5AOBA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
RLRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLKDHVPRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
molecule tags Hydrolase
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aobA00
5AM2A 1UXOA 2ACKA 3V9AA 1XQXA 3TJMA 2GYWA 1R4ZA 5AK6A 4N5IX 2C5GA 4BB0A 1QJ4A 3I2JA 1Y37A 1E3QA 1CUBA 4UUQA 2G63A 5LZ2A 4EB0A 1ZIXA 4H7DA 1P0PA 1FFDA 4XJVA 2WG0A 2V97A 1MX1A 2XMZA 3C6BA 4KAJA 3V1LA 1J07A 5AI6A 3LS2A 1JU4A 1XZEA 3WA7A 3IURA 3ZLUA 1DX6A 2WUFA 4AO8A 1LPMA 3O4GA 2HRQA 3C43A 1K6EA 3WKEA 1LBTA 5LZ9A 3NGMA 1EK2A 1CRLA 1GPKA 5HF5A 4OB8A 4D9JA 2XUPA 1EDDA 4BE9A 2ES4A 2PBLA 3E1GA 3G0CA 2D5LA 1YA4A 4FBLA 4CG3A 3B3QA 2EDCA 1ZD4A 2OAEA 4FNMA 2B4KA 2XQFA 3D5EA 5K3EA 2EEPA 3N2ZB 2JGMA 4B9EA 4BDSA 3D0KA 5FXMA 2V96A 1BU8A 5CH3A 1H2YA 3PICA 2ZVDA 2XMRA 2QT9A 3W9UA 2XT0A 3FYUC 1WM1A 3UMJA 3VDXA 2QZPA 2PSHA 4N8EA 4QZVA 4UFOA 2E3JA 2XUDA 5F4ZA 3C6ZA 2VJCA 3AIMA 2WQZA 5AH0A 3WA6A 5LKRA 4FOLA 3WYNA 4BAUA 2AJBA 1GT6A 4DLNA 4OCZA 3R3WA 3G7NA 3LLCA 5ALWA 4OU4A 4M0FA 3DNMA 2RI6A 1ZJ5A 1EVEA 3I28A 3S2ZA 4BVJA 3FNBA 5I9IA 3VKFA 4B84A 6YASA 4MQMA 3BXPA 4GECA 5BV7A 2RONA 1XZCA 1A8QA 4DMCA 2H7XA 2YASA 4G8CA 4AZ3A 3WWCA 1CUZA 3F8SA 3QH4A 5I7UA 2H7CA 4C89A 3OG9A 4IQ4A 5KREA 3V1NA 1IMJA 3STUA 1JFRA 3HC7A 5AI0A 2PU7A 5KWIA 1LLFA 5LKAA 2G5TA 1F6WA 2WSLA 3CXUA 4X95A 5C81A 4UBKA 2DFPA 1QFMA 4MWSA 2ACEA 3VXKA 1YB6A 3WK5A 4UPDA 1ORVA 5A62A 4MQLA 3H04A 1NU6A 1QGED 2O2IA 1CR6A 1XLUA 3CN9A 5IVHA 4Q1VA 2HRRA 1LPOA 1MJ5A 4G8DA 4ZV7A 1GXSA 4HTAA 5CTAA 4QWWA 2BCEA 5JD6A 3IVMA 3W9BA 7YASA 3O9MA 2ONCA 3M83A 2R11A 4GXNA 1DWQA 2ZJ6A 3F67A 4Q3KA 3WL6A 4W9RA 5CH5A 1RWQA 3HXKA 2WU3A 5AIBA 3R41A 3QBJA 5K3CA 3IUNA 4K2AA 4X71A 3BL8A 3SX4A 1SOMA 3H18A 5CH8A 1H2XA 1WCYA 5T4FA 4QDUA 4J7AA 3D7RA 4WJLA 5HF8A 1FFBA 4WFKA 4GHWA 2ZJ7A 2XUOA 5EIHA 2WIKA 1ZOIA 1YCDA 3OTQA 3SWWA 5JZSA 5EHNA 2CJPA 3C70A 4Y2QA 3E3AA 1F0NA 1QTRA 3C6XA 3WZMA 1MO2A 3QMWA 1XRMA 4K5QA 4KRXA 2HIHA 3KD2A 5HFNA 1DT5A 1WHTA 1FFEA 4UHCA 2HA3A 3QMMA 5CT5A 2RHWA 4BTVA 1E8NA 3WWDA 1UOQA 3G8YA 2JIDA 4BDTA 2GYUA 2WLSA 4J0IA 2WIJA 4UHEA 1BEEA 4Y2XA 1C7IA 1CUYA 3T52A 3BF7A 3BWXA 4DGQA 1J1IA 1R9NA 1VLQA 2QVBA 3R3XA 4H7EA 1ZI9A 3C8HA 1Q0ZA 1NX9A 3N0TA 3LP5A 4P08A 1XZHA 4X85A 1ISPA 1MAHA 2QXUA 4CIAA 1VZ2A 4BC0A 4BCCA 1WOMA 5AI8A 5E4YA 1UZAA 4G9GA 1SCKA 2VJDA 4DNPA 5ALOA 4UHFA 1CV2A 4QEKA 1UOOA 4HRXA 2WJ6A 5DNVA 4HVTA 2XMGA 2HA4A 2OLEA 2HU8A 1YASA 5A7FA 4GEGA 2ZSIA 4FLFA 3H2JA 3W2TA 1SC9A 1GQRA 1ODTC 4OUKX 3FOBA 2XMBA 3D2AA 4KE8A 1MX5A 2PM8A 1DWOA 4DYHA 5T4EA 5FV4A 2DHDA 3ZPXA 3L1HA 5AI9A 2OGZA 5ALTA 4UHDA 2HL6A 3TEJA 3K9BA 5AJHA 1BCRA 4AB1A 1TRHA 5CXXA 4BP8A 4OD0A 3OC0A 1QONA 4JYPA 4G5XA 1G4HA 3DEAA 1H23A 2ECFA 4BATA 2VT6A 4N5HX 2WKWA 1HDEA 1MU0A 1UWCA 3L1JA 3ICWA 5JATA 2Y6UA 3HABA 3GFFA 1JT2A 1IUNA 4G4JA 4NMWA 1CQZA 4M0MA 1TCAA 1YR2A 4IH1A 1EDBA 1WHSA 5DWDA 1AGYA 5AOCA 5AIAA 4BAZA 3PF9A 4QE3A 3ILSA 3H1AA 1U8EA 4FDMA 2Z3WA 4WFJA 1CUXA 2C7BA 1ZD2P 2XUGA 3BJRA 2VSQA 3IUJA 1VZ3A 5C8ZA 1R88A 4BRZA 1CUUA 4ARAA 3QMVA 3O0DA 3G9UA 2WJ3A 4EY4A 4H18A 5AI4A 5JD5A 3T4UA 3PE6A 2WHPB 1IVYA 3STXA 5AP9A 5A7GA 4E15A 4BCBA 5AK4A 1LGYA 3PFBA 2WG2A 3AUKA 2CEKA 3FCYA 1X2BA 4EZIA 1DQZA 2OGTA 1RP1A 1T4MA 3VISA 5ALVA 4X94A 1L7RA 4F60A 1VE7A 3W06A 5AKKA 1AX9A 5AI5A 4X92A 1XZKA 5HQ3B 5HKAA 4A5SA 4ZXFA 4P93A 3O9VA 1E5TA 3FSGD 4MYSA 4CFSA 4IH9A 4JYMA 1O6GA 1LNSA 1JJIA 4LHEA 4BZWA 3DDUA 1BRTA 1BEZA 1I6WA 1UOPA 2OCIA 1SFRA 4RPCA 3AFIA 4YPVA 4H7KA 2DHCA 3QPAA 4B80A 4TPKA 2ZYHA 4MYDA 1L7QA 3I2IA 4QDZA 1XRLA 2FX5A 4YK7A 3ESDA 1EK1A 3R3ZA 1YAHA 5CRIA 4J3JA 5DTJA 1K4YA 4KE9A 5EIEA 3I6YA 2WU4A 1VOTA 4BYMA 1CQWA 4WDRA 3H2HA 4DMHA 3ANSA 4CCWA 4CCYA 3DYIA 2Z3ZA 3BDIA 5HZGA 4NVRA 4S0XA 4F5ZA 4C6HA 1UT6A 1AZWA 1E8DA 3WKAA 2PX6A 4OYYA 1XZJA 3C5WP 5EHXA 3ZWQA 1UK6A 2WUDA 1XKTA 2B61A 4KAFA 1JU3A 4GLBA 5ALLA 3DKKA 2HADA 1DT3A 2YYSA 3GA7A 3FCXA 1Q0RA 2O2GA 1AUOA 4FLMA 3IDAA 4RGYA 1G42A 1MT3A 2C0PA 5JZBA 3EBLA 5ALGA 3EQ8A 3WQHA 4PSUA 5T4BA 1QIMA 4PSCA 5AKZA 3UUFA 4X6UA 2XMCA 1QO9A 1FFCA 1WPRA 3STTA 2WHRA 1ZI8A 2G4LA 3RARA 1HBJA 2ZYRA 2CBGA 4HAIA 1N8SA 4Y2YA 5FLKA 2BUCA 2OQVA 3EF3A 5AKIA 1H2ZA 3GBSA 4MEAA 1VE6A 2J3DA 3QPCA 1C7JA 4A23A 1UKCA 1HPLA 2QRUA 4V2IA 4DM7A 1KEZA 5AKLA 5AKEA 5LIPA 4WY8A 3B5EA 2I78A 5JALA 3HI4A 5A7HA 4MEBA 2Y1KA 4UBJA 5IH7A 4C4XA 3RKSA 1WB5A 4KYVA 2OPHA 2VJAA 4L3WA 4AN1A 4J0JA 4W1PA 3LIPA 4BTLA 1E66A 2WILA 5JYCA 1CUEA 2PUHA 1SCQA 2C0QA 5HF6A 5AM5A 3AZOA 4PO3X 2XUJA 4WCVA 4TGLA 1GPNA 1BE0A 3P2MA 2WHQA 3WKCA 4EY8A 3HEAA 4Y2TA 2BGRA 3G9XA 4KE7A 3VJKA 5FP0A 5BWBA 2RIPA 1HLGA 5ALMA 4J0HA 3WK8A 1N5RA 4ITVA 2DCMA 2WIFA 1DU4A 5DLPA 1ETHA 1MNAA 4L9AA 1CUSA 4J0KA 2IITA 3NWOA 5K3DA 1ZGCA 3C6YA 1XZGA 5ALFA 5HF9A 4EY5A 2VQ6A 3FLBA 5K3FB 1QIJA 3HSSA 2XLBA 2GBGA 2VT7A 2JGKA 2AJ8A 2QOEA 2WFMA 2LIPA 2XUAA 5AKYA 3WKDA 1C4XA 1TK3A 5EGNA 4P9NA 4AO6A 4GWLA 3WIBA 1QIEA 4X93A 3Q8WA 2DQZA 4U2DA 1G5FA 3LCRA 4KE6A 4GDMA 3WK9A 4AN0A 4E46A 1QOZA 4Q82A 2C4HA 4X6YA 4G8BA 2CKMA 3C45A 4B83A 3FBWA 3QITA 4EY6A 2WFLB 1CUFA 1UK7A 1IZ8A 1JJFA 2O7RA 5H3HA 2BKLA 5LLSA 3H0CA 5HK8A 1X2EA 4PF1A 1TIBA 1ZI6A 4WDQA 5DYWA 2DR0A 2Y2UA 5JARA 1TCCA 1TKRA 1QIGA 4ZGBA 3IA2A 4OYLA 3DD5A 4FKBA 5ISMA 4FTWA 4DMKA 4BAGA 4KRYA 3O4IA 3STYA 4H77A 3SK0A 5AKGA 3F96A 2Z8XA 2V9ZA 4RE6A 1EXWA 3NOXA 4DSAA 4O08A 3R0VA 1QIDA 3AILA 3ESBA 5LZ4A 1XZLA 1EHYA 4JEIA 1BCSA 2XQIA 1EVQA 3G9ZA 4Q05A 5FOQA 1IUPA 5ALEA 5D3KA 5D7BA 1W76A 4G4GA 1QZ3A 4BC1A 5IKXA 2QR5A 4E11A 5AICA 1A8UA 5CT8A 1ZD3A 3I1IA 4DNOA 1E89A 1F8UA 4WFIA 1AKNA 5K3BA 4FHZA 4M0EA 3ZV7A 4K6KA 1ZIYA 5YASA 2QM0A 4B7ZA 5T4HA 4UBNA 1R3DA 2QMQA 3D4LA 3QZUA 3A2LA 2OG1A 5FPQA 5CT4A 4BCDA 5A6VA 5ALUA 5FPPA 5SYMA 3I2KA 4QLAA 4P92A 2I3DA 3PDCA 5CMLA 2JEYA 3MUOA 5ALPA 1Q83A 2PU5A 1UFOA 5E4TA 2GBIA 4W1SA 2PSFA 4I4CA 1CVLA 1HL7A 3HLKA 3AJAA 3KWFA 4U2GA 1KU0A 4UBLA 2H1IA 2WIDA 3ZI7A 4XIIA 3O4JA 1THTA 2QS9A 1P0IA 2FUKA 5HFAA 3KSRA 1GZ7A 4QA9A 3VVMA 4J0DA 1SCIA 5AOBA 1GKLA 2H7YA 1ZJ4A 1K8QA 2GYVA 3KWJA 1TCBA 3ICVA 3FYUA 2WM2A 2WTNA 1UKBA 2WUGA 3CN7A 5ALQA 1VJ5A 3AIKA 2ORYA 4Y2UA 2OCKA 1K5PA 2RGUA 5DYTA 1DX4A 1THGA 4GW3A 3W05A 1W75A 2WIGA 3ZLTA 2GZSA 3VJLA 4Q34A 1VA5A 4Y2PA 2P8SA 3DYVA 5SYNA 3WL5A 2QUAA 2I03A 1CUIA 1AC5A 2DSNA 2OAGA 3PF8A 2ZYIA 4OSEA 2BGNA 3F98A 3K2IA 4LYDA 4AMZA 3IIIA 3F9CA 4KAAA 1R9MA 3RLIA 3V48A 4QLOA 3HACA 5K3AA 1UK8A 1T2NA 4QNNA 3L1IA 1BN7A 1XZBA 2WFZA 4B0PA 1BROA 2QJRA 1BN6A 2HA5A 3DLTA 3Q0TA 4HXEB 4MWTA 4U2CA 5J3JA 4LIPD 2OCLA 4X90A 3SC2A 5JAUA 3JW8A 4H7FA 3W04A 3HRHA 2XI4A 4W1RA 4RE5A 4U2FA 1CUVA 1H2WA 4NZZA 5DYYA 3HYSA 1JI3A 1CIJA 5KBYA 4BVKA 4X3CA 1Z68A 3I2HA 2XQKA 1VA4A 2VAVA 3DOIA 2J3QA 3D2CA 3WI7A 1QTIA 1USWA 2G5PA 1DQYA 5LZ7A 1YSCA 3DKRA 3TRDA 3KDAA 3MVEA 1AMNA 5ALSA 1GPLA 1E8MA 3NUZA 5FDFA 1CEXA 2HA7A 2GBCA 5HKBA 4ZV9A 4IO0A 2BAGA 1U4NA 5AM4A 5ALDA 2HU7A 2JGLA 4FWBA 2OQIA 5EI5A 2Z8ZA 1MNQA 1CFJA 2HU5A 5C8VA 3C8DA 3AZQA 4JNCA 4XVCA 3WKBA 4IHAA 3M81A 1QLWA 2HA6A 2X8BA 3VJMA 1R1DA 1EH5A 5LZ5A 5BWCA 1EDEA 3UUEA 4HXGA 5IVIA 4Y7DA 5JAOA 1Y7IA 3BDVA 5ALIA 2PPLA 1EA5A 2AXEA 5A2GA 2ZYSA 3WJ2A 2VF2A 1Y7HA 4YX9A 1U65A 4UFPA 3V1MA 1LPAB 5HQ3A 2Y2VA 4UHBA 3G9TA 4XWGA 4MJ3A 4U2BA 3WL8A 4KEAA 4DSZA 2VA9A 3OURA 5AK5A 3A70A 4Z49A 2K2QB 1XQVA 1PFQA 1JJBA 1HQDA 4YASA 1XQYA 4AMYA 4H0CA 1YAJA 5D6OA 3A2NA 1CPYA 1ZD5A 1ODSA 2R8BA 3IB3A 2J4FA 4ZREA 2WG1A 4PNZA 4B0OA 4ZRDA 2BFNA 4AX4A 4LXIA 1Q84A 2HHAA 4RNCA 4BZZA 2OCGA 4W1QA 1HKHA 3CCCA 1IUOA 5EHQA 3TGLA 3EIOA 3H19A 4W63A 2O2HA 2PSJA 3PI6A 4B6GA 1WB4A 4KJXA 4OPMA 5HCUA 1EI9A 1DTEA 3WLAA 2CUTA 1XRRA 4JUIA 1P0MA 3QVMA 3GUUA 4Y9SA 5ALNA 2FJ0A 2XUFA 5JANA 1YS2X 5AOAA 3STWA 1XZDA 2VATA 1W6RA 4ARBA 2JBWA 2XMQA 4K6HA 1B41A 1LPPA 5LZ8A 4EHBA 4CG1A 3WWEA 4FNGA 1MX9A 3BF8A 3RM3A 5AM3A 2HA0A 4XX1A 2CMFA 3PUIA 2C58A 4ETWA 2Z5GA 4BE4A 2ROQA 4K6GA 1ZICA 1EB9A 2B9VA 4JH0A 1CLEA 2X5XA 2HFKA 4ZI5A 3IUMA 5CURA 3DCNA 5ALZA 1F0PA 4G1FA 3JYHA 3K6KA 2RHTA 3QM1A 2VTVA 3M82A 3FSGA 1MN6A 3ZLVA 2WUEA 4A16A 3OM8A 2XQJA 3PFCA 2JGJA 3O4HA 3HZOA 4UBOA 1XLVA 3D3NA 4UBIA 4MXDA 1UK9A 1XKLA 4PQEA 1BS9A 3H2KA 5IVKA 4I3FA 4HZGA 1FSSA 2XMDA 2HA2A 3E4DA 4HRYA 1FFAA 5JADA 4B9AA 1JKMA 3GROA 2IX9A 3V1KA 2BUAA 1G66A 2WJ4A 3DOHA 5D3ZA 2HDWA 2IIVA 3O95A 3G02A 2D0DA 2PL5A 3FVRA 2VAXA 3R3VA 4LKOA 2JEZA 4DNQA 4EY7A 1GKKA 1WB6A 5C8XA 4J03A 3A6ZA 1CUHA 1YA8A 2XUKA 5E4JA 2XE4A 1DWPA 2QKYA 4AO7A 2PSEA 2PUJA 5CW2A 4C88A 2NW6A 5AHXA 2W6CX 3AINA 3D2BA 1U2EA 3MUNA 5ALYA 4OB6A 3I2FA 2OGSA 4KACA 3FWHA 5DJ5A 4X97A 3DJYA 2QXTA 4GI1A 4QDTA 2DQYA 1EX9A 1L7AA 1LZKA 5KWJA 5AKHA 4C4YA 3PUHA 2XLCA 2BUBA 1IZ7A 4PW0A 3C87A 2PSDA 5HK9A 3BIWA 3I2GA 2X76A 2CB9A 4H7IA 4X6XA 5K3FA 1CUGA 1EINA 1ZGBA 4KR0A 1QIIA 2XMSA 1JMYA 5IVDA 4FFWA 1MPXA 5FKJA 1R50A 3I6MA 2J4CA 5CT6A 5LP1A 2XB6A 3H17A 3KOOA 4AQDA 4CG2A 2WFLA 1W52X 5DNWA 3IULA 4HS9A 1CUJA 1MTZA 3A2MA 1W4LA 4PV7A 1OILA 3HJUA 5EIAA 5CXUA 3WJ1A 3DQZA 3IUQA 1LPNA 5ALRA 4LXGA 3WWOA 5JD4A 2QUBA 1J06A 3R3YA 4G9EA 4H7JA 1MAAA 4J0GA 4B85A 1H22A 1XFDA 1XZIA 3LIIA 3EQ7A 1GQSA 2FJPA 1XZAA 1LPSA 4N8SA 1OXMA 5ALHA 2I3ZA 3QPDA 4FBMA 3WL7A 3H2GA 4AZ0A 2ZJFA 1P0QA 1PV1A 5CT9A 4FFVA 2HFJA 5EFZA 4INZA 5AM1A 2GZRA 4X00A 2VJBA 1QFSA 4U2EA 1PJAA 1ACLA 4Y2VA 3E0XA 5AKXA 3WYDA 3F97A 5JAHA 3G0IA 1LPBB 3D59A 4F21A 3G0BA 2HM7A 3M3DA 3R3UA 3C5VA 3WK7A 4EA6A 4C01A 5I8PA 4BBZA 5BOVA 3B12A 4IH4A 4B81A 4H7HA 1CUDA 4C4ZA 4CI9A 4GBGA 3G0DA 4UFNA 4DIUA 1KU6A 3EQ9A 5A71A 1FJ2A 4OU5A 2OXEA 3WK6A 1CUCA 4H35A 1S8OA 2V98A 1QIHA 1XQWA 5ALJA 1A8SA 2Q0XA 3WMRA 3FLAA 3G0GA 2QJWA 1XRQA 5JZ9A 5AO9A 2YXPX 1EB8A 1ACJA 4OB7A 1CUWA 1GGVA 1XROA 3OPMA 4BRSA 1XLWA 3U1TA 4L72A 4QDOA 1K63A 4WY5A 4C87A 2RAUA 2AJLI 3FYUB 2VEOA 1TQHA 4UHHA 1A88A 1QIKA 4EBBA 2JGEA 2JGIA 1AQLA 4F0JA 3RK4A 5C7YA 4X91A 1M33A 2XUHA 4TVKA 4EUSA 3R40A 5K5EA 4I19A 2W22A 1A7UA 2PKYX 3AIOA 1TAHA 3IBTA 3U0VA 3FLEA 1W1IA 3BE8A 5E2IA 3DL7A 3WIOA 4QDXA 5LYYA 5AK3A 1D07A 5ESRA 2BJHA 5AM0A 2JGFA 5JASA 4LXHA 4HXFB 1LZLA 4L0CA 4BVLA 4DTCA 3FYTA 2PVSA 4AXBA 4ZWNA 2XQGA 3I1YA 2AJCA 2Y6VA 1YS1X 1RYYA 3STVA 4N8DA 2B20A 1CUAA 4LYEA 1QO7A 1QE3A 5JAPA 3DL4A 4BP9A 4Y2JA 5ALKA 2H9YA 3ESAA 2QTBA 4ROTA 1DINA 3FVTA 2XUQA 1AURA 4CIBA 5EHZA 4FMPA 3GELA 1ODCA 1UKAA 3BIXA 1QIFA 4Y2SA 1JMKC 3ED1A 4NS4A 3OOSA 2GBFA 4J0CA 1VXRA 3DS8A 3WK4A 4G4IA 2O7VA 4QWMA 3WWPA 5CBKA 4Q3OA 1NU8A 3S8YA 2ZSHA 1XRPA 2CZQA 3CCBA 3ESCA 4B82A 4DNFA 1B6GA 2UZ0A 2WHPA 1X70A 5FRDA 1XZMA 3YASA 2DHEA 4Q3LA 5DTIA 3JWEA 1VKHA 1N1MA 1N5MA 1ORWA 3I6ZA 3KXPA 2AJDA 4E14A 5FUMA 3QYJA 4DMFA 3WZLA 4UBMA 1WPXA 3ANTA 1XZFA 2WTMA 2C5FA 3BJMA 4Y2RA 4X7BA 3MGAA 3FAKA 3VVLA 3H2IA 1VXOA 1XRNA 2JF0A 4FLEA 1LBSA 1J2EA 2XDWA 5ALXA 3X3HA 2YH2A 1O6FA 3AZPA 2EDAA 4PSDA 5JIBA 5AKJA 1YB7A 2XUIA 1OCEA 3H1BA 4CCYB 3GZJA 5DNUA
chains in the Genus database with same CATH superfamily
1VHDA 3KJHA 3PP8A 1T91A 3A26A 4GAEA 1ZA2A 2FF5A 2XZDA 2PH5A 4CIDA 1FTNA 5ICGA 4KIJA 3R6TA 1V6SA 5G53C 2ACKA 2I4NA 3PXXA 2HU2A 3NHFA 5EG5A 1V8FA 5I5GA 3GWGA 4AKSA 4DCSA 3PLAE 3TJMA 3FB4A 3M8KA 1R4ZA 3X0DA 3N2YA 4X8OA 2C5GA 4MVCA 1XD8A 2IXBA 4FHCA 4BLOA 4ER6A 3OQMA 4WKNA 2OXFA 4UMFA 2EYUA 3I5AA 4DMRA 4FN4A 5E0OA 4DMLA 2B4RO 2Y66A 1OAAA 1XF1A 4IBOA 1OKKD 4R9RA 3EDOA 2G63A 2H2IA 2ZBFA 3RIYA 3QKWA 1BJTA 1ONBA 1EP9A 5LZ2A 2AF4C 1XCOA 1JR3E 2KSQA 3OEYA 3KQLA 1NV9A 4DG8A 1OHHD 4XVUA 2BI4A 3AC0A 5JJKA 1RI4A 2LTAA 4HNVA 3CR8A 2D5IA 1P0PA 3D5QA 4KAXA 3WGJA 5KB3A 2VJYA 4XJVA 5AJWA 4G67A 2WG0A 2EKZA 2QP9X 1E9SA 3DFFA 5JC8A 1KWKA 4YRFA 1UT5A 2G0AA 1SBHA 2H9IA 4ZCQA 5BT8A 1T1SA 2HCBA 1DEOA 4IV8A 4V0RA 5AI6A 1ZJJA 3NVMB 3WTCA 2QN3A 5TQ0A 4BO9A 1SJ9A 3PFWO 1JU4A 3F5DA 1OPRA 2YINC 3VC3A 4YGXB 4R7GA 5TMDA 1PWYE 4YBZA 4DGSA 1U9IC 5CYGA 2IS6A 4LSZA 3GBVA 5D85A 1F2TA 4WLNA 5A9RA 4DR4B 1LPMA 3DTNA 1NW6A 4E1AA 1K6EA 5C37A 4M88A 4M98A 1P1KA 3T94A 4XEUA 2VF7A 3NGMA 3WGLA 1TM2A 1WNFA 1CRLA 5KYTA 2QP4A 2YRFA 3PC8A 5TIIA 4JXKA 2H07A 2PVCA 4CLXA 4KQ2A 4OB8A 4LFBB 2NACA 1U1FA 3QX8A 4RM3A 3WB1A 4CMIB 1KYIA 2GM9A 1OAOA 3TTVA 1KI1A 3BSYA 4JOSA 1EDDA 4OHPA 1QKIA 5BXYA 4OKSA 2VJMA 2F1HA 2CSXA 3QFHA 5GTDA 2WTXA 2VPWA 2YW9A 3G5AA 3MJHA 2GERA 4HLNA 4GQBA 4B6RA 1JWBB 4CG3A 1JG7A 3EA4A 2Z4RA 5BUZA 4B71A 4RDXA 1A5ZA 2VSOA 3FAZA 1I3NA 1P3Y1 2FQQA 3ICCA 4YAIA 2PD4A 1KPHA 2J6CA 2UZ3A 1N2BA 4KXUA 4NYIQ 4EGQA 5K4GA 1K68A 1NNUA 1QHHB 1RU3A 1SIOA 3GX1A 3V8RA 3K0BA 4Q9HA 1KGDA 3PE4A 5C32A 1P1IA 4HLQB 3W5DA 5K3EA 1NIPA 4DY4A 2EEPA 1NA5A 1NBIA 1ORTA 2RHBA 2JGMA 1SKBA 1L5HB 2XOKD 4BDSA 5DTQA 2O3TA 4DA6A 1KVSA 1J2JA 3GH3A 5A0FA 1G7TA 3U9LA 3SJBA 3IVRA 3M33A 1OH7A 1UMDB 1QK4A 3H8WA 3H5IA 2V96A 4M8NE 4C0SA 5EJAA 1P7ZA 4JR0A 5CH3A 4TRMA 3PICA 1LNZA 2O9JA 2PS9A 4HAZA 3TSAA 1Z08A 1NF3A 1OFUX 2P9ZA 3H2YA 4MV9A 4GOJA 5GZ6A 3RTCA 1K08A 1LBEA 3VDXA 2QZPA 3IV7A 2NYRA 2PSHA 4H59A 4TN5A 5AXCA 3WJAA 2FEAA 3ZDXB 4QQFA 4N48A 1LF5A 2SCUB 3CZAA 4TKMA 3VH2A 1EZ1A 2FE1A 2FZKA 2YVAA 5F4ZA 3CIOA 5GPBA 1M1XB 3ADKA 4I7EA 3BIFA 3N2EA 3QTBA 3WA6A 1JR4A 5IC5A 4EYOA 1AF7A 1SD1A 1JA1A 1YGPA 2QAGB 4R1UA 2B1IA 1FTYA 2DGDA 2W6JA 3R3JA 4V0NA 1KETA 1OE0A 5DN6A 2VDRB 2EKLA 4OI4A 1XXHB 1QG0A 4BAUA 5HQTA 4WECA 1PGNA 4G24A 2JGAA 1WZEA 1XTKA 4R1NA 3HRIA 3SC4A 4EW3A 1KMQA 2VVTA 3MJVA 2IUYA 1CYEA 4Q15A 1BO6A 4RPGA 2OP1A 3EAGA 1DAHA 1JN0A 2PX0A 3OTIA 3T9DA 5GZ1A 3PNBA 2OZLB 2PGNA 3G2MA 5DI3A 2AUNA 4IQ0A 5LXTB 4Q3NA 3I83A 3HKDA 3MCAA 4MVWA 2ZWPA 1E64A 3H5NA 2PSSA 3I28A 5F1YA 2P9HA 5FEMA 2Q8PA 3SFVA 1RYBA 3KAPA 1OZFA 3FNBA 1I80A 1Y98A 4YQYA 3R7DA 5I9IA 2NP6A 1OR8A 3UJ7A 2PMEA 1U5AA 1FXWA 4XLLA 1ZPDA 4MQMA 1FDSA 2WW8A 6YASA 3L8FA 4YMHA 1KEKA 2FEWB 1G7CA 3DDWA 3LI2A 4NYJQ 5BV7A 1I7QB 4KXVA 1KMMA 4XKJA 3OQ6A 3N3BC 2VQDA 2LDBA 2EHJA 4A8JB 5DE3A 4B46A 2ZQZA 3GRCA 4Y0NA 4CLRA 3CG0A 3I9MA 2OP0A 3ZZ1A 4CMHA 4FB5A 5CB4B 4IDCA 2WAXA 4D8UA 4PC2A 5C4MA 4YCBA 1KJJA 1V1MA 221PA 2LE0A 3F8SA 1SZPA 1E6CA 1J2UA 3O3MB 3V4SA 5JBNA 3BIOA 1NXQA 1EFRA 3B8HA 2Y27A 3OG9A 5C5DA 4GH5A 3V1NA 1LLUA 3HC7A 3OJOA 3VVCA 1NW7A 4Z7OB 4D9IA 1COWA 3GFQA 4CETA 3OT4A 3PD1A 4GZ6A 2C77A 1J2TA 3GT4A 4PLTA 1F6WA 3CRRA 2WWRA 3QU2A 2O2JA 2GPAA 5EOVA 4DKJA 3K30A 5BMVA 3GPIA 3TI7A 1ZUNB 4H4DA 1YOVB 1L3CA 4X95A 3UGQA 3VAYA 4PLVA 1ULZA 2DFPA 3Q3HA 4JEMA 5LA6F 5LXTF 3D8NA 2DU8A 1QFMA 4MWSA 1P4RA 1SVNA 2EFHB 2HDNB 3VXKA 5CDTA 3HQ4O 3AKEA 3W8RA 1ORVA 2GEBA 5IAKA 1PNRA 1ZESA 4MQLA 3OLZA 4MULA 4B4DA 5LQCA 2A9RA 5DBHX 4LV5B 1QORA 4DRXB 3IDSA 4OXQA 5CPFA 1SUSA 2Z2YA 4BNMA 3KE9A 1EFKA 5D01A 1W0KD 1K6MA 1K3FA 1XLUA 3CN9A 3CSSA 3NDRA 4YONB 4BN0A 5IVHA 4FWIB 3HBNA 5FH9A 4Q1VA 5AHKA 2WT9A 1E1LA 3REQB 4TTPA 3QLUC 3O4RA 4PSKA 2ZIGA 1RBQA 4PU0A 1LPOA 3VDNB 3EW9A 3QU9A 1VKZA 3AP1A 3Q3JB 3JQ8B 1X80A 3RYIA 3PT9A 4G8DA 3PPXA 4ZV7A 1EVZA 4WZAA 3RBAA 1PUIA 1KYTA 3COZA 3DP7A 3ESRA 4C0QC 4PSVA 1L1RA 1XNQB 2FUEA 3FOAA 4JUCA 2A2ZA 2QRLA 1ZL2A 5TGTA 3OZXA 4ZDKA 1CY4A 4W5QA 3JQ7B 4DG5A 2GK4A 1D0SA 4KDEA 3KSDO 3TOVA 4CKEB 2ZJ6A 2CK3D 4ID9A 3WL6A 3PWKA 3K9WA 1NKVA 2EL7A 2QUIA 1XVVA 2X1HA 4ZVOA 5BSMA 1KMNA 3P9KA 1ZZGA 4HYQA 2VZ9A 5JCJD 4I46A 3TZHA 3DDHA 4MS3A 2BC9A 4MR8A 1FRZA 4D9BA 2WU3A 5JCPA 1TM7E 1NFRA 2HBYA 1EWQA 1E3IA 1SMKA 2HPZA 1L4KA 3R4CA 3GJ6A 3IGFA 3MHPA 1JJAA 1GPMA 2XNCA 3K0SA 4BNFA 2NIPA 4X71A 1BHSA 3QENA 1G6HA 3PUYA 1AGRA 3TSOA 1XMVA 1L6IA 1TPYA 2PRSA 2V9CA 3H18A 3GJRA 4JOBA 2NQ2C 2QTRA 2J0SA 1NVWQ 2FMFA 1QGAA 3FFWA 2R4QA 4C3UA 1H2XA 3X1MA 3ROFA 4QDUA 1G5RA 2QQGA 3UIEA 1U3DA 4WTOA 3RF7A 1DPGA 2N47A 3N1UA 2B8WA 1ZKDA 4MLPA 1X74A 3P4YA 2OCAA 4D8WA 3UMFA 1R0CA 4ALIA 3OQIB 2IIQA 1QO0D 4YROA 4QU9A 5JJBA 2NU9B 2D6FA 1DB3A 2YRXA 3DMHA 4AG3A 3EEOA 1P7YA 3EFOB 1ZK1A 2B34A 3MWFA 2C8LA 4IJUA 3HXTA 4RF2A 4ZVKA 4BBJA 1KKLA 1PVDA 3ICOA 4RX1A 5EIHA 4Z3KA 5JLJA 2Q3FA 4PCLA 1BX3A 1HFEL 1XJ5A 1T8WA 4OXYA 4AECA 2R3SA 1I33A 2VK8A 3OJEA 3ZHTA 2CJPA 1VQ1A 3IOYA 4KUHA 4Y2QA 1L5QA 1EXDA 5CLIA 3GLHE 4JAVC 4O1HA 4DADA 4ZQBA 1N6OA 4RJLA 2I62A 3CZRA 4CYMA 1CT9A 5A03A 2R65A 3ZD8A 1ORRA 1DX9A 4UXIA 2ZT8A 4WLVA 2EKPA 4YS6A 1N2XA 1WHTA 3BWEA 3L4EA 3UXEA 1E3SA 1C4WA 2BFDB 1VMKA 3NONA 1AUPA 2RJOA 3CH6A 4ALNA 3VI3B 4Y3UA 5FEUA 3TAUA 4QG3A 2NT3A 2KX7A 3PEVA 1Z12A 4IV5A 3UCFA 3UXHA 2F1RA 5BW8A 2PZ8A 4O4HB 2NQTA 5CT5A 2XQVA 3UAOA 4H15A 1TADA 1TCUA 2RHWA 4B33A 1NVMB 2ZT5A 4BTVA 2HIMA 2O6HA 1LDNA 2ZSEA 1MABB 1UM8A 2OO3A 3JWJA 3QKRA 5F78A 1E8NA 2YJ3A 3M1LA 3BXXA 1ZIOA 2NADA 3DWGA 1DVRA 1GGMA 3B5IA 1KDOA 1J33A 2B6HA 3G8YA 1HT0A 3QJYA 4TWIA 5DM2A 4B43A 1WZ2A 2RGBA 4BDTA 1BSVA 1M3SA 4O2LA 1UMBA 3G5TA 4CR6A 1XMXA 2G1JA 1T5BA 2B2XA 4NU0A 4CEHA 4UHEA 4GR5A 4QUBA 3BF7A 3ITDA 1ZP6A 1JMVA 1ECPA 1J1IA 3EWNA 4G4SP 4CTOA 3RWBA 2YWHA 3LHIA 4JVNA 1GCIA 3CYFA 3LY7A 2JVJA 5I7RA 4H7EA 1AJEA 3LDAA 2P6UA 1ZI9A 2QE7A 3K96A 5BQFA 2RHHA 1I3LA 1NX9A 1G5QA 4L5IA 4LE1A 2QRZA 1EAYA 1WVMA 3JZDA 5FBQB 5C1PA 3SQXA 3LP5A 2VJQA 2XYGA 1QE5A 1DKPA 1NW8A 3GGSA 4M1QA 4X85A 2DFKB 5DCLA 1RYNA 1LV8A 2QXUA 4I81A 4QTXA 3RD5A 1VZ2A 3L6RA 2QYSA 3D0QA 4BC0A 1GUDA 1R6BX 3KDPA 3EE6A 2IK8A 3ZWBA 4AD8A 3FKQA 1JAHA 3WMGA 1CULC 1GITA 2FMIA 2AMYA 1SCUA 1GPUA 1Y8AA 4GZ3A 5H5JA 1MZPA 1KXJA 1FSPA 1I9GA 3VNUA 1Z33A 2QSZA 5LC1A 2CXOA 4HYYA 4QEKA 4B3CA 1JNXX 1W5SA 3R7AA 4IJQA 4CW7A 1Z8DA 4PC1A 3N70A 3RABA 5MDHA 3C3AA 3OQVA 1UP7A 4YRSA 4HX9A 1GAQA 8GPBA 3HN6A 1Q1EA 1IWBB 1QHNA 4C4PA 5IJ0B 3V8EA 2C9MA 1IVSA 1UQUA 1L5KA 3TQOA 1M7HA 3UK2A 4HKTA 4YO8A 2HHJA 2CE7A 3PCRB 3KZKA 4FGLA 3UB4A 1F9EA 1ZOSA 3PYMA 3RHSA 3WXMA 4Y1RB 5HJ7A 4EDHA 4ND2A 4R2MA 4U7DA 1YNSA 4NEGA 1X87A 3ZDEA 5IPFA 5JLAA 2YZ7A 3DXFA 5C4GB 3TTTA 1PK9A 4NWIA 3BMNB 1NX6A 3EXHA 4FMDB 1ODTC 3UAWA 1FTWA 3B13B 4G56A 4DREA 1P7VA 1SUPA 2A1UB 1E61A 1QE0A 1ZAKA 3ZVLA 2DBYA 3R6WA 3FOBA 5L40A 3WXBA 1T4CA 4Z4HA 1UBHS 3JU3A 3UH1A 1P81A 2G7ZA 1K5GA 1V3UA 1Z34A 3MPUA 3PNKA 4CFYA 1QUEA 3ISVA 4DBVO 5FBWB 1FE8A 3SE7A 2XKJE 3B3AA 5IUJC 1P18A 1Z4IA 4FMCB 3VU9B 1PJBA 1Y7TA 5KYYA 1NRIA 1QF9A 2AD1A 2P9YA 2GM5A 3FRJA 3T3MB 3IE0A 4NK5A 5EQTA 2WWWA 4BQEA 4N3NA 5E9JA 4NCAA 1YA6A 2B5OA 3WLRA 4UHDA 4O63O 2BL4A 3DAPA 3E1SA 3ONEA 1OI3A 3QLEA 2YY5A 3V2GA 2R00A 2ZG6A 2FPXA 5AJHA 4CEJB 2BEWA 4L0MA 1OZAA 1DKLA 2YUIA 3F90A 5CXXA 4AB1A 3UTDA 5DEOA 1QH1B 3JVIA 5F2OA 4BP8A 2IX3A 4LQDA 4XJTA 4U6QA 4F9GA 4JYPA 3IE2A 4MP6A 4YT8A 1USIA 1Z38A 2XT6A 3SJZA 4OI0A 1H23A 1PWZA 1VP3A 2MSEB 1GCGA 2O1WA 1I2AA 1C3OB 3KKEA 3I3OA 1XEAA 4LNUA 3MQ4A 5D51S 3SIRA 4CM9D 2AB0A 4MGZR 5FWXB 2WHXA 4GMXA 4J6EA 1MU0A 4F8EA 1JVSA 3FFTA 2QG6A 3F9IA 3EGOA 3L1JA 2QAIA 1N6KA 2Q2OA 1S4MA 5DYGA 4YAUA 2BOVA 2FY8A 2XIQA 3E3MA 3HABA 3GFFA 2AD5A 3GBPA 3L1KA 3N6XA 4G4JA 4NMWA 2J6HA 3FOFC 1MB3A 1R16A 4A8JC 3A3NA 1SOAA 2PS1A 5ITWA 5COBA 4F38A 2BFFA 1EVYA 4W5NA 3JQAD 2Q4DA 1WZUA 1A9XA 1G20E 1CJVC 3N59A 2R6FA 1ESCA 1Q21A 4ZDIA 4F2PA 3I09A 2E6UX 3MTGA 1RHKA 4HS4A 2FW7A 3LZDA 4FOTA 4TQAA 3ZXYA 3EIXA 3EB9A 3VX3A 2ZJAA 1E2GA 5AOCA 2IHVA 2O8EB 5WRFA 1J5PA 1XEFA 2FK7A 1AQUA 4GDFA 5I7FA 1F3LA 2WAMA 3HEBA 1KMHB 2PUTA 1D0VA 2FUG6 2ATIA 2I6FA 1Q2XA 3OO1A 4O8CA 3WE7A 2ZI7A 3ZIUA 2GRJA 1U8EA 2EU8A 4R1MA 2C2YA 4FDMA 3VHXB 3KELA 5J4YA 3Q3VA 4KI0A 5EPEA 1VKJA 2Z3WA 2ZIZA 1WBDA 1CUXA 3QI2A 3ETDA 4I66A 3KXDA 3DUWA 5M29A 5H3LA 1J7JA 2XH8A 3JARA 5EINA 2ZOSA 1TF7A 1VZ3A 2QN9A 4E5KA 4W9MC 3EMBA 3O8BA 4PG8A 2JD0A 1Y6RA 3D3WA 3H65A 1CUUA 1G3IA 5EHNA 1V2HE 2R7KA 1Y89A 3RO7A 1GFSA 1PSWA 2DQSA 2WMOB 1AO3A 2XNKA 3BE5A 4CMGA 1IAQA 1JXOA 2EX1A 3NO4A 4QICA 1KAHA 1FSFA 4EY4A 4HMOA 4ZHQF 2A67A 2BEUB 1Y5MA 3BK2A 3NNNA 3RREA 1ENYA 2XYHA 1EMDA 3Q1LA 5CNMA 2XNJA 5HIMA 4EGSA 3JD1A 1BS2A 4OHYA 3OZTA 2ZTLA 2GCOB 3JQGB 1O77A 1TIKA 3K0AA 4LFCB 5A7GA 4EJMA 3FYCA 2A88A 1HZJA 3HGQA 1E2JA 2OKCA 1NVVR 4E15A 2BMFA 1GADO 1Z5WA 2J3KA 2PR2A 3IHWA 4MAMA 3F5MA 4P3YA 1SUDA 3PR3A 3WHLA 4P0PB 1RI3A 4O1IA 1GAEO 4DR7B 3OMXA 2E4YA 3SS9X 3EULA 3SPXA 2X3YA 1X2BA 3EGIA 4FR2A 2CSUA 2AOVA 4NJMA 1HE3A 2RG1A 4TV8B 1R12A 4AIIA 1XEXB 2GX6A 4HX2A 2Q3BA 1H1LA 3UNXA 3U60B 1IXZA 1RP1A 4LXTA 5T41A 5CIQA 3UK1A 1EDZA 1I5RA 4H3SA 1Y9DA 1N1EA 4Z1OA 3L84A 4NYMQ 1PTJA 4DJDC 1MJFA 3GZNB 3AEUB 3AR2A 3O84A 1VE7A 1RQRA 5BN5B 5K3SA 4GVPA 1P5RA 3Q6IA 2WTEA 3U4IA 4P83A 1DAPA 1L2TA 5CGQB 3T9AA 4XIGS 4F11A 2J7PD 4LY0A 3ZDDA 4HUJA 4M8SA 4TZ0A 4MAFA 4Q18A 3MSXA 3OCYA 4X92A 5AI5A 2J5BA 4P3OA 3ZOKA 5K0TA 3V4RA 1XBTA 3CNHA 4RZHA 1GG2A 5HQ3B 4DPMA 4JXXA 2WI8A 1KWGA 2QU8A 4INAA 4D3YA 4DVGA 3A31A 2GK3A 3DPUA 3LF1A 1NRXA 3IP1A 4P81A 3OKPA 3FSGD 3WHPA 3H7IA 2R1VB 4IH9A 1J09A 1E77A 1O6GA 1PEYA 4U5XA 4I5DA 4C4SA 1C14A 2W6QA 2SBTA 4HAXA 4BVFA 3ZWPA 1E4YA 1UODA 3BOSA 2QX4A 3ZHUA 2YNMC 5JSZA 2RFLA 2X0RA 5K8IA 1RM0A 1SBTA 1BRTA 2PDAA 3OKFA 4FQ8A 1HX7A 3HTXA 2BFAA 1GL7A 4YA6A 3ZCTA 4QTUB 3AFIA 1GZ6A 4EKDA 5GJVC 4L27A 2GJ4A 1J2YA 1JKJA 2IRWA 3IOCA 4UAGA 1ZISA 5COAA 5LYJA 4OHZA 4H7KA 4GOOD 4MO9A 3IBYA 4WD3A 2PJDA 2SECE 3O8QB 5LJIA 1BXGA 1QUFA 3DVSX 2J46A 3L0OA 2HTEA 1C2TA 4EJ6A 2FFQA 4KR9A 3H3JA 2QQEA 4ZEMA 4ON9A 1MT0A 2FX5A 4LYFA 4TTAA 5HIAA 4BKQA 5K20A 3MT7A 3A32A 4C22A 1QTNA 2X5NA 1EK1A 2UYHA 1Q7GA 3EXIA 2BM0A 3NWPA 4MMZB 4RCVA 4IRMA 5J4LA 1Z4QA 4KC0A 4OK3A 4LGYA 1P77A 3LLVA 1XLTA 2WT8A 4PZ0A 4S2UA 2WHEA 1E4EA 4LHWA 2OORA 4TTQA 5K0EA 4IF6A 4QKQA 1DSSG 4RTOA 1KI7A 3TLKA 4O2BB 4RH3A 1X0XA 3CZ9A 3PSHA 4DSUA 1KH2A 4DANA 1CQWA 2OZEA 5KQPA 3E7PA 4LN1A 1GLNA 3FDIA 4DMHA 4AYTA 3E5MA 3H1GA 2GPWA 4IMRA 4KH0A 3GLFE 3M1YA 3DYIA 1GRQA 1QJCA 3BDIA 4ND5A 2JW5A 3THXB 3DOFA 3K5IA 3FCEA 4AG5A 1J0AA 1R3UA 3DZIA 3MRTA 3ORFA 4BEBA 4ARZB 1FTQA 4PGHA 3EF1A 4TUYB 1A5AB 2VT3A 1UT6A 1ZM7A 3T61A 3V7FA 4M9XA 5CUQA 4EPXA 1VYHA 3D64A 4H31A 4NPHA 2XD4A 1AK1A 3PXBA 4IVRA 3RAPR 1GZVA 2PMKA 5KMGA 1K2VN 1XZJA 4I4IA 4ZHSA 3R5TA 1VL8A 5A4KA 2VOEA 3O31A 4BO8A 3I8XA 1UK6A 3PR2B 1COWD 4EHKA 3OETA 4ZV4A 3HP7A 5BORA 5JH7F 2B61A 2R8ZA 1BJKA 1C0PA 1ULAA 2W2VA 4OIFA 3W5SA 2HJVA 5HVNA 1JU3A 3LPNA 1QFZA 5TV2A 4Q21A 2B83A 1XJQA 3UWPA 1KYWA 4MOWA 2BJWA 2YYSA 4O2BF 3TW4A 2VHWA 4J91A 1NATA 3EPPA 5EY5B 2O2GA 3D6AA 1KS9A 4HGQA 3ONNA 4B8YA 1M34B 4QPZA 1L5YA 4Q48A 1U5BA 4PQGA 2QNIA 4NQZA 3KOWA 4Z4IA 2DPHA 1BWQA 4E94A 2L2QA 2BJVA 5TLSA 3AJ8A 3NOOA 3K1AB 3EQ8A 3QY9A 3PQ4A 5C31A 1J9ZA 1QIMA 3OE7A 4PSCA 2B78A 4GGMX 1T36B 3UUFA 1KKUA 3BB1A 4X6UA 1ZJ6A 1AZLA 2XMCA 3UVEA 3EYAA 3AESA 1PNOA 3BMQB 3ZUGA 1CDDA 5JH7A 3OOJA 2W7TA 1DJQA 3DE3X 4FD3A 2RHCA 4JELA 121PA 4TUYF 3VH3A 3ADBA 1CEEA 1GTG1 1A77A 1LQTA 4UDXX 1JKXA 4J90A 1M6EX 2OBYA 1E4VA 2JNWA 5C53B 2UVDA 4ZMSA 4LCBA 4Y2YA 5FLKA 1EP3B 2LP4Y 1I7PA 4LYJA 4AF7A 4O59O 5KNCA 1T6XA 1ARZA 1E7RA 4DUGD 3CMMA 4A82A 2OM2A 4MEAA 3PEYA 5E6UB 2Z8YM 3ANXA 4X1OA 2XIJA 4ZVVA 1SVWA 1QV6A 4KDRA 1XALA 2VDQB 4QOJA 3UHPA 1KY2A 1YNOA 4OGLA 1QANA 3D2LA 1HPLA 2YQ5A 1DELA 1IJBA 5DHFA 3R7LA 1HEUA 1YZFA 1V3VA 3O8RA 4BNNA 2Y0CA 5H02A 3EDRA 1SXJB 3HI4A 3PQ8A 2ICAA 4GYYA 4UCFA 1EUQA 1B3RA 2Q5LA 1H2HA 3RKSA 5PGMA 5G1OA 4DCJA 2HHHB 1P2BA 5H4GA 3HO1A 5CM8B 1XHLA 4HX5A 5TSDA 1UBCA 1Z6ZA 2Y92A 4DS3A 3JQ9C 4BGDA 2JCXA 2QZ4A 3M5CA 4XA8A 2CLHB 5AW2A 4KR7A 1ONOA 1ZLXA 4M1OA 4PFSA 1I8TA 4JP3A 4Q24A 3TQQA 2ZBRA 3QVWA 4R3NA 1KNQA 1M75A 3ZU3A 1T15A 3K94A 4BTLA 3LIPA 4NBLA 5FL7D 1H8ED 2NXEA 1H6BA 2FWMX 4PCUA 4Q7EA 4I2NA 3D0OA 2VL7A 2CKDA 2IYWA 4IG4A 3WNCA 2V59A 5DX1A 2C0QA 2O20A 1E99A 3AZOA 4I1IA 1JHAA 2A58A 3IALA 4WCVA 1EGVB 1Y6FA 5IAJA 3VKHA 1DC7A 2HLNA 1BE0A 4I55B 4YMVA 3LHKA 2OBNA 3P2MA 5EE0A 2WHQA 3EIQA 1H2BA 4MS4B 3EQ6A 3GLVA 3RYFA 3HEAA 3FYSA 2AXNA 4MJLA 4PXYA 4HZUA 1HE5A 2JAHA 2HJSA 3EK2A 5MN5A 3BFPA 3K2BA 3VJKA 1SIWA 3A3YA 2JHCA 4ANFA 3KO8A 4NBSA 1D2GA 1MOZA 5GOZA 1GT91 3SICE 3KP1A 4UTZA 3HVJA 1N5RA 1MC4A 3PI7A 4RYLA 4IUDS 1G0NA 5EWLA 1W48A 3C48A 4RV5A 1NVKA 4GPTA 1ETHA 2VRBA 2Q99A 3JSXA 3LKDA 5JVDB 3UANA 1ACMA 4PZYA 1UINA 4HGNA 4L9AA 1GYRA 1CUSA 1GQYA 3DBVO 2JI8A 4FYIA 5FTNA 3PZBA 5U4XA 3EYWA 3T1TA 1U0LA 3K32A 2ISQA 2ACVA 4FUQA 3QVSA 4G0WA 5D3MB 1DJPA 2Z08A 2GKOA 2IBMA 1IPFA 1LLCA 1XTBA 3OU6A 2DR3A 2NXWA 2IYNA 3PJDA 4G0YA 3ZN2A 3TZ6A 3RQSA 5HGXA 2CFTA 1K27A 2BFWA 3CF4G 2O2ZA 3M9LA 3N2GA 4KJZA 1PLKA 5LFAA 3C74A 3WV5A 1DAGA 3ECAA 1ZOLA 3PT5A 5HF9A 3CPEA 3E8MA 4YAJA 4LRUA 1HFKA 4FEEA 1E1DA 1A7JA 1JPVA 1LV7A 1OF1A 2CVFA 2P8JA 3UJDA 3FSRA 4NI5A 1Y8RB 1P33A 3QVJA 4BASA 4OQQA 2QSYA 4ZAZA 4WK4B 1W2WB 3AHEA 2XTJA 3K73O 5EMLA 5BSRA 1FRNA 1SUBA 3VQTA 2AZMA 2LIPA 3DLHA 5AKYA 3O8LA 5EXXA 1EFLA 4LAFA 1VMDA 2H2WA 2JGDB 2X15A 2XCUA 3KZXA 3KJQA 1ZCZA 4P5PA 4JEUA 1N9ZA 2D2FA 3T7AA 4ZYXA 4QTTB 4Z8XA 4GWLA 3WIBA 4BFVA 5F98A 1QIEA 3ZE6A 3CVOA 2DQZA 3HUFA 2VJNA 3AL2A 4LECA 1R6XA 2FRVA 3WK9A 1VPEA 3KTDA 4V1CB 4JV5B 4X20A 3ENNA 2QYTA 4CV0A 1I4LD 1WKCA 3BERA 1SHTX 3CUUA 4BFZA 1AG9A 1ZN9A 1C3JA 1Z7BA 5M7EA 1QU3A 4UTPA 1UEIA 1TT5A 4B83A 4O0MA 4CQNA 1NC1A 1USGA 1V6AA 3FBWA 1Y6JA 2FKAA 2Z6VA 3MMXA 4NPAA 5E0KB 1EKXA 2DBVO 1RJGA 1EE9A 2WFLB 3AK4A 3P52A 2D0OB 5HKKA 4XE5A 5F3WB 1YC2A 4JL6A 3FI9A 1TMOA 1PR1A 3D9QX 3P19A 3PC7A 4MROA 2PH7A 1Z28A 4UEJA 4YRDA 2XAAA 4BNVA 3DZGA 2YBDA 2REXB 3DE0X 3H0CA 3QPVA 1NLMA 2L18A 1X2EA 4A92A 2Q2VA 4P5DA 4TXHA 5B53A 2G5GX 2A0FA 2H06A 2WWFA 1S2NA 4AJKA 2FG6C 3V8PA 2V6JA 3T54A 1FS6A 3OOWA 4PHGA 5AD1A 3MAJA 5I4CA 5KTRA 4CT5A 2DR0A 5JARA 1DDOA 2PQ0A 4OGWA 1Z4LA 1E62A 1QHXA 1BH6A 3H2ZA 3FSEA 3NTVA 4N0MA 3D3JA 3GLIE 1X7DA 3D1JA 4FVTA 2R6DA 4R9UC 4RD6A 2VZEA 3F2VA 3QIAA 3S2YA 2X6TA 1IIBA 5C0OE 3UKDA 4KN6A 3NTUA 3W7VA 4ZI7A 3O3OB 1QYCA 4AVYA 2VQFB 2JIMA 2DF8A 4JU8A 1O95A 2PRZA 4DV6B 4WLUA 4BQRA 3BRCA 4RVCA 1MFZA 4H77A 5HYVA 3E84A 1QVRA 5CNIA 3KBOA 1MA0A 3EIEA 3HN2A 1T9GS 1IEWA 4EJ0A 1KTVA 2FA9A 2H4WA 3A0UA 3TLJA 3FHJA 3FTFA 2FPLA 1E1RA 5AKGA 5T64A 1J0CA 1FLVA 3FF4A 4R2KA 5U1PA 2YWJA 3OZFA 3RI3A 2BGWA 1G3MA 1RM3A 2IPNA 4YFYA 3L7YA 4TWAA 3CX8A 4R7TA 4UTXA 4YAWA 4ESHA 4Y7CA 2FI1A 3ICPA 4XFDA 3QU5A 4G1VA 4W8HA 1X7HA 1QH9A 3HKBA 3R0VA 1O54A 4EVQA 7REQA 3G79A 4S2EA 3RVSA 3LGSA 4KX5A 1RZVA 1D2CA 2VBCA 3L43A 3SEQA 4KDFA 1KDYA 1VM6A 4GNRA 4DAOA 1FRVA 1I0ZA 1TYDE 2EZ9A 2YV5A 1TX4B 5L51A 1QH8B 1NVAA 1JDJA 1PWEA 1G7SA 2J5KA 3KQYA 1ZDMA 1EHYA 1U8XX 1A04A 1Q1ZA 2OXCA 2Y0EA 4ALMA 4D79A 4QHTA 1BCSA 3VPXA 3RUCA 4M6WA 5MFPA 5DGTA 5C8DA 1KAEA 1O96B 1KDZA 3HNPA 1ID1A 4TKUA 1PL0A 3GCXA 1QFJA 4C05A 3HXOA 4DZZA 2Z9BA 4KLCA 3VNQA 1R27A 1XDSA 2R79A 3P9XA 1JLLB 4IAOA 4K9QA 4LI3X 3ZWMA 1Z8FA 3E22B 5C5EA 1WD7A 4HK4A 2XCSB 2FWAA 3PVZA 4NOKA 4UM5A 2YC2C 2WEKA 5D7BA 1W76A 2Q4EA 5DK6A 4ZAGA 1NXXA 1QZ3A 3JATA 3AR4A 4KXNA 5K05A 1CY7A 1JHRA 3QELA 3UOWA 3ZHCA 4E11A 5J40A 4PIPA 1A8UA 1UBFA 1ZD3A 4DNOA 2AKYA 1F8UA 1HG1A 1NBEA 2OL4A 4YTEA 3K70D 4Q4HA 3S7TA 4NRDA 2AVDA 5E2AA 1YI8A 1H3NA 1RWXA 1Q2UA 1W88B 1WXXA 3ZCRA 2CVPA 4FM9A 2G5CA 1RAFA 3AV3A 4F1JA 2ZJBA 1C4OA 3HY4A 4ZEOA 4RULA 3MLBA 1GIAA 2ZRMA 2I9KA 4FHZA 1Q12A 2ECPA 2XKAA 3N8KA 4FCVA 4FT4A 4M0EA 3ZLBA 5BVGB 4Z3DA 4GO1A 4CN9A 1XVTA 3GR6A 5EMKA 2QENA 4ZZ3A 3AVXA 3FHTA 1V96A 3FTQA 4OEHA 1Z5ZA 5L4LA 1EK0A 3VMMA 4B7ZA 1GG9A 1CS0B 7AT1A 4YWJA 4EX7A 3EOZA 3KLPX 2XB8A 5L9AA 3BHIA 4PY2A 4BNKA 4F8YA 1Q6ZA 2HGSA 1NQAO 3WRYC 1R3DA 4FCWA 2QMQA 1N2IA 3RKUA 2YFHA 1T6BY 1U5CA 7ABPA 5KVSA 1XC7A 5EKDA 4E03A 4OUDA 5ENDA 3EASA 4J6FA 2H59A 4XW2A 4YP1A 4X64B 4BKOA 4BCDA 1RE0A 2QDXA 3L8CA 1AGNA 4L5AA 5ALUA 4XRGA 5JWRA 1M5RA 3C6KA 3FTDA 4ESEA 1OXVA 1UMKA 3NTOA 1YB4A 2GUGA 2VF8A 1BMDA 4MIEA 3IDFA 4RESA 5CYOA 5JPCA 2D74A 3P20A 1TGYA 1GNVA 2RARA 3ZTYA 4AJ4A 2IYUA 1QHFA 2QVXX 2JCVA 2RB4A 1V9SA 4M37A 3UV7A 2OD2A 3JYNA 3V7UA 2IYTA 1QKJA 2JEYA 1V7PC 1FFSA 1H6AA 2QN8A 4HFMA 5CMLA 3AYXB 5ALPA 2J0UB 5HMLA 3ABIA 5KYXB 4U4AA 1U0EA 2HYIC 2EKQA 3IELA 1UFOA 5FLXA 4UUBA 4MV8A 1L8LA 1SIBE 1Z8HA 1DHRA 2FX3A 3ACCA 1E9RA 2GBIA 2R44A 2EZ4A 2BMEA 4GXQA 4J94A 4KMMA 4L50A 1G1MA 4TZTA 2NU7A 3AVWA 1CVLA 2QJOA 5KYUA 4M9RA 3AJAA 3O90A 3I6QA 3OHMA 1E32A 5IC6A 4YP6A 2GFHA 2CLOB 1KI2A 4U0KA 4H3VA 3K1TA 4LHYA 4QYMA 3UM9A 3PSAA 5EE3A 4LW8A 1SXJC 4HAOA 3OCWA 2CC2A 2C20A 4C6TB 3LX5A 1BCRB 3KX2A 4ZOBA 2WIDA 3EISA 5FI0B 4Y6GB 4QUAA 3N39C 1P74A 1ST3A 1MC1A 2KHZA 3EXFB 5JSYA 3O4JA 3ND5A 4HNAA 1GDDA 1J4AA 5DVZA 3RV3A 1A9QA 2K5UA 3WGZA 1THTA 2QS9A 4XYMA 4GEKA 1I7DA 2B37A 1UAGA 2G1KA 4BNLA 2JLXA 5IJZA 2F6RA 3RVMA 4Q4CA 4ZANA 1LVUA 3PS9A 2QZJA 2JJ1A 1D5CA 3KSRA 4MR7B 3C3JA 1RQLA 1FF9A 3BE6A 3LXRA 4J0DA 4ZQCB 5ICMA 2VC2B 3NPMA 3ODGA 4MRNA 5IDYA 1Z37A 4JI4B 4LJKA 1C7FA 1W93A 3ABZA 1NG1A 4RELA 4YALA 4D9HA 2Z6AA 2NV2B 4FE3A 4GNKA 2GJAA 4N0PA 5DBOA 3X1XA 5CDYA 2DPMA 3NYQA 3U44A 1F8FA 2WUGA 4D25A 4EA9A 1VJ5A 3OAAD 2ORYA 2OCKA 1K5PA 4CTNA 2ZCJA 2J0VA 3QUTA 4D0LB 5KOJA 1DX4A 3BORA 5IM4A 3RJ9A 2AEJA 5DM60 3VR4A 4TMFA 2VP2A 1Z9BA 4YJ2B 5CB8A 3N7UA 5JTTA 1WHSB 3OQHA 5KHOC 3WP1B 4BLUA 3CVUA 1AMUA 1QAOA 1W4CA 2GZSA 2WA1A 2FQ1A 3A1SA 1L5SA 3H9CA 4OG2A 4RPIA 4IX9A 4Y2PA 1IXKA 2IP2A 3D8HA 4I9HA 4P34A 1RLIA 1G3RA 4IJMA 4XVHA 4KQ1A 3RPEA 4BO4A 2V1UA 2I03A 3GT7A 4TXNA 3G17A 3O2NA 3SF8A 2FW8A 4O4JA 1Y8QA 3D4NA 2XVXA 2EBFX 3IAEA 3NOVA 4PBRA 3TL3A 1XX6A 2DSNA 3NBUA 4PLHA 4ZVPA 2BGNA 2QG9A 5ITZA 3K2IA 4LYDA 2D8AA 1AQ6A 4KQ6A 3VR2A 3IIIA 4UHKA 1JP7A 3WQQA 4IIVA 2QMOA 5DX8A 2NVOA 3JAWB 4EYSA 4F71A 6CHYA 3OBIA 2WMDA 2ONKA 4MWBA 4X5OA 5K3AA 2WU8A 3PD0A 1ZITA 4KQGA 2C1ZA 2GCNA 3SAJA 1BROA 2PH3A 3MEQA 5IH3A 3WLIA 5BSHA 2NTYC 3DLTA 4HSGA 4REQB 4PYKA 4U2CA 4M7RA 3VJRA 1D1TA 2BEVA 4LIPD 2QLMA 4RA9B 4DF3A 3OMWA 3LPLA 4K2HA 2F8SA 2IE0A 2ZSDA 3ZCUA 3RFXA 1VPDA 2IW3A 4JC0A 1R5NA 2I6GA 1ZCFA 2NLOA 4WOJA 2RAVA 3DVLA 4YJ2F 4YT5A 3TTSA 4IX1A 4IFEA 4HRVA 2GXQA 4L6AA 5I47A 2QRVA 3ABRB 3G8DA 5DK4A 3MTAA 2PGAA 4W1RA 3WGVA 1XTPA 3ZHSA 2SHKA 3D7MA 2H1FA 4JVLA 4P7GA 3UJNA 5JXJA 4RD4A 3WLSA 1QP8A 1P4HA 1CETA 1PIWA 2JLQA 2XWPA 3E03A 1NW9B 3PUKA 3O73A 5KBYA 4CODB 1YD7A 4W7IA 1P45A 4JYCA 1CW2B 1POXA 1VTKA 3KB8A 4OL9A 3EW7A 5B64A 2M6SA 3CNOA 2OO5A 5DGXA 3GUZA 1NQXA 4TYPA 4AZVA 2NVBA 5G0TA 4F2DA 3LECA 4O02B 1GR0A 5GVSA 3K15A 1FDUA 2K4MA 2O1EA 2W6ZA 2Q41A 1QTIA 1UAAA 1FYVA 4TYYA 5LZ7A 1FDIA 5BOSB 1Q7TA 4DJFC 1U0BB 1SY7A 5ICCA 2HLHA 4FUTA 1C9DB 1GPLA 4Q37A 1E8MA 2A5YB 2HF8A 3L4BC 4BV3A 4UU1A 2KQUA 3TLCA 2C82A 2HH9A 4R1PA 4QECA 5AQ1A 4AU1A 2BFBA 4J8PA 1WO8A 2XTNA 3HA2A 5IWAB 5EMMA 1RHUA 4M21A 4U63A 5HKBA 3T1HB 1Y3HA 1HTWA 3U39A 2WDPA 3I8OA 2OKGA 1UOEA 4NJOA 3G49A 1RE1A 5AM4A 3QVLA 4GMDA 1ESMA 5ALDA 2J6IA 4FWBA 2ZS8A 3OCUA 4LXXA 3JQ6A 4F06A 1XYGA 1N8KA 8MHTA 1N25A 1C8KA 4RGQA 1ZGJA 4EZBA 3AOEA 1Z63A 4JVMA 1Q17A 3LDFA 2YMPA 2YTZA 2V5UA 4BGVA 2PGXA 1QLWA 2HA6A 2X8BA 3VH4A 5J9FA 2IL1A 4G0NA 1EH5A 1K6XA 2V7EA 5LZ5A 3GA5A 5HE8A 3ETEA 1X7ZA 3DR3A 5LQRA 3O1LA 2NU6B 3PTZA 4E12A 3U61B 1ADJA 2NYUA 2P1ZA 4WXPA 1Y34E 3IMEA 3UUEA 2IUSA 5BR8B 5JAOA 1Q3HA 1XT6A 2PMBA 3BDVA 1P0CA 3D4IA 1DEAA 1NJ2A 2GRAA 3H9BA 3IP5A 3UK6A 1BNCA 1FJHA 3PIDA 5TQVA 1EA5A 4RHXA 3UFXB 1U3FA 3NHWA 5KTOA 4UXHA 4IJ5A 5E95A 3WJ2A 1L4BA 1RFLA 4GGOA 1W29A 1Z0SA 3SCZA 3ZX4A 1J8MF 1Z2EA 1W44A 4YX9A 4ZAVA 1PNVA 5K6AA 2IKSA 3WWZA 1N2OA 3R2JA 3B1KA 2Y2VA 1KI6B 3H1TA 4FCTA 2C3OA 2Y4NA 3OHSX 4UHBA 3HCDA 1EE1A 5EEHA 3Q15C 2I71A 4IICA 4XWGA 4RSHA 2H11A 1QX4A 2JI7A 4MJ3A 4R51A 3WL8A 1OIVA 2FFJA 1EZ4A 3R77A 1IBRA 2YR0A 2P2GA 3SQMA 3U1VA 3V4FA 4X1KA 2WMYA 2VA9A 4V0KA 1MP0A 2IVFA 2VHUA 1PFQA 3A1WA 1JJBA 3CC8A 3OPYB 4N03A 1IUKA 1EESA 2DECA 3MWYW 1W5AA 3CLSD 3LNTA 3PL1A 3QJGA 4HAWA 4IGFA 4CJXA 1T1IA 2FRDC 1DZIA 4MW7A 3CLVA 4Z54A 1E2BA 3RTAA 3ZY2A 1RWWA 1T2EA 1ODSA 2FUNB 1Z25A 3C3KA 3FCSB 3R1IA 4HATA 4F4IA 3MHTA 2ORED 2RGGA 3FWYA 5IEJA 2JJ8A 4GPBA 5DXJA 4EUEA 4RLHA 2HBRA 5TY0A 3ENKA 4ZRDA 2Q8NA 4DIOA 2R84A 3GLHB 3DNPA 1Q84A 1RADA 3W5IA 5ELMA 2XWJI 5F21A 4RNCA 4HYEA 2QQ5A 5FADA 3C15C 1TJNA 3RU7A 1BFDA 4FP9A 5ETJA 4W5OA 3MT0A 1SVUA 3ER8A 3AP2A 1SVLA 1L0BA 1ZD8A 3BCHA 1T9DA 4LF7B 3DVQX 4C0HA 2Q3MA 3R3SA 2PSJA 5FTKA 2FGJA 3CJTA 3AR9A 1TGVA 3BZBA 4UMEA 3HP4A 5LUAA 3THWB 2XEDA 2J9GA 4B3TB 1B26A 2A57A 3KQNA 3S8MA 1QAQA 4Q9KA 1M8KA 1KC3A 1SKQA 3NV9A 4JL8A 2ORWA 2J67A 1ZYUA 3HPQA 5A4AA 4JC8A 4MV7A 4PM4A 4DL9A 3IOEA 5D1HA 3JYPA 1QDUA 1KPIA 2ZB7A 4Y9SA 5DSZA 1KDVA 4AZWA 4BIMA 1B3BA 2HNKA 3L6UA 3LCUA 4JJ8A 5JSQA 4O5AA 3UF0A 1ULSA 4A4DA 5ALNA 2PQ6A 2BSQA 1E2NA 4NXMB 2IY9A 1HFWA 4PGAA 3PC6A 4HGPA 3LVFO 2CW5A 5KQSA 3STWA 1XZDA 3RC9A 2VATA 3AI7A 4C7VA 1FYXA 1IEXA 1W6RA 2Q3LA 1XCMA 2VDWB 3LVBA 4HQ0A 3ZD6A 1NVFA 2O0KA 1YRQA 1QVZA 3IQEA 4KSCA 1IBLB 3WWEA 1MEOA 1OREA 1U31A 2OV6A 1XZQA 1N5KA 1VIVA 4I3GA 4MCHA 5L6MB 1E1YA 2Q46A 3JQEA 4AS1A 1X3SA 2G06A 3VSEA 1X1RA 3AJEA 1Z2CA 2V7BA 3HR4A 4BE4A 2XSZD 1A2KC 3FDFA 4XI9A 5BMOA 1RPJA 4JGIA 3WLTA 3WL4A 2GVNA 1I3OA 3ZV4A 3CW8X 3DCIA 5I45A 2I6TA 2QD5A 4CMIA 4L4ZA 2P9QA 2UZ4A 4GPD1 1DRJA 3PL5A 4KNVA 2Q4OA 4YRAA 2HFKA 4NE9A 2Y0DA 3LT0A 1Z39A 2JCYA 1DCTA 3ILVA 4KKVA 3CLTC 2HQBA 2BD0A 1FNNA 3CONA 3GYBA 2RK6A 3P0IA 3E82A 3VPCA 1P72A 2PYDA 2VS1A 2ILVA 3IAHA 4JLPA 3BGDA 1L4UA 3ROEA 1QV7A 2P11A 3IJ5A 3WVNA 5E9QA 4Z0NA 2WPDA 4DBZA 1QHHA 3LY8A 1E6KA 1DJMA 1IWPB 1BYIA 3M82A 4BQPA 4C30A 4P7KA 3OWXA 1AA9A 3U7RA 3DV0B 2XQJA 4H4CA 2JGJA 1ZH2A 4IRUB 1XP8A 3OF2A 4GKBA 4KK3A 3H8VA 5HPYB 2JFFA 1L5WA 3HZOA 4UBOA 1YC5A 2Q5HA 5P8WA 3UH0A 1UMDA 4UBIA 2RCYA 1JIIA 2QN2A 1UK9A 2VJPA 2NAFA 3E15A 4CV1A 2DPYA 2B25A 2P4SA 4R2JA 3U19A 3BQNB 3DHVA 4QRIA 1UDXA 5JRJA 1L4NA 4JB0A 5BSFA 4YJ3F 4GSLA 4GWGA 3GPCA 1TM4E 4QGHA 2C7GA 1FSGA 4KQWA 2IEIA 3U17A 1OSNA 4EM6A 4YJFB 4DV7B 1XI2A 2WYHA 2XDQB 3GLGE 1ZCBA 2YYYA 1ZH4A 2SCUA 4AROA 1KIAA 5IK2D 3S44A 4GRDA 4EYEA 1NBMA 3M3HA 2J31A 4GBJA 2O5CA 2QAGA 2F43A 3MWDB 1QHGA 5JADA 3I23A 5KJ6A 4F4UA 4AAYA 4L4UA 4DA7A 2ZYVX 4HNHA 5K8CA 4TQUS 1J0EA 3N53A 3NHBA 3V1KA 2OHGA 4F9EA 4YI5A 2CT8A 2OZPA 2WJ4A 1FP7A 5D3ZA 2AX4A 2FP4B 2I3BA 2GZ3A 2W8ZA 3TOSA 1XL1A 2PCLA 2HN9A 4WSOA 1EG2A 1PK7A 5IBPA 1N2GA 4K26A 1EM8B 3OSUA 2X5OA 3I39X 4GWKA 5ICEA 3FVRA 4FOSA 2C4KA 3E9QA 2VAXA 2IP1A 1ZQ1A 4AK9A 2MU1A 5DHRA 2HHCA 1K06A 2KYRA 3ET4A 4Q7JB 4ZOLF 4DNQA 2ZJZA 1M74A 2JRCA 4RTMA 1KYZA 3ET5A 2DTDA 4QQ8A 3CZPA 5L3VA 3T35A 3KXKA 3GDGA 3TF5A 2ZZMA 4JJ4A 4I0WB 3PB3A 3UEOA 3G2PA 1TC1A 1IM2A 1IZ0A 2XUKA 2X8JB 1YMUA 4G5RA 4MVJE 4ZIRB 1CJCA 4WNIA 1CE8B 3FNQA 3WO0A 3FBGA 2GHQA 4KI7A 3T3PB 3HU1A 3Q8MA 3GW8A 5CB4A 4B17A 1G5PA 1CHNA 3SOPA 1E18A 1G20B 3AM5A 2ZTMA 3NW9A 5G40A 5H3CA 1JH8A 3HR7A 3L7DA 4CUKA 3T3OA 4NMLA 3G8CA 1RHRA 2B21A 3LT5A 3P8ZA 1LTQA 4QARA 3VHRA 3AINA 1C0LA 2B82A 4RK5A 4EUFA 2VA8A 1WW2A 1X7XB 1U2EA 5JT1A 2DOKA 1Q7RA 4J1SA 2OB1A 4MDHA 4XR4A 5ALYA 1HR0B 1CZNA 3OZCA 3SHWA 1TAGA 4Q7MB 2XGOA 1TC2A 1ZUNA 3JASA 1KFCB 5DJ5A 1L9XA 4GI1A 4QDTA 4D0GA 1CX9B 1EX9A 4YMSA 1P2DA 1L7AA 4O2AF 3FETA 4KWIA 1MJHA 3PRJA 3L04A 5JYEA 3PUHA 5HA5A 2AHOA 2TMGA 4WKCA 5CD9A 3H3FA 5EP4A 3JWGA 2FP3A 3Q9SA 3C87A 3OIYA 1YS4A 3U4HA 2PSDA 2H29A 5CFNA 1XNJA 2X76A 2PRYA 3QQ5A 4R1OA 3PXGA 1U8TA 1JUDA 3BL5A 3KBBA 2BGJA 3JV7A 4OFWA 5E1DA 4CHTA 1KAGA 4H0NA 4BLPA 3REQA 4UUMA 3VTAA 1NLUA 4JI1B 3EWAA 3CEHA 3E35A 2JLRA 3WBKA 1S9HA 3JQ8A 3FTPA 1NDUA 3LX8A 3FPFA 1ZGBA 3OOEA 5EZ5A 3WOHA 4AL4A 1YJQA 1QIIA 4I4TF 1YDWA 3HCFA 4PLGA 4E5PA 3OLXA 1TU4A 1ENZA 2CYAA 3OECA 4FJ2A 5FKJA 4BFYA 4ERXA 2MT9A 5THKA 4BGEA 1UBMS 3X1YA 4EHFA 4YAGA 2AZ4A 4WLEA 2J4CA 4CKEA 1GU7A 4R6WA 2ZVJA 2VUUA 5CT6A 2AN9A 5MF6A 5FTLA 3H17A 2JCBA 1DIGA 1PZMA 1EJBA 2NZWA 1P7PA 4OBXA 2OYRA 2N42A 3F47A 3W5CA 5AVXA 2ZB4A 1EK5A 3W4JA 3L4KA 1OI7A 2Q27A 3MT9A 2DY1A 2H1HA 2PG3A 3ELYA 3NBFA 3QNUA 3N5KA 4UU0A 4ZRMA 5L3ZA 5ABPA 5BWLA 3W1VA 4UTOA 3ELWA 4F84A 4NH0A 1VKNA 3K0CA 1A71A 3P0RA 4RLQA 4AFNA 3D6JA 3QWBA 3RSSA 2CL7X 1SB8A 2PGLA 4XQEA 1YJXA 5TARA 1REQB 1MTZA 4S1PA 4B5LA 1MW8X 1FU8A 4PV7A 1OILA 3KPUA 5JD3A 4EHHA 3L6BA 1SIUA 3GVIA 3SYRA 4ZZ0A 3ZU5A 5JR3A 1I51A 1BQ3A 4V0ME 4I1PA 1I1NA 3TXXA 4L5YA 2IYRA 4Q39A 3DQZA 5E7IA 2G9RA 2II6A 2O07A 4ETMA 3K2EA 4ENVA 3RVOA 2ZUUA 2BRUC 4MUAA 2WSSD 1DOZA 3T5AA 2VXBA 3ZHOA 4ESVA 5THXA 2W0SA 1QOQB 1FOEB 4TWRA 2YXBA 1RYEA 2GN1A 3EFOA 2A9FA 1XTQA 3HYCA 3KKPA 4CKBB 3A6GA 1ZOOA 1HLFA 5JBQA 3R3YA 1YO6A 2H31A 4G9EA 3WLMA 4JK3A 4ZXPA 4FYPA 3L6EA 4JASB 4KR6A 5DOVA 3HLTA 4BKUA 1ZVMA 1LKZA 1PJ8A 4JQSA 2RMKA 2G09A 4G37A 3WGNA 2WJWA 3CINA 3PEFA 1XFDA 1XZIA 3AY7A 4OYHA 5CX1B 9LDTA 1YIDA 3NDBB 3PQDA 1FFXB 4ZAXA 2V5AA 2ODTX 4L0QA 4ZTUB 4Q1DA 5HTKA 1HZZA 1TU0A 1U0RA 2BFDA 1JG2A 2NXCA 4N8SA 2VDLB 4TM8A 4NHEA 3AR7A 2QTWB 2QN1A 4ABTA 3FGNA 1OZ0A 4AF8A 3VYRB 1XTZA 1MVLA 4ES6A 1PF7E 4O4HA 4RAOA 2DUNA 4GRAA 3WL7A 5I8WA 1TYZA 1U0NA 16PKA 2M1XA 3ZGZA 2Q50A 1FUYB 1MABA 1SKUA 1WVGA 2NNWB 2MSDB 3M6AA 5AHWA 3FFXA 4DCPA 2XTMA 1A76A 1S02A 2ZJFA 2G9VA 3PPIA 3FN4A 2CFRA 4MARA 3PRYA 4FDLA 4G3XA 2YKGA 1N7GA 1QOPB 2QPTA 3K35A 5CT9A 3VR1A 4FFVA 4KQ9A 4PGFA 4BNGA 3UMCA 3NX4A 2FWNA 5EAIA 5IM5A 2C9ZA 2X4GA 2GAIA 3MGBA 5HTOA 3BREA 1NT2A 2AMLA 3K0FB 5UKDA 4NH4A 3W6UA 5DNCA 4X00A 4EW1A 3GLFB 2VJBA 3JALB 1UH5A 1YBFA 4L1KA 4QDJA 3ZZMA 1CP3A 1G60A 1QCCA 1EVIA 1H3FA 3QVTA 4OHWA 4WXMA 5LDGA 2IVZA 1Y42X 1V1RA 4N6NA 4PPYA 3LGAA 4MRVA 4LFAB 2P41A 2R25B 4XRRA 5EVCA 5A6SB 3EFEA 3D59A 4A2QA 1JDBC 1ECCA 2ZAMA 2HM7A 3GB9A 3G0BA 4J1TC 4PE5B 4R0NA 3QBTA 4LSWA 3SBXA 5CG2A 2CV0A 2PKQP 4B35A 2I2XB 1KYVA 3HJAA 2OV4A 3SNHA 1ZJYA 3WK7A 4BPRA 3TG2A 3H2BA 3G2QA 3NTXA 1DFIA 3RSZA 3DZJA 4RFSB 2RB5A 3VR6D 4KGDA 4C01A 4WJZA 4CTMA 3QKTA 4MA5A 3VTKA 4H7HA 1CUDA 2YOFA 3NBZC 3WLPA 5KCZA 4FFRA 4C4ZA 4CI9A 4EFLA 1Z35A 4UFNA 2ODPA 4EATA 4DIUA 2A3NA 2Q0HA 1S3SA 2HMSA 1FJ2A 3G85A 3TW8B 1S89A 5DLEA 3GUCA 4KREA 3PUWA 3HYTA 4QBGB 4Q9JA 3MFQA 5FWAA 2FUCA 2IPLA 3NBXX 4TMZA 1TVMA 3LRTA 1C30B 3BH6A 3E61A 3NI2A 3K1ZA 5LUBA 2PUCA 1OMOA 1H0HA 3SU8A 5IDQA 5IJ0A 5B1HA 3FLAA 4IKEA 4Q12A 2ZXEA 5C9ZA 3T0GA 3A28A 5CEFA 3GJ5A 1NG9A 4G2NA 4P32A 2YXPX 1EB8A 4IIJF 4H6PA 4M54A 4Y1RA 1DO8A 3JYLA 1N5JA 3PHCA 1EM6A 3W5BA 1EXMA 3U1TA 4C06A 1OX4A 5KSYA 1V48A 3DW1X 2E18A 2KMLA 2BCJQ 1IQPA 1D6JA 3PJFA 1M1NA 3A58B 3SLGA 3FYUB 1U2QA 3LLUA 3FDZA 1TQHA 3MB8A 5FIUA 3KYDA 1A88A 3QU4A 1L1FA 4UATA 3NMUF 4FE4A 3R6LA 1JEAA 4FNOA 3R44A 2CDCA 2FQWA 4HH0A 2WZQA 3LHDA 5BSKA 5CCEA 3ZWXA 5IZ4A 5KC8A 1I1HA 1ADGA 4PRZA 5J58A 3IR7A 2WTAA 3RK4A 1M2HA 4EKEA 1FDVA 3VU9A 3MJDA 1BU5A 3T1YB 3OCJA 4KVFA 4ZCPA 4P1ZA 1HDGO 1SWWA 1SU8A 3QEKA 3GHYA 1YR3A 1A0OA 1ODFA 2Q49A 2QTAA 3N0RA 2ZBGA 1K8YB 1N1GA 1R6VA 4TS3A 3R76A 3IAXA 3ZWAA 4TVKA 4EUSA 5KI6A 4UOZA 4NULA 2W22A 2ZIAA 4II7A 4B34A 2X22A 5SZJA 3H97A 2HF9A 3BGIA 4OA5A 1PZXA 1Y0BA 2XZPA 4OQDA 1F4PA 2Z57A 3BH7A 1S9DA 2I54A 3B7GA 1W1IA 3C1TA 3FLEA 4ZICA 3VR5A 1R6UA 3ODPA 4JYAB 1QH1A 1ODIA 3VR5H 3PA6A 5AK3A 2XE6A 1TTPB 2H08A 4G5HA 3SFTA 3WBBA 2BR4A 2YWRA 3IT0A 2PAFA 3JQBA 4Y98A 1C3OA 5JMOA 2NGRA 2P9BA 4DPKA 1D9XA 1T8PA 2ZBDA 2QV0A 5FWXA 1LZLA 3LBNA 3R9XB 3PU6A 4G0ZA 5DHAA 3FYTA 5HM8A 2WVJA 4D46A 5H8WA 1BQEA 1K7SN 1A9OA 2AJCA 3HDYA 3KPVA 1BHQ1 3SC2B 3TD6A 2WWYA 4QXAA 1O03A 5JS7A 1RYYA 4YGYA 3RG2A 3PFGA 3HK2A 1G7RA 3MXOA 3NJ4A 1Q1AA 4OSOA 1WQ4A 2E6KA 2IYSA 1S2LA 4LDZA 4RIGA 1QE3A 2X8LA 2WD7B 2GFIA 2UYGA 5K3OA 3EZNA 3MILA 1XU9A 2NNLD 3DL4A 4LDQA 4U0JA 1CJKC 4I50F 1R00A 1H0RA 2Y76A 4NQRA 3GD7A 2RKWA 4MRAA 4Y2JA 3F6EX 3HMQA 5B3JC 4DWJA 2IF0A 4R83A 3SE0A 2H9YA 3EJWA 3UWKA 4RUKA 2AOXA 3WQBA 1C1YA 3QVVA 3EVAA 1NQVA 3UT0A 4W5RA 3ORRA 1YJ5A 2QTBA 2AW3A 4XDZA 4ROTA 1DINA 3WFZA 1YCHA 3FVTA 2FU5C 5JCZA 2PT7A 3F46A 3O8OB 3EGEA 1ZMTA 2L42A 4D4JA 2XUQA 3IKTA 5K6TA 2XECA 3SNKA 4FFMA 5CVTA 5EP2A 2IYZA 3VGJA 4EPYA 2EIXA 4YAOA 1ODCA 2G4CA 4NV0A 3CSDA 1JHPA 1ZVVA 1BYUA 1QIFA 3JQPA 4JP2A 1WLYA 3T9CA 1JMKC 2ZJ5A 1K75A 1P5HA 3CPHA 3IKLA 4H27A 3SVTA 3MJTA 4L9WA 2VHEA 4GP7A 4L3OA 4WBSA 2W2LD 4AUNA 4P58A 4NS4A 3OPVA 1EXVA 2Z6UA 5FOSA 3EH2A 1E9VA 2IH5A 2RBGA 1NN5A 4PN7A 4URVR 4FQ7A 3KSUA 4B47A 4YT4A 1T29A 3T41A 3KNZA 1VJDA 1QYDA 3RVQA 5A04A 4Z4FA 3L6OO 2EQ5A 1UL1X 1AZTA 3QWHA 2Q28A 1SK8A 3LU1A 4JSYA 3N0VA 5CBKA 2TMYA 5L4NA 2ZJ0A 4AT1A 2ID4A 5REQB 5LMCA 3S8YA 2ZSHA 5F1PA 4DA9A 2BEUA 3ESCA 4B82A 3A4NA 4C2AA 3E3OA 1B6GA 1N2HA 3OJFA 8ADHA 1J90A 2UZ0A 3OCZA 1KY5A 2N1BA 4AP9A 4EHIA 5E1BA 3MMSA 3TDMA 4N1AA 1X70A 3JQGA 5AHRA 2O4CA 2BMWA 2SKDA 4YI3A 5JS6A 4Q3LA 2COKA 3ZVMA 4JA2A 3HCAA 4WK6A 3RU3A 4CLOB 1N1MA 1PGJA 3CX4A 4G36A 4GRIA 4M0PA 1KRWA 5HCNA 1UWKA 3LVQE 3RJ5A 1VLHA 2QT0A 1A9TA 3INTA 4OQEA 4BP1A 3I6ZA 5LLDA 3J7AC 4ZKDA 3EC1A 1NONA 5FUMA 2X9GA 3NP7A 5K7SA 2ZIXB 3TD2A 3QYJA 4TV8A 2CCGA 4DC9A 1XEXA 4UPVA 1ZUWA 1P9WA 1UJCA 3TL6A 4Z99A 3X43A 2ZJYA 3DFMA 5JQGB 4KSYA 2E1PA 1A4IA 1RJ9B 2WABA 3IEVA 1XZFA 4D2IA 1K66A 5IFKA 1JTEA 3KL4A 4GX2A 1Q1QA 1RRPA 3OBBA 3OJCA 4ZPJA 1USUA 1KE2A 3ZV3A 1VPWA 4UEWA 3C3PA 3FAKA 5BN5A 5I4IA 2YHSA 1VSUA 1TA4A 1XRJA 3SBEA 1N0IA 1N7HA 1VXOA 3B85A 3RNOA 3BTSA 2XA9A 5I4BA 2C5HA 2WPDD 3L9WA 2BKUA 1UFRA 3BMXA 4FLEA 3M5DA 3P9IA 5BP7A 3WGOA 4LF9B 4Z53A 4K9OA 4M1EA 5K2MA 1NN0A 2DBRA 1A1SA 2YH2A 3UWMA 5KVAA 3JQAB 4TQ9A 3GLIB 4YAEA 3RUAA 2GEUA 2EAUA 3GXBA 1EIWA 3EVDA 4R98A 2CXRA 3S1LA 5CJPA 2XVMA 1E1QA