5AOCA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
282
structure length
277
Chain Sequence
b'AEVGRLRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
molecule tags Hydrolase
total genus 104
structure length 277
sequence length 282
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aocA00
4K6KA 5FUMA 1LGYA 5H3HA 3WLAA 4I4CA 3DL4A 5IVDA 4UFNA 4P93A 1EVEA 2WHPB 4H7HA 1YS2X 1EDDA 1HKHA 4IQ4A 1TQHA 1VE7A 1DWOA 2OGZA 2RI6A 2WLSA 4A23A 1OILA 1THGA 5CXUA 5AI6A 2H7XA 4M0MA 3DCNA 3H18A 3I6ZA 3LCRA 5LZ9A 2BUAA 5CT8A 1MX5A 3IBTA 1XZBA 3JWEA 1W75A 3ANTA 2XMSA 3H2GA 5K3FB 2Y6VA 3OTQA 2BFNA 2HA7A 4H18A 4KACA 5DJ5A 4FLMA 2Z3ZA 5IVKA 1XQVA 1NX9A 4BZZA 4A16A 5EFZA 4QDXA 2JGJA 3V1LA 1FFCA 3DEAA 1O6GA 2WIJA 3LS2A 4G8CA 5CURA 2X8BA 4H77A 1VXRA 3QMMA 2XI4A 2ZSHA 1YS1X 4Y2QA 3F67A 3F9CA 4P08A 4W9RA 2QVBA 3BL8A 2JIDA 4D9JA 3SC2A 4E11A 4JUIA 1MX9A 1MTZA 1JJFA 4J0JA 2QXUA 2JGMA 4FBLA 1A8UA 5AK6A 1Q0RA 4FWBA 1XZKA 1AZWA 4Q1VA 3UUEA 5AI8A 1R88A 4FDMA 3FCXA 4J0HA 1ZD2P 1XZJA 5ALXA 4DIUA 4HXEB 1H22A 5EHNA 3WKEA 5HCUA 3D2BA 1QIIA 3PF9A 3TJMA 2RAUA 3AIMA 2WFZA 4EBBA 4BE9A 4EY7A 1K6EA 4EY6A 4DNFA 2XUQA 2OG1A 2V9ZA 2WFMA 4N8EA 1DWPA 4H7EA 4QA9A 2QZPA 4AO6A 4F60A 2GZSA 4BVJA 3U0VA 1EB9A 2H9YA 5LZ4A 1QLWA 1E3QA 2G5PA 1EDBA 4CI9A 2VA9A 3MUNA 4U2GA 4B7ZA 4CG3A 1A7UA 1JU4A 4AO8A 4MQMA 3R41A 3WIOA 3AJAA 3WJ1A 2X5XA 4BYMA 3DLTA 4PQEA 5T4HA 5AP9A 1WB4A 1YB6A 1QIGA 5ALIA 2RGUA 5EIAA 2QMQA 3OM8A 5AI0A 4B83A 3WMRA 1QTIA 4OU5A 3AUKA 4MWTA 4G9GA 3WWEA 1DQYA 2X76A 3WKDA 2XUKA 3HYSA 4FTWA 1BCSA 1WPXA 5ALGA 3EQ9A 3BWXA 3W04A 2PBLA 1CR6A 1XZGA 3O9VA 4INZA 1JU3A 2Z3WA 1XZFA 1XZDA 4QDOA 5ALDA 3BXPA 4G4IA 4BC0A 5LIPA 2IITA 2ACEA 1YA4A 3OC0A 2R8BA 2C58A 1HQDA 2GBIA 3D0KA 4Y7DA 1LLFA 3B12A 2ROQA 2DFPA 3C8HA 3GELA 4G8DA 4UBMA 5ALSA 2R11A 2YASA 2VT6A 5AKKA 3ZV7A 4BRZA 1WHSA 1SCKA 1OXMA 2CEKA 3H1AA 3KWJA 5F4ZA 2HA2A 2OPHA 5LZ2A 1FFEA 1BU8A 2WUEA 4HRYA 1QIEA 2BJHA 4H35A 5HKBA 1GZ7A 4ZV7A 1YASA 5AOAA 3V9AA 5I8PA 5ALMA 2CJPA 4C88A 3H2JA 4ZV9A 1FFBA 2JGIA 5AM3A 2DQZA 2HU7A 1Y7IA 1XQXA 3M82A 1RWQA 2C7BA 1JMKC 3HEAA 1YA8A 1AURA 3IB3A 3G8YA 1E8MA 4WJLA 1OCEA 1VLQA 3QM1A 3T52A 1CUZA 2O2GA 4LYDA 2WJ6A 4YASA 2AXEA 1P0IA 1IMJA 4UBNA 4OYLA 2WHQA 2YYSA 1QIJA 3FVTA 1Z68A 5JD5A 3ESDA 1QIDA 4EY8A 4Q3KA 4ZGBA 2G4LA 1ZD4A 4BBZA 2VT7A 3LIPA 5JASA 4GHWA 3DD5A 1LPOA 2HA6A 3ZWQA 1WCYA 3N0TA 2QOEA 4PSUA 1ZI6A 3ZLUA 5A6VA 1EK1A 3I2FA 4DMHA 1UFOA 2JF0A 3CXUA 3VJMA 3WL5A 3BF7A 3F8SA 1XQWA 5ALUA 4XJVA 3HZOA 4X95A 5K5EA 4AN1A 4H0CA 4S0XA 3FAKA 4U2FA 3WWCA 2FJ0A 1BEZA 4UBLA 2HFJA 4Q82A 4ZREA 3IDAA 3TGLA 1XZHA 4MXDA 3DOIA 2EDCA 4UBKA 4KRXA 4CG1A 2OCKA 3C8DA 3C5WP 5HQ3A 5JZ9A 1ZICA 2QT9A 1QTRA 1TK3A 3QBJA 5LKAA 4CIAA 4HRXA 1AKNA 4JEIA 1VA4A 4QLOA 1XROA 1B41A 5ALNA 1A8SA 1E5TA 5BWBA 1M33A 1X70A 1RYYA 1XKTA 4EA6A 3WA7A 3WA6A 5CH3A 5JARA 2WG1A 3EQ7A 1Y37A 3GUUA 2XUIA 2WUDA 3MUOA 3BIWA 3V1NA 3FSGD 6YASA 4WY8A 1CUVA 4G9EA 4X6XA 4Y2VA 3R3YA 1L7AA 5T4EA 1MNQA 3WK4A 3MGAA 1CQWA 2IIVA 1LPBB 1WOMA 4J0CA 5A7GA 5K3EA 4YPVA 1F0NA 4K5QA 1ACJA 3FLEA 5AOBA 5K3DA 3R3UA 3G0BA 4M0FA 1IUOA 2I3ZA 5AIBA 2XUDA 1IZ8A 1GKLA 2B4KA 3WKBA 3BE8A 1A88A 5A71A 4AN0A 5KBYA 3W9UA 3OG9A 2AJDA 2RHTA 4NVRA 1CUXA 2XQIA 4H7FA 3YASA 1MPXA 1MNAA 4WFKA 2RHWA 4BP9A 3A6ZA 4H7JA 3STUA 2ZVDA 1FFDA 3DYIA 1ZOIA 2OGSA 2QJRA 4EB0A 4U2EA 5ALRA 3QMWA 4CCYB 1LNSA 4FHZA 1QO9A 3AIKA 3IUJA 3LLCA 4Q05A 2PSDA 3K2IA 2BGNA 3UUFA 2QUAA 4JYPA 3G9TA 4M0EA 5FPPA 1MAHA 2DQYA 4BC1A 1CUYA 3WZLA 4RGYA 4X7BA 3AFIA 5HF6A 4BATA 4CCWA 4X71A 5CXXA 4Z49A 3EQ8A 5HKAA 3C5VA 3ZPXA 3FYUC 3RKSA 3G0CA 3W05A 1I6WA 1JFRA 3HLKA 4F5ZA 4BP8A 1FSSA 5ALKA 2PU7A 1GGVA 1R4ZA 3I6YA 3NUZA 1DWQA 5AIAA 1QOZA 3BDVA 4IHAA 2QS9A 5AM2A 4G4JA 4GDMA 4W1SA 2OCGA 2XT0A 3O4HA 1GKKA 3C43A 4ARBA 1QZ3A 2HFKA 2WIFA 5FXMA 2XMCA 3OPMA 3STXA 2XUJA 1XZIA 1MN6A 1CUFA 4E14A 3ESBA 1JT2A 1ZGBA 4P92A 4EY5A 4GXNA 1XZEA 3C6ZA 2DHCA 3M3DA 3NGMA 4GEGA 1GQSA 4QE3A 3H2IA 4QDUA 2G63A 4BAZA 5AK4A 5K3BA 1MJ5A 5LZ8A 4WDRA 3ZI7A 1MT3A 4DTCA 1K63A 3IUMA 2XQKA 4X85A 3KDAA 4HXFB 1Q0ZA 3RLIA 4MQLA 5A7FA 4KAFA 5DNWA 5ALPA 3ED1A 1TRHA 1YAJA 2WUGA 1K8QA 3VVMA 5CT4A 1T4MA 2HHAA 3FYTA 5IKXA 1EDEA 3T4UA 4HVTA 3STTA 4B81A 4LXGA 2C4HA 5ALTA 5HFNA 4V2IA 2DHDA 5DNVA 5YASA 1PV1A 4L9AA 4IH1A 2WJ3A 3IA2A 4G5XA 1PJAA 5AKIA 2PSHA 4CG2A 5AM0A 4KRYA 5ALQA 1CUSA 5AM1A 2GYVA 4UBJA 3IVMA 5DTIA 3VDXA 4OPMA 4BCBA 4B9EA 4IO0A 1CUEA 1UOPA 5HK8A 4AO7A 4X00A 4PW0A 5I9IA 5EI5A 3VISA 3AZQA 5HF5A 1BEEA 4BRSA 1Q84A 3CN9A 4KYVA 1LPMA 2XQFA 3B5EA 4RE6A 3OOSA 4DNPA 2JBWA 5LZ5A 5DNUA 1ZI9A 2VJBA 1H23A 3WK9A 5AICA 5AO9A 4H7IA 4DM7A 4CFSA 1CRLA 2GBGA 2XUAA 4G1FA 4WFIA 2J4FA 4GWLA 3CN7A 4EHBA 3OURA 2JGFA 1DX4A 4X97A 3HI4A 5K3AA 2ACKA 2GZRA 5E4YA 2HIHA 3UMJA 2PKYX 3DS8A 3SWWA 1GT6A 4KE7A 5EHXA 5ALHA 1D07A 2XQGA 2D0DA 5AKXA 1THTA 3STYA 3FWHA 4W1RA 4X92A 2BCEA 4RPCA 5AKZA 5HF9A 3RM3A 3G9UA 3ESCA 2Y1KA 4B85A 3BJRA 4UHCA 4C87A 3R0VA 3C6XA 1HL7A 4C4ZA 1TCAA 4K6GA 3EBLA 5D3ZA 1TCCA 4LYEA 3FYUA 5KWIA 3E0XA 4FMPA 1XZLA 4AMYA 3L1IA 3I2HA 2QXTA 1N5MA 3IIIA 4QEKA 2E3JA 2PM8A 1LPSA 3AINA 1ZI8A 4BVLA 5JZSA 4ARAA 1K5PA 2JGLA 3TEJA 4FNMA 1UKAA 5DYWA 4ZI5A 5T4FA 1G42A 1C7IA 4U2DA 3Q0TA 4GBGA 3B3QA 2XLCA 3WYNA 4TVKA 1CEXA 3O4GA 5LYYA 3WK5A 2H7YA 1HDEA 5ALEA 1W1IA 3BDIA 4G8BA 4PSCA 3VKFA 4ROTA 1VA5A 4GECA 5LKRA 2OXEA 5FLKA 2WU3A 3V1MA 2B9VA 2PVSA 3QPAA 3DNMA 4W1PA 1HLGA 4RNCA 3WZMA 2ZYSA 1H2WA 5C8VA 2PSEA 4IH4A 5EIHA 3WI7A 4KE6A 4Q3LA 4XIIA 3H2KA 1FJ2A 3CCCA 1WHTA 2Y2UA 4LHEA 4J0IA 4B9AA 2XMZA 4K6HA 1N1MA 1CUHA 1AGYA 4UFOA 5HZGA 1XRNA 1CUAA 1TIBA 3ANSA 2QR5A 2O2HA 1Q83A 1VZ3A 3O0DA 4BAGA 5CTAA 2ZJ7A 1VJ5A 3KD2A 2AJ8A 3SX4A 3G7NA 2GBCA 1QGED 3S2ZA 5J3JA 2XUOA 1IVYA 1F6WA 1QE3A 3DOHA 4MYDA 4NS4A 5HF8A 3MVEA 1SOMA 2PUHA 2GYUA 1QIMA 1SCIA 2PPLA 3KWFA 3G0DA 4W1QA 1F0PA 3I28A 5A2GA 2EEPA 1RP1A 4DGQA 1XRLA 4DSZA 1CQZA 2AJCA 1YB7A 3E4DA 5C81A 3NWOA 4AX4A 1UT6A 1E66A 2JEZA 2VTVA 2W22A 3TRDA 5JATA 1K4YA 5IVIA 2WIGA 4C6HA 1CUJA 2WIKA 2WIDA 2GBFA 4LXHA 4BDTA 5FV4A 3F96A 4OU4A 3JW8A 4BTVA 5EGNA 5FKJA 5D3KA 3P2MA 4ZXFA 2BAGA 3IUQA 2RONA 2WFLA 1XKLA 4AZ0A 5ALFA 3I2GA 4TGLA 5AI4A 4B80A 5KREA 1B6GA 2Y2VA 5AI9A 1MAAA 4DLNA 4DSAA 3STWA 2B61A 3HXKA 3BF8A 4YK7A 1GPKA 1ZGCA 3WIBA 4UHFA 1G4HA 1R50A 3AZOA 3GROA 5BOVA 1DU4A 5IH7A 1XZCA 5ALYA 3WK6A 5LLSA 2DSNA 5AKLA 5JAPA 3WL6A 3PICA 1YSCA 4L3WA 1Y7HA 3WWPA 5DYTA 1BE0A 3WK7A 2LIPA 2WQZA 2WHPA 2XUHA 5CT5A 4QWWA 2BKLA 4X3CA 5AK3A 1E8NA 1DQZA 3DKKA 1WPRA 5EHZA 4X6YA 4MWSA 4QDZA 3E1GA 3ESAA 3BIXA 5C8XA 3NOXA 4Y2TA 5ALLA 2PSFA 1N8SA 1ZIYA 4ZRDA 4QZVA 3KSRA 5K3FA 1CVLA 2WUFA 1BS9A 2WKWA 5BWCA 2GYWA 2ZYRA 5JALA 2VAVA 3C45A 4DMFA 4OCZA 4KR0A 5FPQA 3I2JA 3D7RA 1LBTA 3IULA 3RARA 4J0GA 1ZJ5A 1MU0A 2Y6UA 3F97A 4N8DA 3R3WA 3STVA 2PUJA 1VOTA 3QZUA 3WKAA 4WDQA 1USWA 5DTJA 4UBOA 3R3ZA 3HABA 4U2CA 3R40A 2HADA 4K2AA 1QIFA 1EXWA 2O7VA 2VF2A 1SC9A 3W06A 1CFJA 1E89A 4JH0A 4PF1A 5CRIA 1VE6A 1SFRA 3HACA 3H04A 3QPDA 5JD6A 5HQ3B 2ZYIA 1GPNA 1IUNA 5AH0A 3R3VA 3FBWA 4Y2SA 2VQ6A 1G66A 2WTMA 3PFBA 2XUGA 4BDSA 5ALVA 5DLPA 5ALOA 3G9XA 4BVKA 1ZJ4A 1BROA 1FFAA 4X6UA 3AIOA 4N5HX 1HPLA 3U1TA 2ZYHA 1DTEA 3EF3A 2CMFA 2WU4A 2EDAA 4EUSA 4AXBA 1U4NA 4CIBA 3FLAA 4MEAA 5A62A 1TCBA 1LPAB 2XUFA 4H7DA 1X2BA 1WB6A 5C8ZA 4J7AA 4WY5A 2QKYA 4OUKX 3QITA 5LZ7A 3A2MA 3BJMA 1UK9A 4EZIA 4OB8A 1BRTA 1O6FA 4WCVA 2HU8A 2XMDA 3H19A 1XZMA 2J3QA 3F98A 1UK8A 4P9NA 2VJCA 2YXPX 5JYCA 1N5RA 2QTBA 5LP1A 4C4YA 1ORVA 3EIOA 4HAIA 3RK4A 3LIIA 1ZD5A 4FLEA 5EIEA 4DNOA 4UHDA 4BCDA 4Y2UA 5AK5A 2V96A 4N5IX 4OD0A 3K6KA 1MO2A 3DKRA 4HZGA 3AILA 4J0KA 2ZSIA 4W63A 2OCLA 1JJBA 1CUBA 3PFCA 2ZJ6A 1H2YA 3O9MA 1R3DA 4B82A 2V98A 3HSSA 2CZQA 4DNQA 2OQIA 4L0CA 1EHYA 2Z8XA 2C5GA 1LPNA 3QH4A 3GA7A 2DHEA 5CBKA 3D5EA 1X2EA 4J0DA 5KWJA 3WYDA 2FUKA 3FOBA 4ITVA 2OAGA 4UBIA 4UUQA 3D4LA 2WG2A 3ICWA 1XZAA 1EA5A 3VVLA 2C5FA 4UHBA 1IUPA 3X3HA 4DMKA 1KU6A 1L7RA 4AZ3A 3O4IA 4JYMA 2OGTA 4KAAA 5AI5A 5CH8A 5AM4A 2HL6A 5HK9A 1J06A 1P0PA 2PX6A 1R9MA 3L1HA 1ETHA 5CT9A 4IH9A 3I1IA 3PI6A 1EVQA 4KE9A 4JNCA 4Q34A 1DX6A 2D5LA 5A7HA 1CUCA 5AOCA 5C7YA 2XB6A 2FX5A 3I1YA 3K9BA 2H7CA 2JGKA 3DL7A 1A8QA 4UFPA 4OSEA 2HA4A 1QIKA 1XLVA 5ESRA 1TKRA 4X94A 4Y2RA 5I7UA 1LPPA 5CT6A 1QJ4A 1VXOA 4B0PA 5SYNA 4QWMA 4HS9A 3ZLTA 2UZ0A 2C0PA 5CH5A 2BUBA 2XMRA 2WILA 5ALWA 3SK0A 1U8EA 4UHHA 4LXIA 1EX9A 1CIJA 4QNNA 3H17A 4QDTA 2FJPA 2HA0A 2RIPA 1YR2A 4EY4A 1LBSA 4UHEA 3WWDA 3Q8WA 4BE4A 3I2IA 2AJLI 3I6MA 1R9NA 5D7BA 3DYVA 4OB6A 5AKJA 4NZZA 3A70A 4O08A 4A5SA 4N8SA 5EHQA 1AQLA 1CUIA 2QRUA 3QYJA 1UOOA 5FDFA 3V48A 1EINA 3G0GA 2XLBA 4BZWA 2WHRA 3GFFA 3KOOA 2W6CX 4C4XA 1JI3A 1J1IA 4Y2JA 2Z5GA 4C89A 4AMZA 4LKOA 4FOLA 4RE5A 1NU6A 3WL8A 1JMYA 5CW2A 2J3DA 3GBSA 4BAUA 1XRMA 3QVMA 1J07A 5T4BA 1CV2A 4DYHA 3GZJA 1XRQA 3IUNA 3WJ2A 4PO3X 3KXPA 5K3CA 4I19A 2VSQA 2H1IA 1S8OA 2CKMA 4TPKA 1ODSA 1KEZA 1AMNA 1P0QA 3R3XA 4B0OA 1XLUA 3PUHA 4FFVA 3VJKA 2CUTA 5ALZA 3AZPA 3WQHA 1GXSA 3C87A 5JANA 2ECFA 4G4GA 1L7QA 2DR0A 1C4XA 3H2HA 3HJUA 3M83A 1UKCA 3I2KA 4XX1A 3G02A 2WM2A 4WFJA 5JIBA 5FOQA 4PSDA 4FLFA 2BGRA 2XMQA 1F8UA 5JAHA 4F0JA 1LZLA 2HA3A 1LZKA 5AKGA 2YH2A 2I3DA 3N2ZB 1AC5A 3E3AA 4E46A 1CUDA 3FCYA 2HDWA 4B6GA 3V1KA 4BB0A 2XQJA 1XLWA 2PL5A 5SYMA 4YX9A 2VATA 4KJXA 2DCMA 1QONA 4X91A 2O7RA 1U65A 1T2NA 3DJYA 4BTLA 4FNGA 3DQZA 2XDWA 1H2XA 1XRPA 1UZAA 4Y2YA 5IVHA 3HRHA 1EH5A 1EB8A 1J2EA 4KEAA 2HRQA 4B84A 3FYUB 4X93A 1XFDA 5BV7A 3VJLA 1ZD3A 3PDCA 2VEOA 4H7KA 4CCYA 3H1BA 3C6BA 2XMGA 4GI1A 2O2IA 2HA5A 1QFMA 4Y2PA 1MX1A 3JYHA 2C0QA 2WTNA 2I78A 1YAHA 4FFWA 1JKMA 2WJ4A 3ICVA 5AKHA 3QPCA 5D6OA 1SCQA 4ETWA 1W52X 4LIPD 1PFQA 5FP0A 1IZ7A 3WWOA 1GQRA 3LP5A 5E4JA 1ODTC 3D59A 4Y2XA 2ONCA 1U2EA 1CLEA 4OB7A 2AJBA 3C6YA 2Q0XA 3FNBA 3M81A 3D2CA 3O4JA 5JD4A 1W4LA 3ZLVA 1CUGA 2PU5A 2V97A 3HC7A 2PSJA 2HM7A 1UK7A 3FSGA 1QO7A 4AQDA 3VXKA 2VAXA 1UKBA 2NW6A 4E15A 1EI9A 5FRDA 4I3FA 5DYYA 3A2NA 4GLBA 4C01A 4XVCA 5ALJA 4MEBA 5ISMA 5AHXA 4Y9SA 1HBJA 1CUUA 1QFSA 5E2IA 3ILSA 4FBMA 1CPYA 4ZWNA 2ORYA 1GPLA 1XQYA 1XRRA 3CCBA 3PUIA 1P0MA 1VKHA 3O95A 3FVRA 3L1JA 4KAJA 4J3JA 2P8SA 4PV7A 2QJWA 1YCDA 4FKBA 2I03A 2JEYA 1ODCA 2OLEA 4NMWA 2ZJFA 2K2QB 4PNZA 3PF8A 7YASA 3WKCA 4MJ3A 1WB5A 1WM1A 1ZIXA 1UK6A 5JAUA 3G9ZA 2CB9A 2ES4A 1UWCA 1E8DA 1TAHA 1NU8A 4DMCA 3DDUA 4GW3A 2IX9A 1CUWA 1H2ZA 2WSLA 2OQVA 1BN6A 2QM0A 2J4CA 4HXGA 1ISPA 2BUCA 1DT3A 5AKYA 1AX9A 5JZBA 4MYSA 2Z8ZA 2XUPA 1JJIA 4HTAA 2XMBA 1KU0A 1W76A 4Q3OA 4BCCA 1QIHA 1AUOA 4UPDA 3H0CA 4AB1A 3S8YA 2VJAA 3WL7A 1DT5A 4XWGA 3FLBA 3QMVA 4QLAA 2G5TA 4KE8A 5E4TA 5CMLA 3D2AA 3IURA 1EK2A 2WFLB 3C70A 4X90A 2CBGA 3D3NA 1C7JA 1DINA 5JAOA 5JADA 2JGEA 2HRRA 4OYYA 5AJHA 1ORWA 1ACLA 1VZ2A 5AM5A 4F21A 2HU5A 2OCIA 1W6RA 2QUBA 2VJDA 3W9BA 1UXOA 2B20A 2XE4A 3G0IA 4L72A 1R1DA 5HFAA 2OAEA 1UOQA 1BCRA 2WG0A 3PE6A 1BN7A 3W2TA 5AKEA 4U2BA 3WK8A 3A2LA 4J03A 1G5FA 5DWDA
chains in the Genus database with same CATH superfamily
2J6CA 1GQQA 4ZVNA 1KOGA 4GUAA 4F7WA 2FCRA 4J0QA 3TK1A 2IVZA 4HJRA 5AVUA 5K8LA 1LGYA 1SHJA 2REXB 2VRBA 3BPSA 4G0OA 1XKQA 1KC3A 2FOLA 3N8IA 4X5OA 1FX1A 3AGQA 2NXJA 3WLEA 1I32A 1SXIA 2F1HA 4JBLA 4M99A 4MQ5A 5LD2C 1JPVA 1YI1A 2FMKA 3FR7A 4UU7A 3TUZC 1Y3FE 7REQA 1D2NA 5K2MA 2VP0A 1T8TA 2DLDA 2F00A 1GAEO 1BQ4A 2WAXA 3CW8X 1KH1A 2DBQA 2B1GA 3JQCA 3BB1A 5EXDA 2JFHA 3L8CA 4GI5A 1WDWB 4MS1B 3OCUA 5ESDA 2YDXA 3HE3A 4PO8A 3ZE2B 3ZCQA 2Y1OA 3AKZA 1D4AA 4CDNA 4CKBB 1YFLA 1BE6A 2C2HA 2ENUA 1T4CB 4Y1GA 4KPUB 3JQAB 1THGA 1YQQA 5AI6A 2R97A 4RUKA 1D1PA 4DARA 4DC1A 2H7XA 4M0MA 2BH9A 3IAM1 4ZAVA 3T7CA 2WFAA 4RIHA 1Y98A 1CG6A 1S2MA 2M9MA 4RZ2A 1PJ4A 2W2TA 3KR2A 1MX5A 2ZWAA 3IBTA 2ZTMA 3O1LA 3UWMA 3PR1A 1EZ4A 3UXHA 1C1YA 2QLMA 1ISHA 1O1YA 1QRAA 1FRFS 1XMJA 2ZCUA 1KBOA 2ZREA 3ABQB 3ANTA 3E9NA 4AN4A 1BMTA 2PUTA 3DM9B 1P0FA 3CR8A 4CT0A 1D2RA 3D0RA 1RI4A 4KX3A 3ONEA 4H18A 1SXPA 2P2DA 3O94A 1QHHB 3FA2A 4FLMA 5DJ5A 5AW8A 4WINA 2AG5A 2ID7A 2Z3ZA 3A04A 3CO0S 3I0MA 1EIWA 1HLPA 2FX2A 1NX9A 2X4GA 3MWKA 4PG6A 5DTEA 3ICPA 3M8KA 4L1KA 1PSZA 3DE5X 3HHPA 4A16A 4C0QC 3DMDA 1AHPA 4IQ0A 2PO5A 1GUAA 4U6NA 5CM9C 1E4EA 4AJIA 2CNBA 5JECA 1YR9A 2QI9F 3GLHE 1BZYA 2JGJA 2R5NA 3HA5A 1P2BA 3DEAA 2JI4A 2WIJA 3DMNA 5K05A 1GTL1 3NTLA 2X8BA 5FBWB 4H77A 1CQJA 2VH2A 1NQ5A 1SVUA 4HWOA 2K7ZA 4CU2A 4PX9A 4UU1A 2ZSHA 1DBSA 4GLOA 3WB1A 4N0MA 4QYWA 1FNSA 3M1LA 1JHAA 3B1XA 4E5KA 3HO8A 1C9MA 3U81A 1U1CA 3A1SA 1DUVG 3DVAB 4W5HA 5L51A 4OQLA 2IVFA 3THWA 3HDYA 2QTTA 2QVBA 3GB9A 5GAJA 4U7TB 5AJUA 1AY0A 4QKQA 1DJQA 1VJGA 1KMHA 4R6WA 2PX0A 4JUIA 1N9ZA 1EVKA 4MAAA 1N2HA 1MX9A 1MTZA 2I6TA 1TQDA 1MVNA 3MTAA 1E64A 4K8RB 1XTIA 4J0JA 4TX1A 4UNNA 4BHTA 3I01M 3A9VA 2JGMA 4C03A 1YRYE 3P4YA 4OHFA 5AK6A 1JJVA 5J2UF 1A9PA 3KZ1E 4KXYA 1V7ZA 3FHLA 1AZWA 1VJCA 1OA1A 1B0AA 1BMFA 3ENQA 2HBYA 4J6FA 4DCSA 4BQFA 3ZHZA 1X7DA 3IDFA 4JXKA 1S2OA 4GBMA 1T1GA 3VU1A 3HBAA 1WBBA 1O3YA 9MHTA 5GINE 3PNMA 5HRCA 1MIOB 2RHRA 5LLTA 5DASA 1P4RA 1P9LA 3UAWA 1RI3A 3LA8A 1QF7A 2HPHA 2C2KA 3ENNA 3AF1A 5KYUA 5EE1A 4LBWA 3WRXA 4R3WA 3EXG1 1GP2A 3WKEA 1H1DA 1UKYA 3HKBB 3GQBA 2QN6A 3ZY5A 1GTVA 2VDWA 1X38A 3FR8A 3H84A 4IXDA 3ENKA 5K4HA 4Z5XA 5KNDH 3KSAC 2P9TA 3CPHA 3G3EA 1PWXA 4ZJUA 4TUYF 4EBBA 3IE2A 2Y1EA 4KR9A 3ASVA 4ZT2A 4JBWA 1K6EA 3B52X 1WVMA 3M0EA 3AR7A 2G76A 2VRWA 4W7HA 1ZL2A 2C5SA 2DOKA 1LSUA 121PA 3E81A 3NAQA 4KQKA 2D2IA 4L4UA 3C7AA 3D8HA 3R5HA 1DWPA 4BQNA 2F3PA 3BZBA 3F74A 3N3AC 3R20A 4NEGA 4H7EA 4QUKA 4TPKA 3KVOA 5IDQA 2VTBB 3HKEA 2WSSD 1G1AA 1O94A 2NTJA 3EEFA 1T43A 4GZ3A 1APBA 1Y8QB 2ZPTX 2GZSA 1ZD1A 3R24A 4MUBA 2J1LA 4FE4A 4GVPA 4WBNB 4MMXB 3OE7D 4XSHA 3SQMA 1EB9A 1EJ6A 1W49A 1GSAA 2FW0A 3B6KA 4HEA1 4PU0A 5EJMA 2JLCA 4U63A 3UAZA 4TLBA 3WHPA 2ZIVB 4AYWA 1EUCB 1QLWA 1JR4A 4BP1A 1D7AA 3U19A 2R1ZA 2AOTB 3QX8A 1A69A 2HDNB 3GI1A 1LTHR 3K73O 3OWXA 2I55A 3GF4A 1RPNA 2E5LB 1AA9A 1EGMB 4R1UA 2P41A 1US8B 1VBMA 3G79A 2RCNA 3QVWA 3ZS9A 1ZUNA 4BLSA 1FBNA 4H6XA 3RUAA 4RZSA 1TMKA 4Q1FA 3MUNA 2JFZA 4F3RA 3K2BA 1J21A 5KJ6A 4C6TA 2H18A 2WPNA 1A7UA 3N59A 1Z9BA 2BFWA 4POOA 7GPBA 3CVVA 1CT9A 1U28A 1JU4A 1OWPA 3R41A 3WIOA 4DADA 4FONA 5THXA 1PQ4A 1V8DA 4Q6BA 3TE7A 2KW5A 1WB9A 2JLBA 1TYEB 3DV9A 3DLTA 3AHFA 1VMKA 2J9GA 5KSOA 3QFSA 3R1IA 2P79A 3EMVA 3N2EA 1P1HA 4BXOA 1GUZA 1VMDA 2FG6C 3MM4A 3WHIA 1YB6A 3PNVA 4HDKA 5J4LA 2XGOA 4LNUA 5F76A 1RHQA 3UG6A 5AVSA 2QMQA 1Q7CA 3OM8A 5AI0A 4B40A 5HWSA 4YXWA 3ZWBA 1DJNA 1QTIA 2H4JA 4B43A 1RHRA 2BEVB 1F6DA 2YUTA 2FSUA 3MT7A 5HR5A 2VSXA 2BR5A 3MUEA 1AN0A 3WWEA 4MP6A 3O83A 5C3MA 1FMFA 1J22A 2IYZA 2JJ8A 3AOEC 3EA0A 1YZNA 2XUKA 4WXPA 3U3XA 3F1KA 1ZGZA 3EUEA 4RXTA 4J9UE 4QYIB 5JXIA 5ALGA 5B1IA 1RW4A 1R6DA 3JQ8B 4ZT4A 1T1JA 3BWXA 1XDDA 3BIFA 4R1PA 1NR1A 3W04A 1LTKA 1KMCA 2PBLA 2PH1A 3BMOA 3SI7A 3RYCA 3DMRA 2PFSA 3EODA 5JHHB 1BW9A 1XZGA 3M6AA 3SF0A 1VSVA 3VOTA 1JU3A 3KQQA 2NAFA 5K0JA 4HBGA 1HYQA 1RRGA 1U6KA 3ZE7A 5LDDC 2TECE 2IHNA 4FMCB 4L7VA 3KPVA 4QM6A 1HY3A 1AXRA 1AHNA 3N07A 3GLQA 5ALDA 2PL3A 3BXPA 3TQSA 5FPHA 4BC0A 3RSHA 1VI2A 1U7XA 4DLZA 4MIEA 4P53A 1LVHA 3DOOA 3OCWA 2H3HA 4YRAA 1YDEA 1Z5PA 5KVAA 3BE6A 3KZMA 4MW7A 3U44B 4LHYA 3H87A 1LLFA 2IXBA 2J9FA 4XIFA 5DBIA 5CG2A 4AZVA 2PK3A 1SWWA 3IQIX 3DLAA 4HGPA 2W6ID 2PKRA 3C8HA 5E1DA 1G64A 3ECAA 5EE9A 2JG3A 1HA3A 4DWOA 4PAWA 1W4BA 1KI1A 1T24A 2AX4A 2HUNA 2C96A 3M4YA 4P4SB 4FSXA 5CP8A 1N2GA 2EKPA 2O4UX 2R11A 2W2OA 3IDOA 1EAMA 2DR3A 3KPJA 3MCUA 5AKKA 5BP7A 1S7GA 2BFFA 1NW6A 2FB9A 4GEKA 4K9DA 4BRZA 1O5TA 3DO8A 1FYWA 5K20A 1SCKA 2BBSA 4ZJZA 5LU9A 1E0JA 3AY7A 2WM9B 4GRAA 3V4FA 3SP1A 3T5TA 3ZZ0A 1M2VA 2YR0A 2CEKA 4B3IA 4CQJA 5F4ZA 4LK3A 3A1FA 2MTBA 4Z9FA 3VDRA 3DL2A 2P30A 3A6PC 1NSYA 1FFEA 5L95A 1C9JA 1BU8A 2PKQP 2R4TA 3QU9A 3RVDA 4CLDA 3LHFA 3KCNA 2FQYA 4X6LA 4Y1RA 4ZV7A 5JJLA 4CL2A 1YASA 2VP6A 3N86A 2Q2NA 5EQTA 3RBZA 2IEGA 1TTTA 1NUUA 2V7BA 5H9VA 1P7VA 2EP5A 1VGRA 3NBQA 2N1MA 3GJRA 4BZQA 5E8RA 2CJPA 4PYKA 4OL9A 1RXIA 5DGTA 4ZEXA 4Z7JA 3I09A 3O8LA 1HZZA 4ZV9A 3VOAA 3P9SA 4Z4QA 1TT7A 3UGTA 2DBZA 4L6CA 5AM3A 3SR3A 1J0AA 5KJFA 4U6SA 3MHTA 3SXUB 4DY4A 8MHTA 4ZQFA 3U5TA 3MCWA 4NCKA 4ZYXA 2G9VA 5TSDA 1DO8A 1HMYA 4KSBA 3HUUA 1Y7IA 1DAKA 3SKXA 1W4AA 1YHYA 1Y5LA 2VYFA 1PJ8A 2GM3A 1O96B 3DZBA 5FWYB 4E2FA 1SG0A 5EJEA 1ZNWA 5LA6B 4ANFA 1I2ZA 1UBTS 3SYMA 3S7TA 2AQIA 3QI2A 3HCAA 3BEOA 3GJ5A 2OKCA 2YWRA 3M70A 3OMXA 3LWZA 1OU0A 3LWBA 2QZZA 3L43A 4KPGA 4O25A 1JH9A 4TS9A 3IMCA 1MHTA 4IKPA 5HJ2A 3NRCA 3TAXA 3TNYA 3PX7A 4ND8A 3F3YA 1ZSYA 2R1VA 2UZAA 2BFMA 4MKXA 1Q3TA 1VIMA 1S9DA 1PUIA 1U1FA 1E8MA 2Y92A 2ZAIA 3EDQA 3IHKA 4FQ5A 4J29A 2RC6A 3FUVA 5ERYA 1GCAA 1OCEA 1XGKA 2YHIA 4WJLA 3W5BA 3RAEC 1VLQA 2NMVA 2OFFA 3DWEX 3QM1A 4EF6A 1G63A 4LQCA 3TGWA 4Q37A 3HFGA 1QV7A 2O2GA 2C8JA 4PXAA 2Q6LA 1F8GA 4YASA 1TT5B 5HDBB 3V4PB 2OBMA 3IP7A 1RXCA 3PE3A 4K6MA 4J07A 1Y6ZA 4HLNA 5DMXA 4P7GA 2BN4A 3QVXA 1U3UA 5I4KA 5KYXB 2VR1A 4M6WB 3CZMA 3L79A 1VIVA 1VKJA 5HGJA 4G0VA 1NMXA 3BCSA 2CDCA 2H48A 3C1TA 2Z3VA 5JMOA 3RRFA 1TAQA 2V4UA 3IUEA 1UKEA 1H4VB 2O3UA 1QIDA 2GLUA 3T0IA 4RK6A 1T5SA 4GAEA 4EY8A 1YNSA 2BFEA 3CVOA 1IEWA 5CXQA 1KI7A 2G4LA 5ERGB 3ANYB 5HIMA 3WVNA 1KZ1A 1GL9B 3H2ZA 4IF6A 1TQ4A 2AFIA 4OEHA 2AV6A 5D6NA 1KE1A 3IP6A 2PX4A 1Y1KE 1H9CA 4NOLA 4CTNA 4GHWA 3DD5A 4Z54A 3OIFA 2ZVPX 2HA6A 1PX2A 4KQ9A 3RFTA 3ZWQA 2JVJA 1OBOA 2FWRA 3RRMA 1WCYA 2PWPA 1G55A 1F8YA 2QOEA 2VZLA 3N0TA 1ZI6A 4N0DA 3HJBA 2CJYA 3N2IA 4MB2A 3UENA 3ZU5A 4XCVA 3H75A 4BEVA 5BYAA 2YRFA 1DKQA 4MUNA 1TF7A 2PMFA 4KIFA 3M9WA 3OJ0A 3GCZA 4KH1A 2QAGA 4P2GA 1OFUX 1PFYA 2Z95A 1G60A 1EK1A 1LI5A 2X3FA 3I2FA 1KC1A 4LWOA 2C04A 4MB6A 1L7DA 4B3GA 2PRYA 4HDQB 2IYRA 5ES4B 3PFGA 1HT1E 1RIFA 3VSAA 2YJ6A 4EO9A 1NIPA 4PZEA 3BF7A 1XELA 1Q0HA 4NU6A 2JVKA 2NXWA 1USUA 3D3WB 1NVTA 4XJVA 4WT7A 1UWLA 4RMHA 5SZJA 4CFYA 1ZM2A 4P4NA 4NMXB 1U3GA 1HM5A 2V1XA 1DAMA 5P8WA 1Q0TA 1B6RA 4H0CA 3KEQA 4WUVA 3IL2A 1LDNA 1CJUC 3HWRA 5K1ZA 3R8CA 3FMIA 3RIYA 1BTOA 4PN7A 1W59A 1FRQA 2HHHB 4MJ7A 3WWCA 4BNXA 4ZYZA 4JMPA 2ZCVA 3VH3A 1SIUA 1TF5A 3VDNB 2WU0A 5HFJA 1I2AA 1L1FA 1REQA 5GZ3A 4B7AA 1C14A 1TYDE 2YY5A 4DR6B 1QP4A 4MXDA 1LX6A 4B6SA 3CXRA 4UBKA 4YJKA 3JYQA 5HBGA 1Q12A 4CG1A 3LTNC 3C8DA 2FZCA 5DBEX 1I5OA 4KQEA 4CF6A 5HQ3A 5HZKA 4B3RB 3SJBA 3TD2A 1XDBA 1ZICA 2O3RA 3AVPA 1QTRA 1JHMA 1DCFA 3KE9A 1C0PA 1E3LA 5T57A 4NYMQ 3VHXB 3QBJA 1FMCA 4BNJA 2ZE8A 2GCPA 3LF2A 2PKEA 4UVIA 3SX2A 5AUPB 4TSRA 2XDAA 1AKNA 3V2HA 2VDVE 1X7GA 1QR2A 3VMFA 4QDKA 2ODNA 4QLOA 5KNBA 3EGIA 2J31A 2E4UA 3LYUA 4NDAA 2FUEA 2EJUA 4Q39A 3L8HA 3RUIA 5L4LA 4YP5A 4FDVA 1YRQA 5BN4B 1GZ3A 4FKMA 2UVPB 4ZDKA 2XTAA 2V9CA 3RRJA 1PNRA 3TSWA 2DY1A 2HF8A 2P3SA 4FZRA 421PA 2DFNA 2HHLA 1HFJA 3E53A 3PC8C 4KR7A 4RKQA 2WWWA 1B0UA 2QMHA 5J5VA 2ZXUA 4WBNF 2D1TA 2PANA 5TEWA 5JARA 4OFZA 1X9HA 2WG1A 1R6UA 3GAFA 2WJAA 3EQ7A 3JQBC 1MG5A 4TRJA 1GPYA 2XBLA 2XUIA 3F2VA 3ESXA 2PUGA 4JROA 1E2UA 2WUDA 4YROA 5LYJB 4LYAA 4CQLB 4D1YA 4G2TA 4WCFA 3VC2A 3BIWA 3IUBA 1C0LA 3E35A 4H3HB 2G8LA 2ISQA 2Y1CA 3DL0A 4D96A 1VCNA 2ZJ2A 4RD3A 4B48A 4EB3A 4EYEA 4MYHA 3BULA 1QV9A 4L74A 4N6OA 6YASA 3FB4A 2OO7A 4KBYA 2JGAA 1PV2A 2ATIA 4Y2VA 3R3YA 4F96A 4FT4A 3DD1A 2VNIA 3LPNA 3A6LA 1DFHA 3LOUA 3MJEA 3H1EA 2HXYA 4JUCA 2F1IA 1U8XX 4DPLA 4DRZA 2J9YB 4I2NA 2CNOA 3AVUA 4NBRA 4A8TA 1PL8A 1DIOB 2ZSDA 3GN2A 2FFJA 3QXCA 4J0CA 4RZ3A 4J7CA 3DDZX 3F5MA 1QH8B 3NDRA 5CAEB 1F0NA 2RB5A 4K5QA 4HYYA 3T3NA 1IIRA 1O9HA 1C0EA 5AOBA 4IMPA 4C22A 4F97A 1PT5A 4GX0A 5K3DA 2AN9A 3IIKA 1JSZA 4OP3A 3GGGA 3EPPA 1GTJ1 4RACA 1NBME 5TPZD 3S6JA 5C8YB 1I80A 2B1RA 3KJQA 3Q15C 2RJOA 1IC6A 1ZK1A 2V7GA 5H0IA 1H6BA 4H0NA 2XBUA 3A8TA 3IPXA 4ZRMA 3JQQA 5J1TB 2XUZA 3H4VA 1S4MA 2QGZA 1QX4A 4ECEA 3MT0A 3WKBA 1RNLA 3TCXB 3NNSA 2ZT5A 2BEWB 3LLMA 4B33A 4QQRA 4LV8B 4GKKB 5KBYA 2B7BA 1L9XA 3W9UA 4PIMA 3U7RA 1SBZA 1M1YA 2Q0SA 1M8PA 1CUXA 1PT6A 2P67A 1WP4A 2XRYA 2ZIUB 3AUJB 3AUUA 4JVNA 3YASA 2RHWA 4FMCF 5M2QA 2BCJQ 3A6ZA 3IB6A 3U4CA 1G18A 2IV7A 3VH1A 1FFDA 4KDEA 4NJEA 2R8PA 1AF4A 4EATA 4WH0A 2LD4A 1DJOA 2Q9AA 1KQGA 1EVYA 1TZKA 2JGNA 1L1EA 3O1IC 4G0WA 3I92A 3GRUA 2QMEA 4WERA 5FI5A 4CCYB 3GLGE 4F5EA 3RYTC 4JOQA 1GZDA 3IE1A 1DPFA 3SM9A 4QOEA 1ZK0A 2G6BA 4YUZA 1GPDG 4Y9TA 4DQKA 4DUYB 4CN8A 3ZDCA 4MW1A 4YRQA 3LO5A 1JAYA 4P3NA 1YONA 2EKLA 3O2SB 4M9ZA 4WZBB 4NC9A 2Z04A 2D0PB 2YMMA 3L6EA 5KB3A 1PWYE 4YIKA 1V43A 3C15C 4ZDWA 4ER6A 2C29D 4BFZA 4ZAFA 4CM8A 2P9GA 4JT4A 4MWCA 2VT3A 3TPCA 3ZXYA 3TLZA 4FDUA 2OFOA 1FXWF 2H1RA 5A3JA 1Z4IA 3GGPA 4R81A 5DPMA 1JHVA 1CUYA 1TDJA 1YULA 4UMDA 2F48A 4RGYA 4L78A 4LCEA 3QU2A 4X7BA 1K97A 3RF6A 4J4TA 4H7PA 1W44A 4QGAA 4YCAA 3SEQA 1R0SA 2JFPA 3R9WA 1E7SA 5G0UA 3P0IA 1JNYA 3SYNA 5BSEA 3JU3A 3HQ4O 2I29A 2IZOA 4IOLA 3VR1A 4DREA 4TMKA 3VAYA 5IANA 3EQ8A 3DULA 1J8FA 2VRNA 2ORWA 4MULA 4H16A 3W9SA 3FYUC 2R2AA 5CEJA 4AFNA 4RS4A 4RTKA 3HCFA 3I83A 4D9KA 4XYBA 2F8LA 2F8MA 4BVEA 2CFOA 3ZQ6A 1V8FA 1JFRA 4YREA 1G5HA 2OK8A 3IFSA 3L8DA 4LRQA 5LQCA 4MCIA 2O2ZA 5FNVF 1KI6A 2I4RA 3L5OA 4RVOA 5T6MA 5GV7A 1V7QA 2XKKA 4JI4B 5LJLA 1FDOA 3NUZA 4TKZA 1DWQA 2V59A 4GSLA 2QI9C 1QOZA 2FEMA 4LZZA 1Z16A 5CYOA 3MCVA 4LDZA 3V2UA 2XJ9A 4TXNA 5CGZA 1H9BA 2QY6A 1KBQA 4I4TB 4UTNA 2PTGA 1K2WA 2QS9A 2FVYA 3L7IA 4QJIA 4IPTA 4YJHA 1BX3A 3P2YA 3VR4D 5AM2A 2I6QA 4GDMA 4W1SA 5BSUA 2VS1A 4DAEA 1KSGA 5CVJA 2VQSA 4Y8VA 3C43A 5I4BA 5GY7A 5LA6F 1VHJA 3SJCA 4MR7A 1KQNA 2NYAA 1KY5A 3ZE0B 4U2KA 1IZZA 1W96A 3DMTC 4RIGA 2Y71A 1BS2A 1FY2A 2RMKA 1WU7A 1X0XA 3UMGA 3F8WA 4WBSA 4KQGA 4P0QB 3K15A 4O8ZA 2NUAA 13PKA 1W5EA 1ESMA 2X4IA 2YMPA 5FXMA 1N4DA 1YIOA 5TMEA 3A3PA 1XDWA 2Q3BA 3USCS 2A9FA 1EQ2A 5FWXA 3L6OO 5FPKA 3I42A 3NIBA 1XZIA 1MN6A 4CIWA 1C29B 1P5RA 4KLZA 2A2ZA 1VECA 3TF5A 4L73A 2GN6A 2QN2A 3ESBA 4P3XA 4D7AA 2OGUA 4RY2A 4OJKA 4O5OA 1MDFA 3P9NA 4R6XA 1TM5E 3PENA 2BONA 1A96A 1SU4A 3LCMA 3ZBQA 1QHEA 1EQAA 4MRMA 1P39A 5B30A 3K8QA 3RVJA 1QQAA 3GY0A 4TSKA 2WF7A 5JV5A 2B2XA 2DHCA 4XYLA 1GYPA 3NGMA 3PFIA 4R8VA 4Y6RA 1DBPA 3KQLA 1WXEA 4P3KA 4F9GA 5AW3A 4OHWA 3OPVA 2GK4A 4FS8A 4EMSA 3AR3A 3PGA1 3NEAA 3LBFA 3NM4A 3R76A 3DLBA 3H2IA 3PLAE 1ID8A 1ZLYA 2W2VA 2PXAA 1OZHA 4GNRA 3HYNA 3OMWA 4JU9A 3HR7A 1I3LA 3BJEA 3E3OA 3QUTA 1SC4A 1N5IA 3NGLA 4PLGA 2X5JO 3EZLA 4D3XA 2A33A 1YFJA 5IC6A 3IUMA 2HJWA 1KETA 4G8JA 2QBYB 4H59A 5IKEA 1FUKA 2GVDC 3EXAA 3L92A 4GZ6A 3K0EA 4RV9A 2C7PA 1MEJA 3RU3A 3RLIA 2J33A 4M9SA 4X20A 3UJ3X 4QBIA 4O2BA 5E7JA 4JB2A 3E9ZA 3VU8A 4PLYA 4UUAA 1DC3A 1N78A 1RHMA 4MQLA 3WOHA 3OPXA 3CR3C 4CUKA 1Z7BA 2HWXA 4YAJA 2FPIB 2XWQA 1KMNA 3VKUA 2VUHB 4MDFA 3IP3A 4N0PA 4EYQA 1K8QA 1CYEA 1U31A 2ZROA 3DBLA 1D8AA 3V7WA 5AVTA 2HIAA 3FYTA 5J2TB 1GVHA 3I9LA 2AHRA 3ZEAA 1CIVA 4CEHA 2YW9A 1EDEA 2E4VA 1YBVA 1ZIOA 3S8EA 2H29A 2AZDA 2CEAA 3G2IA 1O58A 3UJAA 4S12A 1P3JA 4R16A 4QGFA 5DM2A 1WF6A 5I4IA 5LP6F 4IR7A 2PGIA 4TTRA 1NKTA 2YY6A 2KBEA 4F38A 3O26A 4TKVB 2M6KA 1B6TA 4A8JB 2ODEA 4QHTA 4EKNB 3IXLA 1PV1A 3HGMA 1ENPA 4L9AA 4XGRA 4RJTA 1U2TA 2P2GA 1IAVA 4WE3A 3CRRA 5HVNA 4FFSA 4HQOA 2X0EA 3RVQA 3H1TA 4TTTS 4EW6A 2CLMB 4UAGA 1PEYA 2K2WA 2PUWA 4HLDA 5CLHA 2I34A 4XTRA 4DDHA 1YF3A 1VRCA 3TQCA 4ZZ1A 5FX2A 4CG2A 4EA8A 2FRDA 3QJYA 4FU0A 5AM0A 1F17A 4DJDC 4ISCA 2V0GA 5ALQA 3PTAA 4WASA 4XEUA 1M5RA 2XZTA 3IJ5A 3OUUA 2X6TA 3KO8A 3BXXA 4MVJP 2DFLA 2FPOA 2OY0A 1FW6A 1R8XA 3OY2A 4KBFA 3GHHA 5E9JA 5L40A 4UBJA 2DPHA 3S2SA 1EE9A 1GWNA 3W4KA 1NW7A 1TIKA 3E18A 3NOQA 5FTNA 2VTEA 1H0RA 3HKDB 4AO7A 2W0MA 3AU8A 3GRYA 4Q9KA 5JNSA 2VYVA 1B1AA 2H7VA 1SOUA 3HLYA 3LBNA 4JIMA 3VISA 3ZWAA 1B76A 2A9OA 3AXTA 5DH9A 3K6SA 4EMUA 4QSMA 1BMFD 1X7ZB 3BJIC 2CFRA 3G5TA 5IASA 4URWR 5BN5B 5KVCA 4WZAB 1Z5WA 4ZO4A 1EP9A 3MWDB 2KBFA 1NURA 2ERXA 3AEKA 3AR6A 2PGJA 3EF1A 1BMQA 4MRRA 4HSEA 3CU5A 3K1ZA 2AQKA 2P40A 3MOGA 4JB0A 4PLTA 3RTEA 1HSOA 1HDGO 3I5UA 3MMNA 1T4BA 2C00A 1YJCA 2XQFA 4MR9B 2CV1A 3B5EA 1KY4A 1LTQA 2VDJA 1RFGE 2HNAA 1TKAA 3FYSA 3OOSA 3UJ7A 4E4YA 1PKXA 2CMDA 3K9FC 1BCRB 3LXMA 2PX2A 5LZ5A 3AVVA 2XOKA 1K68A 3IP9A 3QTBA 1CJBA 1ZI9A 3AESB 1XTSA 3FPLA 4RMNA 4DQLA 4B3HA 5CFRA 3QGMA 3PQ3A 1UBMS 2EIXA 3IBGA 4A27A 4KREA 1TU0A 2OTCA 3E61A 2O1WA 1AS2A 1VB3A 3JXEA 4M1WA 4DM7A 3AWIA 3RC2A 3EXIA 1I4OA 3C16C 4DLBA 4EI9A 3UB3A 1ZJJA 1VCHA 2YL2A 4G1FA 3TOVA 3H2YA 1WXFA 1EX1A 3GC6A 4L51A 3FZNA 2HREA 3OZIA 4EPWA 3AWDA 4PLFA 4US1R 1HE5A 4FMBB 3OURA 5EP2A 3KV3O 5DHQA 3F5QA 1U1EA 2GN4A 3HJNA 1W2WB 2V7EA 3EA5A 1O94D 1GLNA 3IMGA 2FN3A 5COQA 4B8WA 4IILA 3JQPA 4LOJA 2QWXA 1QMGA 4YV2A 1K8RA 1NI4B 1WCIB 4KE7A 4ATNA 4Q4LA 4F93B 5ALHA 4OJTA 1D07A 3ZJYA 3FZQA 2OBLA 5K01A 4IJKA 5F21A 2DT5A 2OCAA 1YE5A 3CUWA 3AI3A 4F1KA 3CX4A 3C6KA 4OQYA 2WC1A 1RAHA 5CFMA 4MZXA 3FWHA 1C30A 3LX8A 1W29A 4I14A 4X92A 4EL0A 5CB4F 4FN5A 4X60A 5AKZA 1LQUA 1K06A 2D3WA 2G1KA 2GWRA 3CRVA 4G0QA 2O05A 3MRSA 2A5FA 1JEAA 1QFZA 1XAGA 3O1JC 3FOZA 2P3LA 2Y1KA 2VCHA 1G8FA 3K9LA 3P4XA 2QL5A 4DQXA 1F8XA 3BJRA 1GPAA 4LJ9A 3HGTA 4YMWA 2G9QA 3G2MA 4P84A 4F3YA 1NY5A 5DCLA 5BN3A 4ARUA 5A3RA 2H5EA 3V8QA 1A4UA 1RC0A 1KORA 2CNDA 1X19A 1T5IA 3GEGA 3H5NA 1VE5A 3ZU2A 3FYUA 2FFRA 3SE0A 1KKLA 3E0XA 1JB1A 3OQPA 2JLWA 5KVSA 2EQBA 2R7LA 1V9CA 4MLZA 4OJNA 2IEYA 4ROSA 5F33A 2GRAA 2VUUA 1CS0A 4IXWA 4FMPA 4AKHA 1VJDA 4YXWD 2IPNA 2QGNA 1FFHA 4YTEA 1DLJA 1XALA 1TVEA 4NBLA 3HCDA 3ZCPA 2O2JA 1GEEA 2SCUB 3IIIA 2X23A 2E3JA 5JBIA 2EVWX 4CF3A 5AW2A 3FCOA 3LV8A 1EK0A 2H6EA 4L7QA 3SSAA 3RJ9A 3AINA 3I9JA 4D42A 5C9ZA 2ORED 1AXGA 4OK6A 4R7TA 4F11A 2ERCA 4G56A 4IOMA 1I6MA 1OX6A 2IHZA 4HGQA 4HJXA 4N7BA 4BVLA 3DVQX 3EMDA 2C5EA 4G37A 5F1OA 1DUIA 3ZYZA 5K0CA 2OV2A 3N2KB 1K5PA 3JARA 2JA2A 3SC2B 3EVNA 1ESZA 3PT5A 3TEJA 2VDUE 1XMIA 3TQRA 4DWJA 2GEKA 1A9TA 1IPFA 1Z4QA 1B8OA 4UULA 2ALJA 2DG2A 2JAWA 4Q6WA 3ZY4A 1BX1A 3ME5A 1CZUA 4FCTA 2BE7A 1DAHA 3MAJA 2P35A 4KLRA 4UTXA 2XJ4A 3FPKA 2BKUA 4KW7A 1YBFA 3WBJA 4TS1A 3SX0A 3GEMA 3T7EA 5J2UA 3IPRA 2EKBA 3H65A 3R5TA 1LVGA 2I54A 1M0EA 1ZS9A 3DLIA 3V97A 2O59A 4G5SA 1WCWA 2W98A 1OLUA 3KE8A 4D3FA 4V1CB 4L5BA 4BTEA 4BB5A 4I4TF 2AMFA 3OCZA 4DYVA 4C2UA 4P4LA 1HDEA 1II8A 1YVDA 3WLNA 4J1NA 5UKDA 1CB7A 2NU8A 4PSCA 2GDZA 4ITUA 2OHOA 5GIPE 4OBWA 1MGOA 2AFHB 2DY0A 3NTXA 2CLCX 2YOFA 5BRAA 5JRZA 1U3CA 4PZDA 3GH1A 3CNHA 4L5CA 3VBEA 1DB3A 3RDPA 3BDAA 2VDRB 2PVSA 2P6OA 3AVYA 5FUYA 3DNMA 4OP2A 5M5BA 1SD5A 2IWHA 4W1PA 1HLGA 3EZ7A 3PXDA 1G6OA 3RRZA 2FZWA 3D6VA 2IGTA 2C8KA 2PSEA 3UICA 4DG5A 4PLVA 5AR1A 3W6OA 4XIIA 3WGHA 1Z75A 3JAMA 4QPZA 1EXNA 2CFSA 3QF4A 2ZWVA 2JCVA 1DMSA 4TUYA 3L7LA 1NQXA 1JJAA 1LF5A 2QQFA 1Z0UA 2TMYA 5DU2A 2CCKA 4JHXA 3KPUA 5ESWA 2A59A 3CH6A 2G1JA 4MA0A 4NZNA 2XDQB 2HSWA 4QJBA 4JJFA 4LHEA 4TMTA 1R37A 3V6LA 1IEQA 1JIXA 1XVVA 2X2EA 3N1UA 5MGBA 1W0KA 4B9AA 2XMZA 4PTLA 5FA5A 4DJ5X 1AGYA 2J3EA 2XECA 4XJXA 3CTMA 5K8CA 3ZOKA 3OOYA 3QHAA 1CUAA 1JDBB 1TIBA 4K9OA 4RZHA 3GLFE 3TDNA 4NG4A 4TQ9A 3B6MA 1RE0A 1JDUA 3WOVA 1FDSA 1E62A 5ANRB 1WUKS 3W3AA 4JC4A 2YWEA 1C4WA 1PS9A 3ICOA 2O5VA 1FQOA 2CSUA 4JJ6A 3ELDA 3GL9A 2G0TA 4UJ5A 1H2EA 5CTAA 3B1YA 5FHRA 3UT0A 3KOXA 1HYGA 5DB4A 1YMVA 1W48A 3TIIA 1PYOA 2A0YA 3TS1A 1TCVA 2G28A 3RFXA 5J3JA 3M4JA 4PHTA 1Y6FA 3JAWA 3LC1O 4RTMA 3P26A 3A7EA 3OC6A 1AUPA 1A9XB 2GTHA 2O8NA 4ZU6X 4KBGA 1E1YA 3KVRA 4CMIB 2PT9A 5ELXA 3AHHA 4HGNA 2YJ4A 4XTCS 1YIAA 4G5OA 3RSCA 2Q3EA 3NWEA 2D4HA 5JI3E 3I3SR 4O2LA 2O8DB 4NS4A 3DHWC 4EG5A 5DEOA 1QKIA 4TSFA 3U40A 3R8FA 2CF5A 2PUHA 1JSRA 1ULAA 2VJYA 1UM9B 3PJDA 3WICA 3BMCB 2C8VA 3KVYA 2W2KB 5KJCA 1FX0A 2PPLA 1XUOA 3KWFA 7ADHA 3I28A 5FO0A 1UT5A 4BNDA 1V16B 3KB6A 4YWHA 4AYXA 3GZNB 1JKIA 3E22A 1RP1A 1UJ2A 3M4NA 1SBTA 2FUG6 4DGQA 4EGAA 4RD1A 4HNUA 5IT0A 1KNXA 3DZJA 2EC5A 3RHTA 2XCIA 1FQWA 5A9TA 3FMFA 3ZE8A 3WGUA 1JQ3A 5C81A 5JXHA 2H5LA 2I3BA 1JEYB 2PGAA 2GK7A 3ZVKA 1JIUA 5C7LO 1Z6AA 3TW8B 2POQX 4JI7B 4I1UA 4L5YA 2IWRA 1IN8A 1QHIA 1XPRA 1YL5A 3MS7A 1K4MA 2RBGA 4BWVA 5AJWA 3VDQA 2RHOA 4AL4A 2HY7A 1OC2A 1Z8NA 2JFNA 2WIDA 1WPQA 3QOFA 3ZUPA 2VQEB 2LV8A 2GBFA 2X58A 5A0FA 2ERYA 2NU9A 3A4VA 4B71A 1YZGA 4CUZA 2Q27A 3EZYA 4E32A 5KYNA 4O1MA 3I9NA 4BTVA 1V2GA 4HLCA 1DWUA 1KJQA 3G2PA 3LRTA 2FI1A 4MS3A 4LGYA 1NY6A 5EGNA 3UK0A 4I46A 2PCLA 4IEIA 2YYZA 2GAJA 2ZK7A 2ZXEA 3PSAA 5D3KA 721PA 3P2MA 3HDGA 3I6IA 3L7OA 3NORA 5JMWA 1WV1A 2YWXA 4G25A 5JY1A 2NSHA 4RQAA 1VP3A 5H1YA 1ABEA 2XYQA 1JPNA 3ICQB 1C1DB 2WFLA 3EPRA 3LCVB 3UXMA 5DM60 2FMFA 5IRCD 3CNNA 5ALFA 3A3NA 3I34X 3KKZA 3TVYA 4DIBA 3C5CA 4YQZA 1WD7A 5FV7A 3ZWPA 2CXQA 4B80A 3T5AA 3O1HB 3EARA 3SM3A 3TAUA 4A3SA 1JTFA 2O8CB 1P45A 3AM1A 1N9GB 2FPUA 2HPAA 5D5QA 1WEHA 1L5HA 4JLDA 4D74A 1WHSB 4Z53A 2B61A 1V11B 2ASEA 3SQNA 2YY7A 1R10A 3BF8A 4MQBA 1Z3CA 2IUSA 4LSMA 1P1RA 3SZOA 3SVTA 3LGXA 4YK7A 3NPAA 1MHPA 2QNRA 4R1OA 2C61A 2Z0MA 1R50A 4LSWA 4ETNA 4YRPA 3ZWKA 4HVLA 1POXA 4CFZA 4V03A 1M2OA 3EXEB 1L0BA 2ZTVA 1J5XA 4W8HA 3TLEA 3I23A 1H3EA 3EE6A 1O97C 1OYWA 3O90A 1VLLA 1DU4A 4V0NA 4Y0VA 1J2RA 1T9GR 1VHDA 1V37A 2J7KA 4HDSA 5BORA 5ALYA 2QTVB 2O19A 1C1XA 2CWWA 1JG7A 5LLSA 2W0SA 3HCWA 5AKLA 5JAPA 2OBXA 3F3MA 1P5FA 3RJ5A 3PICA 4FHEA 3WB9A 3WL6A 2Z1DA 4LY9A 1YSCA 4R0MA 4P5EA 5KNBD 1JG3A 2MYNA 3WWPA 2CHQA 5IWCA 5AWFC 1G21E 5KWSA 4LOHA 5TARA 3WIVA 5DSTA 3Q87B 4BNGA 1ADGA 1DJLA 2WQZA 4MV9A 2XUHA 5CT5A 4YDQA 1ZDMA 3TMYA 2X0FA 4K9PA 3KT6A 4JLNA 5C4MA 1GZ6A 5G02A 1C50A 1JFFB 4JI6B 4MDYA 5AK3A 4DY6A 4HNAB 5JAQA 4F46A 2YZGA 3ZJTA 1KMIY 4M86A 1GGFA 3LQ2A 2OB2A 2CHUA 1U8TA 4QQKA 4YAUA 4CKBA 5LBTA 2OD7A 2X9VA 4QGHA 3TJRA 1QGYA 1Z7WA 1GFZA 1U2GC 2GD1O 3JQAA 1NUQA 1OH5A 3E7WA 4H1WA 4D99A 3U1VA 1QHFA 3UKDA 2RIRA 2R8ZA 3BIXA 3AMVA 1N4AA 3MFQA 5C8XA 1ZUD1 4Y2TA 3AEYA 3CA8A 1K7SN 2JVIA 3AHJA 3K9QO 4B6PA 5IK2A 3QNMA 1IOLA 2I80A 2HSGA 2OFXA 1N8SA 1N25A 1ZVKA 1AUVA 4LA4A 2VDQB 2E49A 2EX0A 4GPAA 4I5FA 2VZ9A 3ZHQA 1ECCA 2Y76A 4JP3A 4QZVA 4PHGA 2Q1YA 1Y1LA 2C2MA 4WAUA 5KHLB 4KODA 2O7SA 5CHEA 3K0CA 5KYYB 1OBHA 2Z08A 3DBHB 3GNTA 3IRVA 4NE7A 3WV5A 5BWCA 4YFVA 3GMSA 5LXTB 2PZ8A 3ENWA 2IYQA 4MPJA 4RYDA 1QHHA 1NG1A 2VTDA 2ZYRA 3AHEA 3SEFA 4ZMBA 1RJFA 1ULZA 2ZI6A 2ZYVX 4WQMA 3UWPA 2ZJ8A 4NBUA 2VAVA 1SKAA 2NG1A 3O03A 1SOAA 4OCZA 4Z7NB 4YCMA 3W78A 1SVOA 3INNA 2JHPA 2LE0A 1FSZA 2VO1A 4G24A 3KUCA 1K6JA 3VNVA 1PSDA 5ECWA 5IX8A 1R8QA 1Y82A 2IZ1A 1E9DA 2BHNA 2HB6A 3G13A 1H1TA 1FUIA 5BSWA 4Z4CA 1UEXC 4DCOA 2QQ5A 4EENA 2XH8A 5KSYA 3JY6A 3QFRA 5IJXA 4Y6GB 1L6IA 4HN9A 3QU4A 3OE5A 1EWKA 4A92A 1YZQA 2IYPA 3IKJA 1XQ1A 3EEYA 2OBYA 1N3BA 4BMVA 3D1LA 1Q15A 1U8FO 3DVAA 4TWIA 3OIDA 4E51A 2FW7A 5CCEA 3E9MA 3KR1A 4QU5A 3VYVA 4HV4A 3AY3A 5IT5A 3AR8A 1R0KA 2NUTB 3LDGA 4KX5A 1SUEA 4HH4A 4K7JA 2IUYA 3URMA 1M2FA 4D4HA 1XO1A 1OJ7A 1P8AA 1YHZA 3QXJA 1T5OA 3SZMA 4BJHB 4BLOA 1QJCA 5IKMA 5E38A 2DWQA 4N7MA 3UAXA 2WLTA 3AP3A 2C9YA 2D5AA 1UINA 4DLUA 4XUDA 3NU1A 4WDQA 3UMCA 4H31A 2YOHA 4JCCA 3MQ2A 4TS4A 1USWA 3K0AB 4CCSA 4XOUA 4DT1A 1HE4A 5DWVA 4LYHA 1GU1A 2Q9UA 3EVCA 3OJEA 3R3ZA 2JW5A 2ZSAA 1RYNA 3HABA 1K0FA 3R40A 1OLSB 2P5TB 4AKSA 1XCPA 2O7VA 3BMXA 3ZQKA 1GSHA 4QC2A 1YA6A 2DT8A 1P4GA 4EGSA 1MIOA 1VFPA 3NP9A 4JH0A 4PF1A 4WA8A 3UMMA 4K3VA 3A1EA 3BD8A 3LK7A 4IIGA 1ZM3A 5DOZA 1C3JA 5JD6A 3ERCA 1LI4A 1TM1E 1YR6A 4HQNA 4LJLA 3HKBA 3PUXA 3UTDA 4A4DA 2P0AA 1GPNA 2OWEA 3AI7A 3FBWA 3KB1A 4LOAA 3UGKA 3LVRE 2JLVA 2XUGA 1Z4LA 3E7PA 5H68A 4TTQA 3ZHBA 1PCXA 2GS9A 4DR5B 1SVSA 3JZMA 1C2YA 1PHPA 1ISGA 1CZKA 1KEEB 1U7HA 2OCBA 1MC1A 3CURA 3MGKA 2H31A 3SF8A 3KHUA 3OESA 2OXCA 4M87A 1HDCA 3WYAA 2I91A 1ZJ4A 1MG0A 3CZCA 5FL3A 2DULA 1Z4JA 3AIOA 2FA9A 3QEMB 1HPLA 4HAOA 4O4JB 3KFVA 1G7TA 5KTPA 2Q1XA 2VTBA 3CZAA 4CT4B 3WP1B 1V48A 4WNIA 1Y5MA 3RSOA 4KO1S 1E9SA 3FPJA 1Y8QA 2XWJI 5AVJA 3ITKA 3NCHA 5G3ZA 2I99A 4KQXA 4AXBA 2VLBA 4WBNA 1PZGA 3DTNA 4MYUA 1TKCA 3PS9A 3URKA 1Z5UA 4RVNA 2MSNA 4YAWA 4CIBA 2RGGA 1OSNA 1EUCA 5BV1A 4CXMA 2IUTA 2RK4A 3D6NB 8AT1A 1ZRSA 3CSUA 3E15A 4LY6A 2OL4A 2AOTA 4IQFA 1S7CA 1Z33A 1Z0DA 4G1VA 5TJHA 2X77A 4MQUA 2ZDGA 3MJHA 4HN2A 3PZRA 1US8A 2A94A 2HK7A 2R2GA 3V9PA 1RCTE 3WNDA 1IUKA 4BVGA 1T8SA 3QWIA 1M8GA 1YQ9A 4DCMA 4DV6B 1VHTA 3UG7A 5B57C 1MB3A 3C3WA 3K5PA 2JIOA 4GMXA 2JLXA 1FTQA 2OV3A 3UJ9A 1M6NA 3OJLA 3EIEA 3NOVA 5C8ZA 1G5RA 5DBOA 4J7AA 4WY5A 3GP8A 5A5FA 5J23A 4OUKX 1C7RA 3OUTA 3QITA 3A2MA 2ATEA 1NPYA 3U31A 2W9XA 3PT9A 1VL0A 1A5BB 1G2PA 1EJBA 1UK9A 3BJMA 4XVRA 3WX0A 4R3UC 3PCTA 4EZIA 3MMSA 1RZUA 1RP7A 1BRTA 1A4XA 1O6FA 3JQ7B 4ZVLA 5TQ0B 4DV2B 3RGWS 1U94A 4AIRA 2GO7A 1K7XB 2PE5A 2QSJA 4ZKDA 5KYWB 3H19A 4KRGA 4P33A 4YCBA 4A0GA 3QG1A 4EQZA 5F5XA 2J07A 5M34A 3C7DB 2G1UA 2ZI7A 2BEVA 4JELA 1CP3A 3IQHX 5JMPA 4C4PA 2AX3A 1MV8A 4IIXA 3RS4A 1KL7A 1ORVA 3RVLA 3QKWA 4GKAA 4A36A 3P32A 4RCZA 2B5OA 4ZYWA 2H2GA 4EQ6B 5IZCA 2CE2X 3RIXA 2Y0PA 2CV0A 1ZD5A 3A4IA 3EGDA 3JQ8A 1JDSA 1W19A 1UJMA 2C9ZA 3KTFA 5CNKA 3VNAA 4CNQA 1MAUA 3AKYA 1ZH2A 4J1TC 2WVHA 1ISRA 4PC7A 4WOPA 5AK5A 4GH5A 5KOHB 3K6KA 2FKNA 3WRVA 1DEHA 1QYCA 1UZNA 1TPYA 3BXEA 2B7CA 1C9NA 2ARKA 4XGNA 2YNMA 2UYYA 4FFOA 4XM2A 1LNQA 4PY2A 5F2EA 4JT8A 4J0KA 2JAXA 3GJ0A 3VGPA 3ZDYB 3SDBA 4BJ6A 1LRLA 4BVHA 2LRHA 3KAKA 3OZAA 3QVTA 1E2FA 1JHUA 4AQ7A 4JQYA 1MLDA 1M5UA 3PRJA 1GL6A 3U44A 1E2DA 3JPWA 4WN9B 2V6FA 3DT9A 2BBWA 3TX2A 1TOAA 4N4AA 2VPXA 3U13A 1J99A 1V5GA 5DM0A 3ZK9A 4D3YA 5JC8A 3PC3A 1HFWA 4R05A 4NZOA 5F7XA 1FS5A 1I6KA 3PFCA 2ZJ6A 2ZB4A 4P4SA 4XWOA 3COYA 1M34B 1T9DA 3IHLA 1FVXA 2PRKA 4XX0B 5JCOA 3L02A 1C1HA 4DJFC 1IYZA 4FVTA 1FDWA 1BDBA 1GDDA 1MMFB 1OWOA 1FXWA 3L9WA 5JTUA 2BLLA 2C5GA 1LPNA 3CLKA 3Q6IA 1FZQA 2I8LA 4DE5A 1WXGA 2Y27A 2YWCA 5K09A 2DHEA 2IQ5A 2C7OA 4GLFA 5FJIA 5KO2A 2PG3A 3SZLA 2FUKA 2VI5A 1R9GA 1XTKA 2OAGA 3FOBA 4C0LA 4F9TA 1FMTA 1QBKC 1RRFA 4BFWA 1E9AA 5CD1A 2WG2A 3LA6A 1XZAA 1EA5A 3EWAA 2Z4TA 4LPSA 3VVLA 4Y6SA 3N8NA 2CXPA 2PJDA 4ENVA 4JYBA 3PQ2A 2G6TA 5FNVA 3THSA 2NQ2C 1Y7TA 3H4MA 3QIAA 1TCUA 5TR9A 4JYMA 5GJVC 1DC8A 3NHPA 4QLBA 3CZ4A 1PK9A 3BB3A 2MU1A 3SS9X 3CF0A 3MMXA 2RI0A 3SGLA 4BP3A 1C80A 3DFUA 4FR5A 4RORA 3ZGXA 4C29A 5IBQA 3KVNA 2Z9DA 4PCAA 1H0HA 4FFLA 5EMHA 5B58C 2VYVD 2PX6A 4NPCA 4EF5A 1MAVA 4OFBA 1TA0A 3IPLA 4XB1A 5CT9A 1U7TA 3QYAA 1NBWB 3PI6A 1CXZA 1DKLA 3G6KA 5EZ5A 1QG2A 3BQMB 5LA6A 3IT2A 3K94A 1FBTA 1QS0B 3D8SA 2R7MA 3D6MA 3HKCB 4N5MA 1CSEE 1DX6A 4FFNA 2II6A 4K3UA 5DWQA 2Q3JA 2PGOA 3OCXA 3DTYA 2C7VA 4TVBA 1UPTA 1M7HA 2QP3A 2C20A 1RMYA 2XCRB 3NHBA 3U4HA 1AB5A 1ILWA 5AOCA 4OSPA 2XB6A 4H1UA 4RQTA 4LXUA 3ABSB 3GLHB 4OSEA 4PNHA 1X74A 2HA4A 4FINA 5ER9A 1WE2A 1GCIA 3U62A 3D8RA 1TKRA 2XOKD 4Q1CA 4C4AA 3I05A 4CYMA 1J42A 4GNKA 5IJZA 4LZPA 4BASA 4P5PA 2ZS8A 1EGQA 3ZHOA 4AWXA 4E09A 1U0LA 1UXGA 3KAJA 5BQPA 2VJPA 1S8AA 1HT2E 1QJ4A 1TT5A 2LCFA 4IKOA 3TRKA 3IGFA 3OFKA 4PWYA 5EKUA 5FOTA 3SC4A 5IAGA 3LT5A 4IFBA 1PGQA 2WWRA 3ACBA 4P4TA 1C2TA 4FN4A 4ESHA 3FX2A 4F8EA 4RTPA 1WY7A 2UZ0A 4B32A 2AKYA 3KDPA 4YT8A 3HO6A 1XA0A 2VJOA 3EISA 4GZLA 4HDNA 4UHHA 4OH1A 3UBMA 4AY6A 1SKYE 4RETA 5IM4F 1B3BA 2FFQA 4RHYA 2WJYA 3F7MA 3H17A 3KZCA 4QDTA 1Y4AE 4P3OA 3DEIA 4IGIA 5D3QA 3AJRA 4OREX 1LBSA 4J1SA 2BMWA 3KQYA 1DARA 2HQ1A 1UAYA 3REOA 3W0LB 4J2HA 5ITWA 4Q3DA 4LOKA 4M89A 4UARA 2DZDA 1EBFA 5EZSA 2ZUBA 3SOZA 3SSOA 1CS4C 4HHEA 3I6MA 1R9NA 2A5YB 5EXPA 1TB4A 3DYVA 3SEAA 4BLWA 5BPFA 1MJGA 5FJJA 4OB6A 2PZGA 5AKJA 1YTUA 4NZZA 5AXBA 3CLHA 2PLRA 1SIOA 3D81A 3KXDA 3BYZA 1PL0A 4W4TA 2HQBA 3IO5A 1Z6ZA 2PX5A 3IUPA 4MZDA 3A2KA 4S24A 3WQSB 4KQMA 4NX2A 4BMYA 4QAQA 4EARA 1T9ZA 5EHQA 1L5RA 1BC5A 4OXIA 1J2JA 3D3WA 1HLFA 3QYJA 1UOOA 1BVHA 5FDFA 2EFYA 2C2ZA 1RLUA 3UBTA 4TV8B 4UMFA 2WAMA 5B3JC 2XKAA 4F1JA 2HF9A 4D9HA 2GEFA 2GEDA 2RGYA 3IBCA 5FNZA 1PD1A 2Z2JA 1GGMA 1N2SA 1KDPA 3A1CA 5F52A 3NR2A 2PPVA 4ND2A 5LP6A 1NP7A 2YV2A 1T9BA 3KOOA 3QNUA 4YWJA 1ULHA 2WKSA 4OFXA 3EGEA 3FUXA 2G7MC 5EWMB 4C4XA 4KFUA 3CZRA 4IVPA 3A9UA 3S4YA 4Y30A 4B47A 3VX3A 3GLKA 2JFOA 1E99A 1K6MA 2K6GA 4LKOA 5J59A 4BFSA 1H85A 4MW9A 3RIHA 1KR2A 4RE5A 2JNWA 1NRXA 3G2JA 2NO0A 5CW2A 2D6FA 3ELWA 2UYHA 3GBSA 1CZLA 1PTJC 5CBPA 1JSXA 3IEIA 3NFRA 4FWTA 2IXEA 4R2HA 1J07A 3A10A 1BWPA 2P6MA 4YCDA 5E1MA 1DXQA 3L7BA 5E1OA 4E30A 2UUAB 2H52A 3ESZA 4IJUA 3VHXA 1IRXA 3B7GA 1CV2A 4RTJA 4YH1A 4KXWA 4X0EA 1XRQA 3IUNA 3U37A 3A0UA 5DT2A 2BP7B 1TJ5A 2EJTA 1EQUA 3WJ2A 2B34A 3KXPA 4ID3A 2VHXA 1F0KA 1RQXA 4D5GA 4F2GA 1S8OA 2CKMA 2EGHA 4XH9B 1Z25A 3HB4X 5CVEA 4JB8A 4FJ1A 4EUHA 4PCUA 3R3XA 1Q11A 1PR4A 2QE6A 5BN4A 2VPYA 1KSJA 3WLOA 2GO1A 1NNLA 5CIQA 2NU7B 4L02A 1YZKA 4LYJA 1GXSA 2ZJBA 2R6HA 4ZQHA 2GM9A 4YRMA 4IZIA 1CRPA 2ZB2A 1ZR2A 2EWVA 5FPSA 2AI1A 3DZGA 3H2HA 4IJ6A 1ZEJA 2C4VA 3AP2A 3ZE6A 4XDYA 1DDGA 1LU9A 2BY4A 1EBUA 3FTPA 3VZSA 2AUMA 3WMGA 1UKCA 4CQLA 4ETIA 1O4VA 2D1SA 4MRPA 4CODB 2WM2A 4NZPA 3R9IA 1Q16A 2Z2ZA 3D7MA 1XCBA 2WD7B 4RLHA 2Q46A 4TV9B 2BT4A 3DAYA 3N2GB 4PSDA 1QRRA 4FLFA 1SQSA 5AW6A 1GTRA 1Z5VA 4MVJH 1GU7A 1VYTA 3E23A 3V7FA 1EDZA 1M75A 5E6SA 3ZV5A 2HA3A 5JS1A 4JLUA 4MW2A 4UMEA 3TDKA 4G36A 3N2ZB 2ILVA 1TL7C 2SHKA 3E3AA 3IUYA 4Q3AA 3QEAZ 2FW1A 3KJFA 4E46A 2HSJA 4RVCA 1KDYA 4Y6QA 1CUDA 3OD1A 5AXCA 4ACBA 2AEEA 3FCYA 4EG1A 4EGQA 3H5VA 4ER3A 3W8FA 4RPJA 2HDWA 1PJTA 2P9JA 2B1IA 1E63A 1W0KD 2FCAA 4PFJA 3KHTA 2QR2A 3VUEA 4U0JA 3PNOA 1ODKA 5AVXA 4LBYA 1XLWA 3VTKA 3E3MA 4S2UA 1HK7A 1VP9A 2PL5A 5JDIC 5SYMA 3HU1A 4LTDA 2YV3A 3QLVA 3UAGA 1B8PA 3EOBI 3IEVA 3BXZA 4DB4A 3W3AD 2WDZA 1JDZA 1NJGA 1N5LA 3FIJA 2GVNA 3QHPA 4X91A 3Q98A 1YH3A 1XCLA 3I4LA 1AKYA 2BEWA 4M1SA 3T35A 3J81k 1EKXA 2QPTA 1T2NA 2WP8J 3QMPA 5TGDA 3DF7A 1M54A 1TM3E 3DQZA 4EVIA 1H2XA 3TIGA 2WJVA 5CB4A 3GJXC 1OUMA 1SUBA 1UZAA 1ACMA 2VHJA 4TKUB 4ZOCA 3GPBA 4JDPA 4Y2YA 3T1OA 3U7QB 5BR1A 4CEJB 3DDWA 4KU4A 1UOEA 2F62A 4R51A 2YJNA 4EKDA 2BI8A 3TRHA 2HRQA 2WD9A 2RHJA 2YBEA 3NANA 2Q1SA 3DOCA 4DC0A 2QVCA 2SKEA 3PEFA 2IPXA 1AJEA 4RSHA 3MLAA 2ZUVA 2JLQA 3O8DA 4HAYA 3M89A 4J76A 4TSFD 3FVQA 1EFCA 1RWXA 3CHYA 3LSYA 5TMPA 4H7KA 4CCYA 3KEGA 1G7CA 3NAGA 5EMKA 5H80A 4MGYR 4DDUA 1VPEA 3L0YA 1EEXB 3ZXUB 4UUNA 1H3FA 2GPWA 2JHFA 2AMLA 3R0XA 1W36B 1HOTA 9ATCA 4FB5A 1OKKA 4D9CA 5JDCC 3PQ7A 1JE1A 4WZBA 1NQAO 1HO3A 3HDJA 4GI1A 5M3BA 2C2GA 1H8EA 3LDUA 4JITA 4JL6A 2YVKA 2NXCA 1C9YA 1XYYA 4O4LF 5DP1A 4RD2A 4OHXA 2GWHA 1U7DA 2IDKA 3H5OA 4DUGA 3EZNA 3ICVA 2EZ4A 1X1SA 4G07A 4QVGA 2KYRA 1NT2A 5CYFA 5D6OA 3PCRB 4FXOA 4RPIA 1G8YA 1K6XA 1W52X 2QTHA 3SICE 2ZPAA 3WQQA 4X7MA 3G17A 5HMMA 3CBQA 3ORRA 2OOKA 3BBLA 4C3OB 4TWAA 2IK8A 3AEQB 4JXZA 3H7IA 3D59A 4Y2XA 5EC8A 2JLRA 4IIUA 4OB7A 3OZFA 3QIVA 4NICA 4S1VA 5KS2A 4Q4JB 4Z2AA 4XPIB 2B8NA 2GZHA 3O4JA 1ID1A 5JD4A 2R60A 3U0BA 3IPCA 3T0GA 2D54A 1NBEA 3IVRA 3P2KA 1SC3A 4ZARA 2QROA 3R75A 3ZE1B 1KYXA 3WZ2A 4ZMRA 1BEUB 3AM5A 5ICEA 3M9LA 2P1ZA 5CB0A 5IDXA 2JK0A 4I4TA 5CA0F 5GJBA 2J32A 3CLVA 4JA2A 3FJYA 2FZ4A 4QTZA 3OZRA 4PO1A 3LYLA 3PPXA 2IOFA 3IAXA 1JG4A 3H99A 4BN5A 2QRMA 1FP6A 1I10A 1O87A 2ZRLA 2EFCB 1DBWA 2ECOA 4MVJG 3BICA 4NH4A 2P9HA 1OE0A 5FPYA 3ZV6A 1IZ0A 5CLQA 3EMBA 3G5UA 1M1NB 2IHUA 2WJIA 4QJ5A 3V46A 4D0RA 3U6BA 4E15A 3L7DA 4TZ0A 2G70A 2VF5X 5CJJA 4EEXA 1AN9A 4R31A 4BO0A 2HSZA 2IYWA 3NKLA 4KPEC 3DAFA 3KQWA 2C3UA 3PXBA 1KJIA 3HR4A 4RF5A 1IXRC 3Q3IA 5JSZB 2DVMA 4XQ9A 3EEBA 3HXOA 3V4ZA 5EWLA 4A82A 1QH0A 1J6UA 3E9YA 4ALNA 4MEBA 1AQUA 4BJ5A 1KAOA 1MPTA 1FFXB 5AHXA 2GCIA 3CINA 3X2EA 4YRTA 4L8WB 2APJA 3UEOA 3PC6A 3WGLA 3UHOA 1WVGA 1HBJA 1WO8A 4RAQA 2G25A 3ETGA 3ILSA 4FBMA 3SZRA 1NQTA 1RM0A 5TDHA 4FHGA 2HZ7A 2ORYA 4UAVA 2Y05A 3DC7A 4GWGA 2ZZMA 2EATA 3TCKA 3PUIA 3QQPA 4UKDA 1C4OA 3SR4A 1HEIA 1JQ5A 4DA7A 4DCVA 4HDAA 2RG7A 4JD5A 1RPAA 1GUDA 1KQPA 2MSCB 2CNWA 1A9OA 3FF1A 4BMNA 1KFEB 1IWPB 4KAJA 1W0JA 4P7FA 1N0VC 2P8SA 1UFKA 2JLZA 1Y80A 2QJWA 4JYCA 1VSBA 3THWB 3RAFC 4YCCA 1XN4A 2JEYA 1V8ZA 3NYIA 3OHSX 4LX0A 5DLDA 2EFGA 2C31A 2MWMA 3NJRA 1B14A 3GGOA 1QORA 2HRDA 1LWOA 3EH2A 1PW7A 5EN4A 1DBRA 2G67A 3PF8A 3NTRA 2IOFK 4HAZA 4Q3BA 4QT0A 3Q88A 4QG7A 5BT8A 2GAIA 5E7IA 4KXFB 1PFKA 3DONA 5DN6A 3W2EA 3U09A 2HR1A 2QBYA 1Z2EA 1PJQA 3JQAD 4UM9B 1KVSA 1YO6A 3B9PA 3AGPA 3G2HA 3WNVA 4II7A 1GITA 4F86A 1VRWA 2CZCA 1UK6A 4D56A 1HLDA 2MOKA 4ZALA 2QRJA 2RHGB 3PNLA 4KH0A 3W4IA 4W5QA 2A6PA 5KX5B 3VHQA 3ZHCA 5IK2D 3EX7C 2CB9A 4RPKA 4TTJA 4AX8A 4JQSA 2CF6A 3RWBA 4LCBA 1E8DA 1DC4A 2R8OA 5LMNB 1NU8A 3DE7X 2FW6A 3QWHA 2V3CC 2VDLB 1Y33E 1EK6A 1ODJA 1WJGA 2VOJA 1E9BA 2PS3A 2Y9MB 4GW3A 2IX9A 5GGXA 1CUWA 3VC3A 1H2ZA 3ROKA 2BM0A 4TV8F 5U9CA 2J4CA 3DMGA 3M2TA 4D4LA 5DTMA 2WQ6A 4NEQA 2BUCA 3GEIA 1PR5A 5F9MA 1ZNXA 4YRCA 5KPDA 5DTRA 3DDHA 3EMKA 4LDAA 4LRXA 4ETMA 4MYSA 3ZK8A 1JAIA 1G20E 4TKVA 5REQB 4A8JA 4JP2A 3CE6A 4HTAA 3INTA 3EQ6A 2W42A 3EDRA 5B4VA 1CR2A 3F7TA 1D1TA 1JQEA 1V1MB 3I9V1 1MO5A 4BUZA 3U56A 4Q3OA 1M6VA 2OFPA 1U0RA 1BXKA 4RMGA 2QR3A 1OB2A 1M2HA 3N8KA 4LYGA 3IVAA 3ZGNA 2EERA 2ZJ5A 2GCNA 1AUOA 1Z18A 3MXOA 1TYCA 1VDZA 4LZLA 2GHQA 3FCUB 1M1ZA 4B3DA 4CKXA 2XRMA 3QOYA 4AC9A 2FLKA 1OZGA 1K6IA 3CF6R 3L4SO 3AI2A 4GU5A 5LJIA 3LUPA 3QMVA 3FCCA 4KE8A 1A7AA 4KDCA 5E4TA 1NX6A 5K8UA 5D7NA 5A4AA 4KL8S 3ADBA 2I2XB 1J9GA 5FWNA 3ZWVA 3K8ZA 3L04A 4PIPA 1I7PA 4WNAA 3BFPA 1G8AA 2AZMA 2SKCA <