5AOBA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
RLRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLKDHVPRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aobA00
4BDSA 4UHEA 1FFAA 4BCDA 4ZI5A 4ZREA 5AOBA 4H18A 1CFJA 1UWCA 2PSFA 2DHDA 1A8UA 4FFWA 2WFMA 2ZYIA 3EQ7A 4P93A 4FLEA 5EHNA 4AO8A 3L1HA 1QIIA 1QFMA 3FYUB 3G7NA 3KD2A 3STWA 1DT3A 1ISPA 1THGA 3QZUA 3F97A 1E8NA 3H1AA 1A88A 5A6VA 1QIMA 4Y2QA 5EIHA 2WIKA 1QIFA 4MYDA 5KREA 3VKFA 3V1NA 4TGLA 4L0CA 2PU7A 1TCBA 1UZAA 1PFQA 3G8YA 4I19A 3DL7A 2HADA 3STXA 5ALJA 4BE4A 2GZSA 4Q05A 3H04A 3FSGA 3WK8A 3FYUA 5AM1A 5EFZA 1JMYA 2WU4A 1EA5A 3DKRA 4W1SA 4UBNA 4UHBA 2HU7A 1MTZA 4KE6A 3LIIA 4FNMA 1SCQA 3MGAA 1ZGCA 4I4CA 4BB0A 4N8DA 2ZJ7A 3D5EA 1DWOA 5T4FA 2I78A 1LNSA 2G5PA 3WI7A 2DHEA 1MX9A 4QDOA 5AOCA 3QH4A 2PUHA 3H2HA 3WL8A 1GPKA 2P8SA 1QIGA 4G8CA 1W76A 1Z68A 2JGJA 2VTVA 4E46A 1WM1A 1YSCA 2X76A 3GA7A 1XZJA 3TGLA 2AJCA 4U2FA 1R3DA 1VOTA 4TPKA 4AQDA 2BFNA 4HAIA 1W75A 1ZD3A 3I6YA 3PDCA 2QRUA 3FBWA 4KEAA 2WG0A 4BVLA 2OGZA 1ZI9A 5JALA 3D7RA 3P2MA 1BN6A 4UBJA 2HA7A 4Y2RA 3RKSA 1A7UA 4PNZA 4X90A 5AOAA 2JEYA 4ROTA 4UHHA 1VE6A 5AIBA 1OXMA 1CUUA 4QLAA 5ALIA 4U2CA 1CPYA 2XUKA 3D0KA 4B0PA 4Y2UA 4U2DA 3ZV7A 5ALLA 3SC2A 4EZIA 4WJLA 4X92A 4IHAA 3FCXA 2VT7A 2W22A 1QO9A 1QFSA 1ZJ4A 2R8BA 4GBGA 1YA4A 2C58A 2XMGA 4DIUA 5AM3A 2WUFA 5JAPA 1EVQA 4M0EA 3A6ZA 2PUJA 2HHAA 5JADA 2W6CX 4HS9A 4X97A 1G66A 1NU6A 4UFOA 5AIAA 5K3AA 4XJVA 1CUVA 2YXPX 5E4YA 4J3JA 4OB8A 3F96A 2XUQA 5FLKA 1UK8A 4IQ4A 2OQVA 3DYVA 4BAGA 4LXIA 1Q0RA 3R3UA 4QA9A 1E89A 2J4FA 1XRRA 3D2BA 5ALKA 3W9BA 1E66A 4OB7A 5FPPA 4F5ZA 5EHQA 1HLGA 4RE5A 1C4XA 4UFNA 4BCCA 3FOBA 4C6HA 2VQ6A 5LYYA 5JZ9A 5LIPA 4EY8A 2ZSIA 3D4LA 4CFSA 3C8HA 2XT0A 4BTVA 1HPLA 4EHBA 1P0QA 2WSLA 5ALGA 1XRMA 3G9XA 3T52A 4B81A 4E14A 5ALYA 2OAEA 4FFVA 5JATA 4UUQA 1CUEA 4ARAA 4N5HX 1EDDA 4MEAA 2ZYSA 1YR2A 3HEAA 3GUUA 3TJMA 3FNBA 5KBYA 3C5WP 3F67A 5JD4A 3O0DA 2I3DA 4G9GA 2I3ZA 1EINA 1LPSA 4K2AA 4IH4A 1IUPA 3G9UA 4GWLA 2OGTA 2B20A 1LPNA 4RE6A 5AI0A 2H9YA 2DSNA 1EX9A 1AURA 4K6GA 1VA5A 4FLFA 3PFBA 3D2CA 1CUHA 4PV7A 2GYVA 2XMZA 3HYSA 4DM7A 3EQ9A 1G4HA 5ALOA 4NZZA 2WJ3A 1N5RA 5ALHA 3U1TA 4DNPA 4KAAA 4GXNA 1XZGA 1CUYA 3BJRA 2R11A 1EB8A 3B5EA 3C6ZA 3AILA 3CN9A 4GI1A 2WHRA 4C4ZA 2QKYA 2ACKA 1WB5A 3GROA 4H7JA 3DQZA 1K4YA 4B84A 2BUCA 3QBJA 2E3JA 2ACEA 4OPMA 3PICA 3WKCA 4AMZA 2H7YA 4B9EA 4NVRA 1JFRA 4I3FA 4UBKA 4JYMA 2O7VA 3E4DA 3SK0A 4PSCA 4BE9A 4GEGA 2WILA 2XUPA 3STTA 1VE7A 2WFZA 3IUMA 5A7HA 5LZ2A 4Y2XA 2XI4A 4Y2TA 3I2JA 4IH9A 4KYVA 3T4UA 2UZ0A 3EQ8A 5AH0A 4KRXA 1F8UA 1WPXA 2XMQA 5AKKA 1XLUA 3K9BA 3CXUA 2XQJA 2HDWA 3ESBA 4Q3LA 3G9ZA 5AM0A 5KWIA 4DSZA 4DMKA 5CXXA 3GZJA 2VAVA 1M33A 4PSDA 3BDVA 3LP5A 2V96A 5K3DA 1AGYA 3ED1A 4BTLA 1XZEA 4CG1A 3M83A 3I1YA 2DR0A 3AIOA 2WIGA 3STUA 1P0IA 5IVIA 3VJMA 5ESRA 2WUDA 1MX5A 4BBZA 2G5TA 3H18A 4P92A 1TCCA 4B7ZA 3IVMA 5HK9A 3YASA 3C8DA 4OYYA 1LPBB 2IX9A 2XQFA 4G9EA 1R88A 4PO3X 4LHEA 4FMPA 1DTEA 1GPLA 4FKBA 2PL5A 3VXKA 2XUHA 3R41A 1UKCA 2CZQA 4ZV9A 3HI4A 4ZRDA 4KAFA 5T4BA 5CTAA 1CUAA 2X8BA 4BRZA 1J1IA 2C0QA 1QZ3A 1XZKA 4XVCA 1GGVA 4QZVA 4H35A 5HQ3A 3WK9A 4QDXA 1XQXA 1XFDA 3WZLA 2VF2A 4GHWA 1E5TA 2IITA 3QPAA 2RIPA 1R4ZA 1FJ2A 3AINA 1IMJA 2HL6A 4G5XA 1OCEA 2WHPB 4LYEA 4MYSA 2WUGA 1R50A 5ALDA 1O6FA 4UBLA 5JARA 3DS8A 1WHTA 3WK7A 5FOQA 1ZD2P 2K2QB 2DCMA 1K63A 3WK5A 5ALXA 1D07A 4AO6A 2JGIA 3WKEA 1DQZA 5BWBA 5ALEA 2XMCA 4KE7A 5EIEA 5EI5A 4J0HA 3I2KA 3NOXA 3R3YA 4WDQA 5HF8A 5J3JA 1ZJ5A 1G5FA 3V1MA 5A71A 3GELA 4XWGA 4OD0A 1UKBA 4FTWA 4C87A 2JGMA 1Y7HA 4MQMA 1XLVA 1XRNA 5JANA 1WPRA 4HZGA 2EDCA 5AI5A 2RGUA 4C4XA 1VXRA 1KU0A 2CUTA 5ALQA 3MUNA 2ROQA 1FSSA 3WYDA 2YYSA 4KJXA 3C43A 1VLQA 2OGSA 2BAGA 4Y2JA 3E3AA 1CUGA 1H2XA 4W1PA 1CLEA 5JAUA 2J3QA 5AKIA 1SCKA 1K6EA 2BUAA 1DWQA 3ZI7A 3O4HA 3M81A 1N8SA 3WKAA 4J0IA 2RHTA 3AFIA 5FP0A 3HABA 2XLCA 5LKRA 2VATA 4CI9A 1SOMA 3IUJA 1MNQA 1MAAA 2WIJA 5T4EA 4BAZA 1HKHA 4UBMA 1ZD4A 2QXUA 1BCRA 2RONA 5AI6A 3Q8WA 1GQSA 2VJCA 2XUOA 3A2LA 1LZKA 5AM5A 2BJHA 4BAUA 3K6KA 3R3WA 5C8XA 3FVTA 4GDMA 3H19A 4X6XA 1X70A 1N5MA 1MX1A 2PM8A 4J0KA 5K5EA 3HRHA 4N8EA 2QZPA 5AK6A 3W2TA 1VJ5A 3N0TA 5CW2A 1UK7A 3DDUA 1XKTA 1A8QA 2XUDA 2BKLA 2QOEA 4PQEA 4KAJA 4G1FA 4AB1A 4C01A 1BCSA 1W6RA 2GZRA 3L1JA 3M3DA 3HLKA 1E8MA 1HL7A 3JYHA 2AXEA 1B41A 3DYIA 4Y2VA 3BF7A 4FBLA 4HVTA 5CH5A 1X2EA 1DINA 3ILSA 4AZ3A 4KACA 2OAGA 2NW6A 3AJAA 1FFCA 2Z8XA 4PF1A 4QWMA 2Z3WA 3KDAA 4HRXA 2O7RA 3BE8A 3FLEA 3HXKA 4BRSA 3MUOA 4P08A 3VJLA 3W9UA 4IH1A 2HU8A 1QIHA 5DNWA 4MXDA 4G8DA 3HSSA 5HCUA 4X91A 1L7RA 2CB9A 2PSJA 1GT6A 4F60A 1NX9A 1QIKA 2Z8ZA 3F9CA 1JJBA 4ZV7A 4KR0A 2O2IA 1UKAA 1QONA 4ZWNA 3H1BA 2XMDA 2VEOA 4PW0A 3WL5A 3H0CA 1EB9A 3V1LA 5JAHA 1F6WA 2VJDA 1XRPA 2PSDA 2CJPA 2VT6A 2JGFA 2OCIA 4DTCA 1FFDA 1USWA 3DNMA 3D3NA 5IVHA 4RNCA 1K8QA 2CEKA 2O2HA 1UT6A 5AI4A 5AI8A 1XLWA 1YB6A 1KEZA 2WIDA 3WK6A 2HFJA 1WB4A 4MEBA 4A5SA 2B4KA 2JGKA 5FV4A 2XUJA 2QR5A 4EBBA 1BS9A 3F98A 5DLPA 2V98A 3V9AA 4Y2SA 5ALFA 4X71A 1UOOA 1J2EA 1ORVA 3IURA 5HFAA 1K5PA 1C7JA 4EUSA 3ZLUA 5C7YA 5AKEA 4AXBA 4H0CA 2OCKA 4OB6A 5FUMA 2WHQA 2QMQA 5SYMA 3I1IA 4DMFA 1QIEA 1JT2A 1TK3A 5FRDA 4X94A 3B3QA 5CURA 1CUZA 1YS1X 3AZPA 3E1GA 5JD6A 5D6OA 1HBJA 3LLCA 2H7CA 2OXEA 2ZYRA 2ONCA 1DT5A 3O95A 2RAUA 1XZIA 4FWBA 4L9AA 1CRLA 1MJ5A 1DQYA 1AQLA 4X7BA 4AN0A 1CQZA 3LIPA 3TEJA 4BC1A 2AJLI 3UUFA 4GW3A 4HRYA 1XZCA 2WG2A 1TCAA 3C5VA 4EY4A 5KWJA 1XRQA 3G0GA 2CKMA 3FAKA 3B12A 3PE6A 5HKBA 4JH0A 2D5LA 4V2IA 1DWPA 5DYWA 1MNAA 2VJBA 5HFNA 1H23A 5BOVA 4H7KA 1CUDA 1TKRA 3PUHA 5AK4A 4QWWA 1X2BA 4B0OA 1C7IA 5AM4A 4CCYA 5K3CA 3SWWA 1AKNA 1B6GA 1CUXA 3OOSA 5K3BA 4YPVA 2ZJFA 1U2EA 2GBGA 3GBSA 1JJFA 3IULA 1AMNA 1AUOA 3QM1A 1BEZA 4AN1A 4OU5A 1JKMA 2XUIA 5CH3A 3CCCA 1VA4A 2JBWA 5HF9A 3HC7A 1QE3A 1MT3A 3S8YA 1H2YA 2OCLA 3WA7A 2GBIA 1YS2X 3STYA 4CG2A 2Y6UA 5EIAA 1MPXA 3OM8A 3X3HA 2ORYA 3H2IA 5A2GA 1TAHA 2AJDA 5JIBA 2QXTA 2H7XA 4LKOA 3EBLA 2QS9A 5AKYA 3ANSA 3DL4A 3I6MA 2WTMA 3A2NA 1LPMA 4P9NA 2OG1A 4E15A 1E8DA 5CT9A 4KE8A 5I9IA 4J0JA 3ZPXA 2HA0A 5CT6A 1I6WA 3JWEA 2EEPA 2DQYA 2RI6A 2Q0XA 3AZQA 4H7FA 5JZBA 2GYWA 3ANTA 2XMSA 2BGNA 4WY5A 5ALWA 2XLBA 1EXWA 2Y2UA 1F0NA 3BDIA 5LLSA 4A16A 3FVRA 3ICVA 5HF6A 4YX9A 3WWPA 4RGYA 1Q0ZA 1LLFA 4JEIA 2H1IA 1CQWA 3QPCA 5CMLA 4K6HA 4LIPD 2YH2A 4QNNA 1F0PA 1ZICA 1ZIYA 1XZMA 2G63A 1DU4A 3W04A 1YB7A 2HFKA 1J07A 1XRLA 5IVKA 2B9VA 2C5GA 4B9AA 2J3DA 2EDAA 4NS4A 1LGYA 3C6YA 4WFIA 1VZ3A 1BROA 3W05A 1XZBA 4NMWA 1ZOIA 5A62A 1CUFA 3PF8A 3RLIA 5I8PA 3CCBA 4Q34A 2XUAA 2PPLA 3ICWA 5AICA 5D7BA 2CMFA 4LXHA 3HZOA 4B6GA 3E0XA 2Y2VA 3DLTA 5LZ5A 4Y2PA 4EY5A 4Q1VA 3QMMA 5CRIA 4DGQA 2RHWA 1QJ4A 4FHZA 4C89A 3G02A 4CCYB 3R40A 2ZYHA 5ALTA 4UPDA 1QTRA 3LCRA 5LZ4A 4W63A 1ZIXA 1CUIA 1VZ2A 4JUIA 2XQIA 1RWQA 3C87A 2XQKA 1UK9A 4CCWA 3A70A 3H2GA 1AC5A 4BYMA 5FDFA 2C7BA 4Z49A 2C5FA 4OYLA 2PSEA 3DKKA 2HRQA 1EDBA 4B82A 3KWFA 3NUZA 2PKYX 7YASA 1EK2A 2WJ6A 5C81A 3M82A 3WYNA 4JNCA 4QDUA 3EIOA 5JYCA 3WKDA 2XB6A 4X93A 3BXPA 4ZXFA 2XUFA 4U2BA 4FLMA 4J0GA 3D2AA 1RYYA 1UOPA 1XQVA 3IB3A 1Y37A 5CH8A 4W9RA 4U2GA 3KOOA 4X85A 4EY6A 3C45A 3WZMA 2DQZA 5HZGA 5T4HA 4OCZA 4KRYA 3D59A 5E4JA 3KXPA 3I6ZA 3NWOA 5AHXA 1AX9A 4JYPA 3SX4A 2WFLB 1ODTC 4UBIA 1WOMA 4WDRA 4WY8A 5DYTA 4UFPA 5D3ZA 3R3XA 3OTQA 1IUNA 2B61A 3OPMA 3O4IA 1QIJA 3I2HA 4EA6A 3DJYA 4X00A 2D0DA 5K3FB 3AIMA 1R9MA 4UHFA 5HKAA 2FJ0A 4TVKA 5AKGA 3VVLA 1MU0A 1QGED 1CUSA 1RP1A 2DFPA 1TQHA 4XIIA 4INZA 2Z3ZA 5K3EA 1QIDA 5LP1A 3DCNA 3O4JA 4Y2YA 1ODSA 4BZZA 2WFLA 1XZDA 2VA9A 1S8OA 1W4LA 1IZ8A 2PU5A 1XKLA 2ZJ6A 2HA3A 2OQIA 1ZI6A 2XQGA 2XDWA 3PUIA 1CVLA 2JIDA 1FFEA 2QJWA 4K5QA 1GKLA 2WJ4A 2JF0A 3AUKA 3BF8A 4X6UA 4WFKA 4BP9A 2PVSA 3QVMA 5JAOA 3BIXA 1LZLA 5C8VA 4G4IA 2AJ8A 5C8ZA 1YCDA 1U8EA 2PSHA 2I03A 2DHCA 3WJ1A 4PSUA 5E2IA 5CT8A 5I7UA 1GKKA 5AKZA 4BVKA 5ALVA 3I28A 3U0VA 2OLEA 2PX6A 1EK1A 4Q3OA 1LBSA 3BL8A 1XZHA 4YASA 5EHZA 5HQ3B 4UBOA 5EHXA 3OC0A 1IUOA 2WM2A 2HA2A 2QUBA 5BWCA 5H3HA 5LKAA 3PI6A 5IH7A 1XZFA 1ZGBA 2BGRA 3ESCA 3WL6A 4J0DA 2WQZA 5AK5A 3H2JA 5SYNA 1QO7A 1ODCA 1EDEA 3K2IA 1SCIA 2OCGA 5ISMA 1UOQA 1EVEA 3WJ2A 5D3KA 2CBGA 4L3WA 1A8SA 2GBFA 1XZLA 4FBMA 3RM3A 3WA6A 4J7AA 3GFFA 3IIIA 2JGLA 3W06A 2Y1KA 3FCYA 1VXOA 4F21A 1VKHA 3DOHA 3WK4A 2QTBA 3DD5A 3QMWA 1DX6A 2C0PA 2XMBA 4BATA 3A2MA 1YASA 1MAHA 5DNVA 4G8BA 2Z5GA 3WWCA 2J4CA 3ZLVA 5DNUA 4DLNA 4MWSA 2X5XA 4BC0A 1P0MA 2VSQA 1THTA 1UK6A 4BP8A 3WMRA 4QDZA 2C4HA 3CN7A 3DEAA 3FYUC 2HRRA 3HACA 3OURA 3VVMA 1YAHA 4L72A 3KSRA 1UXOA 3O9MA 3R3VA 3V1KA 4ITVA 4RPCA 3QITA 3G0CA 3F8SA 4H7IA 2QM0A 2WKWA 4WFJA 3ZWQA 1YAJA 3FLBA 3BWXA 4EY7A 4IO0A 1WHSA 5CT5A 2HA5A 3H2KA 1XQYA 5ALSA 1TRHA 2WUEA 2PBLA 4HTAA 3WIBA 1N1MA 2FX5A 3FYTA 3WWDA 3DOIA 3RARA 1H22A 4XX1A 1SC9A 1O6GA 1GXSA 4AMYA 2WHPA 1J06A 4HXFB 3BIWA 1TIBA 3QPDA 3WLAA 5EGNA 5FPQA 3G0BA 1CUCA 2G4LA 2QJRA 2O2GA 5DWDA 4N5IX 1CR6A 1G42A 3C70A 4A23A 4C88A 1GPNA 4AO7A 2Y6VA 2FUKA 3WQHA 4O08A 3L1IA 5CXUA 3G0IA 5LZ7A 1JI3A 1HDEA 5ALRA 4DYHA 4KE9A 3O9VA 1NU8A 5ALZA 4DMHA 1SFRA 2QUAA 1Q83A 1QOZA 4W1RA 2WU3A 5AKJA 4BVJA 3NGMA 1T2NA 1EI9A 3QYJA 1IVYA 1ORWA 3C6BA 4EB0A 1W52X 2HA6A 3PF9A 1QLWA 4C4YA 1CUWA 1Q84A 4U2EA 5LZ9A 1LPOA 1LPAB 1AZWA 2V9ZA 3FWHA 3VJKA 4OSEA 1P0PA 3IUQA 5DJ5A 4HXGA 5AJHA 3UUEA 3S2ZA 2GYUA 4FDMA 2WTNA 2WG1A 3JW8A 4S0XA 4DSAA 4HXEB 3MVEA 4Q3KA 3AZOA 1FFBA 6YASA 4B85A 3WWOA 4Y9SA 1JU3A 2VJAA 4N8SA 4G4JA 3WWEA 1XROA 3I2IA 4AZ0A 3LS2A 5ALNA 2QT9A 3STVA 2FJPA 4X6YA 3VISA 1BEEA 1ACJA 4DMCA 4ETWA 4GECA 3EF3A 1XQWA 1HQDA 4H7DA 4DNOA 1CEXA 2AJBA 2HIHA 4WCVA 5YASA 5ALMA 1MN6A 2YASA 2ES4A 5A7GA 3R3ZA 3I2FA 4BZWA 2XE4A 3I2GA 4J0CA 3IUNA 5CBKA 1LPPA 2JGEA 5HK8A 1BRTA 2GBCA 3WIOA 4M0FA 4QEKA 3TRDA 1U4NA 2XUGA 5AM2A 3ESAA 5HF5A 1XZAA 2ZSHA 1L7AA 4AX4A 1JMKC 4E11A 1R1DA 3IBTA 1LBTA 1JU4A 4H7EA 1ZI8A 4LXGA 1W1IA 1CUJA 1H2WA 2XMRA 1WB6A 3IDAA 4Y7DA 5DYYA 4GLBA 4ARBA 2HA4A 4OUKX 5CT4A 5F4ZA 3N2ZB 3ZLTA 5AP9A 4CG3A 1EHYA 5LZ8A 1KU6A 1CV2A 4UHCA 4X3CA 4UHDA 3H17A 5AKHA 5ALPA 5AK3A 4FNGA 1Y7IA 2VAXA 5JD5A 2JEZA 2HM7A 1CUBA 3RK4A 2ZVDA 4B83A 5DTJA 3O4GA 4G4GA 1WCYA 1JJIA 4CIAA 3C6XA 4H77A 3FLAA 4QDTA 1UFOA 1BE0A 5JASA 4CIBA 2WIFA 2IIVA 4BDTA 1PJAA 1GZ7A 1QTIA 4B80A 3WL7A 2OPHA 1T4MA 1ETHA 4H7HA 1GQRA 3V48A 5JZSA 1R9NA 3HJUA 5AO9A 3UMJA 2LIPA 3Q0TA 3KWJA 4W1QA 1L7QA 2ECFA 4YK7A 4FOLA 1MO2A 1E3QA 5BV7A 1ACLA 5IKXA 2QVBA 3G9TA 3ESDA 5A7FA 5IVDA 1U65A 4DNQA 3R0VA 3BJMA 4J03A 4DNFA 5AKXA 5ALUA 1YA8A 1CIJA 3FSGD 5E4TA 5K3FA 1DX4A 1BU8A 4M0MA 1ZD5A 1PV1A 4LYDA 1H2ZA 3AIKA 1OILA 4K6KA 3IA2A 5DTIA 4Q82A 4ZGBA 1BN7A 2HU5A 5AKLA 3VDXA 4QLOA 4MWTA 3OG9A 2BCEA 4D9JA 4QE3A 3G0DA 4BCBA 5FKJA 2V97A 1IZ7A 4OU4A 3WKBA 4F0JA 2WLSA 3PFCA 1EH5A 4MJ3A 3QMVA 5AI9A 5FXMA 2BUBA 4X95A 4MQLA
chains in the Genus database with same CATH superfamily
4Y2HA 2BMWA 3HGTA 3KC2A 4BCDA 2B5VA 2C3PA 1Q91A 3AVYA 3KFLA 4HPJB 3SYRA 2ALJA 5FOWA 1N7JA 4PZYA 1CFJA 1M6WA 3U4MA 1VHLA 3EBPA 5TS3A 4YV0A 2JKZA 1A8UA 2AR9A 1ZYUA 4FFWA 4KB5A 2YW9A 3FXAA 3VUFA 2Y1DA 3ESXA 1HQCA 3JD0A 3EQ7A 1KZ1A 2FSGA 2VH2A 2QTGA 2BONA 4L9RA 3BH7A 1XCJA 1Z7EA 3AU8A 1Q0SA 2F6RA 1U2GC 2PN1A 3CTMA 4QUAA 1WW8A 3SHOA 3UJ6A 3IAUA 3VHLB 1I24A 4JR0A 4YAKA 3G7NA 5C80A 2EKDA 1YZHA 1TA0A 3AFNA 4FGWA 4FZ3A 3KD2A 1Y9DA 3K72B 3STWA 4C5CA 4YRCA 1WY7A 2TRSB 1ISPA 1WXHA 3QZUA 3F97A 4JLJA 3RHSA 3SIPA 3RJZA 1J8VA 1V11B 2VNKA 4MUAA 3E53A 1HQYE 4D9KA 2Y1FA 2Q3BA 4KR2A 4N9QA 3TQTA 1G3RA 1L7PA 4AULA 1OIVA 2UKDA 1D03A 5IFKA 3QOFA 1FP7A 2FKAA 3RG8A 3RTAA 4B3IA 4TYNA 2E0IA 1MEOA 1PVOA 4G0VA 3UMCA 5FBVB 4R2JA 3QEBZ 4HH1A 1OU4A 1FPMA 3JQGB 5K6AA 3RJ5A 3TO5A 4CMIA 5KREA 2PZAA 1DFIA 2BHNA 4QVKA 3VKFA 1AH2A 1WMSA 1E9VA 2BCGY 2GZAA 5B1YA 2PU7A 1VYUA 1U7UA 1UZAA 1RAFA 2VP9A 3CNHA 4MV9A 1MVOA 4H1TA 3RKRA 3VZDA 5IDXA 4ZU1X 3OBBA 1WW3A 5IXJA 3LY9A 4RLHA 1VBMA 1PTKA 4URWR 1QHHB 5M7EA 4RA9B 5KHAA 1HNXB 4BV9A 4MVJA 3T3MB 4A0SA 1M76A 5E7QA 5C7LO 3W8DA 3A6JA 2O57A 4L22A 5BNZA 1EDZA 2NG1A 1M1YB 3AW8A 4Q21A 4YREA 4YCBA 3RUEA 4R9NA 4ZICA 2RMKA 1XDDA 4Q05A 4K9OA 1AV7A 3DKPA 1KIMA 4KFUA 4MWBA 5FBHA 2SKCA 1GNVA 1GL9B 3K9HA 2YV1A 5CG2A 4NYIR 1CVIA 4KO3S 1ZINA 3DKRA 1EA5A 5LJLA 3F5QA 1BWPA 2I80A 3K9GA 4QATA 1KETA 4KE6A 1G8GA 2WNSA 3N7AA 2C9BA 3DE2X 3LIIA 1ZCBA 3L6BA 3BJIC 4FNMA 2VUHB 1Z8DA 2ZSEA 4MK4A 5HHTA 6REQB 2X0KA 5AJUA 1HETA 1MJFA 1V16A 2P79A 1O94D 4H1HA 3I0ZA 5JY1A 3RT9A 3DH0A 4B4OA 2XBLA 4YRFA 3DTVA 3LVRE 2H8GA 1OWOA 1ESCA 3B3JA 5LYJA 1FDSA 1JKIA 3OA0A 2VF8A 2EHJA 1KAQA 1MX9A 2FPUA 3TS1A 3K6SA 4QNMA 2AQKA 4WKCA 3NMUF 1RXUA 4GLLA 1LJ8A 4PRYA 2O50A 3I32A 5AVVA 3K0FB 1O54A 1QK4A 2I2FA 2ADMA 2PUHA 1G6HA 2C5SA 2XAAA 3H2HA 3H8VA 3K32A 2V7PA 2P8SA 3FOEC 4FE3A 1QIGA 2PKCA 1IZ9A 4G8CA 2YWDA 1CZHA 4JFRA 2OEPA 3BXZA 1ZOOA 4RXUA 1Y1SA 5FPHA 1Z68A 2JZOA 2QAGB 1WM1A 1VMKA 2QA5A 2YZMA 4BEJA 4HF7A 2P77A 3DXYA 2G9ZA 1XZJA 4HAOA 4ATNA 2AJCA 3M34A 2GA9A 5K9ZA 1FFSA 5EIBC 3UMGA 4U2FA 3FB1A 2A9RA 4BO8A 4S35A 2EBFX 2XJ4A 4RDCA 2ASEA 1R5NA 2C82A 2R4UA 2GI4A 3LFHA 3MIIA 4AQDA 4BMYA 1XPUA 1OD6A 1Q1GA 3PNYA 3M1AA 4OQ4A 1ZD3A 1E9CA 4F4JA 5KCZA 2Z2XA 2BFMA 1MO5A 1CDOA 1E20A 4BO2A 1MH9A 2QRUA 1L4YA 4R1OA 4BLPA 1HUQA 2V3WA 3AUAA 4OY3A 2IEAA 3TRKA 1JMVA 1I30A 1JLMA 1O97D 1ZI9A 3W5CA 4LQDA 4GPAA 2J6HA 2GN0A 3QU2A 5J2UF 2I6SA 2VNJA 4OH1A 2H2FA 2VNIA 3U09A 4D4KA 1FDUA 3QW2A 4YACA 3WQSB 5J2TA 1N3IA 2W2TA 3I4FA 3OLZA 3NB0A 5IS2A 4DYVA 3ZKAA 4IMPA 4R2LA 1EK5A 4FC7A 4GMDA 4LBYA 3JV7A 4R05A 2Z04A 5MGBA 3FTEA 5AOAA 2Q5QA 3HXOA 4ROTA 4UHHA 4EW2A 1ZH4A 4B6PA 1SPXA 1EJ6A 4ZK6A 4DDWA 1MR3F 3DE7X 4R8RA 3IIJA 1R0LA 1HLFA 4YJ2B 5G4KA 5EWLB 5DN6D 4EPXA 1SKBA 3CLTD 4XGIA 3D0KA 4JAVC 1X3SA 5DWQA 1JEAA 3CO5A 1I7DA 1K7EB 4B0PA 4Y2UA 3N5CA 2F3QA 1VRCA 3SC2A 1I3NA 3VOSA 4QXMA 1J8FA 2JCYA 4RIGA 2P69A 2JLBA 4I5EA 4X92A 3V7UA 3FCXA 1NQTA 1L7DA 5I5EA 2FMTA 1QO9A 1QFSA 3DZCA 4AK9A 2CLOB 1KKLA 2R8BA 4UTRA 3I5YA 1YA4A 5DNCA 1REQA 4KFRA 2OZEA 1SBQA 3SZRA 4BNXA 2QMOA 3LPCA 5AM3A 5JAPA 3O8RA 1EVQA 1K4KA 3M6FA 3NXKA 3TDNA 4YV7A 4G26A 3G59A 3ZCXA 2NSYA 1EHIA 3GRRA 1Q7BA 1TIPA 2H08A 4HBGA 3UWSA 4CFZA 2MSCB 1GNRA 2TECE 3FVWA 3L05A 3IBGA 5DI3B 1E1CB 2W6CX 4FSHA 1UP7A 2RHDA 4GF5A 5AIAA 4CV2A 4S2EA 4R2XA 2JLRA 3LQQA 3B1YA 5I7AA 5LQAA 4AY6A 3ZTTA 3DUFA 3NEYA 4G5SA 4XJVA 5E4YA 1UADA 1CSEE 3FWPA 4JT2A 5JAQA 2ZB3A 4PX2A 4CKEA 1UFKA 5EJEA 3PXEA 1GGMA 4FVTA 1JEQB 4ER6A 2Q6LA 5FLKA 2WWRA 4UXIA 1UK8A 4Q9KA 1JVSA 3UYLA 4D80A 3WGOA 2QG9A 3G6KA 3Q7EA 2HJWA 3EXIB 1FRNA 3UOGA 2ZJ0A 3VNSA 4UTVA 4Z53A 4CGYA 2QSUA 1Q0RA 1G7TA 1PHRA 5HMLA 1TF7A 1LV7A 3BL5A 3HN2A 3VU0A 1A82A 1KQPA 3ELWA 3WRXC 1BYUA 1O03A 2HY7A 2NNWB 2P1RA 2X6QA 3FDFA 3ZIDA 4F46A 5HIAA 4QUDA 1E1DA 3UB2A 4WZZA 2ZIZA 3BD6A 2PR2A 3D2BA 1CERA 1O94C 4R6XA 5ALKA 2VNSA 5FPPA 1LX6A 4F5ZA 5HRUA 5EHQA 1R6VA 4ARUA 5AW9A 2EL9A 1IATA 2B4QA 2Q3LA 3N5KA 3ZCPA 3PGLA 1Q7GA 3RU7A 1U0GA 3NJRA 4O1MA 4YXWA 1TT5A 4C76A 2IC5A 2XGJA 4TVOA 1G18A 2C2BA 3DO6A 1BH2A 1Q77A 3I1JA 2BFBB 3FOBA 2RB5A 2XTMA 3VR6H 3Q10A 1YKGA 1OV4A 1YVUA 4IHJF 4TOIA 3X1MA 1N1EA 4KLZA 3BHIA 5A3JA 2ODTX 1AQYA 5EJ6A 3IQDB 5JZ9A 3TOXA 2O8BB 4HH0A 2LW7A 5D8DA 3K0EA 2XEDA 2P1ZA 3L01A 4ON9A 3D7SA 5KYWB 2D8AA 3ASVA 2UVDA 1HQKA 5I48A 5L3VA 1UBGA 3NX4A 4UM9D 3EIFA 4GLJA 2J41A 4B8WA 1IFXA 1Z18A 1ZIPA 4BTVA 3HNRA 4YV1A 5LPNA 2OYRA 1VCMA 4G0NA 4J43A 4EHBA 2M6KA 1W5FA 1KJJA 4I4TF 1RDFA 2W2LD 1XRMA 4PNPA 1FXSA 1U3WA 5L7YA 2XGSA 2BFCA 1NLFA 2NSJA 3CB4A 4FN4A 4E14A 2YOHA 2OBMA 4NPCA 2OAEA 4FFOA 3L7MA 1QTQA 5DEOA 4BLWA 1W29A 2DM6A 3M3PA 1MP0A 3CZMA 1H2BA 1FX0A 3HU1A 3IIEA 2EHDA 4F3TA 1FB5A 1VMEA 2YRFA 1Q44A 1CBUA 1B6RA 3I2YX 1R0XA 4MEAA 1UP4A 5EJFA 2OUKA 3F1KA 2WYUA 1RAHA 1CFZA 2CUNA 4OQYA 3CEAA 4AJHA 1O95A 5EXXA 3FM9A 4RPHA 4HYTA 3I4LA 1GRNA 3V7YA 3H6KA 1RC8A 4DM4A 2VDKB 2HWYA 2JIBA 4OA5A 1KFJB 4I5IA 4OHUA 2PLWA 4RXTA 1SM4A 4M1QA 2WWXA 3KUUA 1Q20A 3CIFA 1EVYA 3QUSA 2XTAA 4RDIA 1J0DA 4G9GA 5IZ4A 3D6JA 1X8JA 3S7ZA 5D85A 1TOAA 3KPUA 4NJMB 3ZOKA 1ZVKA 3GQVA 5GY7A 4A9AA 1C3XA 2ZGVA 2NLOA 5H4GA 1KYWA 3G2PA 4K2AA 3K9FC 3GLFB 1SRQA 3NHSA 5A5FA 5IDVA 4LDZA 4H3VA 2DBVO 1VIDA 2OR3A 2YV5A 4KP7A 1KOJA 2PLRA 4C7MA 1X7ZA 3ZQKA 3EHEA 3ZHXA 2HBRA 1OKKD 3PUXA 5K8UA 2FE1A 3FFBA 1JF8A 1EX9A 4M9RA 4MOWA 3ICQB 3TVDA 1RT9A 3EASA 4FLFA 3TVTA 3JALB 4M60A 2HCBA 4LJ6A 1CUHA 3NW9A 1Y8RA 2JRCA 2QLTA 3H2SA 1G3IA 4ZRNA 5GZ1A 1C4KA 4ECAA 2OKGA 5CAEB 4UATA 4NQZA 3TPFA 5DHTA 4RD0A 1JHRA 2P11A 2Q1XA 4O59O 2D1TA 1WUTA 4NZZA 4LFBB 5JZOA 3K9WA 2V8BA 4H6PA 4KOEC 2XKAA 1I80A 1VE1A 1OIWA 3BKXA 3JXEA 3SYMA 3CB2A 2BMJA 1XZGA 5HJ2A 3INYA 2PBRA 1CUYA 5KMGB 5I4KA 3B5EA 3AILA 2HU2A 3CN9A 4QULA 1D0IA 4GI1A 1YDHA 3L1KA 1I4DD 2DFTA 2X41A 3S0JA 5C9ZA 2RK4A 3L77A 1M7BA 2ACKA 3LY5A 3AFGA 3E9YA 1P4GA 2XNHA 2KSQA 3WMFA 4AUNA 3PWKA 1I0ZA 1Z5WA 4HSGA 3G5UA 1N6IA 2C4VA 4P4SB 1H4TA 1YR7A 1CZRA 2PL9A 3AVOA 1KO4A 5H1YA 1NE2A 2E3JA 5A03A 1H3FA 2H2IA 5IM4F 2ACEA 4M1KA 5TGTA 1PFKA 1Y7PA 2ZRDA 1Q92A 2DPXA 3UMSA 3T15A 3ZVKA 3VHRA 1FPQA 2PXAA 3HJRA 3L0CA 3WOHA 5JMPA 2N42A 1KQGA 5CA0A 2B5WA 4Y9UA 1XUOA 2E1RA 2IPMA 3NTUA 4JYMA 4YCSA 1XRJA 3E4DA 4NCNA 4QUEA 4R0MA 2R2GA 4N0EA 1BRMA 1O96A 4GEGA 4OVKA 3EEFA 3L0BA 2KWIA 2DETA 2JVJA 3AB3A 5BRNA 1YRWA 3VNVA 4EGSA 3BK1A 1TM4E 2HC9A 4BMVA 1U3TA 4BLVA 5LZ2A 4F1WA 2DECA 4Y2XA 3QE9Y 3KJIA 4Y2TA 2PVCA 3I2JA 3N0WA 4PC2A 2CLLB 2OSBA 4WOBA 2ZVQX 4NRDA 4W5OA 4YGXB 5AH0A 4MV6A 1OXSC 2BJVA 1ZW1A 1L8OA 1SBIA 5KJEA 3TW0A 3FZYA 5CNMA 5DRYA 5JBIA 1O0CA 2XQJA 4N6OA 3GJYA 3FGOA 4M98A 1ECCA 1ST2A 2EP5A 5L7WA 5BWMA 4W9NC 1T8YA 4KQMA 3IXMA 3UJAA 1UT8A 2DE0X 4DSZA 4DMKA 5CXXA 1C8LA 1JKXA 1QYWA 4MTLA 1B6SA 1T1RA 5JVDA 5DGTA 4X65B 1KRWA 2NVOA 5M29A 2BGWA 1DIAA 2J0VA 2CCKA 3BDVA 3DO8A 4IKPA 5KOHB 1ABFA 1OBFO 3S2FA 3T8YA 3ND5A 4EEXA 1WABA 2V96A 3EUEA 1V4NA 4GO1A 2CNOA 3ED1A 4KVFA 3PFFA 5JZMA 1TPZA 1YC2A 3M83A 2BJWA 4BO6A 3GLFE 1Q2UA 4XA8A 5B1IA 1IYZA 4R3UC 1JHMA 1LV8A 2UXCB 9MHTA 1Y1LA 1Z16A 1V45E 4OBEA 2IELA 4CLDA 3LUHA 1JSXA 1W5SA 1P0IA 3QKUA 4JJEA 4R3NA 1HI9A 4U39A 5CGZA 4JD5A 2GXUA 3TIIA 3IR7A 5EE5B 1NLMA 4OKSA 4Y8VA 3OPQA 2FR1A 1R5BA 3RUCA 4G5HA 4Z6KA 1B0UA 5A4IS 4P92A 2CJXA 3L4BC 1OB5A 1TCCA 3Q5DA 5IBPA 3AW9A 4Z0TA 1OOEA 3WJAA 3C8DA 3YASA 3I61A 4NCAA 2X1HA 3KQHA 1S4QA 3N28A 3AQ4A 2O3RA 3MMNA 1PU2A 3IE0A 5LXTB 1LPBB 2Q3FA 2XQFA 4JUCA 4NYIQ 1E3LA 1I0LA 1R88A 3EZXA 4C03A 9LDTA 2IXFA 1EMDA 3H0KA 3P9KA 1J20A 4PO3X 3WC4A 1KXJA 1E2KA 3R5XA 4LHEA 3UW1A 2B92A 2MSWA 3MYRA 2OO5C 3EVFA 3OJ0A 2AS0A 1DTEA 4L8YA 3OZTA 1QBGA 1Z88A 3AR5A 4FKBA 5CD1A 5CM8B 4LJYA 1Z5NA 4C7KA 1YHZA 1S8FA 1V8ZA 3FMIA 2ZRKA 2RI0A 1GLVA 1BEUB 3I52A 3IAM6 4NDAA 1V3VA 4IDOA 1J0CA 4BNHA 2XUHA 5JJBA 3LCUA 3AVPA 2TMKA 4BVFA 5L8VA 2LUOA 3I0MA 4JK3A 4PZEA 4C0QC 1SHZA 5AR1A 1ZD8A 2BT4A 3D6HA 2VP4A 3QNWA 1NYLA 3RVJA 1PL6A 1LI5A 1FL9A 3ROTA 3WSTA 3ANYB 3I30X 3HI4A 3VR0A 2FF7A 4NZYA 3PJFA 5GIPE 1YR6A 5T4BA 3HFJA 3QVLA 4P58A 2C7RA 2W8BA 1CJBA 3C41J 2WWTA 4PQYA 5CTAA 2XSZA 1V3UA 1ZN2A 5JXGA 2QJFA 3S2EA 3Q8XB 3O47A 1TAGA 2AG5A 1E1RA 3GN2A 4NCHA 1AMUA 2H1VA 2YW2A 2V4ZA 3TRJA 3ZZUA 4QO7A 4WBNA 1MVLA 3B9RA 1V1MB 3N05A 4JT4A 3DHWC 1Y0BA 4H35A 5C0OE 4QU0A 1Z45A 3BERA 4QDXA 5TVKA 1U8UA 1XQXA 4P3YA 4IEIA 5A4AA 1XFDA 4JLDA 3HYLA 5H81A 2XVYA 4X1YA 2OFFA 2O07A 2RJ3A 3PR1A 2ODAA 3D4BA 3P71T 4GHWA 4PBRA 4ZZ1A 3V9PA 2GKOA 5E7MA 4RL6A 2IITA 1AS2A 5H59A 4I5DA 1QNFA 3QPAA 4Z99A 4BJHB 4FHGA 5TF4A 3VZBA 4ZVVA 2F9FA 5JS2A 1APBA 2DEUA 2OL4A 4QDJA 2PJDA 1IMJA 5LDHA 2ZE7A 5IC4A 2PH7A 1O95D 5IASA 1T9ZA 1OCEA 2CYBA 3GFGA 4M6WA 4LYEA 2ZE6A 4P98A 2BDEA 5CVJA 1XB2A 4RORA 1ISRA 2P0YA 3FPJA 3QEOA 1WS6A 3JSXA 5JARA 1A4RA 3H7IA 5ADVA 3DS8A 3MINB 2IXTA 3ND7A 2VEDA 5A9SB 2QPTA 1OZAA 1A5SB 4JVNA 2X9NA 3OD1A 4EELA 1WQ3A 1ZD2P 3C2QA 5EPOA 5FOQA 3IUEA 3LTNC 1DJPA 4RSMA 3U81A 4MUJA 3ZW8A 4ND5A 1G2QA 3CZ5A 5C5EA 3ZV6A 5FFNA 4MZXA 3UFXB 4MLPA 3T9AA 1SO8A 2O3JA 4HDSB 2B2XA 3CF2A 4WZBB 4XTRA 3L3BA 1Q1QA 1AA9A 1YWGO 3PHGA 2DBQA 4MP6A 4E94A 2QX9A 3U13A 2XMCA 4D8YA 3RT1A 1GL3A 3Q88A 3UWDA 2OV2A 2FPRA 4OHXA 3I2KA 2B1IA 3N1UA 1GV1A 4UMVA 1MFPA 3F6RA 1PGQA 2IUUA 3S81A 1SR8A 4AYXA 3GFVA 4N0PA 4FYKA 2NXNA 3S1LA 1IPEA 3I42A 4H08A 3U3OA 1G21A 3AKDA 2VF4X 3QLEA 1G8YA 3DFFA 3EC2A 1OFIA 1BOOA 4UUBA 1U5CA 2BD0A 3AGPA 4UOQA 5ELLA 5FBQB 5A71A 3R7DA 3UHFA 1XJQA 2CWWA 1G98A 4I46A 1RAGA 4BQIA 3C8ZA 2V6MA 4QASA 5PNTA 4MI3A 2J3IA 3VR2D 4WSOA 4FTWA 4FGLA 2OO3A 1E1KA 1HX7A 3BRQA 2JGMA 3LBAA 4C87A 4EKEA 1IY0A 2ZBEA 4PRKA 5A04A 5BY2A 3OLQA 5G40A 2Y68A 5CFNA 1XLVA 3T54A 2BI4A 3RC1A 1ZL0A 2Q28A 1XRNA 5JANA 2ZIVB 4O4LB 4DW8A 3DBIA 2E4UA 3COVA 4C4SA 4HZGA 4BJ6A 4ERXA 3BXFA 3BIOA 1IN6A 3GJ6A 4MVJP 4UREA 3RH0A 5LR6A 3N8KA 3AV0B 2EKPA 3C3KA 5EIWA 1JIIA 3O1IC 4D81A 2O8CA 2CUTA 2I3AA 2WD8A 3MS4A 2I2AA 2KB0A 1L4BA 3GLKA 4V0NA 5A5GA 3UFXA 2YZNA 3GRZA 4EGCB 4LJAA 2XNCA 2B2CA 4ZJYA 3A27A 1WDLA 3CRVA 5BSRA 3H65A 3H5IA 1J49A 5JW6A 1L5HA 2NUBA 4MIOA 2OTCA 3GZNA 3C3WA 4Y2JA 2CHQA 3QY9A 3DKIA 2ATIA 3PFIA 4WTOA 5D1NA 1EUDB 2BZ1A 4W1PA 5JAUA 3PVSA 4KXQA 2FZGA 3N53A 4RZHA 3JR3A 1N0UA 3FOWA 2C4NA 1U5AA 4C2TA 5AKIA 3DVQX 1ZCAA 2BUAA 3DZHA 3L0OA 3NV9A 2JDID 1TO1E 4MO2A 4YQYA 5BMVB 3EPLA 1O4WA 1ECBA 5K0FA 4D4JA 5CGQB 3T34A 2FGKA 2HAEA 1OAOC 1OXUA 3HDQA 2I22A 3LAWA 4NMXB 1YFKA 2JA2A 3WGMA 5AHKA 2CBXA 3MYYA 4UEKA 5BYAA 4KWEA 5E0KB 2O23A 3LHKA 3OOEA 3K6JA 2GEUA 5FP0A 1T9HA 5HCIA 3SX0A 3VQTA 4Z1OA 2QTFA 3KUXA 4IFEA 2XLCA 5LKRA 2AQIA 4UQPA 2XE6A 3CFYA 4YRAA 4WD3A 5LU8A 3T3IA 2R86A 3UMVA 1Y3HA 3CLUC 3VYUB 1SBTA 1ZD1A 4MIYA 1WSDA 2R62A 1EVIA 2ECPA 1JB1A 1MNQA 3IP3A 4OA8A 4AY4A 1NVUQ 1FRZA 1JW9B 4EFLA 1R0CA 3EIUA 3QX9A 3FMPB 4UBMA 3ZCRA 1LUAA 1VG9B 2QXUA 4TTVA 1N5DA 2XWJI 3IPXA 3KDPA 1BCRA 3IQIX 3CUTA 3RVPA 3ZGNA 4IEEA 4RD3A 1Z7WA 2AZDA 4M88A 4F5WA 3PBKA 4OJQA 3VU9A 4HMQA 4DKJA 1ZN9A 1G63A 2QN9A 2AEEA 2HJRA 3E1KA 1GPAA 4KIWA 3E70C 3RC9A 2EBWA 2XUOA 2D3TA 3EPHA 1DDIA 4UCQA 4BVAA 3T7JA 4F9TA 1CWUA 2Z1DA 2Z95A 3BFVA 4LE2A 4AWBA 3PXUA 4YBZA 4EY6A 2Q7DA 3PS9A 5KQSA 1G21E 1Z2NX 3D3WA 3D81A 5LOVB 4DDVA 4ZOBA 3EDQA 1O0BA 3GUHA 4R9UC 1NW6A 2OV3A 3PV0A 1YZLA 2RHCA 3AIIA 4FXPA 1P0CA 3P20A 2EFHB 3AHFA 3K6KA 5FUYA 4DZRA 1J5EB 1DELA 3DWGA 2V0NA 4GDMA 3H19A 1UBEA 5HDQA 2VRWA 2DQSA 1UMDA 3DVRX 1ZZEA 8MHTA 1X70A 2FETA 1JQKA 1CYDA 2Q4DA 4PSKA 2MCFA 5KYUB 2XCTB 2XD4A 4UDOA 4BO4A 1A2KC 3KELA 1YJBA 2QZPA 3W1VA 2XB8A 4R68A 1WUKS 3MWYW 1D3AA 4XJSA 2ASVA 1VJ5A 1LTKA 2CFTA 4LOJA 1G1AA 2YYZA 2VQDA 5EP4A 1JPVA 3QNMA 4IAOA 4JJ8A 4RCZA 1XTTA 2A3NA 3MLBA 4ZALA 5CVTA 2XUDA 1NNI1 2HXSA 3EXG1 3RFFA 4UVDA 3O8OA 2FSPA 5EWLA 3F9IA 4RD2A 3QXXA 2VDOB 2ZCJA 3NNDA 4A0HA 4UTZA 1NONA 4KAJA 3NO4A 3MJCA 3ANNA 4HUQB 4Z2AA 2LIVA 1W5AA 5LP6F 4AB1A 4C01A 2GD1O 4YXFA 4O2AA 1Y5MA 5IM4A 2XYVA 3RRZA 3IE2A 2B8TA 2O1XA 3L1JA 3L9WA 3QEMA 1I2CA 4LS3A 1W87A 5C5DA 3HYRA 1DKUA 2ECQA 3COPA 4CL0A 1Y4DE 1IZYA 1OASA 4GXQA 4LY0A 1WZ2A 3TUIC 2EQAA 2A0WA 3N2KA 3W77A 2Y0CA 4OAQA 4B7XA 1GPH1 1HL7A 1L7MA 4NY1A 3SF8A 1CEQA 1YS9A 1JDJA 2WD7B 3EXHC 3ZY3A 1GR1A 1GAJA 2ZJBA 3PUKA 3AETA 4KHZA 3U4QA 1PEDA 1J24A 1N0WA 2P2DA 3BF7A 1NBWB 4JLSA 1VPTA 4RKQA 5C1PA 3OE7D 2TSYB 3J80A 3DEYX 3JQ9A 2Q5OA 3L6CA 2OAGA 4L6CA 2JIRA 2IW3A 3QYFA 2WKPA 4PF1A 1M5RA 5J4YA 4EF5A 2IYAA 1CJTC 2BE9A 2WOJA 4P38A 1QH8B 2UZ3A 4GPD1 5CK5A 1H9CA 1YS7A 4HRXA 3MS2A 1EE1A 4ZQFA 3F4KA 3M6AA 4WKOA 3ZD7A 3HA5A 1JIVA 3AOEA 5HR5A 4BRSA 1U9ZA 1BO6A 4WNIA 3VJLA 3FF4A 1SUDA 4YQFA 3NAQA 4I55B 3N75A 3R9XA 3CU5A 3HUDA 1QIHA 4EF6A 5DNWA 3PCXA 1N2ZA 4L6IA 5DHPA 1NMXA 2AHOA 1GKYA 2IZ5A 3OT5A 3QV2A 4MXDA 4G8DA 2C2MA 2CC2A 4YRPA 2ERXA 2C9OA 1Z2CA 1NDHA 2ZYDA 2QLNA 4X91A 1V7CA 2CB9A 3QHPA 3UK1A 2YICA 4N0DA 4Z7QB 4U5XA 5FBZA 4Z4GA 1A2OA 3SEQA 1G1MA 1XCMA 4EYKA 3T5GA 1ETUA 2O6LA 2V7XA 5KYNA 3KU1A 2FWJA 1P2VA 1K6IA 3TR5A 5TMPA 4TMXA 1L5NA 2FX2A 1QHFA 3SDBA 1UWVA 1A2QA 1NJSA 3BPSA 4ASUA 3UWMA 2J59A 3EPPA 3QG5A 4AJNA 1U0FA 1JA1A 1XMVA 3U4HA 3IQFA 2KW5A 4OM8A 1X7XA 5HW0A 2WJIA 1R4NA 2OB2A 3H0CA 5JJCA 3WB9A 5IJ9B 2CVZA 4H59A 3VOBA 5IN4A 5ICGA 3C98A 1SWWA 5JAHA 4G0ZA 4A73A 2F48A 1V3TA 1PWHA 2CJPA 2UAGA 3A6FA 5G53C 4M1SA 4DUZB 4PIMA 4ZYTA 4ND1A 4YRLA 3VNUA 3RFXA 2F3UA 3ASUA 4BLTA 2KHZA 4HDKB 1OWLA 2GFHA 4N6GA 3TOZA 4DJTA 4L9SA 2O2HA 1C5KA 1N2JA 4K3UA 3WGVA 1UT6A 5AI4A 5AI8A 2G8NA 1XLWA 3FHOA 1VSVA 1OTXA 2A1TR 1XD9A 1KEZA 1FTSA 1RQGA 2A3RA 2CXHA 2OV4A 3PHCA 4E51A 5A3QA 4IIHA 2QL6A 3ZWWA 2O0KA 3CKKA 1X1AA 4B3HA 4ARIA 3NTRA 2Q46A 2ZCVA 4IM7A 2CN1A 4QVIA 2FPOA 3HWX1 1JT9A 4LYGA 3LPLA 3TTUA 4B76A 5J58A 1FCJA 2UUCB 3LBNA 4DA9A 5CDHA 1TCUA 2JGKA 1MW8X 3IAS6 4R5HA 2H51A 2QR5A 4S04A 1BS9A 2CV0A 3T7EA 2C2OA 1RC1A 4BL5A 5E1DA 4HQFA 1E1LA 1J2EA 4C0LA 1E3TA 3KZ1E 1ZISA 3NWPA 1OYOA 1TZBA 3VKWA 1UBJS 5CVVA 2HBYA 1E9SA 4E88A 1ZUNB 4EUSA 1HT0A 5G1NA 4PVDA 4BWYA 2LVBA 1X80A 4QUJA 5C7YA 3TNYA 4P81A 3LECA 4OB6A 1PNOA 5I9TA 1KDVA 2GRJA 4M7PA 4DA7A 2WHQA 3AYXB 3RSCA 2QMQA 2ZBDA 1EYZA 3L02A 1OVMA 1HDRA 3I1IA 4GC9A 4BU1A 2AC4A 3ZCVA 2DR2A 2JFPA 4DKXA 1KR5A 3AVWA 3NHJA 4LBWA 2XSZD 1AIPA 3LT4A 5FRDA 4NJMA 3LYAA 3RAPR 1P91A 1NASA 3A0UA 1NWHA 3B3QA 1C1XA 4G09A 5CURA 2AHRA 1G55A 5EJGA 3S7TA 4EA9A 3GLFA 1W0JA 1XXHB 3ZE1B 1PHPA 4QRIA 5SZIA 5C5IA 1JHPA 3AF6A 1GGEA 2Z3VA 2CXQA 3E1GA 1CJKC 1KFEB 3KRTA 4PPGA 3H2BA 1O0SA 2XB9A 3EHDA 5D6OA 3RTBA 3SZOA 1T3HA 5CJ2A 3VZSA 1HBJA 2FZKA 3LLCA 4AUKA 5LQJA 2XYHA 3RAEC 2X0RA 1DTWB 4K7JA 4G1BA 5JI3E 1T2CA 1Y34E 3IMFA 1M8FA 1PKEA 1ZFNA 2ADOA 2GX6A 4LDAA 4B40A 1DT5A 3CPHA 5GMOA 3D7LA 4G0PA 2I87A 4FWBA 2YOGA 4L9AA 3H9BA 5TQ2A 1UQTA 1YDEA 4XDGA 1C30B 2B4YA 1EXDA 4DR1B 2Z8YA 3IP1A 3H3JA 3Q87B 4K1XA 1CQZA 1D2RA 4YJDA 3ANLA 4F3NA 1ODIA 2BP7A 5KVAA 2AJLI 1OQAA 3NAGA 4CUJA 2OFWA 1RPTA 2ONZA 3NYIA 1U90A 1GPDG 5L3ZA 5D5QA 2WY2D 2VK1A 4B43A 2UVQA 3Q5EA 1TCAA 1AVTA 4C07A 4F1JA 5KMGA 4ABYA 2RFLA 4F97A 4JVOA 4AYWA 1TW3A 2F4NA 3EXEA 4EFDA 1M2JA 1ZM7A 2WJHA 2XKKA 1Z6YA 2P0EA 3PE6A 5CHYA 3RREA 1VMIA 3SS7X 3V80A 3VR3D 4C2AA 4N76A 2R44A 2DTDA 1MXHA 2QRMA 2XWSA 2P41A 4RA6A 1UAGA 4UUNA 4L28A 3RU3A 4XTCS 3EODA 2VJBA 1PLJA 3R6WA 4XOUA 1NR7A 1H23A 5EKSA 5E6UA 3MD9A 4U0KA 4ZVTA 1OT3A 1T3GA 1EWYA 3HDYA 3QXCA 4HWTA 1EX1A 4FGSA 4JGIA 4LSGA 3E9CA 4LNAA 3W4IA 1XELA 3Q4GA 4XIJA 1U80A 4JROA 3MHPA 4LCBA 5FWAA 3WLMA 3A3YA 1H85A 1IB6A 2BFEA 5HMMA 3WLLA 4B73A 1OBVA 1ZWKA 2Q50A 1R74A 5AM4A 1HEIA 1KORA 4FD2A 1EP9A 4MWGA 4Y9RA 5K3CA 4CCYA 3S3TA 4Y9DA 2F3TA 1AB5A 1N25A 1PT6A 4ND4A 4ENRA 1W46A 2OECA 3W9SA 3X1DA 5HKKD 3OOSA 2XZOA 3URMA 4LZAA 1TD9A 1USGA 1BG6A 3EZYA 3ZDDA 2FQ1A 2IJGX 2R6GA 2XCRB 3CE9A 1E7QA 4R3WA 5LA6B 4L0DA 1AMNA 3OZAA 2ZRQA 4ALNA 5DM4A 2GBLA 1GTL1 4IGKA 3DEZA 3BTOA 1BEZA 2WSBA 1YRLA 2R7AA 4FYMA 1JHAA 1AKYA 1U98A 2GNOA 4RQTA 4E2ZA 2V7UA 4U7DA 3RWMB 1Y6JA 4JI0B 1JKMA 5AHOA 4WOJA 4ZVQA 3ABOB 3H4VA 1R00A 4BVEA 1YZ3A 4TM8A 1Q0QA 2ZIAA 3SLRA 1FQKA 3MCZA 3OQPA 3LVBA 2UYQA 1E32A 5EPEA 1Z34A 3I01M 2VJQA 3QUAA 1Z3CA 2FQWA 3HV2A 1JIKA 2GSDA 3OZSA 3C6MA 3RR2A 2BCJQ 3SQNA 4BGVA 3WA7A 2GBIA 3F7OA 5CLIA 3LGXA 4B4UA 1LI4A 1VB5A 1CY2A 2IY8A 3DWFA 5EIAA 1XOIA 4HLUA 2ORYA 1NRWA 4LQLA 3GJ7A 2KLBA 3ZHQA 3HI6A 5G41A 2Q1TA 5A2GA 2CLMB 1F3OA 1T1SA 1TAHA 2P5YA 2ZWOA 4JV5B 4PGHA 4GX1A 2IYQA 1MVNA 2ZBRA 1CRZA 3R5JA 4KXVA 4YUWA 2O3QA 2OHJA 4RCYA 2JD1A 1Z5PA 2VJLA 4PAWA 4M8NE 5HE9A 4LF9B 4UEWA 3NEJA 4ZOCA 4CRWB 4DR6B 4JBLA 3KP1A 1G0OA 1E79A 1WY5A 3H9CA 1OAAA 3F6YA 3PQ8A 5FQOA 1GLNA 3WGJA 2R5NA 2WTMA 1O97C 2JIOA 1QHSA 1V1RA 3A2NA 4KDRA 1LPMA 4Y0AA 1SIWA 2OG1A 3QG1A 3W6ZA 4KXNA 4NCJA 3EFOB 1IBMB 5CT9A 4IX1A 3V8VA 1KY3A 1YQQA 5I9IA 3ENQA 3ZPXA 1I6WA 3JWEA 2Z1NA 1MW9X 2DQYA 1PW7A 2CLDX 3TH5A 1YZTA 4RH1A 4GWKA 1AN9A 1EUCB 3LA6A 1L9KA 4UAVA 3NQ41 1ZMOA 5KJ1A 3OE1A 3EA4A 4L95C 1GZ4A 2XMSA 1DC7A 3L0DA 5LCXA 1IB0A 2QX4A 3NDPA 4KVAA 5ALWA 3W6NA 3B7PA 1PR9A 1V41E 3O21A 2ZI5A 4MS4A 5J43A 1V1JA 1D2CA 4O4IA 1F0NA 4B31A 4D43A 4DQKA 4FYIA 4Z4CA 3E48A 5ECWA 3DB2A 2POCA 2FN4A 3NLLA 2ZWIA 5IAEA 4OJKA 3ICVA 2PYDA 3KT3A 3WWPA 2FPIB 2O2XA 4FCVA 4RGYA 2G1AA 1Q0ZA 3MMPA 3PKJA 3ETEA 4TZTA 4BC0A 2HT6A 1OGYA 1E7SA 1JPUA 1Q1EA 4XH9B 2PUVA 4ISBA 3ZI4A 3C7AA 1CQWA 4K9MA 3FX2A 4TM7A 1JHOA 4OXNA 4FB4A 2V1XA 1NI4A 1FVOA 2IU6A 1UXJA 2VWPA 1PNQA 3OBIA 1SBYA 2BR5A 3B70A 3ONEA 4PONA 3HXTA 3T7CA 1Z56C 1W88A 4B6OA 3GLUA 2WSMA 1PWEA 2QAIA 3HCCA 4FFBA 1BJTA 4C14A 5CFQA 2QRJA 3TLKA 1AKQA 1P29A 5DSTA 1XCOA 1DUIA 5HZHA 5HIMA 4EPRA 2ZTUA 4JBHA 2JFOA 3O74A 3EZ6A 2Q9BA 1YB7A 2XVMA 3DAOA 2HFKA 3JYOA 3JQAA 4R9RA 5EXPA 3ZX4A 1JR3A 2YXLA 4Z8XA 2Y66A 1YS4A 3RV4A 1XWWA 1YACA 1DAIA 4K9SA 1C3EA 2B9VA 3WFZA 2C5GA 3ELBA 4M99A 4B9AA 2PZMA 4WW0A 4OAPA 5FWYB 3KPVA 4FJ2A 1BXGB 1XTVA 4NS4A 3W0LB 3QPUA 1Y42X 1E3WB 1MTOA 3QFTA 2OBYA 4WFIA 4D97A 3W05A 1XZBA 4ZZ2A 3PPVA 4PZ9A 5CFOA 1M6HA 1SXJD 2O9JA 4BX3A 1NF3A 1ZXLA 4AJJA 4MVJE 4LC9A 2GCPA 3M0EA 4FUQA 2CMFA 4O4IB 3STHA 5MFPA 3ER8A 5JUWA 4GE0A 1MABB 4WKPA 3OJCA 2I4NA 3O8QB 4M87A 2NXJA 1XL1A 1COWA 3IPLA 4FYYA 4JC8A 3E0XA 1DBWA 1XVUA 3IDFA 1CR4A 1KEUA 3QOYA 4Z4IA 1C7RA 2JANA 4TT3D 2W4QA 1WUHS 2NO4A 5CRIA 3ZUGA 4DGQA 3E22B 1QGZA 3OQ6A 1L4UA 1QJ4A 2R8XA 1SB9A 3Q85A 5KCMA 4D5EA 1H6DA 3E5RA 5I4BA 5LYJB 5JS1A 1V8FA 2BGGA 4PO1A 721PA 2PDAA 2AN4A 4MP3A 3O4FA 3V4FA 3MPUA 1K7CA 1E58A 3BMQB 2I2BA 4MR8B 4TTSA 3X1ZA 4WACA 1F8FA 5FLYA 4NXMB 2IXBA 3M6UA 3OZIA 1L1QA 4JP3A 4W63A 4D4IA 1CUIA 5DDIP 4DCJA 4JUIA 4WZBE 1FP4B 4YRRA 2XT6A 1Q16A 121PA 1X87A 4H0NA 3C5HA 5F3RA 3IQZA 4HJXA 1KMHA 3B1KA 3A32A 4KH1A 1QZTA 3CWQA 2WRZA 3FNRA 3U1VA 4K0KB 1ZXBA 4OHMA 4MR7A 5BR7A 2F1OA 1FU4A 1XCPA 3I9LA 2A5YB 3A70A 3RWOA 2JLWA 4KJZA 3HBJA 3H2GA 1Q3TA 2D5AA 2GPYA 5FULA 4P3PA 4BYMA 2FFQA 4OBBA 1GUZA 4WXRA 3ER6A 4CM8B 5M34A 1Z6PA 4WLNA 4DBLC 2C7BA 5C1DA 2NZVG 3PNLA 4FFDA 2I6XA 3AHGA 4BFVA 2QPLA 1JUDA 1LF5A 2QMYA 2H9AA 1FBNA 4B33A 5JQWA 3ZGOA 1BE1A 2QTVB 3B1VA 4LJ5A 4ENUA 2HRZA 2HRQA 3SSMA 2A88A 1ULSA 4K9LA 3EXAA 1Q2XA 4IOKA 3THYA 3MB5A 3KWFA 4TLAA 9LDBA 4CXMA 2V4MA 4N65A 2QMZA 4FI3C 5EMHA 2FG5A 4TTRA 3RUHA 1AQIA 2G6TA 2XB4A 3NC0C 2DUNA 5JSFA 2AD5A 3DMHA 4UVGA 5MFZA 2ENWA 1KY2A 3R0IA 1A72A 1MB2A 2C4UA 3HCWA 2JI8A 3X1KA 1H5UA 1M6YA 3TQRA 2HRCA 2GZ2A 3TL2A 2FSHA 1A9OA 2YIJA 4AUMA 2HQOA 4A10A 4MUHA 4PC1A 5JYCA 4LXTA 2R1UA 1D6SA 5KYXA 3N9IA 2E87A 1R4MA 3ZK7A 2Q5LA 1TMGE 1V48A 1L5WA 3BXPA 5BMVA 4DR2B 1Y8ZA 3TNJA 2OA0A 3BORA 4IVQA 5INTA 5IKPA 3T7AA 2ZT8A 2XH8A 1Z33A 1AHIA 3GEMA 3MCVA 5FFFA 1ONSA 4WT7A 3SHFA 3JY6A 4HFJA 4OI4A 4CT5A 2C54A 1II9A 3CVYA 4KRFA 4MP8A 1RYYA 2O2DA 2ZRGA 4X8MA 5FF9A 2W6PA 4DN6A 4EUFA 5KYYB 3ND8A 3KPYA 3SQWA 3H5WA 3TEMA 5JMWA 1KNQA 3MTGA 3FNHA 4YBRA 3SLKA 4NV1A 5EJ8A 5T64A 5C8YB 3WIDA 1CZLA 3LRXA 2EERA 4XFKA 3S28A 1O58A 3RRJA 4D9EA 2Q99A 2QQFA 2YVAA 1MO4A 1QORA 2C4KA 3KXPA 3QX8A 4OXQA 5AHXA 4UVIA 3W5SA 2BFBA 2ZBFA 2FEMA 3KFVA 5HVNA 5TB5A 4JXKA 1RWXA 2Q0QA 5DI3A 1R10A 2J3EA 3BRWA 4MMZB 1E4OA 1DWUA 4NDNE 4KI7A 1QWOA 2WFLB 2X19A 3FGNA 3MBIA 5FUQA 4DV0B 1Z07A 1FLVA 2DT8A 3PX7A 3RC2A 1WOMA 2W6MA 4WDRA 5DYTA 3S68A 4UFPA 1NIJA 1QQ6A 1UJ5A 1RQLA 2XZDA 2IYLD 1RQXA 2LNDA 2QW8A 5I7WA 3C7CB 5JNTA 3OTQA 1BDBA 5DH9A 3KHKA 4BNYA 3ZWBA 1W5BA 2BFFB 3UAVA 2IBSA 3GNTA 1LVHA 4CQLA 2IK8A 1JN0A 4TVSA 4B44A 3DBHA 2Q3EA 5TPZD 1Y9JA 2IYZA 3FCUB 4OGLA 2J30A 1L2TA 16PKA 4WZ6A 1E2BA 3BGVA 2FMFA 4PAQA 3U5TA 3D6UA 1NJ1A 1JLLA 4HFRA 2YN0A 5CDSA 1R5JA 1C29B 2CDNA 1XJ5A 4W8GA 1OB2A 1QBKC 4X00A 2I8CA 2CV1A 2Z83A 3P0EA 3K8QA 4EO9A 3VH4A 4JI2B 2QZ4A 3P32A 5AVYA 5HKAA 1Z0DA 2Y76A 3PPYA 3PD0A 1XP5A 2OY0A 5AKGA 1U3CA 2INGX 5ENVA 1RC0A 4G0QA 1MU0A 4WIAA 5ICEA 4YMIA 2PMBA 2IE0A 4Q0MA 4RVUA 4D9GA 4BNMA 4XIIA 1PJ8A 3UNXA 2Z3ZA 5FOSA 3EDCA 2BMVA 2BTQB 3C1TA 1G5PA 4LRSB 2WKRA 3AL3A 5HZKA 2F1IA 3T1NA 3H5VA 5HTKA 4XDYA 5LP1A 3HY4A 4MUNA 1ODSA 3F6EX 3O4JA 2ZUFA 1RRCA 3EDMA 2WFLA 5I45A 3RVRA 3WBFA 4BLUA 2HWXA 5FEUA 2E4VA 4NBLA 3OZVA 1N92A 2QU8A 1Q74A 1FVFA 1Y3BE 2HXYA 3FCEA 1FUEA 3CX7A 1LBQA 1AM4D 2XVZA 3EY4A 1EFVB 3RCBA 1IHDA 4BMXA 3JZAA 1SVKA 2PU5A 1T0PA 4IPTA 2HUPA 1GZHB 3KLPX 1CR0A 1ZI6A 2BFDB 2OQIA 4YDHB 4CMEC 2XDWA 1JEJA 3ZEIA 4BNWA 2PUCA 1Z47A 4ITUA 4V0QA 3SMVA 3WOVA 5ERXA 1QP8A 3WAKA 1J22A 4XIFA 4EUNA 1CQIB 2B3DA 1GKLA 2HSGA 3S40A 1WLSA 1IG3A 2BSQA 1K06A 2WJ4A 3H2ZA 4TV9B 3GFTA 1US8B 1Z4QA 3ZR4B 2H5JA 1EFRA 2OILA 4FD3A 2I3GA 2JIZA 4F5YA 2ZI9A 3GT0A 4X6UA 1Z26A 3AESB 4ZYZA 3AL2A 5JSZA 4NR0A 3CE6A 4PSVA 1I51A 1ZM4A 3GJRA 4ZAVA 4V3BA 2A1UA 4DMLA 1U0NA 3TZHA 2RKOA 3GN1A 4CETA 3IAXA 1AQUA 1Q1AA 3KJGA 4L6AA 2LXNA 3PLAE 3D64A 4W5HA 2D2VA 3AEKB 1IM2A 1XCBA 4BB5A 5K0BA 5CNIA 1ZVQA 4MQ4A 3CH7A 4G4IA 1A8HA 2XGGA 5BVGB 1SA0B 2HIGA 4DDMA 4F56A 1JQJC 2CBZA 3FPLA 1QX4A 4INJA 3BWMA 2W7TA 4R1LA 4M21A 2Z2IA 3BHNA 1RRFA 3E9DA 4RABA 3WDSA 3ZE8A 3TZQA 3L0YA 5F3DA 5B7GA 3RTDA 1RWOA 5L3SB 1MG0A 5KB3A 5FOVA 2I03A 2DHCA 3NGLA 4PSUA 5E2IA 1H6BA 3HUTA 3FBGA 1KPIA 3WMGA 2DWUA 1W581 1XAIA 2SNIE 1ZUD1 2D4AA 4R8KA 4R83A 2R96A 1AHNA 1CDDA 1U4SA 3G5AA 5HE8A 5I7UA 1FUIA 1O8CA 3KKMA 1AXRA 4BVKA 3TYXA 1OYWA 2I1VB 3K0CA 3GA5A 1FS4A 1U8ZA 1A5AB 2OLEA 3RQSA 2F1RA 1X92A 2N46A 3GFPA 3Q3HA 1JQEA 1EFKA 1KI4A 4BNVA 2A5JA 5E6SB 4YASA 1GZ3A 1T6XA 3WXMA 3OIGA 3OIWA 3JALA 3ENNA 5HQ3B 5EHXA 2GSWA 1Y8RB 1XFAA 5PGMA 2CYCA 2HA2A 2WM2A 1J0AA 1Z25A 2AUNA 2Z5LA 2ZYWX 3B78A 2QUBA 1E1MA 3GZTB 3ZDYB 5C46F 3WHKA 4BS9A 4D25A 3HJGA 5L3QA 1V4BA 1S3IA 1SXQA 2R4TA 1OYVA 3D5TA 5LIRA 3LVQE 3LE8A 5ILOA 4TKVA 3ADBA 3HWRA 2YIMA 2AUTA 3ETCA 1JYEA 4CEIA 3KO8A 4IDBA 4UE2A 3WL6A 1F6DA 1YCHA 3ZCQA 3MILA 1XNQB 1M83A 2PUAA 2FWBA 4UVEA 3DW3X 3HBAA 2PX8A 1BVYF 1P5ZB 2B2NA 5GPBA 4WH0A 1EDEA 3R3HA 2X5KO 2ZM5A 4GOXA 5AVUA 2ZSJA 5FUBA 2VYVD 1HYGA 1VRVA 2XCLA 2OCGA 2Z09A 4JDPA 4IIDA 2V59A 1J25A 3L6OO 1J8QA 3NM4A 3HBMA 3ANMA 3R3JA 1SH7A 5JVDB 3NS7A 2Y3IA 1MOQA 1XXHA 1WJGA 4L3WA 5LB4A 1H6AA 4KGXA 1MF7A 2PMDA 2E5LB 3HU5A 4PS0A 2GBFA 1U0RA 1XZLA 4HYEA 2ZUDA 3A1EA 4RAQA 1XZNA 4RV9A 1E6EA 2AFIE 1NUTA 2A9PA 2PZKA 4GOMD 1MC5A 2CD9A 3HKDA 3K4HA 3FCYA 5CFMA 3NYWA 4NV0A 4RY8A 2FRDA 4PHGA 3U19A 3Q7RA 2V7QD 3NT4A 5CDTA 5HCNA 8AT1A 3FPGA 1F1JA 3BX1A 4ZQCB 2FHPA 3CA8A 4EX6A 2AMLA 4JJKA 1SOUA 1V43A 3DD5A 4OUDA 1NYRA 2AK2A 3AR8A 4R2WA 1VYVA 3OJLA 3HMKA 2O8DB 4CG0A 1WSWA 2AWOA 3JVUA 3CF6R 3K7EA 2FAXA 4OH7A 1DAEA 1AKEA 2IYOA 4GYWA 4TKVB 2VWGA 3GLIB 2KJQA 4QTYA 1TM1E 3FYDA 2YXDA 5DNVA 3AUJB 4G8BA 4GPIB 4IV5A 3Q2KA 5IFLA 1C1YA 4XQEA 4Q7KA 3OFNA 5LQSA 4NWIA 3SR0A 1OH7A 5IKEA 1MIOB 2H5IA 3OKPA 4FHCA 1P1JA 3BH0A 1R27A 1UK6A 3AR3A 3EG9A 5FEMA 4BP8A 1U02A 4RA6B 5E8RA 2AN5A 4CDNA 2YQ5A 3FZQA 1NKSA 1DS6A 5LB2A 2HLNA 3OURA 1KZYC 1ULZA 1THMA 4IHJA 4KXLA 1CZUA 1T9CA 5JQGF 3NYQA 3QU9A 1N5IA 1ILEA 3EQ6A 1RKVA 1QRDA 1T3SA 3R3VA 4UNIA 4DDHA 4ZMRA 3P8ZA 5AQ1A 2IUTA 1DOZA 3EXG2 5DX8A 1IEQA 1XZ8A 2YINC 3PXDA 5B58T 4DNXA 3F8SA 4AW9A 5KJCA 1Y8QA 5EXTA 4WFJA 1AZSC 4IDQA 1YAJA 3K4QA 5J1TB 3SBOA 3ZWQA 4BNDA 5HZMA 1ANKA 2G17A 5T5QA 1KH2A 1TJ3A 2H29A 3DP9A 1PD0A 3BWXA 4M46A 3TCNA 4EYSA 3WGYA 2XZTA 4FU0A 1IY1A 2QD4A 2Q5IA 2FXVA 4E07A 3U62A 2A30A 3K20A 1NMZA 1AO3A 1XO1A 1DEOA 3OIDA 4XLTA 4LPSA 1TF2A 5GP1A 4CQJA 1WXEA 2ICAA 3HU2A 1XQYA 6NULA 3LDGA 4N12A 2A35A 1YJQA 1DC6A 1T3ZA 2J6CA 2PD6A 2J31A 1R0KA 1VSUA 3GRYA 3M49A 2QROA 2WUEA 4G67A 1RPNA 3D7MA 3V7NA 1WUIS 2FX5A 2H65A 3KU4A 4E2FA 4HSEA 4M1MA 4ALLA 3R5FA 3WWDA 2WM9B 5IT0A 3HEMA 4D3DA 1C50A 4PX5A 3M6MD 1I5RA 3RARA 4BLRA 4A36A 4FFLA 4NOMA 1SC9A 3GDFA 3OP4A 3RADC 4LJ9A 3TAXA 3JQ8B 4Q9NA 1J06A 4MW2A 1V6AA 4HXFB 1YR8A 4X0EA 4PZ0A 2DPYA 4ZAWA 1TIBA 2AMVA 1USKA 2IEDA 3I34X 4PC7A 2B0CA 4D56A 2C4TA 4G41A 3SSNA 2W6JA 3CPSA 221PA 4NENB 4D9FA 2Y27A 1H2RS 2QPAA 5CYPA 5DWDA 1TUBB 3TLGA 2HHLA 1EXNA 4NMLA 4UDXX 2VSYA 3Q72A 4ZO7A 2FUNB 1GTG1 2BVNA 2Y1GA 3QX3A 3C70A 2E55A 1T5IA 4IIYA 4B32A 4BFXA 1QX3A 4GUDA 5GV7A 2VXCA 3BWYA 3I04A 5CCDA 3ZQUA 5FNVB 2FUKA 4ZYYA 4R51A 2FW8A 3P9NA 4O08A 4P82A 1OZ0A 3SYTA 1GKIA 2E7ZA 2FRVA 3L1IA 1AKWA 3MSCA 3KTFA 3QHQA 4MQ5A 2Q4BA 1VPVA 3L4BA 3TKAA 4D8XA 4HAWA 2RBEA 2CUKA 3B7GA 5IULC 1B14A 5TT1A 3ELYA 1RRKA 2WIBA 1E2JA 1AGNA 1REQB 1JI3A 1HDEA 1M8PA 1VLVA 2QRPA 4AAYA 3RS3A 2ZUEA 4W5JA 2B94A 3O9VA 4ZOLB 1R5OA 3GO4A 4HNAA 5CVDA 5TC4A 3FPSA 4Q03A 5JCOA 3WRVA 2I7TA 3GJ3A 4HDNA 1E4EA 3DVAB 2QP4A 5ALZA 3V8QA 3KYBA 5CB4A 1KC1A 3KTAB 1NKTA 1SUFA 1F3LA 2IP1A 2PGJA 3GRPA 2MMCA 4XSHA 3HL0A 2O05A 4JI5B 3TL3A 1FJGB 2PO5A 3DUFB 3NGMA 3EC1A 4YAFA 1UFQA 3QYJA 1IEXA 4NBWA 3C6BA 3N39C 3LP8A 4ENSA 1ORDA 4BQFA 4Q7QA 2J48A 3SD7A 1Y3DE 3WRWA 1SKYB 2XDQA 3R8CA 1Q84A 5KVCA 3F3MA 2OK7A 1A97A 2O2ZA 2R47A 2YIDA 3FTDA 1V1RB 5DOZA 3IVGA 3DHYA 2ID9A 2C7VA 4KXMA 1C0PA 2NV6A 1M74A 1VCNA 1IHPA 1P0PA 3GRKA 4MWDA 3KV3O 3EXHA 4C0KA 2YV2A 5DLYA 3VH3A 3DFKA 5AJHA 3UUEA 4DPLA 4O4JB 3SVLA 2OGWA 4FDMA 4JENA 1RPAA 2A9QA 1XEWY 3JQPA 4D4LA 1EFDN 1T0HB 1TVMA 3JW8A 4R98A 3UOWA 4B6FA 4BO7A 4XKJA 3DTYA 1XF1A 3LFUA 4EATA 1AB6A 1EA7A 3T0GA 5AUOB 2XZLA 3TTWA 4WKBA 1L5HB 2FMIA 5J5CA 3HCAA 4QSHA 1DBIA 2YUTA 3BJZA 3E7FA 4KIJA 3AEUA 1VRWA 4YXWD 3GOQA 1LQTA 3VFDA 3TM4A 4B2IA 3WAGA 3IALA 1UEJA 3QXSA 5EQJB 1YDFA 2QNRA 3V42A 1GU1A 3P0IA 3WWYA 4CMAA 1C9JA 2ZIXA 3ZY6A 5IT5A 3P9RA 1GGKA 4RY2A 4A6XA 4QG3A 3ZY2A 4WA8A 2GZMA 3KL2A 1XNGA 3A9UA 5KYWA 3STVA 2FJPA 1J33A 4KO4S 4D1YA 3SSOA 1ACJA 1P77A 1XLTA 3TFQA 3JQ9C 3W5HA 3NXSA 3KOWA 1NLUA 1YTUA 5JEDA 2WDPA 5LMNB 3MGKA 2HDNB 4QOEA 4AMBA 4HG2A 1QZXA 5J63A 3RTEA 3ZYCA 2CNDA 4OIMA 2EZUA 2Z56A 5KWSA 3KXIA 1P4RA 1CEXA 1PS8A 2BELA 2AJBA 4OHKA 1CK4A 4P80A 4R2KA 5F1PA 4W5NA 3UW3A 4O29A 2HIHA 1PR1A 2X9GA 5J5AA 3AI3A 1ZS9A 3W5DA 1EM8B 4EJ2A 4X7MA 1G8MA 2NZXA 4KQ9A 1WD5A 3PP8A 1MN6A 1QCYA 2YASA 4KYUA 2CSXA 3O7MA 4DGSA 3AG5A 4MVJI 1GAWA 3RHTA 1RJ9B 4PLYA 5CK4A 3R3ZA 1R2QA 3CEJA 3GLQA 3VU9B 1RIFA 3VSDA 1YB4A 1M5TA 1Z0SA 5G0SA 1Z12A 1E1QA 3ETDA 1VKOA 4CF4A 3I2GA 3FPHA 4D3SA 4I4TA 1NAHA 4IJVA 5DEIA 5JBNA 2QMUA 2ZSBA 4KC0A 3ZWDA 4GQIA 4EB6A 3RB8A 4F2GA 5B36A 3CLRC 3EVCA 2F59A 2WF5A 3M5WA 1XIVA 5JS8A 5M5BA 1Z36A 1U4OA 3E27A 3Q11A 3IT1A 4JCCA 1VL0A 3O1LA 3T5PA 1E1RD 1GSIA 1NN0A 5KX5F 3R23A 3CLKA 2XUGA 5FLEX 3AR6A 3LU1A 5B1DA 1XZAA 3LT5A 2HMYB 4MMYB 4MR7B 4RACA 1PCXA 4AX4A 1CKEA 3UMFA 4D6YA 1XZPA 5IJWA 5K6TA 1C0KA 2MU1A 3HP7A 3IO5A 1M2VB 1OA0A 4ESEA 1S7GA 2QJOA 1T0JB 2IIQA 2VLBA 3CZ4A 3EWAA 3CLSC 5EKDA 1R1DA 3GDWA 3HHEA 4AT1A 4HEHA 3ZBQA 4JU9A 4Z9FA 1YUBA 3DDOA 4A26A 2PLNA 1LBTA 1QDUA 3VX3A 1ZI8A 2EFYA 1TEXA 3O26A 5A3RA 1H1LB 5BNFA 4IV0A 3P4UA 2RHOA 4MAFA 1GTVA 4HDCA 1BJKA 1CUJA 5I7EA 3R8XA 5LM3A 3OY7A 3IDAA 2YN2A 2GAIA 4YRTA 5IC6A 1YI8A 1ZHHA 3DL0A 3AFMA 4GLBA 2ZU6A 3REQB 4OQLA 5JO0A 4KQKA 4CR6A 4KL8S 1HSZA 1QRRA 3O3CA 1XJCA 2I4IA 2DWQA 2SCUA 3LWBA 1U7XA 2F1HA 4J2HA 5CT4A 4ZYLA 1BMDA 2IYFA 5F4ZA 1FYDA 1TO2E 5ECDA 3BXOA 5CNJA 1A9XB 1RBYA 4O0LA 1JA0A 3VV2A 1BHQ1 4XWYA 3DAYA 4QOFA 5AP9A 2JLVA 3QVWA 4RVDA 3IS3A 1DP4A 1YL6A 3PDIA 2JFFA 3MA0A 4LZPA 2VAWA 4NX2A 2YUIA 1A04A 1UBHS 3L41A 2WSIA 4JLMA 4M37A 4JI3B 3U4GA 4A91A 5FTNA 1ILWA 1KYZA 2FFHA 2RGXA 5GGYA 3EOBI 3PQDA 4JC4A 3PYMA 3WYFA 1SXJB 1PDOA 3EAFA 2P2YA 4Q48A 2AF3C 3ZK8A 4FNGA 1IG0A 1MB0A 2A59A 1P44A 1QK3A 2VAXA 3D8NA 4HX9A 4L4SA 1OMOA 1R0ZA 2HM7A 1CUBA 1WBJB 3PE3A 4IRXA 1XLTC 2VJPA 3SSAA 1MT0A 2OENG 3SAJA 1XDSA 3Q1LA 4CLXA 2CMKA 2WF6A 1QG4A 4CTMA 5AJXA 4L4RA 2Y0PA 4U1RA 5B3AA 2VYND 4K40A 1R4MB 4WCDA 4N0MA 3FW1A 1R3UA 4ER3A 2IIBA 2NU7B 3BAFA 5DN6A 3P2JA 5TPWA 3DPSA 3GP5A 2IIVA 3O2NA 2Q5HA 1ZUIA 1PJAA 4HT3B 3QLTA 5IDYA 5KHOC 1GZ7A 1S2NA 2CFCA 1JFVA 4AF6A 1R6TA 1PUJA 1O94A 1WZNA 3N0VA 1TQ8A 2OPHA 1T4MA 1Y82A 2UUBB 1K2VN 3FCCA 5DIZA 1NJ5A 4EQ6B 1IJEA 2VJNA 3WBBA 5K0SA 5F5LA 3U3ZA 5J47A 5KPJA 2IXAA 3I58A 4R9SA 3M9WA 4BZXA 1AQJA 3B1XA 3JASB 2CL5A 4ZC8A 5JZSA 4LCJA 1R9NA 4V1CA 1H2AS 4PHTA 1KF0A 2VJMA 2QZZA 3OJXA 5AO9A 3UMJA 4ZHQF 3WY9A 1SC6A 4GBED 1QWSA 3I9V1 4M0DA 1GRCA 1IIRA 2C07A 2XRZA 4NE7A 1IVSA 1NC1A 5SICE 5K99A 4FJ1A 4NP6A 1PJ3A 4QJ5A 5GONA 2C2HA 3ZIAD 2OP1A 5TARA 5B1EA 1JKJA 3ZUPA 1NXOA 3UWPA 1H4QA 3R09A 4BV8A 2XOKA 5IKXA 2WB4A 4GFDA 4WY2A 4Q7EA 4FW8A 3UO8B 4NFSA 4DWJA 3DV0A 3KUKA 3ROGA 4EYGA 3ESDA 1KRHA 4ND8A 5A7FA 5IVDA 1U65A 4PN3A 3P96A 4HPXB 1H0KA 2B21A 1YBVA 4D9CA 2FLKA 3H1GA 1HEUA 2HRBA 1J7KA 1IWBB 2D74A 4ID9A 3A3PA 2XYGA 1KWKA 1JLLB 2BM8A 3FJOA 1FQOA 3MJEA 2V0GA 3ZE6A 1A8IA 3ZHOA 1G8JA 4DIFA 1FE8A 1QMGA 4O2BA 5ELXA 5E4TA 1IAVA 1P74A 1NSYA 3ZG6A 2I2WA 2OXIA 3KEOA 2HJSA 4MV4A 2PK3A 4AJPA 2D7DA 2ZUTA 3U16A 1K92A 4P7FA 3ISTA 4YQEA 2W6OA 4HGRA 5L51A 1H2ZA 1BSVA 3TG2A 4B3TB 1L4GA 1OILA 3SJZA 4K6KA 1JR2A 3IA2A 3ITNA 3PSAA 4BP3A 4EY3A 1KXZA 5L95A 5H3LA 1AHPA 5DTIA 1GQQA 1PG2A 4LMAA 2BTEA 2W0MA 4JSRA 5FPTA 1YBFA 3TLBA 1RACA 1HYBA 3MXOA 4IXWA 4BNNA 4ZGBA 5JS6A 1ODKA 1P2FA 3DLBA 4G65A 1FP6A 4FSXA 5KNDA 2AXPA 2WF8A 3NOQA 2ZAOA 4CTKA 3PI7A 3H11A 4MJLA 2YY6A 1FMLA 2QQGA