5AOCA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
282
structure length
277
Chain Sequence
AEVGRLRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
molecule tags Hydrolase
total genus 104
structure length 277
sequence length 282
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aocA00
1U65A 2DFPA 4Z49A 3PFCA 4ZGBA 2AXEA 3I1YA 3BJRA 1QIHA 5IKXA 3FVRA 3W05A 3PE6A 3JWEA 3G9TA 5BOVA 1QTRA 3NWOA 1LPMA 2OQIA 2H7CA 1A8UA 2VAVA 2PX6A 2XMBA 4MYDA 5EFZA 1CUAA 5E4TA 3W9UA 2IX9A 4AZ0A 2WUFA 3F8SA 1ZD4A 1GKKA 3QH4A 2ECFA 4C01A 1P0QA 5AI5A 4NMWA 1XQVA 2WJ4A 2WQZA 4K2AA 3FVTA 1G66A 5AKEA 2FJPA 4UBIA 5HQ3B 1ZD2P 3AILA 3G0GA 1LPPA 2QXUA 1CUJA 2GYWA 4OSEA 4BTVA 2C58A 1MX1A 5AIAA 1E5TA 4Q1VA 5EGNA 5EIAA 4AXBA 3O4JA 4EHBA 4UBMA 2GBFA 3FLEA 3FYUC 1BEEA 1W1IA 1BCSA 4RE5A 3A2LA 3SC2A 4DMHA 1A88A 3V1LA 3NUZA 2GBGA 2HADA 2CBGA 2XT0A 1AGYA 5HCUA 3OG9A 5C7YA 2EDCA 5ALYA 1EXWA 2XLBA 4N8DA 5EHZA 4H7KA 2Z8XA 1ZICA 1DTEA 3G9ZA 1LPBB 2RGUA 4Y2JA 4CFSA 4E15A 1ODTC 2BJHA 1QTIA 2P8SA 4KE8A 3ZLUA 2WUEA 1UOQA 1XZDA 5JAHA 3LIPA 3EBLA 5EHXA 1TIBA 1WCYA 2O2IA 4LKOA 4IH9A 4XWGA 4JH0A 3EQ9A 3I2FA 5FXMA 3I6YA 1QJ4A 4JUIA 1XLUA 3PI6A 4FBLA 4BCDA 3BE8A 2IIVA 5FP0A 5AK6A 1E8NA 3WA6A 3SWWA 1W75A 4X00A 5KREA 4M0FA 4KE6A 3DOIA 3AFIA 3I28A 1ZD3A 1LPOA 3I6ZA 2WKWA 4HXEB 1GT6A 3QITA 2K2QB 3WKDA 4KAAA 3ZV7A 5AM5A 1CEXA 1CUVA 1ZJ5A 4QZVA 1L7RA 1YAJA 4HXGA 3G9UA 3C43A 3HEAA 4UHEA 5AO9A 1USWA 4M0EA 3UUEA 4KE7A 1WHSA 1EK2A 2NW6A 2XMGA 2AJCA 2QUBA 2VAXA 2YH2A 1AKNA 3IUJA 5CMLA 1YA8A 1ZGBA 2XMCA 3JW8A 3IULA 4GDMA 4UPDA 4X97A 4L9AA 1DWQA 3BF7A 5E2IA 3H1AA 4G4GA 2B9VA 5IH7A 3DEAA 5IVIA 4ZREA 1VLQA 1VKHA 3TEJA 3QMMA 1E8DA 1SCQA 5HKBA 3BWXA 1K6EA 5C8XA 3STWA 5ALNA 3GELA 1MTZA 2OCIA 4F5ZA 2RAUA 2GYVA 3QMWA 2C5FA 4J0CA 3ZLTA 3IBTA 4BZZA 3T4UA 5DNUA 2DHCA 3OM8A 5AI6A 4INZA 4H7DA 1N5MA 3I2IA 5ALRA 4MQMA 3H2IA 4U2CA 2OGTA 3IVMA 5JZBA 1EA5A 3C45A 4AO7A 3DKKA 2WU4A 5ALHA 5ALPA 4ZRDA 1YCDA 5C81A 5JZSA 1U8EA 4L72A 3WKBA 4C88A 3WWDA 1CUYA 3RM3A 1TK3A 1K4YA 1XZIA 2Y2VA 4X6XA 2Z8ZA 3D2CA 4ZV7A 4TGLA 1M33A 1CUHA 1YR2A 1THGA 5CW2A 3I2HA 1H2XA 4RNCA 4AB1A 1BEZA 2WU3A 1UXOA 5D3KA 1XZKA 1XRPA 3WLAA 2C0QA 2VJBA 3PUIA 2WSLA 3G8YA 2ZJFA 2ZYHA 5ALIA 5J3JA 4G1FA 1ETHA 3WWEA 5LZ4A 1HQDA 5ALDA 1CVLA 1IVYA 2VJCA 4LYEA 5JATA 3AUKA 4MYSA 2JF0A 5CT8A 4FOLA 2OCKA 1ZI9A 3NGMA 5AI8A 1Y7HA 4QDXA 4H7FA 4TPKA 2PPLA 2WHPB 2WM2A 5T4EA 1MX9A 2FJ0A 2QZPA 1J1IA 3C6XA 3C5WP 1DWOA 1U4NA 4G4IA 3L1HA 2QT9A 4DNFA 1R3DA 4GWLA 1QIKA 1EK1A 5K3CA 1VA4A 2JEYA 2QUAA 5DLPA 3AZOA 2PSJA 4Q3OA 3HC7A 4DMKA 3M81A 4GECA 1XRMA 4OU4A 2XUIA 1H23A 1KU6A 4EY7A 1CPYA 2ZYRA 5I8PA 1G4HA 3WZMA 1JJBA 5BV7A 3WK8A 5FKJA 3ESDA 1BN7A 1NU6A 2OPHA 3STUA 4DMCA 4N5IX 1SFRA 3C6BA 4WFKA 1J2EA 1YA4A 3VJMA 2BUAA 5AK5A 3CCCA 4JEIA 2QJWA 5DJ5A 3UMJA 1Y7IA 1WOMA 4G9EA 1TCCA 5JAOA 3ICVA 2RHTA 4HVTA 2BGNA 3DS8A 4DSAA 4BC0A 2HFJA 4D9JA 3L1IA 4K6HA 5FV4A 2WG0A 5KWJA 2WIDA 2G5PA 4EY5A 3H04A 3UUFA 4LXIA 3LP5A 4FLFA 2V96A 2YASA 3V1NA 3HLKA 4ZV9A 3G0BA 2FUKA 4QLAA 3FAKA 3OTQA 1XZFA 1VZ3A 2CUTA 3WKAA 7YASA 1C4XA 4L0CA 5AICA 3KSRA 2BUCA 4QLOA 2I3ZA 5KWIA 1IUOA 3SK0A 2CJPA 3PICA 4CCYB 3R0VA 4OB6A 2V98A 5D7BA 4HTAA 4B83A 1L7AA 1AC5A 4H18A 4X92A 2XB6A 4C87A 2HIHA 1GPNA 5HQ3A 5AHXA 4B9AA 2QXTA 4B7ZA 1CUCA 2HA5A 1P0PA 1T4MA 3H2GA 1LZKA 3VISA 4E11A 4EY8A 3CN9A 2HHAA 3VKFA 1DWPA 3O95A 3H17A 1H2YA 4FTWA 1UOOA 2GZSA 3DNMA 4QNNA 4BCCA 1QGED 1BCRA 4Q82A 4OYLA 3A2NA 3OC0A 2AJBA 1WHTA 4Q3LA 1QIIA 1E89A 4FWBA 1B6GA 3KWFA 1PV1A 5JARA 1ODSA 4EBBA 4B9EA 5ISMA 4UHHA 4BVKA 2AJDA 5LZ7A 3HXKA 1JFRA 3FLAA 1ZD5A 3C87A 4GXNA 4CI9A 1QFMA 1K8QA 1CUBA 2O2HA 4HAIA 1Y37A 1XZMA 1QIGA 2OAEA 1MX5A 2WFLB 4ROTA 4RE6A 4Y2XA 1YS1X 5A6VA 4OU5A 4NS4A 2XUHA 5C8VA 2I3DA 1XLWA 5LKRA 4K6KA 1W6RA 5EHQA 1EDBA 1ORWA 1SCIA 3LCRA 3SX4A 3DD5A 1XZJA 1FFDA 1S8OA 2OG1A 5AKKA 4WCVA 3DL4A 2HA7A 5AH0A 4ITVA 3G02A 6YASA 1LBSA 2HA2A 1CV2A 4BCBA 3FNBA 4TVKA 4HXFB 4J0JA 2BCEA 3ZPXA 5AM0A 5CRIA 2DQZA 3K6KA 4BTLA 4BB0A 3AINA 4PQEA 1Q0RA 4QWWA 4OCZA 1Q84A 2XDWA 4GLBA 3WK7A 4B82A 3CN7A 5JADA 5AK4A 5BWBA 1N8SA 2HU7A 3HSSA 4UBOA 5AOBA 3BXPA 2VTVA 2EEPA 1ZIXA 4NVRA 4Y7DA 2VA9A 4C89A 3H2KA 4P08A 4J0HA 4YASA 1EDDA 1MPXA 1ZIYA 2JGFA 1CUGA 1FFEA 4C4YA 4H7HA 2J4CA 3R3YA 4BAUA 2HU8A 4KE9A 3LS2A 4FMPA 4UBKA 1AQLA 1ZI6A 1XZAA 3WL7A 2WIGA 1XZHA 4MEBA 5AK3A 4DSZA 3HZOA 2V97A 1WM1A 4F0JA 3B5EA 4CG1A 1X2BA 1LGYA 3E0XA 4J0IA 5ESRA 4KYVA 2ZJ6A 1EB8A 2IITA 4G4JA 1MO2A 5LZ2A 1UOPA 3I6MA 4MJ3A 4BRZA 5T4BA 4U2EA 4KACA 4PNZA 4M0MA 4W63A 3V48A 4BP8A 1H22A 5ALTA 1C7JA 3C8DA 2ES4A 3A2MA 1DU4A 2WG1A 3VDXA 5AM4A 1UT6A 4LXHA 3NOXA 3FWHA 2XUPA 5AKIA 2XUGA 4B0PA 2HL6A 3LLCA 4KRXA 4QDUA 4UFNA 3LIIA 4AX4A 3E4DA 2XE4A 3TJMA 1GXSA 2WIJA 1XZEA 2QR5A 4JYPA 1TCBA 1ORVA 2OCGA 2GYUA 4CG3A 1OCEA 3E1GA 3HJUA 1CUSA 3Q0TA 4QE3A 2WHPA 3IA2A 3WKEA 4QDTA 3JYHA 2I78A 4P92A 1HL7A 3P2MA 1ACLA 3DL7A 4G8BA 4KRYA 1JU4A 2XUDA 2C4HA 1MN6A 3MUOA 2JGMA 5A71A 3WIBA 1LLFA 1WPXA 4W9RA 2QOEA 3HRHA 4WFJA 1CQWA 2WG2A 3FYUB 5AKHA 3OPMA 5ALVA 1LNSA 1Q0ZA 4FLMA 4EA6A 4BYMA 2JGKA 1DX6A 4MQLA 5AM3A 2Y2UA 5AM2A 1UZAA 2QTBA 1BS9A 1CRLA 1X2EA 4O08A 5DTJA 3PDCA 3HI4A 2QS9A 1LPSA 3PFBA 5HFNA 3O4HA 4B80A 2CEKA 3BDIA 4FKBA 3M82A 3WK4A 1F6WA 4X7BA 5ALWA 1D07A 5IVHA 3YASA 1AURA 2VATA 2D0DA 2GBIA 3D59A 1XQXA 4HZGA 3IURA 4UBLA 2BAGA 2H1IA 4I4CA 4PO3X 3AZPA 1KU0A 1MAAA 3E3AA 5E4JA 3OOSA 3D2BA 4G8CA 1W76A 5CT5A 3WK5A 4CCWA 3G9XA 1JJIA 1TKRA 1UK8A 2XI4A 4C6HA 5HF9A 4UHDA 1XQYA 1NX9A 5ALXA 4B81A 4UHFA 3WJ2A 3R3VA 1VXOA 4QA9A 1FFBA 4DTCA 5FLKA 3DCNA 1QLWA 2Q0XA 5JALA 4CCYA 4LXGA 2ZSIA 2W22A 3DYVA 1SOMA 3I2KA 2OGZA 1XQWA 3R3WA 2JIDA 3QPDA 1L7QA 2JGJA 5K3EA 2QKYA 3QBJA 1JU3A 2WFMA 5A2GA 2LIPA 2VT7A 2XUJA 3ED1A 3GFFA 1QFSA 2XQFA 1YASA 3VJLA 2W6CX 3O4IA 3K2IA 2QMQA 5CXXA 1LZLA 1TCAA 3STXA 3C5VA 3F96A 4A23A 3ANTA 5ALGA 1CIJA 4BE4A 4YX9A 1XZGA 1CUZA 4OD0A 5DYYA 3TGLA 4WY5A 1CUUA 1HKHA 1H2ZA 3AJAA 4BDTA 4YK7A 5HK9A 1CUDA 1UK9A 4J7AA 4BC1A 2X5XA 3RK4A 4K6GA 5CTAA 3F97A 4FNMA 1GPLA 4BAGA 3QYJA 3WYDA 3M83A 1ZOIA 4KJXA 3F98A 4N5HX 1JT2A 2WFZA 4PSCA 1VXRA 4G9GA 2PUHA 3D2AA 1JMYA 4FFWA 4QWMA 5DYTA 2WFLA 4KEAA 5HFAA 1IZ7A 4X94A 3K9BA 2XMQA 4RPCA 4XVCA 4B6GA 3WZLA 5AKLA 4UUQA 2WHQA 3GROA 4FDMA 2HA3A 4KAJA 5ALLA 2ORYA 1XRRA 5EHNA 3EQ8A 1UKBA 3STVA 1K63A 1BN6A 4MXDA 2B61A 5I9IA 2BFNA 2XMSA 1VJ5A 4BDSA 5EIEA 3H2JA 2FX5A 4I3FA 5I7UA 4GHWA 2UZ0A 3BJMA 1UFOA 1EHYA 1VA5A 3Q8WA 2PUJA 1GGVA 3W04A 2VT6A 3WWPA 3I1IA 5K3FB 3TRDA 4B84A 5AOCA 4EY6A 2H9YA 1EVEA 3GUUA 3KWJA 5E4YA 1X70A 3QMVA 3DKRA 2HA4A 3KOOA 4K5QA 5CXUA 2R11A 2VF2A 2HU5A 3DYIA 3G0IA 2VJDA 4AMZA 2XLCA 5ALQA 2D5LA 1EVQA 4QDOA 4N8EA 5JD5A 3FCYA 2JGLA 2C7BA 2Z5GA 1HBJA 4H0CA 1YS2X 1PFQA 1CUEA 3CXUA 5DNVA 4XJVA 4B0OA 1GPKA 1AZWA 3R3XA 1QOZA 5HZGA 2ONCA 1ODCA 3BIWA 1XROA 1UKCA 4DIUA 4J3JA 2E3JA 3I2JA 1JKMA 4Q34A 4BBZA 1C7IA 1F0NA 1JMKC 5AJHA 4CG2A 4ZXFA 5DNWA 3KXPA 3VVLA 4ARBA 3MGAA 1QONA 1DQZA 1EI9A 5AKZA 2I03A 2O7RA 3G7NA 3VVMA 4AMYA 2G63A 2ZJ7A 2YXPX 4IH1A 4IH4A 4IQ4A 4Y2SA 2H7YA 2WLSA 3WJ1A 3V1MA 2B20A 2J3QA 1GQRA 5AKYA 3R3UA 3W06A 5JASA 2JGEA 3PF9A 1U2EA 3D4LA 2XQKA 3ZWQA 2O2GA 1CUWA 4GEGA 3PUHA 1AMNA 1TAHA 3BF8A 2WJ6A 4H7JA 1IMJA 5JD6A 4E46A 2B4KA 1NU8A 5K3AA 3X3HA 5ALMA 4NZZA 4BVLA 2OXEA 5CH3A 2EDAA 1BRTA 5T4FA 2WUGA 4AO8A 5CBKA 3N2ZB 4Y2VA 5LP1A 3V9AA 5A7FA 2DHEA 3WL5A 4EUSA 4LYDA 3DOHA 2RONA 3DDUA 4ZWNA 2Y6VA 5LYYA 5LLSA 1FJ2A 3FYUA 2OGSA 4PSUA 4RGYA 3H19A 3B12A 5EIHA 4X90A 4X95A 1UK6A 2DSNA 5H3HA 1PJAA 2C5GA 3WK9A 5JYCA 5LKAA 1ZJ4A 4X91A 4IHAA 1AUOA 2G4LA 4Y2TA 3C6ZA 4GBGA 5IVKA 3DLTA 4G5XA 1YAHA 1UK7A 3R3ZA 3I2GA 3FLBA 4AN1A 2HA6A 5ALEA 1BU8A 3C8HA 1R9NA 2WIKA 1XFDA 2QJRA 2PBLA 1QZ3A 4WFIA 4FLEA 1MT3A 2ROQA 4N8SA 4OPMA 3IDAA 2WJ3A 4WY8A 1IUNA 1N5RA 4UFOA 1E3QA 1G5FA 1F0PA 1HPLA 5HK8A 5CH8A 1P0MA 2XUKA 5D3ZA 1WPRA 1CUIA 2BKLA 3G0DA 2J3DA 4DMFA 1VZ2A 5AKGA 5ALUA 3AIOA 1XZCA 4MWSA 1CLEA 2DR0A 4J0DA 3GZJA 1SC9A 1GQSA 3T52A 3U0VA 4BZWA 5HF5A 1R88A 1H2WA 4JNCA 4LHEA 5A7GA 5JD4A 4KR0A 5DTIA 4DGQA 1XKTA 5A7HA 3ICWA 1MJ5A 3EF3A 4UBJA 3D3NA 3D5EA 4C4ZA 5C8ZA 2PSFA 4UFPA 4ARAA 4X6UA 1JJFA 2ZSHA 4W1RA 3H0CA 2JGIA 5JAPA 1ISPA 5ALKA 4B85A 4XIIA 4A5SA 1BE0A 5CT4A 2CMFA 1P0IA 3O9VA 3IIIA 1QIDA 3AZQA 4Y2QA 2VQ6A 1XRQA 4P93A 1MNQA 1UWCA 5K5EA 1KEZA 4EZIA 1EDEA 1OILA 3ESBA 2CKMA 3D7RA 1QIJA 3BIXA 4P9NA 4PW0A 3S8YA 5SYMA 5ALZA 5AKJA 2WIFA 3GBSA 1YB6A 2PSHA 2RIPA 2PU7A 2AJLI 1XLVA 1QO7A 1CUFA 3WQHA 1WB6A 3O4GA 5AI9A 4DM7A 4EY4A 5JAUA 1HLGA 4FFVA 3FYTA 2O7VA 2WTNA 3EIOA 5ALSA 4OUKX 2GBCA 4HRYA 4W1PA 2PM8A 5FPPA 3KDAA 2AJ8A 3V1KA 5YASA 2WILA 3QM1A 5FPQA 3GA7A 1EB9A 4V2IA 5IVDA 1XZBA 5A62A 3A70A 5AOAA 2RI6A 5AI4A 1CUXA 5D6OA 1A8SA 4PF1A 4QDZA 4Y2RA 5JANA 4X85A 3FCXA 5HKAA 4ETWA 2WUDA 3DQZA 1DINA 4WDQA 2WTMA 3IB3A 4UHCA 3WYNA 5K3FA 2VEOA 2HA0A 3WWCA 2XMRA 4Y9SA 2PSDA 3RARA 1MNAA 1HDEA 1LPNA 3ILSA 3F67A 4EB0A 4CIBA 2YYSA 2GZRA 5FUMA 2PL5A 4F60A 1F8UA 5FOQA 3F9CA 3WIOA 4HS9A 2WHRA 1IUPA 4X93A 1RWQA 4GI1A 2DQYA 4FBMA 2QRUA 5AKXA 1TQHA 1E66A 2XQGA 4DNOA 1LPAB 4X71A 1WB5A 1QE3A 1OXMA 2OQVA 3QVMA 1J06A 2VSQA 1VE7A 4BP9A 3BL8A 5CH5A 5AIBA 1W52X 2JBWA 2XUOA 1XRLA 5LZ5A 2Y1KA 4OB8A 3FSGD 1O6FA 3HABA 4CIAA 1DT3A 3ZI7A 2OLEA 4PSDA 1VE6A 3IUMA 4W1QA 3H2HA 3QPCA 3VJKA 2R8BA 1XRNA 2HFKA 1UKAA 3HACA 2C0PA 4G8DA 3W9BA 4F21A 4OYYA 2V9ZA 3H18A 1R50A 4J0GA 1R4ZA 3M3DA 1I6WA 3U1TA 5DWDA 1VOTA 4DYHA 5HF6A 3DJYA 3BDVA 2XUQA 2OCLA 1E8MA 4X3CA 3OURA 1FFCA 2QVBA 3B3QA 4H77A 5ALOA 4U2FA 3WA7A 4AO6A 4JYMA 2XMZA 2ZVDA 4Y2YA 2HDWA 4BRSA 2Z3ZA 5AM1A 4FNGA 3O0DA 2G5TA 3FBWA 1N1MA 5CT9A 4DLNA 5JZ9A 5LZ9A 1B41A 1DX4A 2JEZA 1GZ7A 1QO9A 3WK6A 3G0CA 1SCKA 5FRDA 5K3DA 5FDFA 1FFAA 3D0KA 1Q83A 1TRHA 2X8BA 4MEAA 1R1DA 4H7IA 3H1BA 3FOBA 5LZ8A 4BE9A 1J07A 5CURA 4IO0A 5EI5A 5KBYA 5T4HA 3IUNA 3WKCA 4C4XA 5ALFA 1W4LA 5ALJA 2RHWA 5DYWA 2ACEA 1AX9A 4BVJA 5CT6A 4I19A 4J03A 1DQYA 4ZI5A 2OAGA 4E14A 3PF8A 2VJAA 5HF8A 1Z68A 1JI3A 4WDRA 1MU0A 2XQJA 3EQ7A 5JIBA 2X76A 2Y6UA 5BWCA 4L3WA 1THTA 1K5PA 3ESCA 1QIMA 2H7XA 3R40A 1A7UA 3KD2A 4W1SA 2ACKA 3C6YA 3RLIA 5K3BA 1ACJA 4LIPD 4FHZA 1QIEA 4X6YA 1BROA 3FSGA 2DCMA 4OB7A 2HRQA 3ANSA 1G42A 1T2NA 4QEKA 4Y2PA 3AIKA 3ZLVA 4WJLA 1R9MA 5SYNA 3WMRA 1CR6A 1RYYA 1EH5A 3VXKA 4PV7A 2PKYX 1IZ8A 3RKSA 1O6GA 2QM0A 2ZYIA 1XKLA 4S0XA 4MWTA 3N0TA 4DNQA 2PVSA 1A8QA 1FSSA 2J4FA 4BATA 4Q3KA 1CFJA 4Q05A 4A16A 4XX1A 2PSEA 4UBNA 5F4ZA 1CQZA 5AI0A 3ESAA 3QZUA 1YSCA 3IUQA 4HRXA 5AP9A 4AZ3A 3L1JA 2XUAA 3WWOA 4BAZA 1ZGCA 1LBTA 1EX9A 2HRRA 4Y2UA 3STTA 3C70A 1DT5A 2BGRA 2DHDA 2PU5A 2CZQA 1EINA 4H7EA 3WL6A 3MVEA 1XZLA 3WI7A 3MUNA 1ZI8A 2XMDA 4AQDA 4DNPA 2Z3WA 4AN0A 3R41A 1WB4A 3STYA 4U2DA 3S2ZA 4H35A 2ZYSA 4UHBA 3CCBA 4YPVA 5LIPA 3AIMA 3QPAA 2XUFA 3W2TA 2BUBA 3HYSA 3WL8A 2CB9A 1RP1A 1MAHA 1YB7A 4GW3A 4U2BA 4KAFA 3A6ZA 2HM7A 1QIFA 4U2GA 3O9MA 2XQIA 4J0KA 1GKLA
chains in the Genus database with same CATH superfamily
4QBGB 2Q4RA 2E4AA 1TJ4A 2G4VA 4Z49A 3QFTA 4OX9Y 1T10A 4JNKA 4C43A 3R7WB 3Q6IA 3F74A 3H84A 3W1EA 4QXRA 3BJZA 1QGAA 3IT3A 4C3UA 4NCAA 4PYIA 1UC5B 5ETJA 3FVRA 3LXXA 3L4JA 3AHIA 3JWEA 2P0YA 1TF2A 4RCYA 3UAGA 3G9TA 4UU0A 2G76A 3I1JA 1P1HA 5BOVA 1BW9A 3ORRA 3V2IA 5GOZA 3Q7QA 1X9IA 3EGIA 1E3EA 1IWBB 1NUAA 3C3AA 1K0UA 3GYBA 3DFFA 5B64A 1U2GA 2GJSA 1P18A 2PA0A 1QTRA 4PAMA 2C7GA 1LPMA 3WL3A 3ZCQA 3KTAB 3EEOA 4TKUB 2EJUA 3PA6A 3HYLA 4FDUA 4R2KA 3H4MA 4AY4A 5ITZB 1ILEA 2B78A 2G1JA 1FS5A 2CMHA 2OBNA 1XV5A 2OV3A 4Y3UA 1L8OA 4EB6A 2OBFA 2XMBA 5HOQA 1VGRA 4MYDA 2HSJA 5EFZA 4J1SA 1T0HB 2XVXA 1TA9A 3KYJB 4UCXA 5E1DA 2PNJA 1MPTA 1P5FA 1U2ZA 1MQ9A 1L5GB 2BFEB 3DDHA 3W9UA 3ZDEA 1RYNA 2DT5A 2R5NA 3NDRA 3IGFA 3FZNA 4LBYA 4JLMA 1WDWB 3DLBA 4KR6A 1WCWA 3OIYA 2ZIXA 2QLTA 4C01A 5JHHB 1K3UB 1CTQA 2BFPA 4Z9AA 4ZP1A 2OT3B 1RBQA 2C3MA 2WQZA 2B0JA 4Z7NB 2D5IA 2NZXA 1OVGA 5CU7A 2PUDA 1A2KC 3UOGA 2WJAA 4IJWA 3RU2A 4L2IB 1GAQA 4FOSA 4BKMA 5CFPA 3M9LA 3IEUA 4AS2A 4H3SA 2R6DA 1Z7BA 1RYMA 3AEQA 2Q5CA 3FIUA 4HUTA 1U6IA 2Q2NA 2W2XA 3AEKB 2GYWA 3MS2A 2FSUA 3TMAA 1FSFA 2JFOA 2W8BA 3KAQA 4I8XA 4BTVA 3H7IA 5BY2A 1UBKS 3QEMB 1QR6A 1ZIDA 5AIAA 1E5TA 2AB0A 2PK3A 3O90A 2X0IA 2DWUA 2YVQA 3OJEA 1TF5A 3OHPA 2ZBFA 1HYBA 4TUYA 3VDQA 3CLUD 4BTEA 2R68A 4ZCRA 2FP3A 1UFVA 3CLTD 5EJ6A 1U28A 1LRJA 4XSVA 4CL8A 2F1OA 1TA0A 2ZIEA 5IDXA 1D4ZA 2C2BA 3C3PA 4NCNA 1DKUA 3EPLA 3K16A 5ULLA 3R9WA 4BMSA 1BEEA 2W2KB 1AHHA 2O6LA 2ZJZA 1OFUA 5J2UA 1I3MA 1A88A 3B1KA 4MW6A 2JLWA 4GRIA 4TYWA 2ZUUA 3F7OA 3P9XA 3V1LA 1IHDA 3NUZA 2HNBA 2ANCA 3IJ5A 2G5GX 2Q3DA 4CWAA 2OMKA 2D6FA 5EPUA 3ZZ1A 3GEIA 1OJLA 2CBGA 2J9RA 2XT0A 2ZIFA 4XZ3A 3RROA 3SJZA 5MHTA 1EXDA 1H3NA 4IKOA 3TM4A 5HNKA 3FGPA 5EN4A 3VBCA 1C9JA 1D4AA 3X1ZA 5CB8A 5FWNA 2EDCA 4DG9A 4ZAYA 4QODA 4AKEA 3N8IA 5C1IA 4KVFA 3UM9A 3H6KA 4TOIA 4I9UA 1WHTB 3GJZA 4MYCA 3VNUA 2V7QA 4H7KA 4JDPA 4BJ1A 4QUEA 1XWFA 1Y48E 1LPBB 2OM6A 3AUFA 2RGUA 4DR7B 2JFPA 5H8WA 2FMTA 4L5YA 1RRVA 1YJ8A 2GCGA 4ZYLA 3EX7C 4EVRA 2HOQA 5AHOA 4D6PA 2ZTUA 3QSYA 3CNHA 1MEOA 1OIWA 3DFZA 4GM0A 3FFXA 1A27A 1Q0SA 5J59A 3ZY2A 1SA0B 4EQZA 2JIQA 4QD3A 1UH5A 3MRXA 2QTVB 2DHRA 2Y92A 4GZMA 1PYOA 2OL4A 1NJ2A 4CHTA 2NU6B 1O87A 3D43A 4JH0A 4R84A 3SQNA 2J0QA 2C88A 1Q11A 2C5LA 4M76B 1YDGA 4AC9A 3UWMA 1BHO1 1DBVO 1IK4A 1QJ4A 2CJXA 3WIDA 3ZHUA 1O5IA 1OTYA 1EX6A 1IWOA 3QPVA 2I67A 4BCDA 3ABQB 1D4OA 4DNXA 1RZRD 1T24A 2DUMA 3WLPA 3MCTA 4DREA 3KOZA 2LCFA 3HEBA 4BN0A 1Z4LA 4KR2A 2O8DB 4YB8A 5E9JA 1ECFA 1PE0A 3NHMA 3UJDA 5IHPA 3OCWA 4HQKA 1SIOA 1YIOA 4A2PA 5LOVA 2WY2D 5KREA 4XJXA 3L7YA 3PUJA 4IXWA 3K6SA 1W5FA 1MC1A 1ADJA 3CRVA 3G2OA 5TPZA 3AFIA 1ZJJA 1GSAA 1N5LA 3I28A 2DFVA 4NR0A 4AXXA 4QREA 4ZGWA 1KY3A 2WKWA 1BIFA 4RK4A 1GT6A 1DVRA 1OX4A 3X1JA 2ZYGA 1ULHA 3L82B 1Z6ZA 3PNVA 4TL8A 3OD1A 1PUXA 1DCMA 2FWAA 1KJQA 3LOPA 4D0NA 4BIIA 3MJVA 2Q8PA 3FROA 3HKCA 3MAJA 5A1TA 3EZ2A 1CUVA 1VHTA 3DBHA 2Y0EA 1Y1PA 4BO1A 2ZZMA 1ZJ5A 3DOCA 4ITRC 4W5TA 4RF3A 1WETA 4W5NA 4IJUA 1L7RA 3CHYA 1GUAA 3EIUA 1L4EA 4HXGA 2J7KA 5H83A 3CNEA 3S2IA 1AQIA 2FZKA 2VSYA 4B17A 2IHJA 4GE3A 4QBTA 2XNSA 1AN9A 4KE7A 3NM5A 3K1AB 4FCWA 3TL3A 4D3DA 4BKUA 1JVBA 2XMGA 5CNIA 3RFVA 4FD2A 3ST7A 3K5IA 4LF6B 3E35A 2AJCA 1QHYA 1AA9A 2QPAA 1ULTA 3CRW1 4JU9A 4AZWA 3PJRA 1HT2E 2VYVA 1AKNA 5MGNA 1DBQA 1VJ1A 1P2SA 1MG5A 2EF1A 1M7HA 1HETA 1H05A 3B9BA 3HYNA 4MTLA 1P17A 2OFPA 4RHFA 2D59A 3DE1X 4GF5A 4W9NA 5T6BA 1P7VA 2C96A 4GKBA 1ZM7A 1Q1NA 4YMIA 4BEVA 1MOQA 5A0VA 4ECEA 2E4ZA 1XJ0A 3GLVA 3ZTYA 1JWLA 2FEAA 3JW8A 2PUAA 2D8AA 3IULA 3K1YA 4GDMA 3FPAA 4PQRA 3U17A 4PYJA 5K0CA 4L9AA 4B09A 2IUTA 1DWQA 1LWOA 1KEVA 1QH8A 3BF7A 4MMXB 3WGNA 4D5EA 2JH9A 2R87A 1NI3A 4BQQA 2PGLA 2M6SA 2Z9CA 1G3IA 1HQYE 1O6BA 3K1ZA 4FZ3A 3UAYA 4PVDA 4IJVA 5CPBA 3DEAA 3WBBA 5IVIA 3KL2A 1OWPA 2LZ0A 4ZREA 4QVGA 3RUIA 2CF6A 2WF8A 3LNTA 1I0IA 1UWVA 2QX4A 2Z30A 5F2KA 3LJKA 5DLEA 1RNLA 3CLRC 4KPUB 1UC8A 1UKZA 2J0SA 3M5CA 4ZZ3A 4O2BF 2C2OA 4DC9A 1KXJA 3JWIA 4DKXA 1SELA 1QQ7A 4ZT7A 1PT7A 5C8XA 1V11B 1YI0A 2EL7A 3U60B 3ICEA 3M34A 4N1AA 4AJLA 4BZXA 4EB8A 1YVRA 4CTJA 2FH5B 3OU7A 3TECE 4PTZA 2NZWA 1LDYA 2R62A 3KVRA 2OCIA 3C6KA 3EF0A 5FBQB 4KIGA 1XEFA 3FRIA 3RHFA 3EZ7A 1E58A 3OM9A 4F5ZA 1SBZA 5ABPA 2OXFA 3BL6A 1Y4UA 1VHQA 2HPVA 3MGCA 4TWZA 4XQCA 4URVR 3KQKA 4DA9A 1VI5A 1SUEA 1ZP6A 1SB8A 3GRAA 3I6IA 1A9TA 3L8MA 4LGMA 3B9PA 4MMZB 2XTMA 4IVNA 5DNUA 1O95C 4WXHA 2ILVA 1EDOA 3OM8A 3ZLBA 3NIFB 4JKYA 3H9CA 1OWOA 3SZMA 1E63A 1V8PA 2Q6IA 3NKLA 5LVAA 1BKSB 5EGSA 4H7DA 4AX8A 3HVIA 5ALRA 3N7AA 5LB2A 4ZAVA 2VF8A 4Z8XA 2PJZA 2PUWA 3RYHA 1H66A 1Z2OX 4R1UA 4DQDA 3AEUA 4QM7A 1LU9A 2SCUA 3IVMA 4QQ8A 4D56A 1LA2A 1Z4MA 1M0WA 3FDZB 2H4FA 4FGLA 3RS4A 4D4JA 5U9CA 2PXCA 2WZDA 4LDZA 4NBTA 4RFSB 4ZEMA 3QY0A 2VK4A 2VHQA 5FBRB 3S4YA 2A4KA 1Q20A 3B48A 1XA0A 2YRXA 2ZOSA 3DKKA 2G06A 3OE5A 4IFBA 4LOJA 3VUFA 3SEFA 1PZNA 1QZUA 3FI0A 1JDJA 4HEA1 5DULA 2GAIA 4GP9A 3VPAA 4CR7A 4OKNA 4RD1A 1JTVA 2PT6A 3F78A 4FQ8A 5FJJA 5PNTA 3Q88A 4CIVA 5C1DA 1A2QA 5FWXB 1GARA 2FPIA 2H4WA 3FKSA 3AG6A 5C81A 5IZCA 5JZSA 3C39A 2QUIA 3K0KA 1II0A 2IYQA 2VYFA 4CMGA 3D6NB 1OA0A 1T8PA 1CUYA 3CZ4A 5KYYB 2VHWA 4C4AA 5LQCA 2W42A 3RM3A 1K4YA 1VE1A 4M21A 4RZ2A 4X6XA 1KZGB 3TCXB 1IQRA 2A1TR 3D2CA 4ZV7A 3S29A 3CISA 3U7QA 3G2QA 3O94A 4QEDA 4DQUA 1H9CA 3VNRA 5BQXA 5EWLA 2A5LA 2BFFA 4OV6B 4ZN6A 4D9HA 3SKYA 1ZK4A 2PKEA 2WU3A 2Y4OA 1V9SA 2Y76A 2ZT5A 3ASZA 4TZTA 4ZC1A 1TM5E 3QFFA 3KUUA 1OLSA 3SCZA 1V47A 1X9GA 4QRHA 5JNWA 2VSFA 3VPHA 3R9IA 2Q9CA 2YS6A 3U7IA 1ZDMA 2XDQA 3CNOA 3AM5A 3LUPA 2YX1A 5EKDA 4YREA 1KOLA 3AKEA 5C1OA 2DBYA 6LDHA 4PONA 1BXRB 2KWIA 2XCQA 4PRKA 3WWEA 4BBJA 1WXXA 1L0BA 1Y1TA 1EFAA 3PWZA 1GXSB 3DVRX 1HEYA 5F3DA 1IVYA 4GWKA 1MH1A 3R0QA 2VJCA 2CXTA 3CURA 4LYEA 5JATA 2EGGA 2H59A 5FTMA 4MYSA 1M1ZA 5IBCA 3U5TA 1X42A 2OLJA 4MH0R 2OCKA 1ZI9A 3HN6A 4HAZA 5CA1F 2I3BA 3SOPA 3VKWA 4CEJA 3CV3A 2REXB 4L0QA 3ND5A 4JT9A 4D26A 2PPLA 3OUTA 4Y6RA 3D3KA 3EVZA 5T4EA 1DELA 1LC3A 1HZZA 2ZJ0A 4XYLA 2V3CC 1FNCA 1KORA 5L6LB 3Q6NA 1WR8A 4ZVTA 4EI7A 1T0JB 3X2FA 3OZUA 1ONBA 4KK4A 2VR1A 3NDBB 3L1HA 1T6NA 3DNFA 1OAAA 4BNVA 1R3DA 1DIGA 3HHPA 4KXWA 2MCFA 1QIKA 2NSJA 3I62A 5LA6F 4NMLA 2OO7A 3DWFA 1A4XA 4GU5A 3UY4A 1TJYA 3T7EA 1DIBA 1VA4A 4M1ZA 4JR0A 4M9SA 2VJMA 2V1UA 4FE4A 2VL7A 4TTAA 3K92A 1TZKA 4NK5A 5D3MB 1DEOA 4OQLA 2PSJA 4DQ0A 3WLFA 2CN1A 4UVEA 3U61B 5I8WA 2QTHA 4PICA 2J0UB 3M81A 2BGTA 3N3BC 3QRWA 2G9UA 1C4KA 3HYRA 1P1IA 2F3SA 3UATA 4C0QC 5L6MB 1WB9A 5EAIA 5JQGA 1S6YA 2VC2B 4HWKA 3S81A 1H23A 1Y9AA 1X7GA 5I8PA 3AG5A 3AY7A 2JGDA 1U5CA 1H85A 4BBPA 1QYVA 4UULA 2Q4OA 3ADDA 2ZBRA 1FMJA 3V4LA 3ESDA 2ONJA 1BN7A 4A92A 1MOPA 5K0JA 4LZAA 4Q1AA 1WBBA 3ZWAA 1F6DA 4WXMA 3W79A 2BEUA 2P11A 2Z0MA 1J2EA 2ZB4A 4MUGA 2XRZA 3RVDA 1J7JA 3TX2A 1QPGA 1L4GA 3KM0A 3UFXA 4MUNA 5AK5A 3ZE6A 5LUBA 4JEIA 2QJWA 4FYYA 4HS4A 2C4UA 1XMSA 2G3YA 3WGJA 2BTQB 1CQJA 3UMJA 1XE3A 3M6WA 2SKDA 2C29D 5PGMA 2ZE6A 4EAQA 3KOWA 5HKKA 2GZAA 1VMDA 1N2OA 2QVLA 1O94A 4DWOA 1QCZA 3D6HA 1HC7A 1O9HA 1YR3A 1TB4A 1QO0A 3BXGA 4HDCA 2PUVA 1O8CA 4Q7KA 2V5UA 3A3YA 3D8SA 1JXAA 3ICVA 4YGXB 2D4AA 1N25A 3L4EA 3LKDA 4HFRA 5D6NA 4YP1A 3NCHA 2BGNA 2Q1YA 5CAEA 3LCCA 4GMXA 3L0ZA 4UDYX 3UHFA 3ILXA 2JJ2D 1O8BA 4Y9DA 4NEHB 4H3VA 2DWOA 4A0SA 4BC0A 4OQYA 4KQIA 1U7DA 2VPTA 2R96A 4D9CA 5C9ZA 4D9JA 5JISA 3L1IA 1U8ZA 1WMDA 3VVBA 3DZFA 1ISGA 2NU8A 2A5GA 1GTMA 5BW4A 4H4EA 2AI3A 3PQCA 3WDMA 2WIDA 3DV0B 1SCNE 4MV8A 1RACA 4MQUA 4PZYA 1N2CA 3VYTB 3FOZA 3H04A 4LS3A 2FDRA 4W7HA 5CCBA 2IEIA 1ZNXA 3BFPA 3TBHA 2YASA 2H2AA 5IN4A 3LX6A 4DT1B 2LNDA 4TQGA 3M0EA 2RB4A 1QRDA 4ZV9A 1SWWA 1RAEA 2FUKA 4P2GA 1BMQA 2JHFA 3NZEA 2YN2A 5HQJA 3ROPA 1Z35A 2B4YA 2FK8A 3ECAA 2UXCB 1U8FO 3AEUB 1BXKA 4XTCS 5H5JA 3GT4A 4BE7B 2WWXA 3ZGYA 3C7DB 1RWXA 5LC1A 5DHUA 3EPHA 1N2CE 3R20A 1NN0A 1BFUA 2ZIVB 7YASA 3SGLA 3ADPA 3ZE2B 1IPHA 1O3YA 1FTNA 3KSRA 1N34B 2PFGA 1FQJA 1T1JA 5A5VA 1KI1A 4FYXA 2CJPA 3PICA 4R71A 4RL4A 3VDMA 3WGUA 4R16A 3OPNA 4OB6A 1LCIA 3PQ4A 4N39A 2QNIA 2ZCJA 3W5UA 1CEQA 4UW9A 4LRUA 2GJ9A 5L7TA 4X62B 3ET5A 4C14A 3AVTA 4B3DA 1VDZA 3QXGA 2R6R1 4K6OA 1AC5A 1CY1A 4H18A 3O03A 4PX3A 1H65A 3ZJ4A 3FTEA 3DFUA 1X7YA 1Z18A 1M8GA 2OA0A 2AOTA 5AHXA 4B9AA 1VBNA 5EWMB 4R8KA 3UJPA 2GFIA 3PDHA 2BFDB 2BCJQ 2C2XA 2JKZA 2QXTA 1QP4A 5DHSA 1SRQA 2H2GA 1O5TA 3AF3A 5KJ6A 2EKPA 2G71A 4WLEA 5G2OA 4A03A 3KB1A 3NAGA 4IL5A 3M7IA 4IIGA 4KUHA 5BSKA 1E4VA 2IYPA 3V00A 3VISA 3O47A 1EFKA 1PJ2A 2GRUA 4A10A 2QMOA 3LU1A 1AV7A 1I7NA 4C1NA 4WINA 3IT0A 4MB2A 3OT5A 1JDTA 1XC7A 2RKBA 4G24A 2IYUA 1KSHA 3VKFA 2VHJA 2Y71A 1A5TA 3H17A 2O8EA 1QGZA 3WISA 2DWPA 3DNMA 4QNNA 5DGCA 4BCCA 2MJLA 3U7EB 1R0YA 4E31A 5A4FS 4AQ7A 3TLKA 2ERYA 1C29B 3ECCA 2ORED 1UPXA 3C1TA 3E7PA 1N6OA 5BN5A 3B85A 1JKJB 2SKCA 4K26A 2XJ4A 2WI8A 4DLZA 1GDTA 5TARA 4PLYA 1E4YA 1YQUA 3ZXXA 2AJBA 3DBRA 4RTMA 2G1PA 3N2LA 5A04A 3SSNA 4R3WA 3RVRA 1E89A 1MZVA 2FSPA 2WTXA 1P4JA 2WICA 3QEAZ 3P0IA 3IR6A 1B6GA 1H3FA 2P1ZA 2VUUA 2W2MA 3KWFA 4NBLA 3QKUA 4MHOA 1EJ2A 1K7CA 3EYWA 3REQA 5BW8A 5K6RA 1QTQA 1RE1A 4DA4A 4QRIA 2ZUFA 1VL6A 3ITKA 4YS6A 4LMBA 5T3YA 3SHOA 4BVKA 3D8BA 1YRQA 3WHKA 1P45A 3A4VA 3AUYA 3MD9A 1ZD5A 2D2FA 1B16A 2VJMB 2BGKA 4ETMA 4UNQA 2WVJA 4BFUA 1HNZB 1DAOA 4IWXA 3PFHA 4CI9A 3IUSA 1KZ9A 5B2FA 2FSVA 3WB0A 2EP8A 4DIKA 1T43A 3TNJA 4ER0A 2XH8A 4MIEA 3IAM1 3OWOA 2O2HA 4F6CA 2PMBA 4QBIA 4ZCIA 3WNBA 3PWSA 2FFBA 3QUBA 1XZMA 1QIGA 1J0DA 1WPGA 2EJVA 1KO8A 2ZBQA 3K05A 4OK6A 1E18A 2FF7A 3N28A 5E4FA 4X7PA 1VJCA 1XMXA 4ROTA 4WZBA 1IM5A 3ROZA 3KLOA 3KRTA 3ZN2A 3DZ8A 2IKSA 2ORWA 2ZTSA 2P9HA 3QE2A 4L8WB 5JNVA 1YULA 1K3FA 3B2EA 3AHJA 4B4OA 5KS2A 4AP9A 4KK3A 4WRRA 2D1QA 4D3XA 1YZUA 2XUHA 3N0RA 3AO0B 4MV7A 5KDOA 4Z3DA 3AP3A 3L8CA 4OXKA 1OC4A 1I4DD 1SUPA 3NOOA 5FPTA 5J63A 2NUTA 1NX6A 1R4MB 1XLWA 1ZHFA 2CXSA 3IMEA 3N2EA 3NONA 5K8LA 4INPA 5LKRA 2C00A 1YB5A 4HI0E 4AK9A 1W6RA 4B3CA 2W2QA 4OJKA 4RH1A 4QPNA 4WZBE 4JJZA 5G40A 3KZOA 2E9SA 2ORVA 1EDZA 4Z7QB 1S8AA 2ZI6A 1QQBA 1J2RA 3SX4A 4G1EB 1YDHA 4D0RA 1WULS 2EFDB 3DD5A 4DBLC 1Y4DE 4J9VA 5KPJA 2N1BA 4KPGA 4CTNA 4PZZA 4HNAB 4RZSA 4UMFA 3T7JA 3BRSA 4U7FA 1IN7A 2OG1A 4O2AA 4TQ9A 5GPBA 5AKKA 2G1UA 2NO1A 3AHFA 3TRKA 2VZ8A 3LRPA 3R3HA 1JYSA 5DXFA 5ERXA 3CA8A 2ZB7A 1RXSA 3PX2A 3URKA 3R7AA 1TYCA 2VCYA 1LBSA 2QW1A 1CV2A 3PFFA 1DKRA 3FNBA 4I5IA 2ZUSA 4WLUA 2IWHA 2FFHA 2VDUE 4NEGA 4ZT5A 5JSZA 4M6WB 3ZPXA 4JVSB 3SS9X 2P30A 1KC1A 3PLNA 4TWAA 2VDMB 1FC0A 1KEEB 2DQZA 4BMYA 3K6KA 5HDQA 4BTLA 5A0TA 1ZQ9A 4BB0A 1KVSA 5HBRA 2QN8A 1N4AA 1JDPA 1ZCBA 4BNLA 2ADOA 2WNSA 3C3CA 2J7PD 3E3LA 4FILA 3HY4A 3SLGA 4E12A 4R1LA 3DG9A 1H1LB 5IKOA 1F3OA 2QM8A 4JI3B 1H4QA 2RGRA 3K32A 1R27A 1H6AA 2WZCA 1IHOA 1SU4A 4K3UA 4LV6A 4KSBA 1NHGA 2ZT6A 2Q6KA 1D1QA 1KYTA 3BS4A 4QPCA 1KQPA 5DHTA 2QMUA 4YUYA 3PRKE 1GNPA 1FNDA 3D7NA 2HU7A 3NHBA 4XR9A 3NTRA 5KHOC 5L9AA 5J4YA 1KO5A 5AOBA 4TKVA 3U4CA 1G6Q1 3UICA 3W3AD 2QLLA 4TMYA 1BRMA 3R0XA 4LJ6A 4MB0A 5FBWB 2VTVA 1YTUA 2EEPA 4QYSA 4M60A 1ZUD1 1RLOA 4HT3B 3HRIA 1IY0A 2SICE 3N0VA 4RHXA 2XXAA 5ITWA 1IBKB 3G79A 4F5WA 1M0TA 3UMGA 2FUEA 1PJRA 2CLMB 2LWIA 2PHZA 4J0HA 3ZJ5A 4YASA 4YX9A 5KYKA 5FLXA 1XZPA 3ZVMA 2XZPA 3VKVA 5DOZA 4P4NA 3TUJC 5LQDA 4OXXA 1FFEA 4C4YA 1YQGA 2MTBA 1V1JA 2Z8YM 4OUDA 1GM5A 1JDVA 4HDAA 5HM6A 2J4CA 1GQQA 3L7DA 3MPOA 3R3YA 4ZVSA 3LTNC 2GJ8A 1I51A 3R5SA 4ZQIA 5E1BA 1X14A 3LX8A 1T0PA 3QHPA 4Q3EA 1ABEA 1H1DA 2ZE7A 4HEA6 4KN8A 2YV4A 1SK9A 1JWAB 3LG2A 4KE9A 3EZYA 3LS2A 1ZMTA 2ICAA 4CM9A 5LLTA 4PZDA 3PL5A 1J56A 3NUGA 4CTOA 2H4ZA 1JEEA 1X9HA 4DSZA 3K8YA 4A0GA 1Z22A 4O4HF 5TQ0A 1W5EA 2NNWB 3EOBI 4M9QA 1ZG3A 3MWEB 4KLCA 2IVZA 2VDWA 4FX5A 3DMDA 2AG5A 3UV7A 1V7QA 4F9TA 1KH3A 2BGJA 5L4NA 3L5KA 1W2HA 3DW1X 2OUIA 4J0IA 1LBIA 1CE8B 1IPFA 1EB8A 4G4JA 1IXRC 1MO2A 1JIUA 1NF8A 3I6MA 3KEMA 1AIPA 3P9IA 3ONEA 2VVTA 4R1SA 4YJFB 3EC7A 5K4AA 3NHWA 3HWWA 5DBFA 3RAPR 3PRYA 2QX8A 4M0MA 1SNYA 1HFWA 1TO2E 1UBTS 3V8VA 1H22A 2I4OA 5KIAA 2G04A 3ILHA 4O3FA 4AM8A 5CLIA 1WBDA 3DO5A 4OL0A 2H4YA 4R83A 4WKGA 3A2MA 4M9XA 4AF6A 1RLUA 3IP5A 1E60A 4F96A 1MJGM 5JXGA 3E05A 3ZIUA 4MAMA 1UIRA 2D5BA 3JZDA 3H5NA 2IK8A 4G5YA 4J76A 1E1KA 4LJRA 2RAPA 4O33A 4PO8A 4JI0B 3GD5A 4EGSA 2XUGA 3B1WA 3Q8KA 4MVJA 1KDTA 3X1DA 2PZJA 3EOZA 3ETDA 3LT5A 2HL6A 4QDUA 1YOVB 4KRXA 5FI0B 3VU3A 2DGDA 4DQXA 3CUEF 3JWGA 3PK0A 2WTAA 1U2GC 4GE0A 3TAHA 3SLRA 5P21A 3TJMA 3W6UA 3W8NA 4DLXA 4ZK6A 1CWUA 3RQIA 3KYCB 2CFSA 2JK1A 2VOJA 4E2WA 2V8BA 1BQEA 1K4MA 1O5OA 1T4DA 3HNPA 1NMYA 4BFWA 1VGVA 1XAJA 3SYNA 3U3DA 1ORVA 5HHTA 4YV0A 5BUSA 1HDYA 4MVJE 3TL2A 1RM4A 2IU4A 3TCNA 1E9EA 1DNPA 1PFYA 2HF9A 2SNIE 3HJUA 4V24A 4BN4A 5JWRA 4D1YA 1JT9A 4LVCA 5E8JA 2QD3A 3L7AA 1SVWA 3G8AA 3VKUA 3A58B 4OJNA 1E2IA 3SXJA 4YJ2B 3RS3A 2I78A 1B76A 2QRZA 1UPAA 4P92A 3FUWA 4WLFA 5CDUA 5IKPA 4B7XA 3K6JA 4G8BA 1DAKA 2UVPA 4KRYA 3GJ8A 4JQZA 4LQDA 4C7VA 4O0LA 3GU3A 3GDFA 1SC6A 4RDCA 4HNTA 2C4HA 1M5RA 3VSBA 2FN3A 3RVNA 2JGMA 4C4PA 1V39A 1Z15A 3NBFA 1E64A 5A71A 1PFUA 3GT0A 1AKYA 2Y8EA 1LDEA 2QOEA 3V1TC 1Q1GA 3ZX4A 1CQWA 5K3OA 1Z0FA 4FDVA 2WG2A 2V1XA 3FYUB 1DRKA 1RD4A 2R1TB 4UVGA 1LNSA 5EHGA 4EA6A 3JQAA 1RYEA 3H9QA 2JGKA 1M76A 3BILA 3LUJA 1JR4A 1QSGA 1FMCA 3ETCA 1GOTA 1H2AS 3JRNA 3AV0B 2RJNA 4B3SB 5CFZA 3ZDAA 4N7RA 4JELA 5AM3A 3UENA 1G0NA 3VX4A 1U2PA 3CPSA 4UTNA 2B94A 1U28C 4DA8A 1EUYA 1U1CA 2RJOA 1E9FA 2W6OA 2YOFA 1Q92A 4MQFA 3E22B 4I4NA 3O2JA 2O52A 1V5GA 3N59A 4E22A 1BS9A 1EK0A 4BNWA 5DBEX 1VSVA 4O08A 4BNGA 1JHOA 5IM5A 5K0NA 2BDTA 2ZRJA 2VRWA 3KPYA 4TZKA 3T3MB 1SUIA 1I4LD 4CR6A 3NHZA 1AT1A 3PFGA 2QS9A 1LPSA 4GPD1 4MICA 2P41A 3GT7A 5HFNA 3SP1A 3RYIA 2Z09A 2Q0SA 4FFRA 3EGEA 3K8OE 4FSXA 4N7JA 4ZZ2A 3T5DA 3K1JA 1NXQA 6ADHA 4C6RA 1F6WA 2QV0A 3KZVA 1PDOA 4ASUD 4DVJA 1YUNA 3G59A 3ZHZA 4IMRA 3MJFA 4PM4A 5IVHA 2AUMA 3PXDA 1AURA 1K9VF 4PZEA 2BH9A 4B3MB 1XCOA 2ZFUA 4PLVA 2D0DA 5I9SA 4GPEA 4D02A 5KSZA 2EG5A 4NKRA 2UVQA 3CWCA 2YINC 4J16A 3V4OA 4EUHA 1FYWA 2WHXA 4F9FA 5BP7A 4TT3A 1N7JA 4ENUA 2H1IA 4EG0A 2IYOA 4DDWA 3CVWA 1WOYA 1Z6PA 4CQLA 2IPOA 4I4CA 2Z4RA 1LC0A 4H1HA 1V3UA 3U4AA 4HUQA 2J08A 4MKGA 4WN9A 3E3AA 3TJZA 1ORTA 1C8KA 3ASVA 1HEIA 3IMGA 5TIIA 4PU0A 4B6PA 4NP6A 3Q72A 4B46A 3PUXA 4JC5A 3D2BA 4GR4A 1TYZA 2P4QA 3EFEA 1J00A 2QZSA 2WT9A 4G8CA 2HWUA 4LVNA 1IAQA 4IV8A 4TLBA 3WK5A 3UW1A 2O8NA 4CMHA 1FW6A 1YDEA 3BE4A 4UTOA 4EEZA 4CCWA 4GMGA 1REQB 3KZMA 1J0EA 3OE7A 1GSIA 3TIGA 2BR5A 3GD7A 4RADA 2IX3A 4CXMA 1AUXA 5B7QA 1WZIA 2UYCA 1Q7BA 2QTCA 2DUWA 4D9EA 4QGBA 3EUEA 2DFLA 1OXSC 4OK3A 4I2VA 3GRRA 3JVVA 3USZA 2VAMA 3R3VA 1N3LA 1VXOA 1ZXBA 2B5VA 4HDNA 2J6IA 1FJXA 4ZOEA 4E6EA 5GIPE 2ACVA 3ZYCA 1EKXA 2VDOB 4ZT6A 4YCSA 2PIAA 2P9GA 1QLWA 1Q21A 5DBGA 1KMNA 4LQCA 3T9AA 4S1PA 3NHUA 4CCYA 1VJ0A 2XF2A 1CDEA 2XB9A 1HY3A 4FGUA 1ZCZA 1JEYA 3L04A 2VSOA 3PZBA 3AVXA 4EYSA 2WD7B 4O4JA 5FL7A 4KZPA 3ZVRA 1ZW1A 3NQ41 3RC7A 4DKJA 3AK4A 3BYZA 2PX4A 2N3ZA 2OOKA 3R3WA 1GCOA 1QYCA 3OPYA 4CMIB 2JDID 3MOIA 2JGJA 3SAJA 4DIDA 4KWIA 3QBJA 1ESCA 1UMKA 2I6GA 4LAFA 4EPXA 4WZ6A 4BKPA 1DG9A 1JU3A 2PEZA 3ENZA 1UC4B 2WFMA 1LV8A 5G3YA 2R6FA 2DFDA 3V4FA 4W5RA 2PPVA 2QTNA 2VT7A 3GPDG 2VTEA 3NIGB 2PXXA 4IIJB 1Q1EA 4V0KA 5GIOE 2VHYA 2YBEA 2BZGA 2ZSUA 1CSEE 4UUMA 3AB8A 3OQIA 1Y5NA 1T2FA 4W9NC 3A05A 3VJLA 5IABA 4O29A 3D8HA 3DLAA 4TS9A 3C3BA 1EFDN 4JFAA 4L0DA 5EJMA 2R7NA 2IJGX 3GOQA 5JDIA 1KK3A 3HYCA 5DDIP 4QTYA 2B2NA 1JLLA 4ZU3A 3UJAA 1TCAA 3C5VA 2BJVA 1RI4A 4PAWA 4HDMB 1FVHA 5K6TA 4A23A 2X2OA 1JFFB 2VBFA 3ANTA 3KUKA 3PCXA 4BE4A 2Q6OA 2XTNA 3TE7A 1S4MA 1X7WB 1C30B 3D6MA 3LFHA 4I2NA 1C1XB 1HKHA 3V3KA 3HRKA 4S3MA 1ZO8A 3BPSA 4XPIB 5DCLA 5CPFA 3U13A 2F8TA 1N0WA 1Z2PX 2J3IA 1CJSA 1B0AA 3IAUA 4IAOA 3SPXA 4NFYA 4TLEA 2G0TA 1UBJS 1UK9A 1YGPA 3B2NA 5LNK6 4J7AA 4E2XA 3F7TA 4XOIA 1PIWA 1PT6A 4TYPA 1RW4A 1U5BA 3IP9A 3ELUA 4REQB 3UK1A 4P36A 3A3KA 1PFVA 1YONA 2QYOA 1GG8A 3AYZB 3H5LA 4GLJA 4XYEA 1ZCJA 3AUUA 1OV6A 2FKAA 3SIXA 3FUUA 4EO9A 5H9WA 2A2ZA 3JQ8B 2QSZA 4LSWA 4B73A 1GPLA 1ESEA 4P31A 5L4LA 1KQFA 3WYDA 3K5WA 3HFJA 1RQ2A 4XVRA 1EWVA 3E9MA 3IAM6 3M83A 1ZOIA 2CE2X 1W6UA 4KB5A 4B8WA 3PEWA 1I13A 3BK2A 4KJXA 1BJKA 3IHWA 5EXPA 3RFUA 1OBOA 2Q6TA 5JJIA 2QM7A 4DV6B 2HO4A 4QUIA 1P39A 4BLUA 2Y1GA 4RANA 4L4RA 4TLCA 5JCJA 1NY6A 4KI0A 4KG7A 1P6QA 4WGGA 3DHVA 4ZKDA 4M0LA 1G1MA 4F06A 3NNDA 4U63A 5KNDD 1ZOSA 1D5CA 1VXRA 3GFOA 3QXHA 3FYCA 2PUHA 5KOHA 1Y5RA 2G77B 1VRCA 2M1XA 2HJ9A 3DZGA 4KEAA 2C42A 2Q46A 3EDOA 4N4AA 1NBMA 1X7HA 5EIOA 2ETVA 3WL7A 2H00A 4NJMA 4Q4HA 5JS6A 4G0PA 7MHTA 2ODAA 3NATA 2BI7A 4RPCA 3ANNA 4TQAA 4CLDA 2EYQA 4PANA 1KP9A 2X9NA 2QY9A 5JI3E 2NP7A 2AMYA 2FFJA 1S2NA 3IC5A 1RMYA 1VB5A 3GPBA 3IT1A 4RIEA 4BV3A 4AN4A 3E8MA 2MSKA 1EEXB 4D4LA 2POQX 5AKLA 1TQ6A 3O92A 2BEVA 4UUQA 1RHQA 5JD3A 3SYTA 2XWBF 3ZCUA 3N2KB 4LXTA 1DCKA 3I61A 2HA3A 5IZCC 2ZYUX 4OM8A 4KQXA 4QDKA 2B21A 5I51A 1N8NA 1R12A 2ZCUA 1NBME 2CFOA 3NWJA 4FC6A 1KFEB 1W5SA 2PZKA 3EQ8A 4KO3S 1UKBA 4FDAA 1PG2A 4AF8A 3IAHA 2X9LA 4D9MA 1E4EB 2GLXA 1JIJA 4E0BA 5BQ3A 5HW0A 3DMTA 3OTWA 3CUUA 1RJWA 4E2FA 4MXDA 1O2DA 1TD1A 5JXIA 4BO2A 2P7HA 1GLNA 2PV0A 3I34X 4OQDA 2AK2A 3WBFA 3H86A 1S3SA 1IHYA 4Q3BA 1OX6A 2NSYA 3PUZA 1OT3A 3UJHA 2BMAA 4DAOA 1G20E 3D7LA 3RTEA 1E61A 1F20A 1Y5MA 3GQBB 2DHQA 1ZNYA 5FOVA 1XU4A 1YB2A 1BE6A 3VH2A 4GHWA 3OESA 3F7MA 3JATB 5KTKA 2HBQA 1NULA 3N8GA 4NOLA 4LY9A 4LHZA 3UA4A 4TWJA 5U4XA 1N1EA 3TE6A 4YQFA 3NYIA 4QFMA 1ZK3A 4EG8A 5HZKA 4MQBA 4QXMA 4KH0A 1UFOA 1X1BA 2IOYA 5FFMA 3ZR4B 4DB4A 4A36A 4JV5B 3RC8A 2QORA 1V5EA 3JWHA 5EZQA 3FH0A 1VA5A 4C0JA 3OMLA 4LF9B 3PDIA 1HF3A 3N2GB 4UU7A 5KTOA 2AE1A 2OC9A 3JZIA 2O4UX 2QL9A 4ZVNA 3R7NA 4E5YA 3LXMA 1XVTA 4BVEA 1JZQA 2VT6A 3WWPA 5ILGA 4XJTA 5JLAA 4KUGA 5K3FB 4B84A 4YT8A 2VRCD 3PHLA 5J1SB 3RC1A 1A5ZA 2H9YA 1PVDA 3EDMA 4TYMA 3PE3A 3GUUA 1G1AA 3KWJA 5GONF 5G41A 1PZFA 3LUBA 1UJBA 5F9FA 5B7NA 4J43A 1HZZC 1BS2A 2QLBA 1DAEA 3R5FA 4BVAA 3DKRA 1KS2A 1U0TA 2I22A 3CO5A 1BVYF 1W0KA 2HQRA 4FXOA 4OP3A 4DV7B 2ZXUA 3A6JA 4LHVA 1JDBC 4D99A 4ZAFA 3AF6A 4JI6B 4R8VA 1JYFA 3B82A 3PNKA 2VF2A 5EE0A 2GI4A 5TGTA 4FB5A 4HDKA 2VJDA 2PUBA 3TAXA 2WJPA 1V6AA 2VG8A 1XB2A 4JUAA 4QFDA 3M1LA 4TWBA 3UF0A 4MVJI 3JQDA 5D1NA 4RAOA 2O2DA 5DW3A 1KKUA 5KSYA 1JEYB 3BFXA 2R85A 2G8LA 1G18A 2DQKA 5IANA 5JH7B 3K9WA 3O93A 2O5EA 1C3EA 4UUAA 1ZRNA 3UK6A 3T3GA 1EUCB 2ZSFA 4JASB 3K7EA 4WJKB 4U8GA 2Q4TA 2P6MA 4R1TA 1MAUA 4JWTA 4Z4IA 1FFWA 1SULA 3V6LA 5B3JA 1PFQA 2FZLA 3VHXB 4XSGA 5DNVA 1PNRA 4MUAA 4NC9A 1NNSA 3K0HA 2V03A 1FFSA 4LOKA 5FBLB 1GPKA 2QX6A 5FBZA 1C9DB 4RIFA 3PGXA 2FN4A 3R3XA 1G64A 4BJ6A 2XOEA 3V7UA 2ONCA 1G4UR 2YJ5A 4X1IA 1BXGA 2PZAA 2QD2A 2P5TB 2YZKA 3BIWA 4E13A 5EKXA 4F7DA 4D43A 3FZGA 3A7EA 4AKSA 4QTXA 2OCBA 3I2JA 4FMDB 3NJRA 1S8FA 3IOBA 3KXDA 4WKCA 2E49A 4QQRA 1C7IA 3P4YA 2ZB2A 3PTLA 3VPBA 3LT1A 3WYAA 3LHFA 1FNBA 2RHDA 3DMNA 3JQFA 3K9LA 1JTEA 2W93A 4BQPA 3UV6A 2OZLA 3MGAA 2UZIR 3H9JA 2LV8A 2XA2A 1H2EA 4AKGA 2WDZA 2WM3A 4RFLA 1P0FA 2REQA 1GGJA 3B36A 1EI9A 2WYIA 4NTZA 2NO4A 3CZAA 3E3OA 1A98A 3KYDA 3G7NA 3OZBA 1MKYA 2G63A 2ZJ7A 3DBIA 3DMGA 3HY3A 5JAQA 4AMYA 4YRIA 5KWSA 3LUCA 4HP8A 1O94C 1FX0B 2Z83A 4IH1A 2H7YA 4D25A 4GYYA 4ZHQF 2YNMA 2OHVA 1U3FA 5FNZA 2BGWA 4PSKA 2D62A 2A5YB 3Q1LA 5COBA 5IC4A 3FAZA 1E69A 2EW8A 4XM2A 4TV9A 2XT9A 3T12A 4B7CA 2AG0A 4FQ5A 1P8JA 3R3UA 2XX3A 2Z2IA 3LXRA 3VC2A 4JSRA 3I58A 4RK0A 4IGAA 1ODKA 2XBUA 4P82A 1L5KA 2LW7A 2P9CA 3VH4A 3EEYA 5TMDA 2I8AA 3EFOB 1LI4A 1U2EA 4BKQA 2VBCA 4F2GA 4MKHA 1XZ8A 1DQSA 3LW8A 1AGNA 2OM2A 1U80A 2M2IA 1W5TA 4HADA 4MWBA 3CZ9A 1RQGA 3A4MA 3NRBA 1ZPDA 1I5EA 1G17A 2GXUA 2XYVA 1ECJA 5ANRB 1LTHR 3L40A 2P3QA 3L02A 2VQDA 3ZKAA 4AUKA 1Q3KA 3IP7A 3COSA 3O3OB 2ATCA 1XIVA 2HZBA 3FX2A 4QU5A 1I7QB 1EESA 4NJMB 2XT6A 1RHKA 2OAP1 3GUVA 4FYPA 2X0FA 4EYOA 1SCDA 1WD5A 2F43A 2MSNA 1JP7A 2EDAA 2YY5A 2IZZA 4CLOB 4BU0A 2WUGA 1X8LA 3B1FA 3PNSA 4UZEA 3N2ZB 3VNAA 1JPUA 5FTKA 1GG9A 1WXFA 2JH3A 2PVCA 4RQUA 5F1YA 2UZ1B 3H99A 4QUBA 2L42A 1G20B 1PR9A 1TC1A 3PQ3A 4B2PA 4ZDWA 4A8HA 4GKKB 2J5BA 2RONA 2O7NA 2X1HA 4ZYVA 3LY7A 1T35A 1M66A 1NXVA 1TZJA 4Q3DA 2XA9A 3C1OA 4UQOA 3TR6A 3MA0A 4DEYA 2JLBA 4MLZA 4HWGA 2OGSA 1PHPA 2O5RA 3H11A 5AOVA 3BJIC 5CM2Z 3LGSA 5CB4B 1X39A 2IS4A 1FIUA 1JKIA 1OA1A 3KJGA 7MDHA 3B12A 5IXYA 4WHMA 2GKSA 2GR9A 5EZYB 3OQNA 3SICE 2DP4E 3BWBA 1WNTA 3CRRA 3H1GA 2C3UA 1V1MA 3ND8A 3VC3A 4X95A 2QRNA 3W7AA 3WGKA 3BT7A 2ZJOA 2EFCB 1IWPB 1FVOA 1UK6A 4O4IA 3BXXA 4FYWA 1PQUA 2A1IA 2D2XA 4CLEA 1WSBA 1UBSB 1RXEA 4HWOA 1SQ5A 4CI0B 4JI5B 4EECA 5LIRA 3QIAA 1WW8A 2FR8C 2WWYA 2PLAA 4OA5A 1H4SA 2JHAA 3LVRE 4BQEA 1PJAA 2G28A 4J3FA 3HM9A 4O02B 3FZQA 1P5JA 2AMLA 3OFVA 4RA9A 2IF0A 3P9NA 3H5TA 3NW9A 2BSAA 2HLNA 3E8SA 4M36A 5KYUB 3PNMA 5T3UA 4J0QA 5F64A 1ZJ4A 4X91A 1FBTA 4MUMA 2YCBA 1HE3A 2OBLA 1LXCA 3CNNA 3CY6A 3VR2A 2G4LA 2D0PB 2H8KA 4X1YB 5C80A 3OPYI 4J1NA 3BB3A 5FNVF 5K8TA 1J1UA 3L0OA 2AFRA 4HWTA 1LK0A 3ZK7A 1GUYA 3D7MA 3WFJA 5KTYA 3NBYC 5C0OE 3ISTA 3SZOA 2I62A 1E3MA 4GXTA 1YVUA 2XNJA 3IUYA 1HTTA 4H17A 3LQRA 4M1YA 2HRBA 4AN1A 1K6MA 1OD6A 1NVXQ 3FVWA 4GC5A 2W6ZA 3WDKA 1NJSA 4Z4FA 2QRMA 2A9JA 2E5WA 3BMQA 3QOYA 2Y4NA 4YJ3A 4D8VA 4Y6QA 2JD2A 1L5QA 4ALJA 3C8HA 2RDMA 4MR8A 4CV3A 1X1QA 5FTWA 2NACA 1C1DA 1PZXA 4PINA 3HSKA 3PV0A 3VTFA 3LK6A 4FM9A 1QZ3A 3GWGA 1YJAA 1MT3A 1GR1A 4AYXA 1O57A 4CDNA 2QLNA 1H8HD 1ACMA 1ZX1A 4KWTA 2JA1A 2CK3D 3P94A 3PNYA 2I7TA 4ALLA 3GDOA 2P2SA 3PVZA 2CXRA 1ARZA 2FSVC 4QJ5A 1N5RA 4WY8A 5T8KA 1E3QA 1EM8A 2IKQA 4E7PA 2AR9A 1IJFA 4BWVA 5BR7A 1M5UA 1O6CA 4TM7A 1GTSA 1P0MA 4M1EA 4JOSA 3C5EA 3EIEA 3EFBA 1YOBA 2XUKA 1MC8A 2PY6A 5D3ZA 4EDFA 1YZFA 3GPIA 2G25A 2J3DA 2XODA 2B98A 4O4LA 4LYFA 5J47A 3GBVA 3CLKA 3E9CA 5AKGA 5ALUA 5JDCA 2FW0A 3QBDA 5DNEA 4W5OA 4KWEA 1KYVA 4KDEA 1E7WA 3HJGA 4MWSA 5B57C 3ZDCA 4JJGA 4I1IA 4P0TA 2Q1SA 4KVZA 3GZJA 1BJRE 4EABA 2NOAA 4FUTA 3P0RA 3T52A 3IEIA 2F55A 3A32A 3UK0A 1ZEJA 1Y63A 2J45A 4Z0NA 3INTA 1G6KA 1TT5A 1K7YA 1PNQA 1GO2A 4JUDX 4M8NE 4YAOA 3NBKA 4ESVA 1F7VA 2NLOA 3OEHD 3P5SA 1E6CA 3E5HA 4JVLA 1NJ8A 1T25A 5JD4A 3W5VA 3RUFA 5G1PA 4A8JA 1WDTA 4PYMA 4FT2A 3T3NA 4JVOA 1I1HA 3WFZA 1MJ5A 3ND6A 3LKVA 1C14A 1CJTC 1EMDA 4NFLA 3EF3A 4QO8A 3D3NA 3HB0A 2C8LA 4R8LA 2OYCA 3LF2A 1VTKA 5F12A 4RPIA 4WNAB 4ARAA 5BRNA 4E21A 3P9PA 1H5UA 3Q3CA 1JL3A 6PFKA 2GEBA 3LSTA 1QQTA 3Q7TA 3GGJA 1XX6A 4W1RA 2RGAA 1ISMA 2NO0A 2JGIA 1YL6A 2VWGA 1ZN9A 4J8PA 3UUGA 3WSVA 1OXVA 3B53X 3SKXA 1ISPA 2E87A 5TVGA 4QVIA 4QOSA 9GPBA 2I2BA 1M1NA 2VUHB 3T4PA 3CZQA 4HX5A 4XR4A 1RLMA 3QW2A 1ZD1A 4FGWA 2EZTA 3BRWD 5FPKA 4WKNA 1HUQA 1U3DA 2CXNA 3AJRA 6NULA 2CLEB 3ADOA 3MQ2A 3O9VA 3JQBA 4J1QA 2VXOA 2R48A 5HIJA 2E1PA 3ODPA 2FEWB 2ZSKA 4JJ8A 3P2JA 2VDPB 4OLJA 3Q5DA 2JJ1A 4J2OA 3S27A 2X3FA 1H2RS 1PJ3A 1FYDA 1R10A 3R5XA 5FO0A 1NMQA 4AYWA 2XNKA 2H08A 2H48A 3BWCA 3LYLA 5K3SA 1OE0A 1INLA 5ADWA 4MROA 3BEOA 2O0HA 1QRRA 1OILA 4CM8A 4RF2A 4RZXA 2B83A 3WFIA 4BGIA 1NPTO 621PA 1VSTA 2PH3A 2E0IA 3D7RA 2JCYA 1JMVA 2TSYB 3LHSA 1ECCA 1QIJA 1WY7A 1OFIA 1XTRA 1JZTA 1TLTA 3DW3X 3T7DA 5B1YA 5B3LA 5SYMA 3LFUA 3H2ZA 2ZM5A 2P40A 1XTQA 3GHHA 2ODBA 3CWQA 4I46A 4IHJF 2I55A 2JAXA 4LYHA 4XDZA 1C7EA 1WCIB 2FFRA 2PSHA 3GBSA 4TVOA 3ZXIA 4RY9A 1X74A 2C1ZA 1OYVA 2OD7A 2JIRA 5TDHA 3LRTA 3U3XA 1CUFA 2JGNA 3WQHA 1WB6A 5DHQA 2QU7A 3OCXA 4FSDA 1T4CB 4XX0A 3TB4A 4FHEA 4DRYA 4OMUA 4DM7A 2B69A 3I0ZA 4Y2GA 2AG8A 3AWDA 3PQ7A 5AVKA 5CEJA 4QAQA 3O1IC 4IXDA 3MXTA 5JAUA 4CBVA 2HIGA 3COYA 4FFVA 1SIBE 2JGAA 2CNNA 2A7XA 2O7VA 2WTNA 3QUAA 2CMDA 3JTEA 2WTBA 1CNFA 2W6PA 4GO1A 3DV2A 1FNSA 1G55A 2ZS9A 4MI1A 3LL7A 2FRXA 3CZ5A 4H9GA 2K87A 4N0PA 1PBNA 1L5WA 2V74B 1SBTA 3K8ZA 3WGGA 2YIJA 3LGAA 2ZVQX 4W1PA 1YV9A 2VO1A 1LFAA 4MW2A 5FPPA 3B9QA 3W7VA 4C29A 4E30A 3SFTA 2ZBPA 3KDAA 4EMSA 1KPIA 1ZD9A 4RA9B 3F6YA 3HLYA 4P3YA 1T2CA 5ICFA 3UT5B 2XOKD 4MO2A 3VDRA 4BFCA 2C04A 3HB5X 4D41A 3NTVA 1OMOA 4ZD6A 3EMDA 2F4VB 1XDBA 4RHEA 1IEVA 4MHSA 5K0SA 1R0LA 4AL4A 5JNLA 1TVKB 3DLCA 4BPRA 1T8YA 3GA7A 1EB9A 4KQ6A 4DLUA 4GGMX 5JYDA 1EAMA 1Z36A 4KQMA 1JPNA 1W48A 1UPCA 4TMTA 4V2IA 3O2SB 4JI7B 1OY1A 2X2FA 1CIVA 3IQIX 4BL5A 4JIGA 1B15A 3L9XA 3A70A 1NUTA 1DTSA 2JW5A 4AROA 1XMVA 4PYNA 4E70A 1S2GA 4PLGA 1PWZA 4RLSA 1FDRA 4OIFA 1JA0A 4MP3A 4AUEA 2H2DA 2DRIA 2VYNA 4FB4A 1XNQB 4FGZA 4Y2RA 1O4WA 4JA0A 5DNCA 5ENVA 4L4ZA 2ZPAA 4IBOA 1XCGB 2O48X 1NQ5A 2OECA 4RXMA 3H83A 4X85A 2HXYA 3AUSA 2HV8A 4ZJZA 4I1OA 3WDSA 4IOMA 4YMSA 4LY6A 3FCXA 2JK0A 2OHXA 5HKAA 5C8YB 3ZKWA 1ELOA 3RRNA 2O8BA 4ZO4A 1DINA 5DIZA 5FBHA 3WMXA 5JOQA 5IK2A 4G0VA 4JYCA 2PO5A 1N6KA 5HZHA 2QTZA 4P35A 4ZOLB 4FMCB 2CJWA 1SEVA 3WWCA 2BRUA 1G3UA 2QAJA 3OBBA 3IJPA 1P4GA 1X13A 2Q5JA 1KE1A 2COKA 4LDAA 2IQ5A 5BRJA 1D2HA 1JG6A 3AX6A 3OJLA 3CLSC 4NONA 3ZTWA 4DWVA 3KTOA 4KMSA 3JS5A 1KZ7B 4PAOA 1R8XA 3IELA 4IVQA 4PZAA 5FA8A 3V80A 4EB0A 4DRXB 4PWYA 4CIBA 3V4RA 2UZ3A 1JF8A 1DBSA 3DBOB 3ME5A 1ETUA 3WJAA 2VJNA 4D80A 4YP6A 2GZRA 2GBLC 3B3GA 3G7SA 5FUMA 4G1CA 4MCHA 5KNCD 2RHMA 5EMMA 4DSTA 5MFPA 4QU0A 3HO8A 3V3TA 1G9SA 1KYZA 4EL5A 2BFBB 2HHJA 3ZDFA 5B2ZA 3CW9A 1U94A 1F8YA 1TEVA 3I04A 4J94A 4FN4A 4CNBA 3K2BA 1OLUB 4BGDA 4CGZA 1GCGA 4X93A 5KTMA 4D0SA 4PRLA 3ER6A 1YDWA 4QHTA 1QLHA 1RWQA 1N9GA 2RI0A 4L0MA 3W4KA 1K5HA 3SC2B 4UNNA 4L5AA 4DPMA 3EBPA 1XTSA 2CMGA 3UWSA 2ZE5A 3E48A 4F9GA 2HIAA 3PD7A 4CEIB 1J8YF 2WU1A 4PX9A 4DCOA 3V4SA 2X8JA 1LPAB 2W98A 1WB5A 1VDMA 1IH8A 3LOQA 1AZTA 1KI4A 1TFUA 2IY7A 5JLJA 2BONA 4TMFA 2NZJA 3HGTA 2CFIA 2VTBB 3KJEA 3QWFA 1J06A 2VSQA 1RFLA 4NNOA 1DEHA 2WZQA 3UXMA 4B34A 5H4GA 1G2IA 1CFZA 2ODWA 4BP9A 1RQPA 5BRAA 5FAXA 2FZEA 1HK7A 3RSOA 1XXHB 2JBWA 4LFCB 1T9HA 5JCOA 4NATA 4YCMA 2KBFA 2DSTA 1NKSA 1AHIA 3TPFA 4ZO7A 5EXXA 4D9GA 5KKAA 4C4SA 4XWWA 3ZE8A 3HABA 1G7TA 5L7YA 4F38A 2GPJA 4CIAA 4CKBA 1DT3A 1QVAA 1LVGA 4IEEA 2OLEA 4PSDA 4WD3A 3MJTA 2H1VA 3CEPB 4W1QA 5JECA 1P2GA 3VR6A 1MAVA 4ISCA 4X3OA 3VJKA 2A6PA 2BE9A 2GWHA 4EA9A 4C6TA 2GGSA 2NTNA 3S5UA 4EF4A 2R8BA 1CEYA 2IYRA 4OK5A 2WPDD 2P4EA 2HQBA 4C0SA 5JWOA 3FNHA 4Q02A 4EX7A 4HBGA 1QYXA 5BSGA 4Z0PA 1QS0B 4J16C 3KQOA 4JR2A 1YKSA 4W6ZA 3A31A 3QEKA 4I5GA 1IONA 2R8EA 3QI7A 4F21A 4HL6A 4ENSA 3W2HA 1QXSA 5C5EA 2V9ZA 4MVWA 2GZMA 4MVJM 4ZYZA 1WUTA 5JFTA 2BBSA 3EDQA 4M1QA 3QVKA 4J0GA 3L4SO 3EASA 4XDYA 1E0AA 4NMXB 4AUNA 5KSWB 1BFKA 1U81A 4PPGA 2YFQA 2I5PO 4E5NA 1ICIA 4MS3A 1GA1A 1CF4A 4HWSA 5BWMA 1X87A 4PRZA 1OH7A 2AFIB 3M6XA 1UDAA 2VLIA 4WCFA 4DYHA 2B1GA 2I6SA 4HQLA 4PLTA 5HF6A 2A0KA 4KVGA 3JAWA 1MP0A 1NBIA 2YRFA 3DE4X 3HU5A 2ZCVA 5F21A 2NUAB 4BGUA 2C9ZA 2QW8A 5GOTA 5H02A 3A36A 4BNTA 1Z5UA 4KIUA 1EHCA 1E8MA 4R05A 1GPDG 1SU8A 1UJ4A 1FFCA 5A4DA 3TUZC 4RELA 1TDJA 3W6ZA 3UMVA 4H77A 5IG2A 1KZ6A 1NN5A 2NZ2A 3CJTA 4HX9A 2PLRA 4DCCA 4U2FA 4N7MA 3T41A 4B45A 5C34B 3MLEA 5IYZF 2RHOA 2X7HA 1AUVA 1BVUA 2QRVA 3Q9NA 5ITSA 2KS6A 4JYMA 1Z4IA 1UDXA 4WWHA 1Y6GA 4YRAA 2LUOA 1XVVA 3AR8A 2ZVDA 2EAUA 4IS2A 2E6KA 1V43A 1Z75A 1QHNA 4LMPA 1OBFO 2H54A 4I1UA 4RBNA 2Z3ZA 3U7RA 1AO0A 4ZTBA 4PPNA 2G5TA 2VUIB 5LZ9A 3ZIAA 1DX4A 1GZ7A 3AHEA 4HNUA 3OIVA 2FUCA 3WK6A 2H2IA 2NAPA 1MABA 3G0CA 3HL0A 1MJHA 4YWJA 5K3DA 2CLSA 3S2FA 5FDFA 3D0KA 3DZBA 3TQCA 1Q83A 1D6NA 3C6MA 3DBVO 3Q10A 2HUPA 3ZWMA 4F3CA 1N2ZA 4MA4A 4LNHA 4KBYA 4DY4A 1IZZA 1A97A 3OQVA 1CQXA 1R1DA 2V59A 2ZEJA 4L8VA 4P1ZA 4DLYA 4YY3B 3OAAD 3FOBA 2GN2A 1LSUA 1IZ9A 1Y3IA 2QE7A 5D5PA 4CDMA 4CM3A 2VAPA 3ITEA 4GX1A 3T5BA 3AESB 4EOGA 4KXUA 1J07A 2C2ZA 4NY1A 2O1WA 4P81A 2CCGA 3F47A 5KTSA 3QX7A 1G291 7AT1A 5EI5A 1NAIA 2R4QA 4HTFB 1J8DA 3LQ4A 4A3SA 3IUNA 3G1WA 4BHTA 3ZD9A 4GVPA 4RZHA 2B25A 1TVEA 2C59A 1ZZGA 3ZDRA 3OFKA 1L7OA 2O8BB 2Q1TA 1G8JA 5JDIC 2J5XA 2GEKA 3S1AA 3QV1A 1N0VC 4Q3CA 4JS0A 2UKDA 1PN3A 4ND8A 4Y0NA 2OYRA 4NBNA 3ZHXA 1AX9A 1HE8B 1A9SA 3ZXUB 5CT6A 5KTTA 5A4JA 3FLMA 2C5EA 3TLEA 4ZXPA 3FI9A 1DJQA 3WR5A 2WWVD 2QK4A 2XCSB 2Q9BA 3THWA 1A0OA 3VYRB 1YBMA 2A0WA 2A7QA 3EBOA 2VJAA 3PXXA 4KIJA 3QWHA 3PJDA 4M1OA 4POAA 3VR1A 4HPWA 1DC3A 1H93A 1LSSA 4QSMA 3K0SA 5A0FA 2ZSBA 3VSEA 1XRJA 3LDUA 1UKEA 4I66A 1RLJA 4RHCA 1D1PA 1SXJA 4WDRA 1BMFD 3EQ7A 1ZWLA 5TF0A 1TTTA 3K0EA 4TXNA 1P9WA 3EVCA 4F6RB 2C4VA 1K5PA 1QFJA 1EXMA 2JLZA 2GSWA 5JEDA 2Z6AA 1SCUA 3R1IA 5F23A 1I33A 1UJCA 3ESCA 1QE5A 3R40A 4LFBB 2A84A 3ES9A 3M6IA 4LX0A 3UH0A 4QGAA 1KYWA 2O2CA 2ACKA 1N1DA 3U39A 1KDVA 1VJTA 1ABFA 3RLIA 8OHMA 8AT1A 1ACJA 3L7MA 4IJQA 4LIPD 5GQSA 5KI6A 2PZMA 3QOXA 3O5AA 3TX6A 1XPJA 3AR4A 4H0FA 1KMQA 1Q91A 1SXJE 3W2IA 1FQOA 2OVBA 5CB6A 4J6EA 2O8CA 1GU7A 5C51B 4X6YA 4PCLA 3JALB 2CLHB 2LP4Y 1U7UA 3QNWA 3MJEA 3FMIA 1EUZA 1C7QA 4BP1A 2YICA 4XB1A 2B82A 1PGQA 4N6GA 1CVRA 2AEFA 5DM1A 5HIIA 1TM1E 4CF7A 1O08A 4UNPA 5JVDA 1W2GA 3ANSA 5G1OA 2FVXA 5EQFA 1G42A 1VKZA 2BFCA 1VRVA 3B6EA 4K2HA 1XK6A 3AXSA 3DMYA 4PAQA 5DISB 5DYGA 1V16A 4AG5A 4DMMA 4TWRA 3NASA 5K8UA 1IXYA 3DDNA 3NM6B 2IE0A 3RODA 4TYNA 2QIPA 4OOEA 1DFHA 3PNLA 2Q5EA 4WJLA 4A6XA 5CG1A 1OX5A 2AQ8A 2H16A 3F5FA 3Q6MA 4ZZIA 2XB2A 1V5FA 4OJMX 1W73A 5J5AA 5BQPA 4Z1MA 5L3SB 2CHGA 1C80A 4RZUA 4UEOA 3E9NA 3UAOA 3VXKA 1VFPA 2OBYA 5E3HA 2YWDA 3JYOA 1Y9ZA 4QOEA 2X6TA 4KFTA 4Y6LA 4I50A 4RKEA 3C1AA 2DWQA 3LUKA 3RKSA 5D3QA 4P8RA 4EQ6A 5B58C 2ZYIA 1F5NA 3RSLA 3IBGA 4BLPA 3GPLA 3W9SA 1VKRA 4KQFA 3TCKA 3DMTC 3VPGA 5E38A 3RSZA 1A71A 3W6OA 4I0WB 5JI2E 3DTNA 3RFCA 4OI0A 3BGWA 3EGOA 1ONSA 5LP6F 2YV3A 2FEPA 2X2PA 3LO8A 2JBAA 1R64A 2J4FA 4YUXA 1Y9DA 3EXG1 1Y34E 3ZK9A 1P2TA 2YVUA 3KQNA 2LKDA 1JH9A 1NMXA 2PZEA 2WQ6A 1JE0A 4Q6BA 2O0MA 4A16A 4N9WA 5DLQC 1LI7A 5FUQA 1RTKA 2PSEA 2WYVA 3NNNA 2EX4A 1MT0A 4LWQA 1WLYA 3TF5A 1MENA 2ZTVA 3EIWA 4F85A 5B36A 3OY2A 2NTVA 1YNOA 521PA 5LYJA 1WABA 2IGTA 2YMMA 3G8CA 4FFOA 2H29A 4RQTA 3WSWA 1QQAA 4HLUA 4LRSB 2WABA 2NXEA 2O6HA 4HRXA 1NVMB 4AZ3A 2QTGA 1Y6JA 2PJUA 1AS3A 2RGCA 2XUAA 3ACCA 4US2R 3G1TA 1QF9A 3A1SA 3T1QA 1Z6QA 2WYHA 5B58T 1KHHA 4GOND 1SXPA 1ZGCA 4TRJA 5CCXA 3SQOA 4Z1OA 5KQRA 3SNKA 4L76A 5EIXA 1CR0A 3JYLA 3STTA 2ST1A 3C70A 4RUKA 4NYJR 4C7BA 4B75A 2IOFK 1KJNA