ZA 1ZGCA 5AM0A 1WPRA 3HLKA 4AO8A 4NMWA 1UKAA 4KACA 1DWPA 3QYJA 1JI3A 2HFKA 3OTQA 3FCXA 1EDBA 2AJDA 4E15A 2PPLA 1LBTA 1XKLA 5ALEA 2WTNA 2XUAA 3TJMA 4AO6A 1MN6A 5LZ5A 4U2BA 4GLBA 1E89A 2OGTA 1YA8A 1AUOA 4FFWA 1BEZA 1Q0RA 3KD2A 2Y6VA 5AK5A 5AHXA 1BN6A 4CI9A 1N5RA 1XQWA 4IO0A 4A23A 3BJRA 1CUSA 3F96A 4UBJA 4PV7A 2DHDA 4BC1A 4FNMA 1YB7A 1CUJA 3AILA 4PSUA 3DNMA 4H7EA 1XZFA 1MX1A 3Q0TA 1XZJA 2O2HA 4MYDA 5CBKA 5SYMA 3D5EA 2QS9A 1TKRA 4BZWA 4FNGA 1KEZA 2JGEA 2HFJA 3GROA 4HRYA 2XUJA 3ESCA 2WG2A 3UUFA 5DJ5A 1M33A 1Y37A 2V98A 2ZSIA 4X6UA 1G66A 2QRUA 4RPCA 5HF5A 4YASA 1N1MA 5A7GA 1A8QA 4B0PA 4AMZA 2B61A 2GYUA 5IVKA 1BU8A 3IA2A 2OGSA 2CZQA 3P2MA 5LZ4A 5AKZA 1Q84A 2D0DA 4X85A 1PFQA 4UBOA 1CRLA 2AJBA 1IUNA 5T4EA 3C8HA 4OYYA 1ZI9A 2G5TA 2WIKA 1EDEA 3RLIA 5AIBA 2JEYA 3O95A 5AI5A 1GQRA 2WJ4A 2XQIA 1QIHA 1RP1A 1MU0A 3HXKA 1XZAA 4HAIA 1FFCA 4PW0A 4B7ZA 4BBZA 3FVTA 5AIAA 4OB8A 3WK7A 4J0GA 1K6EA 2HA0A 1CV2A 1Y7HA 1LNSA 1LPPA 3K2IA 4HVTA 3EQ7A 3WYNA 2XT0A 4IH1A 1JMKC 2JIDA 1XZCA 1XRLA 5AH0A 4NS4A 5E4TA 1WB5A 5EIEA 3PFBA 1F6WA 1EB9A 2WJ6A 3G0DA 4PQEA 5C81A 3HZOA 1K5PA 5JZ9A 3WQHA 2VAVA 4DMHA 1QIDA 4CG2A 1BN7A 1FFDA 4DSAA 3WMRA 4MQLA 4H0CA 4CG3A 1HKHA 2JGJA 3STWA 1C7IA 1XLVA 3WZLA 3ESBA 1ACLA 3WWDA 4BVLA 3SK0A 1UK9A 1EK1A 2EDAA 1A7UA 1DX6A 3ZV7A 5HQ3B 3H18A 4GHWA 4B9EA 3PE6A 4Q82A 2JBWA 1R9MA 3QITA 1UWCA 2O7RA 2R8BA 2WHPB 5BV7A 5E4YA 4KAJA 4QWMA 2HADA 4ZRDA 1SCKA 4WFJA 5JAUA 2I78A 3FYUB 3V1LA 5AM3A 5JADA 4W63A 3D2BA 3M3DA 3TGLA 1XRRA 2BJHA 4QZVA 1CUEA 4U2FA 4S0XA 4A16A 2WIGA 2QUAA 3QBJA 4QDXA 2Y6UA 4UUQA 4XJVA 3DDUA 1RWQA 3L1IA 4H7KA 5FXMA 3VKFA 4ARAA 4ARBA 3HABA 4JUIA 2ZSHA 5AI0A 5HKAA 5AJHA 2VA9A 2ECFA 1BE0A 2H7YA 3R3WA 4C01A 3G0GA 2PSJA 2OCGA 3SC2A 1R50A 5E2IA 1K8QA 5FRDA 1X2EA 2IIVA 5HF6A 1ORWA 2FJ0A 2QR5A 4CCWA 4MEBA 4MEAA 1ODCA 5EIAA 3KXPA 1AMNA 1USWA 4KE6A 4EY6A 1JT2A 4BRSA 5ALKA 2JGKA 1Y7IA 4G9GA 3PFCA 2QVBA 1ZJ4A 1R1DA 4KAFA 2C5FA 3I2KA 4B83A 3IUNA 3GFFA 1CUBA 3WK9A 1GKLA 2WUFA 1CFJA 4BDSA 4X90A 5JIBA 4U2GA 3D0KA 2W6CX 4LIPD 1DTEA 5CMLA 1MAAA 1UOOA 2GBIA 1BROA 5FPQA 3DL4A 3UUEA 2WIFA 5ALIA 3WK4A 4JH0A 1LBSA 3DD5A 3O4JA 1DWQA 4JYPA 3E1GA 4LYDA 1Q0ZA 1EK2A 4Q05A 4KR0A 5IH7A 3ZLTA 2HU5A 3R3UA 3WL6A 2B4KA 2CEKA 4N5HX 4DNOA 3PICA 4UFPA 1MT3A 3EF3A 1U2EA 4U2CA 2WM2A 4K6GA 1VXOA 3GELA 5JAHA 5K3AA 1AKNA 1NX9A 1F8UA 4FBMA 3FYUC 2OQVA 4WY8A 1G5FA 5ALLA 4M0EA 4KE7A 3NOXA 2Z5GA 3I1YA 1Z68A 3R40A 4FMPA 4Y2VA 4YPVA 5T4HA 2VQ6A 1LPSA 2PU5A 5K3DA 4QE3A 2H1IA 1UKCA 4TPKA 1XZGA 3W05A 2GBFA 1T2NA 5JZBA 4JNCA 3JYHA 4HXFB 2XDWA 4B80A 1DX4A 3H04A 3V1NA 3WJ1A 4LKOA 2PSHA 1UOQA 4W1QA 4OU5A 5HK9A 3FCYA 5ALSA 2BGRA 5ISMA 2WHRA 1VA5A 4J0JA 1H2ZA 4H77A 4UBIA 2IITA 3WKCA 2H7CA 4IQ4A 5AKKA 1VZ2A 3D4LA 3BWXA 1F0PA 2PUHA 5EHZA 5ALXA 5CH5A 1YSCA 1BRTA 2RONA 1QFMA 1QFSA 2WUDA 3A6ZA 5ALTA 3KWJA 2RAUA 4RE5A 3D7RA 4GI1A 5CT9A 4Q3OA 5ALOA 1O6FA 1QZ3A 1QTIA 2LIPA 5AICA 2J4CA 1WHSA 2ORYA 3A2LA 2CJPA 5HZGA 3O0DA 2PKYX 4XX1A 1ZD3A 2ACEA 1W75A 2HA6A 4Y2YA 1XZIA 4LXIA 2G5PA 1IVYA 2G4LA 1CQWA 5LZ2A 5HQ3A 4QDTA 3I1IA 1LZKA 5AK6A 5AI8A 4BCBA 3IUJA 1DINA 4LHEA 5CRIA 2OQIA 1CUIA 1LLFA 4B84A 5CT8A 1TCCA 5AI4A 3BL8A 3PF8A 4CFSA 1JJBA 4AMYA 3I2JA 3QH4A 3S8YA 2Z3WA 4EHBA 4C6HA 4Y2SA 2HIHA 4J0CA 4X7BA 3W2TA 3ESDA 3HSSA 2JGMA 3DJYA 1GT6A 1KU0A 2Z8XA 1D07A 4PSDA 3JWEA 1ODTC 2BKLA 3FYTA 1HBJA 3O9MA 5HFNA 3F67A 5HF8A 5JZSA 3HC7A 5JD4A 5AKEA 4PSCA 2EEPA 2DQZA 3LIPA 3E0XA 4H7DA 5LP1A 2XMBA 5A2GA 1OCEA 1A8SA 3I2FA 2ZJ7A 3PUHA 1XRNA 1UT6A 1EHYA 1KU6A 3ANSA 3L1JA 4KRYA 1A88A 4XVCA 3AIMA 3F9CA 3DCNA 4INZA 3E3AA 1E8MA 4HXEB 4I3FA 5FP0A 4OYLA 2Y2UA 5A71A 4P93A 2XMSA 1R3DA
chains in the Genus database with same CATH superfamily
2O7VA 1J9GA 1TAHA 2ORWA 4MS1A 3F5SA 1LDBA 2XBLA 3BKWA 3F3KA 3T7KA 4BGDA 1JLMA 4FHZA 3NTRA 3GLVA 5K4AA 4QOFA 2WICA 3W8EA 2WDZA 1P31A 3M4YA 3T0IA 4ZOQI 2XNKA 2M1ZA 5CA0F 4QM7A 1DC3A 2WA1A 5KNCH 3U9LA 1XTSA 4J3FA 2CXPA 3GNLA 4FLFA 3RC1A 2C2XA 3ZJUA 3TI9A 3CWCA 5E8JA 1JFRA 1H69A 3KLNA 4Q02A 1E2PA 1P9WA 3Q6IA 4HRAA 3ZK8A 1ZKMA 2LZ0A 5TE9A 1OSNA 1TLTA 3AY3A 1XF1A 4HBGA 1ZCZA 4IYJA 4Q3DA 3ZDEA 2NZUG 5F7XA 2ZXEA 1QH8A 4CT4B 3L3BA 4Z2YA 3OQ1A 2AA3A 1OLSA 4BLTA 3FM9A 2PUBA 1GILA 1X92A 1G7RA 4NBSA 3L01A 3OPXA 1RXUA 3R3YA 5JSYA 4CMKA 2HA3A 4C4TA 2YRFA 4L5BA 1BS9A 4C30A 1LLQA 3HS3A 5AVQA 3K1ZA 2ZSKA 4OJQA 5CH8A 3ZD6A 3ELUA 4BRZA 3WA7A 1FQJA 4ZZ0A 4L76A 2EDCA 4EZEA 2AH5A 4MYSA 3Q3CA 3PUIA 3QVGA 1GCOA 4M1YA 1A69A 4L08A 5AKXA 3UOGA 1HTWA 5I7RA 4DIDA 3HKBB 1E2HA 2L17A 1NWHA 2YNMD 4WGGA 3FLMA 1J5EB 1DHRA 2D7CA 4KHPB 4Q9AA 1ULHA 1H5NA 1FVOA 3D4IA 3F4LA 5GM1A 5JPIA 4F72A 5ALVA 3LW8A 2BJWA 2O5VA 3AJ9A 4ARSA 3QY9A 3EPJA 4KR6A 1ZHHA 3NTUA 2YUIA 5DYYA 1OBCA 3UY4A 1X7WA 1B76A 1Z33A 2ZWVA 4B5KA 4FR5A 2ONKA 4U7FA 2XLBA 2VTKA 2I2AA 4PC7A 2C3PA 5LC1A 1MTZA 2WM3A 2QPAA 3GLIE 4B6OA 2HJRA 2XQJA 1YCGA 3FGPA 3CF0A 3GFPA 4TKUB 4BO1A 3JY6A 2HJWA 2VDLB 4X45A 2AUMA 2AXNA 5AJTA 3OETA 3FWHA 4XD7A 1NUUA 4RL6A 1MIOB 2A9QA 2VZLA 2QAGB 2EHJA 3IP8A 5CA0A 1ZK4A 3EEFA 5TQVA 3Q7QA 1QAQA 4BPRA 1DBIA 3ILHA 5JWRA 3IEUA 2JFHA 3O8NA 3E4DA 4M1QA 2YJGA 4L8GA 1QWOA 2VEDA 3LH5A 2H1WA 5B55A 3AVWA 3C3DA 2ES4A 1CKEA 2BBOA 2G63A 4CHGA 1JIUA 3G89A 4ZAWA 1U7PA 2PEZA 3EF1A 4OUDA 2HQSA 3DEJA 1RABA 3JQ9A 4FXPA 4ZO7A 5ELLA 1E7SA 5BV0A 2OHIA 2RGAA 1W2GA 1Q1BA 3M7IA 1C1DB 3GRYA 4W9NC 3BDVA 3GAMA 2B4AA 3K0AA 2AZMA 1P4RA 1UDBA 3R7WA 5KVSA 1I7NA 2YTZA 4N0MA 1TCBA 3USES 4QOSA 1B6GA 1CZOA 1S3SA 1NF9A 2IYWA 2J3QA 2QTLA 4PFQA 2PGNA 4X7RA 3ESAA 2C5LA 3WIVA 5D1HA 3VU9A 2X86A 1EBFA 4JJKA 1P80A 1YJAA 4JC8A 4UNIA 3VR0A 4YT4A 2BFBB 4S1WA 4HNQA 5LYJA 3RTCA 4IDQA 2VSFA 5COAA 4EYKA 4R3WA 1S1CA 3I62A 1CRZA 3KAKA 4JP5A 3AP2A 2P3QA 4WW0A 1Y5LA 3PE4A 4BJ6A 4ZXFA 4AY2A 4XQGA 5L3QB 5T8KC 2HU7A 2J9YB 4N0PA 1G17A 4WBNB 1F3LA 4N8EA 5CITA 4L28A 5FO1A 2JDID 4BATA 3HB1A 5LP6C 3ADCA 6YASA 3OCZA 3INTA 4GRDA 1BVYF 2AHOA 4X1KA 5HMMA 4CEIA 1WUYA 2HQOA 4AMBA 3JQGB 3GR6A 2ZW9A 3TE6A 3V7YA 3REOA 4DDMA 1JTFA 5JBQA 3PUYA 4H3KB 1XLUA 4J0QA 3L0YA 1O8CA 1OZ0A 5JFOA 4JL6A 1VLLA 1U9IC 2G9RA 1SU6A 1FRFS 2ZR8A 2A0UA 3RAFC 1GGHA 3A4TA 4QTXA 1N0WA 3U48A 3HVRA 5F9HA 2XVZA 1K75A 1GM5A 2NOAA 2RCYA 3T5MA 3VOAA 4MQ6A 2RHTA 4UUMA 1ZIDA 1P61B 4XOUA 4MP3A 4L72A 5FPPA 2X8AA 3UUWA 1H94A 1W96A 1Z4LA 4C07A 2P2NA 2QDXA 3PNVA 3QFTA 3CEHA 2ZYAA 5BURA 1CEXA 2NYAA 3V1KA 5F5XA 1SURA 5B1EA 2ZCJA 3SKXA 2J3IA 3TLJA 3KJZA 1O6BA 4PLPA 1Y8QB 1HRKA 4IF4A 5BOSA 4JBIA 2AX4A 4NHOA 4DGSA 2RSLA 1ZICA 1CFZA 4GS5A 1B6SA 2SCUB 3EPKA 3EIXA 3N6RA 4LXHA 4QELA 5EVCA 1PFGA 4YR7A 1N36B 4PZCA 2FCAA 3DVSX 1U2GC 1H1TA 5ADUS 2D7DA 1Z2AA 5CX4A 3KLPX 3MA0A 1QFJA 2Q41A 3P0EA 2A2ZA 4YT8A 1FZTA 2VK4A 5DGTA 3TEMA 2Q1SA 5EIBD 3HL0A 4ZVQA 2WWVD 2QP9X 2R8OA 3MERA 4G0OA 3WGOA 4R2KA 2X1MA 4JC4A 5JAMA 4AZ3A 1XA4A 4C0BA 2BEVB 2ORED 4EG5A 2KJQA 3GFRA 3LC7O 1RXIA 4P5DA 2PNJA 1F8FA 5CFLA 5ALFA 3IEVA 1EWVA 3UV6A 4LEIA 1EHIA 1OU0A 2IA5A 4CKBA 4JVNA 2WRZA 3Q8XB 4QEZA 2FPPB 3NKFA 4N12A 2XT9A 4ETNA 1FSSA 5I3CA 3HXOA 3A1CA 1JYEA 1WOMA 3NHLA 3IA7A 3G0HA 4C7OB 4R9NA 2OG2A 1SBIA 4L95C 1T35A 5ALWA 4XWOA 5BT8A 4ND8B 2YYZA 3N5CA 5BN1A 3R9WA 2ZJ5A 3PHLA 3WK5A 4AKEA 2X9GA 4V0RA 1HDOA 1ZMXA 2V7XA 4JXXA 3H1GA 5C32A 3GMIA 4DR5B 5E1MA 2W7TA 3S5JA 2IWRA 1CIJA 1XD2A 4ALKA 3GLIA 1FYDA 4RM3A 1JH8A 5BR1A 4KVAA 5DVZA 3THSA 4EATA 3X1WA 3UMMA 4LG1A 4MDYA 2OCYC 1S3GA 2ZAYA 1Y34E 3C3CA 4HWOA 4A4DA 3WFIA 3NUQA 3OQNA 4LDAA 1UQRA 2QZSA 1L8XA 1NU8A 2BM8A 3EHEA 3ISVA 4NK4A 1F8YA 4X1IB 5KEIA 4NQRA 4V0OA 1E4EB 2H9IA 2Z3VA 1NKVA 1A3CA 2JLBA 2WG0A 1M1YB 3ITDA 3VR4A 4D74A 3MM4A 5EZQA 4E33A 3DR3A 3ZIAA 3QSYA 4DKXA 1DRJA 2CVFA 5B1SA 1KSJA 1Z22A 3EOZA 1Q6ZA 1EE2A 3EDOA 4EVIA 1OGJA 1PHPA 2CUKA 3SHQA 1F0NA 3U3RA 2AMVA 3PNQA 3EIQA 1ACJA 3F3YA 4IBOA 4D8YA 3LUCA 3CB2A 2WZQA 3RLFA 3ZHQA 1ZR4A 4NCNA 1MVLA 2F8MA 3OMLA 2NTYC 2ZIXA 3PJGA 3V4OA 1YRYE 3NV7A 1V2HE 3DUFA 4R2LA 5BN5B 2QZ9A 1JILA 2GK6A 3W9SA 2K87A 3LUDA 2FRDC 1J97A 1XU4A 1M7HA 1HDIA 2COKA 3CWQA 3HJFA 3PNLA 2A0WA 3DFMA 3HEAA 4PANA 4XLLA 4PN3A 3IMFA 4IZ6A 3KSBC 1QS0B 2HRCA 4G5OA 2C04A 1K6MA 4X61A 4ESOA 2IU0A 4JKYA 1GXSA 1RHJA 2I66A 2CHFA 5AWFC 2AZ4A 3CW2A 1G20B 3N3AC 2D62A 1Z08A 2P2SA 5KDLA 3ZG6A 3PNPA 2D8AA 4KX5A 1N75A 3GGSA 2QVGA 3LA6A 4LJRA 1XKXA 2LRHA 4RSGA 3A4NA 2PUGA 4XYBA 2C58A 4RA6A 4DR6B 2C4TA 3OZGA 5KWVA 2EFJA 3UJ7A 2W6JD 2QZ4A 1WPXA 2ZZMA 1GQSA 3BFPA 4PU0A 4RKWA 2EJVA 4H31A 3DHYA 4WNIA 3L46A 1ODSA 3FZNA 2YWBA 1XDWA 1GTVA 3TL2A 4QYIA 4PX2A 3R3XA 4PAQA 4TVKA 4EF5A 4KLNA 3FTFA 1T9CA 4PR0A 4AZSA 5IAGA 2CB9A 1R6VA 2OY0A 3UAWA 4OHYA 1E2MA 1UOEA 1QNLA 3L6EA 5FOXA 2ST1A 3THRA 2IE0A 5FFNA 4JOSA 4IGIA 3STYA 4UMEA 2WMOB 1NLZA 2HSWA 1T0PA 2OBLA 4UNSA 3SM9A 1BA2A 1VBKA 1XVAA 4LGMA 1VMAA 3LBFA 3OX4A 2IGBA 2GPNA 4O2RA 1YULA 5G0WA 4TL7A 2VHWA 3TFOA 1H8EA 3AXTA 5DSXA 3LXMA 4GU5A 1NONA 2SICE 3PCRB 4P3OA 3GRRA 1L5HB 2Q5FA 4RACA 5DTMA 5BYKA 5GM2A 3B9BA 5IPFA 4MV4A 2X0DA 3W8DA 1CK4A 4KOEC 2PBRA 1RAFA 1N3YA 3VNVA 1E1MA 2OM6A 4IXWA 4LQLA 4UHCA 1QYIA 2ZYTX 4R1MA 3M33A 3WZMA 4DB2A 1SBYA 4V0QA 3M83A 3P2YA 2E4VA 4EDHA 3E70C 4DIUA 3CV3A 2P9ZA 1ULTA 3PYXA 1V39A 2REBA 5F51A 3R77A 3UTCA 1PL6A 2HK7A 4QFMA 2IOYA 2X23A 3ENKA 2PUJA 2WKPA 2WWFA 4GYKA 3ZJVA 4FGUA 2VPTA 3FPKA 4I55A 5G1OA 4G0MA 4KPUB 3SWWA 1WD5A 1JEDA 4TLBA 1ZVJA 2CUTA 4RH1A 1BO6A 2R11A 2D1RA 5CK5A 1A9SA 4I4LA 1L2TA 4UVEA 4W7IA 4EECA 1NM5A 1P39A 1PWZA 2EBHX 2VPIA 2HB6A 3OG9A 1WWKA 4C76A 1L4LA 5E9AA 3ZHXA 4YHHB 2H2WA 1VP3A 4IDGA 5CURA 5AI9A 3KQLA 3GCDA 1GWNA 3OJ0A 1BH6A 2R5WA 3R23A 3Q12A 2W8BB 2HXGA 3NAZA 1EG7A 1JQJC 5FV4A 1G18A 1NUAA 3BWBA 5CAEA 1KK3A 1D0SA 1UDWA 3T3DA 3H5OA 2VQEB 3W3AH 2BEUB 4KO4S 4UD6A 5AI6A 4C4PA 2VJDA 4EFDA 2B6NA 4ZWNA 3NS7A 3N2KB 4Q3KA 3T6KA 5EE1A 3D1LA 2KBFA 4L78A 5LMZA 1FNSA 2IZZA 2W6OA 2E18A 2IDKA 3IDFA 1QCCA 1LPMA 4IIVA 1OLUB 5JVDB 5IJZA 4DLWA 2PJRA 4M7OA 2VATA 3U3ZA 1L7DA 2G1AA 4LRUA 1W1IA 1NI3A 2CFTA 1G4HA 4ZANA 3ROFA 4A92A 2QMZA 2R66A 4NE9A 4REQB 4D41A 2PX6A 1ZBQA 4KUGA 2BUCA 3EGWA 3BSSA 1BSVA 4O4HA 1IUKA 3T52A 1IULA 1SCDA 3N28A 4BNIA 1PTJA 2D7JA 2FEWB 3KCNA 4XGQA 4EZBA 3ND7A 2OO3A 4CF3A 4I08A 3KZ1E 3AVPA 3NETA 8AT1A 3VC2A 5JLAA 2GD6A 1ELOA 3HU2A 4NMLA 3WDLA 3RI3A 2DBVO 2BJVA 2FR8C 1FPMA 4UQOA 4ERNA 2Q9BA 3H4IA 1L5YA 5L3SB 1ZM3A 1W9MA 4TYYA 3T7SA 1GPBA 2P2GA 4BUZA 3O92A 4FKBA 4MIKA 4PF1A 5K6RA 1Y8AA 2HK8A 2HHHB 4FFBB 5KHOC 1QP7A 4IIGA 5TT0A 4QGSA 5JPCA 4C4ZA 1A72A 3EZYA 3FKSD 3LUGA 2P0YA 4YP5A 3VTAA 3AY7A 3I12A 4G5SA 4RA9B 1U11A 4Y2QA 2XRZA 1LI7A 2XCLA 4YX9A 2X8WA 2VQDA 3HCCA 2G6BA 1CRPA 3KYBA 1EM6A 1QVWA 3LXUX 4OGFA 5F7OA 3GVIA 4IJWA 4KQIA 4RQTA 4X92A 3BX1A 1YZVA 4TN5A 1ZOSA 2KI5A 4YO7A 4IJ6A 3IAM1 2BD0A 1K63A 2O0HA 4AQYB 4O29A 1II8A 4RE6A 4RC9A 1OJLA 1U90A 3DTVB 3TD6A 2BUAA 3FVWA 3V46A 2E4AA 4X5OA 5H81A 2C5SA 2IYTA 1FE8A 2Z1DA 2A7QA 4BNXA 4EQ6B 2BR3A 4NQZA 3FZEA 5ITSA 3NQ41 4RAQA 1BKSB 4N65A 2WYOA 4KSBA 1T4BA 2GAAA 4GE3A 2OGUA 4O33A 4C78A 3MS2A 4UNQA 5FLKA 1KE1A 2OD2A 2RGRA 5FDFA 1PRYA 1GUBA 3JQBA 3FRJA 1CY1A 3CC8A 4GI2A 1OI7A 3FDXA 1PF7E 4FYXA 1KFKB 2NW6A 2ZDQA 1AA9A 2KQUA 2YHBA 1KEUA 3TSOA 2H48A 5C34B 3PLRA 2VJLA 2P3LA 1P75A 3MAJA 2F1OA 4Y18A 4M8LA 5B58C 3K5IA 3L7JA 1KAEA 2J59A 4HD8A 4IFIA 1LPNA 1OHHA 3P2JA 4OQ4A 1OH6A 2QUZA 3B13B 5GV8A 4RMGA 5K09A 3DE7X 1EA7A 4F6RA 5C1OA 3VO2A 4RTRA 1XMJA 1TTPB 1CIPA 1NPDA 2WB4A 5AQEA 5HCUA 2MCFA 1PO7A 4DNQA 3ICOA 4G4GA 3VFDA 1WDMA 1AK9A 3KAPA 1FW6A 2OFFA 4K6HA 5FWAA 2GPWA 3HVIA 1VJ5A 1BVRA 2RHDA 4FOPA 2H1LA 4ZOLF 4BKPA 4YJFB 2JC3A 3CN9A 4CM9A 5HBGA 1Y8QA 2EKZA 2XYPA 2X6QA 1IDN1 3PGXA 4YMHA 2DHQA 2PZFA 1J5XA 3LKVA 3NH6A 4KYTA 3GLHB 4INPA 3N7UA 2QF7A 2CKDA 1Y7PA 1YE5A 1DDOA 4D9BA 5FAXA 3VHRA 3V2UA 4ZIRA 3J7TA 4F71A 1G7TA 3K72B 3R0VA 3PTAA 1T2AA 2XE8A 4U7TB 2B5VA 3ZWOA 3LHSA 4L07A 1VG9B 2JGAA 1TMGE 3PTLA 4GM4A 5HM8A 4OP3A 3TPFA 2OAEA 4QODA 1E1YA 2N42A 3MG9A 5KOHB 3H42B 4L7QA 2W6PA 1PJRA 2FMUA 3MOSA 5DM70 2PTHA 1VDMA 1MOZA 3R7FA 1NF2A 1Z36A 3K6JA 4HG2A 5FA8A 2C96A 4IXMA 3WK8A 2G09A 1HZZA 3LBHA 3NHAA 1E20A 1EM8A 3I76A 5B1IA 4MDEA 3E3OA 3D6UA 2ZIXB 3EFHA 3IMCA 1U28A 3ZY6A 4PPQA 2FDCA 1ZG3A 2O14A 2O0KA 5L4LA 3K0FB 4DUGA 1AT1A 3ZV6A 1RJFA 2G9VA 5EERA 4IHQA 2XCUA 4QXRA 4R84A 5LZ7A 4D5GA 5B3JA 3URKA 1XP8A 2AOVA 4M21A 2IEIA 5CPBA 5TJHA 5D7BA 1JJFA 1ID8A 3EEQA 2RHJA 2CVZA 1OTXA 3C70A 3VVLA 3TECE 1WPGA 2BFBA 2PZMA 5CW2A 1N4AA 1SUIA 2WSLA 3U4DA 5IM5A 4E14A 1M2VA 3E1SA 3IQWA 2C9CA 3I01A 4N1AA 3AP3A 5E7QA 5EUMA 4EY4A 4RTMA 1DX9A 3SEFA 3WS7A 5JYCA 1M5RA 10MHA 2ZETA 4TTSA 3V1MA 4F2GA 2VVTA 1LCIA 3C14C 3EZLA 4X1IA 2EC5A 2NZVG 4F8JA 2C4VA 1EXDA 2BLLA 2XQGA 4PG4A 4F5EA 1VB5A 3P9XA 2QOEA 3TTTA 4QQRA 4F7WA 4HNSA 1NWCA 4HGQA 2CL0X 2GZRA 3BSYA 3QMPA 3WLMA 3EG5A 4EA6A 1WSDA 2O2IA 4B6QA 2GARA 5CFOA 1Z7EA 1JG1A 1OFUX 2G06A 1D0VA 2GKSA 2YZ7A 3RRFA 2Y1EA 1T8YA 3CX7A 5C80A 3SX2A 3MINA 2EFDB 5I4BA 4D43A 1VKRA 4M9CA 4DA7A 2C97A 2IYYA 1N7HA 1SVUA 4WL0A 1OLXA 4EJMA 1E6WA 5LUBA 2BMJA 4PAOA 3C5VA 2DFVA 1QF6A 1PUXA 2AC7A 2YXPX 3ZOZA 3H8JA 3HKCB 1CUZA 3GYBA 2PMEA 3UHJA 2G77B 3BJEA 1SWWA 4YRIA 4RY0A 5DGCA 1UBJS 3K0HA 3P2IA 5IVHA 4FS3A 4IDHA 2ZIAA 4FDVA 3LGXA 4M99A 5FLYA 1M0EA 1CLEA 2ON6A 3EW7A 3IFSA 4JJ7A 1P18A 3QBEA 1FTSA 3H1BA 4HEA1 1PYDA 3ZI7A 2SNIE 4DY4A 2A86A 2QEQA 3DOIA 3RYCB 2XMCA 1E63A 2OAGA 3UJ3X 4BMCA 1I9CA 1OZFA 2GXSA 4CM6A 2NMVA 3GC6A 4K46A 1M1NB 3CZAA 3SC2B 5BUQA 4XCXA 1OQAA 5IXJA 2IWHA 2IH5A 3MTQA 4DT1B 2IRWA 3QNUA 3LE8A 2ZTLA 2MYUA 4V3CA 2CBGA 2V03A 2QA5A 1OPXA 1WEHA 2UUOA 3DT9A 4TL6A 5TARA 5AVYA 1M2FA 1T4GA 4FFDA 1UINA 1TQ6A 1UJ4A 4HDSB 1KZGB 4Q1DA 2W93A 3HCBA 5KJ6A 4HRXA 3GRAA 2NO1A 3E9DA 4OFBA 1VLMA 2J85A 3EASA 3Q88A 3E9RA 3I6ZA 4TWIA 4DDTA 3BUSA 1IZ0A 2NU7B 4LRWA 1UQUA 4FZJA 4LMBA 2G5GX 1RWNA 2I22A 4EKGA 4PNEA 5LP6B 5K8VA 3YASA 2EW2A 1X1RA 2FEPA 1XQXA 5JCPA 3T99A 1P77A 1E8DA 1PGJA 1QU3A 1DIGA 1QKIA 2ZBGA 4BWFB 3LLCA 1QH0A 3PUKA 4XVRA 3SHFA 3HYNA 5KREA 5H3CA 4EL5A 3L8DA 3GJRA 1ABEA 1SM4A 3TKYA 1EH5A 1GRCA 1X42A 1RE0A 2A30A 3KOXA 3BXGA 3UC9A 3VKGA 2OO5C 1QIFA 2C9DA 3L7NA 3NTLA 5AM5A 2JIBA 4UM5A 4DVJA 5AVUA 3PD1A 3PX2A 1UL1X 3HMQA 2DPGA 4JOQA 4OK3A 4UXJA 1HE1C 1KVRA 2DHCA 2WW8A 5TVGA 3T9CA 4ZYWA 3DLTA 2I62A 3CR8A 3KKNA 3OCUA 4HX5A 4UCXA 3ND8A 4BRUA 2NO4A 5IZCA 1T1JA 3LYLA 3DCIA 5IT0A 4XLZA 3RIGA 1QUFA 3IX7A 3L6UA 3OCJA 5HIMA 3NIWA 3E5HA 2PQ0A 3OC0A 3PC2A 1PG2A 4KIFA 4BNNA 3K0CC 4EHHA 5P21A 3IS3A 1UZMA 4Q4JA 2GZMA 4G4SO 5BOSB 4UUNA 2BEKA 3NNSA 4HGRA 3T3EA 1KXZA 3ZTTA 2QB5A 1V9LA 3AJ8A 3BERA 1MAVA 4CUZA 1CR2A 2OT3B 1X38A 3CEJA 3CCFA 4CKXA 5A4MS 5HXAA 1HX7A 2IPMA 1GITA 4Q24A 1ZEMA 1JKJB 2WTAA 3FTNA 3GBVA 1R6DA 1ZCFA 1RKBA 3A8TA 1LPBB 1BXRB 1GV1A 1QTRA 4N5NA 1FVXA 3CH6A 2QIPA 2ODWA 3E9EA 5KSOA 1A9QA 1PZEA 1U4NA 2CLOB 1QHEA 2JANA 2ZRJA 3UBTA 2B98A 1TJYA 3I3SR 3TGPA 2D0IA 3PITA 2IS2A 1YAHA 1QH9A 2EKBA 2ZJYA 2X9QA 3E4CA 4MVJH 1LPAB 4UPVA 3DZ8A 5ULLA 1U3VA 5AUPB 1X2BA 3S2ZA 1QQBA 1YBFA 3BRWD 3C1UA 2YFYA 1W59A 3R74A 4MMZB 2GHQA 5AVJA 4IDBA 3U3OA 2OC4A 5FLEX 4KN6A 4UU8A 4K0RA 3BWCA 1MO2A 5JNWA 3C45A 1IN6A 3AJRA 1C81A 2XGGA 1GFZA 3QTTA 3W9UA 4Y1RA 4J2TA 3CEPB 4QUHA 1CS4C 3IO3A 4MQ5A 3RTEA 3H9UA 2QKYA 3CB4A 3VI3B 4JT2A 1JU9A 4TMXA 5E8RA 3SYNA 3TL6A 4YA6A 3WFZA 3J81k 3PTZA 3VDRA 5KNDH 1WRBA 1Y1SA 4H18A 3QU9A 3QA3E 1R0BA 1SELA 2P6MA 2ZIZA 3KZOA 4TMTA 4X8HA 5K3FA 3AM3A 3PRHA 4OY3A 2C2KA 4WDRA 3RDPA 3TUJC 4BQSA 1C30B 2CLDX 2VQ3A 4CU5A 3NH9A 4NVRA 2ATVA 1JZSA 1SB9A 2CN1A 2BM9A 1B0PA 2NU6A 2P9QA 3C3PA 4NJMB 3A4IA 3AFMA 3H6GA 5FUXA 3O7MA 3SHWA 4DCPA 3I0MA 2R751 1U3FA 4P0QB 5BSKA 5JAPA 1OI4A 3VPCA 3MLBA 4EJ6A 5JS6A 4BRWA 1BYUA 5K4HA 1WV0A 4G5FA 2P27A 1FLNA 1TQ4A 1MOSA 4TRJA 1Z4MA 5G4KB 1U8XX 3AI3A 2YMLA 3CUKA 4L51A 5JYBA 1EUDA 1TYCA 3CGGA 3DONA 5JSFA 3FETA 4RV9A 4G0WA 2WKRA 4MVWA 2WLTA 1YRHA 3O4VA 1RRVA 3ACDA 3E03A 1O5OA 3U81A 2X0IA 1DCTA 1OV4A 4Q3LA 1Q3TA 4B7XA 2J5XA 1D2GA 1QX3A 3RQSA 5HZHA 2W00A 4RLSA 4WLVA 1HQDA 4EMSA 4LZLA 1XLWA 2Y1OA 3A4VA 2FQYA 3BXPA 5AW5A 1TIBA 4KC0A 4IV5A 3D2CA 1TKCA 1JAZA 1L7MA 4B1FA 4CKCB 4YV2A 3DDHA 3R75A 1D04A 2OPBA 2YXNA 4FFNA 4MW7A 2OENG 3KOWA 1JP7A 1UBKS 3AZOA 4PZPA 5D01A 4DDHA 5CD9A 3RV3A 3WLEA 1Z38A 3RC2A 3ZKWA 1M8PA 4ISCA 1QLWA 4Q4AA 4BB9A 4N8SA 1OB5A 1ESZA 1C4WA 3K2BA 1CUYA 2PM8A 3HCFA 4FGWA 4NCIA 2WFMA 2O3SA 4R98A 4ZQCB 4RULA 2NUPA 1R4ZA 2BELA 3FRIA 1Y98A 1F8XA 4JI5B 2H4YA 5AHRA 2NU9B 4YRAA 3V6LA 5KPDA 4Q16A 2VUUA 1GGKA 3B52X 3I9LA 3PI7A 3LI2A 1RMYA 4WUTA 1CSEE 3HJNA 2VYND 3UT5B 1AKEA 2V7VA 3VV2A 2I87A 3NTOA 4NS1A 4FFRA 6AT1A 3V33A 2J3JA 1OF1A 2YIVX 5EJ8A 1EZZA 4HFMA 3W1VA 4MQMA 1WMAA 3I3OA 2OORC 4F8EA 3NWBA 1GAXA 1Z5ZA 1U8YA 4M0CA 4IM7A 3CNBA 2F64A 3SSAA 3FNRA 2J4DA 1CBUA 4WXRA 1A2QA 4YUZA 3NU1A 4MLCA 2PT7A 1JS1X 2VSQA 3W3ZB 3JPYA 2QRJA 2A6PA 1Q16A 2ZDHA 1E1QD 5DB4A 4AB1A 1V1RB 4ER7A 1FS6A 1GPLA 1XB2A 2PV0A 2V6JA 3UF0A 3LGSA 4MZXA 3S7TA 3H2ZA 4DF3A 5SZKB 3EQ9A 3RYIB 2YZNA 2V3WA 2P8JA 1S3IA 2R8EA 4EM6A 1U6IA 3UQZA 1OFGA 4CR7A 3PIRA 1I7QB 4OATA 1LNQA 3VPAA 2FK8A 2QRNA 4QNRA 1XCGB 1ZSNA 4OVKA 1A96A 3SF0A 1GCGA 3Q3VA 4UNRA 4YRNA 2YXEA 3BZWA 3M6IA 4HQNA 4PHHA 3NANA 3S3TA 4P33A 3VR2A 3AJAA 2VK8A 3BREA 1GFSA 1X8KA 1O95D 1OE0A 2Q5OA 3BQ9A 3OX3A 3U0BA 2F3UA 5GQSA 2F8TA 2JI8A 1U0BB 3S68A 4DQLA 4AJ9A 1KQPA 1UKBA 4QARA 5FEMA 3I2GA 4HFNA 3VNBA 3MBIA 4LY0A 3RIXA 3R7AA 3RUPA 4CW7A 4E5PA 1FJ2A 1GTJ1 1THGA 2BH9A 2BMVA 4RGYA 1ORVA 2C29D 2E85A 2YWXA 3GWZA 4YHBA 5A3VA 1H2XA 2ERCA 4ND8A 1VP9A 1E8NA 1D03A 3L82B 1KYZA 2IHJA 3IBTA 5JC8A 13PKA 4MRNA 1JSCA 1RM5A 4D6YA 1EVEA 3SXJA 3S2SA 3K53A 3ZDDA 1WKCA 3C8UA 5F78A 3TQHA 1JECA 5F1YA 4ZODA 2JLCA 3EBOA 4XQEA 1FF9A 4OHMA 3OAAD 2AB0A 2BFDA 5B12A 2JG3A 3TBKA 3VMMA 3CLKA 3C7AA 3DBHA 2ROQA 2AOUB 2O3RA 3FOBA 2P9CA 3ZHCA 5C8VA 1MHPA 1HETA 3FPBA 1XVVA 2FMKA 3IL2A 5BPHA 2HCFA 2GNAA 2HYDA 2O0JA 4KR3A 3NHRA 1OX4B 1W25A 3KV3O 4RMIA 4EH1A 1JWLA 2NO0A 4WK2B 2WZDA 4CTKA 4UBNA 5FNVF 1QQAA 4HP8A 2HSDA 1W44A 2I67A 1CQJA 4MA5A 3KALA 3HJRA 4EI7A 5BUCA 5H3LA 4CLXA 5FUVA 3FPCA 3NKLA 2NYUA 2ZJ3A 1HZZC 2HNBA 3GJZA 4DREA 1TD1A 4YAGA 4J0KA 2JARA 2P69A 3HYRA 3OHPA 3QEAZ 1MRSA 4ARVA 4Z1MD 2WQ6A 2JAUA 1SCIA 2ZUUA 1EIZA 1GRQA 2ETVA 3OM8A 4FPXA 4D9KA 4NZZA 1N2CE 2JAXA 2YYYA 3OIVA 1E6CA 2HHCA 4TTVA 2Z8ZA 2QLTA 4PYOA 3BJMA 4QSMA 2Q49A 4MW9A 4TM8A 3VZPA 2RGXA 4BL5A 1J09A 5L3RA 1AC5A 2J0UB 3N75A 1EKXA 4H6WA 1WMDA 5GV7A 3RTBA 5LQAA 4BFCA 3IUPA 2H1CA 3B6IA 1X80A 2IY7A 5DBHX 1E9BA 4EPYA 4L5JA 1CQIB 2XXAB 2IHTA 3CSDA 4ZT6A 3ROEA 1ESDA 1PLJA 1GD1O 1G4UR 1KSHA 1QOPB 1WDWB 3JD0A 3MGKA 4MUIA 1AJEA 5B53A 2POCA 4QPZA 3DNFA 4DLKA 1K98A 3FFTA 2W22A 2B35A 1X8LA 1SIWA 4OHXA 3IULA 4WASA 4WI1A 4B3DA 1DCKA 4MIEA 1Q0UA 3WKDA 4Y0NA 3GGOA 2PMWB 3DMRA 4OK6A 1HQCA 2CFRA 1QFXA 4DEVA 4ZDKA 1NATA 3ETEA 3HQ4O 3KT0A 3EH2A 4RD4A 1FNCA 3JQ7A 4FX2A 4XVQA 1Q3HA 5CJJA 3MCAA 3REQA 1LQ2A 3HO1A 3CNQS 1CYDA 1XRSB 3IRUA 4IPTA 1T4DA 2RG1A 3OWXA 3JPWA 3AO0B 5FNVA 5LLDA 4G23A 1FFGA 1SY7A 4UTXA 5IYZA 1YTUA 3QFFA 1M5UA 3CLRC 1UBHS 1V9CA 1JKIA 1RCFA 3E15A 1A5TA 3OLCX 2W2LD 4I50F 2JLAA 1HPLA 1I3MA 3RIYA 4YRJA 3VUEA 4D0SA 3C6XA 2V8OA 2W6NA 2ODEA 4BV8A 4FYYA 5LPNA 4BVHA 1PG0A 1Q0PA 2IGTA 4MJ3A 4Q7MB 3RASA 3BULA 3DQZA 4FQ8A 4ZDJA 1KVQA 1K86A 4Q1VA 5GIPE 1YC5A 3HVKA 3TZQA 2FQ1A 1QCDA 1TGVA 1A5ZA 3K1AB 2DTEA 4FK8A 1T36B 1QYRA 1T3LA 4X7MA 1XLTA 2H08A 2VAWA 3C7KA 3E7FA 1G42A 4JSRA 4DSZA 2ETXA 2Q29A 4MS1B 4MROA 4AXXA 5CFNA 3G9UA 5CM8B 3JW8A 1UBOS 4K9DA 3U4QB 3VPGA 2C2OA 2V3CC 4OB7A 1XPRA 2N75A 3QF4A 1FFSA 2HPZA 1A8PA 3MYYA 1UXOA 4DEYA 1LF5A 2OK7A 2HF7A 1WCV1 1MB0A 1SFRA 1DFIA 1P4GA 2IHBA 2J09A 2JEZA 1TO2E 1YASA 1ISJA 2B9VA 3DTVD 4TUYF 5AOBA 121PA 4FFOA 2Q1UA 5TIIA 3BH6A 2FSVC 3SNKA 4CT0A 4CQMB 2IEDA 4XTCS 1DJOA 1TZJA 4WAUA 5KAPA 2E6UX 1TL7C 2BHLA 4PC6A 3ZDAA 1FNNA 5COQA 1FXWF 1O03A 2FR8A 3NNNA 2WJHA 3ZHRA 2NQ2C 2RG7A 1YNOA 2H2DA 4ILEA 4QHSA 1J0XO 5C8ZA 4FP9A 2GD2A 4QQ8A 4P8RA 3SEQA 4DWWA 4O2LA 2E89A 1NVGA 1LF0A 5FWDA 3SYTA 1NXSA 3RK4A 4OHKA 4DHEA 4AF8A 3SQXA 1L1QA 3P4UA 5IYZF 4IH9A 5CDUA 1A9RA 2HPAA 2ZRGA 3QPDA 4LJLA 3R4CA 4L4XA 4M83A 4X91A 5FV7A 3ZWPA 2H4JA 5EJ9A 2VPPA 1QU2A 3BTUA 4CE6A 4ENQA 4MJ7A 5HDQA 3BF7A 2ZE8A 4LPKA 2O2DA 1NL3A 2AE2A 2C2GA 1PWYE 2FHPA 2WVHA 3CLTD 3GVHA 5JAQA 3RJTA 2V6MA 1DKNA 1NOKA 2FETA 4X9XA 3H9CA 3M4XA 1EK5A 3O1JC 3OZRA 5K3FB 5A0VA 3UMJA 3I72A 1EA5A 4K9PA 1I6WA 3ROTA 3H5RA 1DBQA 1TOAA 4FFSA 2UZ3A 5FWXA 4HVLA 4QLAA 2RIRA 3T5DA 5GJVC 3T4PA 2ZI5A 1WCIA 2M32A 3PGLA 5BYAA 4GMXA 3SXUA 1RKVA 3UICA 3LS2A 2O8VA 3KWFA 1T8RA 3KUKA 5F1OA 3SMQA 5IBQA 4B9AA 2R7KA 4ESEA 2HKIA 4NESA 3RBVA 2OMEA 4LQDA 5I9MA 3ZE1B 5CB4A 3IMEA 3SX4A 1H22A 1UJ5A 1VIAA 4LJ6A 1KEEA 1WQ1R 4ECAA 2J3HA 2FWBA 1NC1A 5IKOA 4HRVA 1ZEJA 3GOQA 1ILEA 2K4MA 4UCWA 4K28A 3W6UA 2I6FA 2CMFA 2D2VA 4FMDF 5ALGA 1I51A 3DBRA 1YD7A 3NNDA 4HO1X 3KTAB 2AEFA 3VZRA 4EHAA 2YJTD 2EG5A 2JKZA 3WA6A 3JVVA 1NX6A 2VYCA 4LOLA 3C3BA 1CZHA 1G21B 4UE6A 2PFKA 5DBFA 3W7VA 4RYLA 1U8FO 5CXSA 5IWAB 1DKUA 3BIOA 1HE5A 1RLTA 4BFTA 5KTOA 4ZO8A 1FSGA 1Y80A 1ZM9A 2Q1XA 3JQFA 3ZD9A 1B6RA 2AFRA 4HEA6 3D3QA 5LYJB 2CE2X 3ZDFA 1Q7BA 5JS2A 1MF7A 4TKUA 5D3QA 1ETHA 2DUNA 1SHZA 5AKJA 1OR8A 5EJ4A 4GLOA 3PE3A 1IHOA 1NZJA 5AOAA 2CNKA 3HPQA 4JP1A 4XVHA 3GUUA 1C0KA 1O95A 4NZMA 5FFFA 2FN4A 4EKIA 7MDHA 3CNHA 4BFUA 4CTJA 1Q1ZA 1X7YA 3DEYX 4B3CA 5EJMA 2QJWA 3ELDA 3P9QA 5KTTA 2MHCA 1WETA 4RANA 4Y8VA 1YBMA 3EJWA 1FDUA 2IHZA 3ZIDA 5HJ2A 3ILSA 2YBEA 5ANRB 2UVDA 2ODQA 5AVXA 3V42A 3PDIA 3ITNA 1FJGB 2HQRA 4HFJA 4IQGA 4BVEA 3E3MA 3GLHA 3AERA 1VLVA 2WILA 3F6EX 3IP7A 2I7XA 4CUJA 1CY4A 3MTDA 3D8NA 4X8MA 3QLUC 2FRDA 2O20A 4KZKA 3JWJA 5JI3E 3I32A 5AKGA 1E66A 3KWLA 3ZU3A 1NQOA 2AJCA 2BL4A 2O2XA 3EGCA 3T5BA 5K0CA 2Z5VA 4BDTA 1DEXA 3O91A 5IUNC 1P0IA 2X2PA 1EINA 4Q4CA 3AL3A 1BE8A 1RAGA 5G0SA 2UYQA 2F3RA 3MUOA 3PD0A 1UJBA 5BSVA 1PUJA 3BE6A 9ABPA 3HA2A 1SK8A 1ZC3A 3D59A 3H4VA 3MWEB 1F12A 3NC4A 4R2HA 4CR6A 4YMUA 3FWNA 1YQXA 2QRZA 3D6NB 3P94A 1Y8ZA 2YZ2A 1LWNA 1U3GA 1YHNA 621PA 1CRQA 2JBHA 2H1RA 2HLDD 2J1LA 4RHYA 2O4UX 4YFVA 3DXXA 1RIIA 1O58A 1YT5A 3UXHA 3O8OB 3G88A 2VSYA 1VSQA 1CS0A 2BVNA 1E3MA 4ZT4A 3QELB 1J07A 3NYWA 4FD3A 1AZLA 2F67A 3WYAA 3PENA 4HYEA 4EEKA 4ESHA 1KWGA 1AV6A 4LOIA 2ZI4A 3ST7A 2IZ1A 1GGJA 2Q9CA 1NZFA 2HDWA 2X4IA 2RGBA 2YHSA 3E5NA 1CQIA 1N2IA 3PDHA 1EUYA 4DIBA 4B09A 4BAGA 5IJWA 3C24A 1L7RA 3FSEA 3DLAA 4C7OA 2BGUA 4HR7A 2DHRA 4HJRA 1PZXA 1GR0A 2NNWB 1VZ3A 4AKGA 3NP9A 3OOJA 3TD9A 1ECBA 4KOAA 1U4OA 1W6RA 3KSRA 3K0SA 1EVJA 4DR2B 1IHXA 4F91B 4KAXA 3LOQA 3E8SA 5I9BA 3WJ7A 4NCKA 1C3OA 1KJJA 1VIDA 3GDWA 4ERXA 3C7DB 3OIYA 3JZMA 1BE6A 4QLOA 1X15A 4QO8A 3D8SA 4H3VA 1H8HD 1HDRA 2JHPA 2REXB 1G3UA 1PWEA 2PLAA 1Y82A 3H8SA 3Q3GE 5E6SB 2V0CA 4YREA 2SCUA 4GDFA 1U3WA 4FDUA 2ZI3A 4B81A 2JATA 1EUDB 2OLKA 4Z4CA 2XR1A 4Z4EA 1XRJA 2Q1YA 5FLXA 1HORA 1QO7A 2AN1A 5LZ8A 3AUUA 1ZOLA 3DBVO 3WQRA 3HKDA 4M9SA 2VLBA 4WLEA 4QC2A 2NO5A 3PPVA 3LNTA 4TMFA 1NDHA 3DHWC 1J20A 2HNKA 4EF6A 2V6IA 1SGWA 2JAOA 2EERA 4HB2A 2VA8A 4AQDA 1QHYA 3GHHA 1SUBA 3M4JA 4PTYA 1PGOA 2F4NA 3K05A 5KYYB 2E1PA 5C2JB 4CHTA 5KQGA 3B6EA 4H6XA 2YIDA 3DSRA 4MO9A 2NTEA 5EE3A 4E13A 1Y1TA 4CF6A 4Z1OA 3EVAA 3PX7A 1TDJA 1JJ7A 1QZZA 3U4IA 4XIJA 4DZRA 3WXBA 4V0LA 4JGIA 1YQGA 4PZLA 1FTYA 2LCFA 4F96A 3PGKA 3V1UA 3C3XA 5K8CA 3REFA 2O8DB 5HIKA 3PR3A 5I8PA 1JLLA 1FRQA 2Z5LA 2JGIA 3DWEX 4DNXA 2WWYA 2SKCA 5AKYA 3RJ9A 5JNSA 3JARA 1XA0A 2TYSB 3I83A 3PKIA 4A0SA 2ZIEA 4MPDA 2FFRA 3LC0A 2CMKA 3VR2D 3G2JA 1EFDN 3V7WA 5CFPA 4ARCA 4P92A 1OAKA 3JCZA 1BEEA 2C1EA 1PL0A 2NUBA 4AYTA 4PO1A 1K9VF 1NY6A 5FPHA 3SI7A 2ECKA 1XNQB 3B1XA 5HKLA 1QDUA 1OFVA 4HSEA 3X44A 2EGUA 3I92A 1T1EA 1P6QA 2WK1A 1K7SN 3KAQA 2XZOA 3OCCA 2NQ8A 1IVSA 1YKGA 1KDYA 1NNEA 1K3TA 1KK2A 1WCIB 2VZ0A 3I6QA 2O07A 2UV8A 4AO8A 3U17A 3VPHA 3HZRA 3QYJA 5AYVA 4IF6A 2HFKA 3LKBA 4EKDA 4F3NA 1HFEL 4E15A 4O1IA 3W6NA 2PPLA 3S40A 3ZE9A 3K0AB 1Y1RA 5FR1A 4MPPA 3AKZA 1DSSG 1P1RA 1Y1PA 3AR5A 3ETLA 4YS6A 5M34A 4QXAA 3GJXC 3TJMA 1L5QA 4GF5A 1U7XA 2QYTA 4AO6A 5A4FS 4Z8YA 4HH1A 1QF9A 3PPIA 4GLBA 2ZT6A 5FI3A 5NULA 3HBFA 2ZSBA 2OGTA 2BMWA 1EQAA 5DEIA 5I9NA 5H4GA 1AUOA 4ZOAA 1Q0RA 4FC7A 4OSPA 4PRKA 5TMEA 3TNFA 2ZROA 2XE6A 5AHXA 3X1MA 4ACAA 1BN6A 3EODA 4G1BA 3VPBA 4DJEC 2O19A 2RGEA 3RS3A 4DCJA 5BN3A 2A7XA 2YMQA 3N07A 4OHPA 1CZNA 4YV1A 3RAEC 1W8DA 2JCVA 3GRPA 4P81A 3T4EA 1N34B 3BH0A 4Z7OB 4UBJA 1NYLA 4RADA 1Z6QA 4EHNA 3ESXA 2CW5A 4OI0A 1E5LA 4DRXB 2Q21A 3VTZA 5D86A 1JSZA 4FNMA 3D3WA 1ULAA 5J9FA 2FZWA 1X80B 3AILA 2NUTA 1M3SA 3LAWA 1TK2A 3FB4A 1ZU5A 1KF0A 1VPDA 2WR8A 2Z5FA 5AVRA 1XX6A 1XZJA 3RCBA 4RLFA 2XCRB 5G2OA 3X1YA 3DG9A 4YC7A 2BZ0A 2UZIR 2KBEA 4IG9A 4MYDA 5CBKA 1IWPB 3R9KA 2ZTSA 1X7ZA 3A3NA 4HNHA 4UTZA 4ZI7A 1HR0B 3LO8A 3I9FA 1CNMA 2Z6AA 2BEUA 1R8XA 4BZWA 4DG9A 4YDSA 5L8VA 2ODBA 3OZDA 4FNGA 1ODFA 2HYIC 2J0EA 5TC4A 1QRSA 4PWYA 2HV8A 4B73A 2FMIA 1DHTA 1DKLA 1F4VA 3AKYA 4WA7A 5E1OA 5E6UB 2OLJA 5THXA 2W58A 1LW7A 3V80A 5JSZB 3NO4A 4AI6A 4TTIA 4CMHA 3PQ2A 4WLFA 1M33A 2PDAA 1Y37A 5A4DA 1Y81A 4GI3A 4IAOA 3VU3A 2WBLC 1H0KA 4X6UA 3UJAA 1NF8A 2DRIA 4HCJA 4LECA 2Z2XA 2ZG6A 4JXZA 1A8QA 3JRWA 1QDLB 1YA6A 2FFHA 2GYUA 2ZU6A 1G2QA 3K0CA 1QAMA 4CM7A 3OUUA 5AKZA 5M04A 1CT9A 1B8PA 2DU8A 5GIOE 1GNVA 1SXJB 1J7JA 1OW3B 1GPYA 3PRYA 2AW3A 2KMLA 3DAYA 4K9NA 1DEOA 5T4EA 2PUDA 1U63A 4MKZA 3VAZA 4OYYA 1C2TA 1SZDA 1B00A 2G5TA 4LFBB 2YMPA 5CVTA 2P9TA 3BBPA 4IDDA 4LF5B 4Z3KA 4UATA 2HNAA 1Y5NA 3AY6A 3IT3A 3O8QA 3D5TA 3K73O 1II9A 3O95A 3ORFA 1JLKA 1JX6A 5AI5A 5C1PA 3DHEA 1VPWA 2PGIA 4Y9UA 1NVMB 1OBHA 1WXEA 2AHRA 1CY2A 3OC6A 4YRDA 3GJQA 2VH2A 3OE5A 3OIWA 4JVSB 1E6EA 3TUIC 4C0XA 3KBBA 1AMOA 1AN0A 4G0QA 4HF7A 1WULS 4UXHA 3QHPA 1KJ9A 1E2GA 3L8HA 3OZEA 4DJJA 3W5VA 1JBQA 1XZAA 2O3UA 4ENUA 3TGWA 4BLQA 1OXVA 2BR4A 1XZNA 2J9FA 4ZTBA 3UFBA 5HJ5A 2X0FA 4D25A 7AT1A 2QLLA 1I4OA 4PW0A 4B7ZA 3MFQA 4FZ3A 1APBA 2GCPA 1SXIA 1WZUA 4QOHA 3P9RA 2C9MA 2ZRNA 4JQOA 3WBJA 1BE1A 5KVCA 4MPRA 3SVTA 3T7JA 3PC8C 3SLKA 1XD9A 3VHLB 5A5FA 3JWGA 4M49A 3L43A 4H4CA 2UDPA 1WF6A 3ODPA 1SD5A 1Y7HA 4CQLB 3K2IA 4F2DA 2DB3A 1IG3A 4KIWA 3KXIA 4UAUA 4HZUA 4IX9A 2DXIA 1N6NA 2TMDA 3E2PA 2WYVA 4KPFC 1Y4AE 1GKIA 3QWHA 2CBXA 4HDRA 1UMBA 821PA 4YPFA 5H9WA 4EHKA 3TF5A 3RFFA 1NBMA 1DP4A 1QWSA 2GA9A 2DM6A 4EHIA 2ADOA 1F6WA 4JL8A 3UBMA 1T9HA 2CWWA 1LI4A 2BBTA 1UQTA 1WP4A 3DZBA 4HT3B 3U3XA 5C7LO 1JKXA 1G16A 1TW3A 4R7GA 4HX9A 3ONVA 1RBQA 4JBNA 3KJQA 4QTYA 1V8DA 3OM1A 3KZMA 3TDKA 3U56A 3U61B 3KYIB 1K5PA 2B5WA 2IC5A 3HGTA 1YBVA 4R1LA 3G13A 1NULA 3ZKAA 4NCAA 1TAQA 1W30A 3BHMA 4G5HA 3AWIA 4RVDA 4XW2A 5JEEA 1CEYA 3LT4A 4CG2A 4AKTA 3NC0C 1KDTA 1P1HA 4RF4A 5TPWA 2HJGA 4PYKA 3TPCA 4ZAXA 3RUHA 3LRXA 5CCXA 4L74A 4MQLA 4X54A 1ZL0A 4CG3A 1PR3A 3HG7A 5TF4A 1SHLA 3WNVA 4D4LA 2J45A 3STWA 1C7IA 4M60A 4BN4A 4Y30A 1IY2A 5FADA 1OJ7A 4QYIB 2JA1A 4B4VA 2W8ZA 3B9QA 3ESBA 4CZ2A 4CDRA 3AKDA 3ESZA 3L6RA 3L8FA 2ZYUX 1MO6A 3A58B 1CP2A 2A3NA 1TM1E 3AETB 1O0SA 4C0JA 2XWQA 3E7XA 3QE9Y 4OYRA 2W8BA 2EF0A 3SK0A 3CF6R 4HNVA 4Q4LA 3WGQA 3GRCA 1DO0A 1FTGA 2YS6A 3ICPA 2CNWD 4X0EA 4KQCA 3ZS8A 4JI0B 1L5LA 1G5QA 1QQ6A 3B3JA 2FX2A 4WWHA 2OHVA 3ZV7A 3ECSA 4GHWA 3MYRA 4AWAA 5B30A 3I0ZA 1LA2A 4KRFA 2FWJA 4BJ5A 5TS3A 2WJJA 1ZONA 1R9MA 1Q1EA 3ETDA 4Y6QA 1UWCA 1ZRSA 5CYFA 3EDMA 1D6SA 1A9TA 2ZBVA 3A05A 4REQA 3IKTA 4KP7A 5EPUA 5FO0A 2BHNA 3KLBA 5E4YA 2AG8A 4GBMA 2Z08A 2AMFA 3CLSC 3FWPA 3ERCA 2HADA 4BU0A 2QJFA 3GVCA 4EF4A 4P1ZA 4L73A 2VHXA 1L3CA 4GQBA 3KQUA 1ZA1A 3NHKA 1HE8B 3G5LA 1XMXA 2E2WA 1GAEO 3L6BA 5JAUA 4TXMA 5DNEA 2HIGA 3BPSA 3QWFA 1XMOB 2D1YA 2G5CA 4LNHA 3TSWA 1J7KA 2Q0QA 3V1LA 3T1OA 2QE7D 2FLKA 1GZ6A 3NRJA 5JADA 1ZXXA 4NX2A 3RUFA 3D2BA 2HMSA 2Q5HA 4Q66C 3QU2A 2XZDA 4TVOA 2VWGA 3M3DA 2XEXA 4YUYA 3ZWWA 5KDDA 3EIUA 2BF7A 1XRRA 3FHCB 1H1LB 3O75A 1HT0A 4KQ2A 2GF9A 3NYRA 4B79A 4BLSA 4P54A 2JA2A 4MUJA 3LOUA 2SBTA 2HCBA 3MT0A 1R0YA 2CHEA 4S0XA 2VUSA 4A16A 2F4VB 3K70B 3ZH2A 1GU0A 2LWIA 3M5DA 3CVUA 1H0RA 3QJYA 3T3PB 1LDGA 1RJEA 2HU2A 4UU7A 1G8KA 3QUCA 4YCBA 2YXBA 1HFKA 2ZSEA 3PPYA 4QDXA 4F85A 2G25A 4DR4B 1Y5MA 4YUAA 1RAHA 1Y9JA 4P4GA 4NEQA 2BI7A 4M0DA 5EIBC 3TWOA 3D4PA 3L1IA 3EEYA 4O4IA 1QPBA 1GKUB 1W1UA 1DQNA 3F3MA 5EMNA 4ARAA 2HXYA 2VDMB 3QA9A 5H4HA 1HOTA 5TQ0B 3TQFA 3UA3A 5K6TA 5KTPA 3KLMX 3QWIA 3R7NA 2C03A 1JFTA 1VI5A 2FCRA 5F73A 3KQSA 1DARA 1M34E 1X3LA 3K92A 5EWLA 5ARCA 3RD5A 1NQXA 4LHYA 3R3WA 3SOPA 1AQIA 3G0GA 1X6VA 1R74A 3GH1A 2EWWA 1DAGA 2Y68A 3GRKA 1GPWB 3IB6A 1J9ZA 1LRLA 3IEXA 4N0EA 3BQMB 4U7HA 1M1NA 3SC2A 1JG3A 1KARA 4YAFA 3K6SA 4ATNA 3LHFA 3SJ7A 4AY5A 4BEWA 3AYZB 1LDYA 1UJNA 2EF1A 3H5AA 4OHVA 4XYMA 1XXLA 1L5GB 5FRDA 2OOKA 1MT0A 2RH5A 1Q1AA 1NBME 2FF5A 3N2KA 2P9FA 4IGFA 2FOLA 1QVRA 1GL9B 4RZQA 4CCWA 1I6MA 1OLUA 3EX7C 1JI0A 4Z0NA 3BGSA 3KXPA 4ZHSA 4FCCA 4E07A 2HOQA 3QF7A 1YCFA 2F48A 4ZOLA 2QI9C 3AERB 1JT2A 5C8DA 1YDWA 5T64A 3CIOA 3NJRA 2XYRA 4WCFA 1WNTA 3FVVA 4RKEA 2Q8NA 4EAQA 1E4EA 3I9KA 3RFXA 3PPWA 1D5CA 1SG9A 4G9GA 1TIPA 2AKYA 4E4YA 2PUEA 3PFCA 2YRXA 4UEWA 5IM4A 2JI6A 1UCFA 4R0VA 3THOA 2C5FA 3SQWA 3EA0A 3AGPA 3IHWA 4G67A 1JR4A 1T13A 3H9JA 2D5AA 5EMJA 1UC4B 3GYGA 4HXYA 2GPBA 3K1TA 4O25A 3RS7A 3BHIA 4CM9D 4DLVA 5B7QA 1R10A 3DE3X 4D9HA 2AFVA 4A8JB 2OB1A 5E3HA 3MSXA 1GPDG 4EW1A 1M34B 1V1MB 5E3IA 3N05A 3JWHA 4WIAA 2H16A 3ZI4A 5KQPA 3AI2A 5P8WA 3RH0A 4CLOA 2F7SA 1QP4A 4LIPD 2YDYA 4OMFG 2R1UA 2R1TB 4QO7A 5EWJA 1UOOA 3CT6A 3X2FA 1KI6B 3RFTA 4DJFC 4AL4A 2VNKA 5FPQA 1YQWA 1SC3A 5D2CA 2NXCA 4KFCA 3R5HA 2VJMB 1IN1A 5FBZA 2M6RA 4JB0A 3UUEA 1NJ6A 3NDPA 4BWGA 1O5TA 1VE1A 2K6GA 4P4LA 5TMDA 1PJBA 1Y6QA 1YZLA 2G9UA 5JSHA 1UUFA 3WK4A 5JFTA 1ORHA 2AEMA 3FUWA 2PV7A 5SZJA 1HQKA 4PC3A 4C0QC 2BTQA 5EINA 4IEFB 1F20A 3CY6A 1MQ9A 2W4QA 4U6QA 1JDZA 4KIUA 5ADHA 1FX0B 4HDMB 4IMRA 4QATA 3C3KA 3DYBA 1XAHA 1DS6A 4R1TA 3ZLTA 1DEAA 4CM8A 4QRDA 1PSDA 3BB1A 2HU5A 1ODIA 1OXBB 4XOIA 3WL6A 1YQEA 2OV2A 2Q3JA 1NLUA 1E92A 4N5HX 1RNLA 4GPD1 2X1LA 4ZIRB 3KL2A 1I2BA 2B3DA 4DC9A 4A6DA 5LYJF 4LF8B 2FG6C 4GZMA 3V8NA 1MT3A 1BWQA 1RI3A 2A59A 2CXTA 4GNRA 3ROXA 2A0YA 2NN3C 1U9ZA 4KDCA 4MJLA 2RK4A 3UJBA 1PKEA 1H0SA 1WU8A 3UHOA 4AURA 4ZICA 1VXOA 1WE2A 1RWPA 4MVJA 5K3AA 2VDRB 5KCMA 1AKNA 1NX9A 2I8CA 3F1LA 1MJNA 1HQYE 4RJKA 2PH7A 1V0JA 5AW7A 5IX8A 2Q8PA 1R0SA 3PQ4A 1MB3A 2OQVA 3PRJA 1ONSA 2IKQA 2J31A 3IIEA 4C08A 5IXYA 4LS3A 3U4QA 1YMVA 4I1RA 1VCMA 4J7CA 3ZWVA 2ZJ8A 2H3HA 5KTYA 3GMTA 4M0EA 4HQ0A 4KE7A 4TYPA 5TRTA 1A2KC 4RQUA 4IJUA 1YTLA 2JFFA 3G7UA 2GJ9A 5DPMA 3AW8A 3NDJA 1BNCA 1QMGA 1VJDA 2Z5GA 3JU3A 3M5CA 4GIBA 1CZKA 4XPZA 4RW0A 1AMUA 3AK4A 5HCIA 4XCQA 1UP7A 4LMRA 5HG0A 1Z68A 3DB2A 1EEHA 3AR9A 4B3TB 1CE8A 2RAFA 3OQJA 1RIFA 1XFAA 2GN0A 1XJ0A 3IC5A 1PNVA 3DAPA 4ZRMA 1RQGA 1XJQA 2QGZA 5FTKA 4TLDA 3TB4A 421PA 1TEXA 2VJPA 3B1ZA 2QLMA 3P9IA 1G7SA 1AQUA 1MC8A 1SBCA 1TKBA 2PU5A 3F71A 4N40A 3WRXA 4YYZA 1JHRA 1IQUA 1YGPA 1UKCA 1O6CA 4MR8A 2CLMB 4ZEXA 3ANMA 3UCXA 3W05A 2GBFA 4CIWA 2QAGC 3V8EA 2E1RA 3W5BA 4CL0A 5KNLA 3UPDA 1NW4A 1SNYA 2QM3A 3CLHA 1MZPA 2IT1A 3F46A 2QV0A 1XF9A 4DA9A 5JH7B 1ZVMA 5A3SA 1FX1A 2NV0A 1SUFA 2WJZB 1T5BA 2IZOA 3ANLA 4G3XA 4JCCA 4DMMA 4BJ1A 4OU5A 4JLSA 4M9XA 3WIDA 1B74A 3CH5A 4P4UA 1OLXB 3VVBA 4YYEA 4BFSA 4HDQB 5JCJD 4Q7KA 4HC4A 2FSHA 3FMVA 1SHJA 4AU1A 2QW1A 4IXNA 2A4KA 2H65A 1H2ZA 1OU4A 1HYGA 1ISFA 1MQAA 2QV7A 1YUMA 2IITA 1OWOA 3DOJA 3L7YA 3IBSA 4I6GA 2O5EA 2FQQA 5LSAA 2YFHA 3OZIA 4JJ8A 4HLUC 1OIWA 1X7YB 3CTPA 1E98A 2IKSA 4WZBB 1X0VA 4U9IS 2I55A 1KZ9A 5IKPA 3N3BC 1NVUQ 2ZE5A 4YRFA 2JHGA 4A8HA 4ZHQB 1PGNA 4C7JA 2W2TA 1VSTA 2X1VA 4J4TA 4DILA 2C7PA 3SDSA 2RONA 3GP3A 1QFMA 4YT2A 2DWQA 4DWJA 3KYJB 2GZAA 2PRKA 3LQFA 1L4GA 4IWYA 3ZDYB 2VK2A 4CT5A 2JLSA 1QBKC 4XAQA 5IULC 1RU3A 4KYIB 2M6LA 1R15A 4LYYA 3E22A 4GI1A 5CT9A 3PC6A 5LQUA 4Q3OA 1BHO1 1QZ3A 4EOGA 4MUGA 4NK5A 5ICFA 1Z17A 1GL7A 1L5FA 1Q6YA 1WHSA 1PNOA 2J4CA 1FDOA 1E2LA 2ZAMA 3H3XA 4X20A 1D2RA 3KOZA 1KO5A 1F51E 2PKYX 3MMXA 3SU8A 2ZXUA 3GH3A 4PLZA 1ZD3A 3H9BA 1KIMA 2XGOA 1XTTA 3SMVA 4XFJA 3UM9A 1HE2A 3V8VA 1W75A 3S99A 2AW5A 1U81A 1SRQA 3M8KA 2QAIA 2P11A 1BD3A 3LTNC 2WM9B 5C9ZA 1TUIA 4RHFA 5LZ2A 2BSXA 2ZIGA 4CR8A 5ALYA 2UYGA 4DBZA 3TYXA 3HJCA 4UM9D 3RPEA 4ZHQF 3HP7A 3AF4A 3B7GA 4W82A 5DGXA 4BCBA 1J49A 3IUJA 2W6JA 3FOAA 2CB0A 1FNBA 5JCJA 1TW2A 1FEZA 4GPIB 3A9CA 5MN6A 3EIHA 5KJCA 4R8VA 3PQ7A 2UVPB 4UU0A 1YH3A 2J07A 2LGJA 3EQ6A 1V5WA 2PQ6A 1N2EA 2RAPA 3QE4A 4FFMA 4WZAA 1QHNA 2I7CA 3BL8A 3ZWCA 4D9IA 4E5VA 3E2IA 3A14A 3ENNA 4RZIA 3C3WA 3L4BA 5HIJA 5K8JB 3WNDA 4M8KA 6REQB 5C4MA 3RVQA 4P7JA 4FT2A 3QH4A 2Z3WA 4MS4B 4BNTA 4Y2SA 5KNBA 4JSTA 2SECE 1XYVA 3B1FA 5A4AA 2RJNA 1X8XA 3DEHA 2OHFA 3HSSA 2JGMA 1PYOA 1AF4A 1RPTA 1TC2A 2C9OA 2UYOA 1QHXA 3FCUB 4RDXA 5ILGA 1R8SA 1GT6A 3G85A 3AKEA 2W6QA 3FNFA 1MO3A 1U7TA 3FI0A 3LZCA 4OUDB 2YJ3A 3EVZA 4FE7A 1XE3A 3FJYA 2EHDA 3I05A 3Q2IA 5E6SA 1CHDA 4XRRA 3ZCTA 5HTOA 1UAAA 4DA6A 4G56A 2ZRQA 1CZUA 2Z8XA 4V2UA 3CEMA 4ABYA 2QTNA 2W2KB 4HMQA 4HWGA 4P3NA 4BFVA 3O3CA 3G2KA 2ID8A 1FZQA 4PSDA 1OAAA 4Q15A 4D97A 4ZCIA 1AHPA 1EJ6A 1MFZA 2EZ8A 3K0BA 3FYTA 3WGUA 2Z6UA 1HBJA 5HILA 3DHNA 4N03A 3VZCA 3FHTA 2NT4A 3CWZA 2H1FA 2C57A 3F67A 2GDZA 5HFNA 1X13A 2DAPA 5BQOA 5HF8A 5B5SA 3R6DA 2EX0A 4CKZA 1CX9B 2OZLA 3GLSA 4N0QA 2OYRA 1QO0A 4RESA 2VHZA 2WA2A 4HPXB 3CSUA 4Z9FA 2GEVA 1I13A 2QN6A 3RG8A 4JC0A 5ESXA 3UZUA 2ZS8A 3TW0A 4XD7D 2DQZA 1WP9A 2IODA 4NYIR 1Z0JA 2IP4A 2QLBA 2R7LA 4O4JF 1DTWB 3LSTA 4FEGA 4WZ6A 4OI1A 4OQQA 2ZJ7A 4C3ZA 3GARA 3G2IA 1XRNA 1B7GO 1UT6A 5DN6D 1OZHA 3IR5A 1R27A 2MOKA 4GXTA 3OQHA 1KU6A 1ES9A 3AR8A 4UDYX 4A8TA 2W48A 4FT4A 5ENZA 2NIPA 2B36A 2Q6LA 2XKAA 2YVLA 1NFQA 2JI4A 2BFEA 1M10A 1T0IA 1UMBB 3ZWBA