5AOKA

Structure of the p53 cancer mutant y220c with bound small molecule phikan7099
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Cell cycle
source organism Homo sapiens
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aokA00
2WGXA 3VD0A 1CMOA 2FEJA 3KMDA 4KVPA 2IOIA 3WU1A 2ADYA 4IJTA 5AB9A 3IGKA 3D07A 2BINA 5ABAA 2AHIA 1GZHC 1TSRA 4QO1B 2X0UA 2J1WA 2BIQA 2H1LM 1T4WA 3Q05A 3TS8A 3WTUA 4IBUA 4AGQA 3D08A 2XWCA 3D09A 3Q06A 2BIPA 4L0ZA 1HJCA 4AGOA 2MEJB 3EXLA 1CO1A 2J1YA 2RMNA 5AOJA 3EXJA 4L0YA 4AGPA 1EAOA 3D0AA 4IBWA 5G4OA 5G4MA 3KZ8A 4HJEA 2J6WA 2J20A 5AOLA 3VD1A 2J21A 4LOFA 5LAPA 4MZIA 3WTYA 1E50A 4IBVA 3US0A 4XR8C 2IOOA 5A7BA 3WTSA 2VUKA 2J1XA 4L18A 4GUOA 5AOKA 4G83A 2XWRA 2X0VA 4LO9A 5BUAA 3WTXA 1LJMA 5LGYA 1HJBC 5AOIA 4A63A 1YCSA 5G4NA 3ZMEA 2YBGA 4IBYA 3Q01A 2P52A 5AOMA 1H9DA 1IO4C 1HU8A 2AC0A 1EAQA 4IBQA 2X0WA 4IBSA 5ECGA 3QYNA 4IBZA 3WTTA 3WTVA 2PCXA 4AGLA 3D05A 3VD2A 4IBTA 2BIOA 3US1A 1TUPA 4G82A 2IOMA 3D06A 2ATAA 4GUQA 1EANA 1UOLA 3WTWA 2GEQA 5KBDA 4AGNA 2OCJA 4LOEA 4MZRA 2J1ZA 1KZYA 3IGLA 4AGMA 2BIMA 3QYMA 1GZHA
chains in the Genus database with same CATH superfamily
2O61B 3V0IA 4L4VD 4NQCA 4MQ7B 2YAHA 5D2LF 4UT6H 5T33L 3IJEA 2DKUA 2O4EA 1WBXB 1S9WA 1Z0NA 1HIML 2C4FU 3P3RA 4YO0A 1XGRB 2AHIA 3CPLB 1ZE3C 1E90A 4OLXH 4Q2ZA 1KIPA 5SWQB 1QFUH 3LNHA 4MMYA 3I50H 3GS4A 4MVBC 4NCC1 1JP5A 5GZNA 3V7MA 2XKUA 4U1NB 1ETZB 3IVKA 5HDWA 3BPLB 4IRSA 1ES0B 1MFNA 4Z7OE 3E9TA 5TGBB 3B9KB 1IGFH 3AS1A 4G8GA 2AW2A 4P4RB 3I6GB 1QR1A 1NUFA 3GXIA 4M7ZB 3H1ZA 4C83B 1CB4A 3OLGA 1MZZA 3O45B 3SDYL 4JE4B 3EJYD 5LB1A 3U4AA 1QUNB 1Q8MA 2IANB 1MIMH 5AOLA 4H8PA 1S9VA 4IDJL 5T3ZE 5E5MA 1HEZB 5EUKA 2WC7A 5IEKA 1OSZB 5TH2A 4DP9X 3VWKC 3QR1A 1ZHLB 4QXUL 1JGUH 3HIZA 2Z7YA 3RVUC 4TV3A 3V5DB 3WAKA 3DHPA 1IT9H 5TF0A 3KPTA 3PGFL 4TM9A 4LASL 1MXGA 3UAJC 1E4XL 1IEHA 2CR3A 1A25A 1BVKB 2HX8A 2B59B 1TTAA 3EYFB 4N0FB 2EDTA 4Y9FA 5FFGA 1TLKA 1O7DC 1CDYA 2PMZA 2DQJH 4HHGA 1M2VB 1YCSA 1E8XA 3FUDA 4GG8B 3TVMD 3W11D 5EA0H 5GJSL 4RRPM 3MREA 2F8VA 1IO4C 1OAKL 2CDGB 4K94H 1LDPH 4HMCA 4TSBH 2IH1B 2WYZA 2NY0D 4M5YL 4RQQA 4D9RD 3ZZSA 1BD2E 2ZCHL 4NT6A 5CZRA 1KTCA 3VXNB 1QSZA 5KG9A 2A6JA 1QTYT 1H6TA 4NNXB 3AACA 1U8HB 3DV6A 2JLLA 5CJBA 1Q72L 2WINA 3ARBD 4LLUA 2DLIA 3AGWA 3MXVL 2X3CA 3GMRB 5CSZA 4CGTA 2MCPH 4B9YA 1GW6A 4Z3EA 4B5EA 4ODSH 3QG6A 5EFIA 4S10A 5AW2B 1F6AB 3VWJB 3P9MB 5KUKA 4X6DB 4QRRB 4GNKB 4KKAC 5E8OB 1EBPA 4M93B 1KJ2L 2QQNL 4ZUUA 4JHBA 1ONQA 4KK8C 4MAYD 4R90L 3ABLB 5HJ3A 4BGDA 1E6OL 3UJIH 2JELH 4OJCA 2WGXA 1RJYB 4WI5A 3CSPA 4K0OA 3W9EB 1IQWL 2HJLA 3U0WH 2WQVA 2VR6A 5EOCH 1ACZA 2NR6A 1UD6A 1FCCA 1CICD 4PJ9D 4R7XA 5D6CA 1IB5A 3SO3C 1UVQB 4BUGA 2WCGA 4RAUA 4J3VA 3TYFB 4MA3B 3LRKA 5C0DA 3PWVA 1Y6KR 1AY1L 3ZDYB 3BAIA 1F6FB 4JRYB 4MYPA 1GGYA 1HHHA 4NP9A 3V0GA 3T2LA 4IU3B 5HHXL 1FA4A 4AVJA 3V0WL 2UUDK 4BM7A 4Q7DA 5HVHB 3ZE1E 1H5BC 3CH8A 2NYYD 3MBEB 4X7SL 4C56B 5E99H 3UMNA 2IIJA 3BD3A 4B50A 1HCZA 4FTVB 1I7RB 5E8DL 5KVFE 5J56B 3UIZA 1EO7A 2ICWA 1XT5A 1KTLA 5EU6D 3II3A 2D7QA 1VFOA 5D1QB 3QAQA 2YXWA 3O2WL 4N0RA 3MRMB 4I89A 4F8TA 4TUKL 2D4DA 1MF2L 1N0LA 3LRSB 3MROA 2N0KA 3VI4E 3H6AA 1PQZB 1UASA 2GG1A 3ARPA 3MX0A 3KL0A 4DVBA 5J12B 2QKIB 5FUZH 4JFHE 5LBSH 2UZYB 2MHAB 4KQ0A 2I32A 1UGNA 5CCKL 5J11B 3E7JA 4YLBA 3QQDB 1U8KB 2HH0H 5IB5A 1K6QL 3B56A 1XGUB 4OAWB 1CI5A 3C2AL 1NBQA 1KSRA 1QATA 1H6EA 3WIFA 2LU3A 4MMXA 4P9HL 1XF3A 2O5ZL 2IPUG 2EVIA 1JK9A 3NN8B 5HTSA 4BWUA 1NCCH 4G1MB 5JYLA 1S5HA 1OAUL 4D0CB 2Y7NA 2WQUA 1GH7A 1I4FA 1R1CA 3C5ZC 4AW4A 3LVTA 1PNDA 1P7KA 2ARJQ 3UC0H 4AL8C 4KJPD 5HVWA 2EH8L 3VSTA 4G2AA 3KYKH 5I2IB 3N9GH 2OJEA 4NNPL 2YD3A 1C12B 2P5EB 3PJNA 2GHZA 1FJ1B 2MH4A 4A04A 1CXHA 2ITEA 3QQ9D 1PD1A 4XO9A 4JLRA 1AZZC 3D06A 3TV3H 1KCUL 3CK0H 3ZHLA 4PJEE 1OW0A 4H1LA 4I85A 4DZBB 5CKAA 2ADIB 2BOLA 1G87A 3QQ3B 2ED6A 4ZYKA 4D9QD 2AAVA 3WI9A 5CGTA 3WEAA 1Z5HA 4POUB 4NO3A 4X6BA 1ZLSH 3RVVC 1FQ9C 1RHHB 3RWIB 3B9EA 5JMOC 3RWDB 5DFVD 2FBOJ 1VJSA 3UABA 1AHKA 2BP0A 3GK8L 3Q8CA 2PO6A 3HUJF 4ODVH 2G0KA 4V33A 4DKEL 2DJ4A 3SGEI 2AQTA 4HLZG 4OZ4A 4KZCA 4FJ6A 5HHNA 5IW3A 1AKJD 4XB8A 2VN5A 1H3TA 4FNUA 5DWUH 3DX8B 4FHKA 2OZ4A 4Y2DA 5FXCH 4YSAA 2FWUA 3AT0A 3LEYL 3EO0B 2FQEA 3NJNA 3S97C 2HRGA 3MGAA 3TEXA 3KGRA 1QOKA 4HS3B 3DHUA 4WTQA 3RWFA 3G5ZB 5GGTH 2OI9C 3HAEA 1DDHA 2HLAB 3LZNA 3DTDA 4D2NA 5B8CB 1XGTB 1PKQB 3CCHB 5EU4A 2EDYA 2Y5QA 4JZNB 1IIIA 2R1WB 5C08E 5TQ2L 3APCA 1J9CT 1CDIA 3GMLB 1R3HA 3M7FB 4HK3J 3WEXA 2WP3T 3MO1A 1THAA 3W37A 4FERA 1OT1A 1JV2B 3QRBA 3MRJA 2WQ8A 2YPVL 1F3RB 3BSZL 5HHOE 4G8AC 5DD5L 1NLDH 4M8VA 2R9HD 4N2OA 2IBBA 4PV8B 4NBXB 2CPCA 2DQCH 3KYOB 4JX0A 1GW0A 3ZDXF 6PAZA 2BNRE 3ML8A 3U0TB 4AXWB 4M7ZC 3TYGH 1FG9C 1P5UB 3DKHA 1OAJA 3L5XL 3VH8G 3MPCA 3RGVA 5C0BB 3K4ZA 4XO4A 2F2HA 3UAAA 3WKQA 4BFIB 4DO6A 2DDQL 1GIGL 1MY5A 3IJHB 3MDJA 1TXKA 3BUTA 3EKCA 3TOPA 5LGHL 5B39G 3WKMH 2H6PA 3O9WB 2X4NB 4NO5B 4ICXA 4U1JA 2GJ6E 2YUWA 4UQEA 2VGLM 4M1DH 4JKWA 3TGXA 2J2ZB 4IBTA 3BUPA 4PH8A 3V0FA 2ZOOA 2XYCA 3LQZB 3FT4B 5F9OH 1IFHH 3HR5A 4PJ8C 5AL8A 3W5NA 4PLKC 2D9QB 4YXHL 4RWYH 3KHQA 5GS1A 4BSVA 1IBFA 2Y7MA 4RA0C 4C57C 1G7LB 4JL1A 5GZOC 4DTGL 2F1AA 1GGUA 2JXMB 1PL3A 3S8WA 3L5WA 2GBVA 4O51A 2VDPL 3BPNC 1JPGA 3QEUA 4NO2B 5C2BL 2F9BT 4L29A 2H1PL 2KHAA 2VLKA 3QZOA 3DX7A 3EJQA 3PNRB 1I9RL 1DQLL 1Q38A 5DZLA 5GIRB 1F1AA 5EZJA 4ZDHA 3VD0A 3HMXH 5E0QA 5INDB 4WFGE 1JYNA 2UX6A 3Q1SH 4L4VE 4RBPH 5D5MB 4AOFA 1VPOH 4NAQA 4TUOA 3MJ8B 5DVMA 3J7HA 1C8PA 3OB0K 4Y5YA 4CVXA 4QYAA 2WXNA 4WWKC 1ZTMA 5IZ7A 1UKQA 4KZDL 3KXFB 1V7NL 3UOAB 4XMXA 1WTGT 4PY7A 5DQJA 3VX0A 5C0AA 4J27A 43C9B 3RWEA 2PW1B 4OQTL 4CVZA 2EYTA 2D73A 1MFEL 1I1AB 5J6HB 1TETL 4F1SA 3FRPG 4S1SH 5D7JB 5F7UA 2VIRA 2HJKB 4NZFA 2DWEB 5DRWB 3L7EA 1AZUA 4GMSH 4HG4J 4H0LC 1J48A 1ZAGA 4ZSOE 2BH0A 1S7WB 1PJWA 1A6AB 2WKOA 3D0LB 1TVHB 4PYHA 4AI7A 4Y16D 2J55A 1DQDL 2DM2A 4TNFA 1HILA 1AZNA 4LCUB 4ACTA 4QHNA 3U0WL 1SEBB 4JKLA 3UP1A 2TAAA 2JIXB 2ZUUA 3RLSA 4HUUB 3VE0A 1DEDA 2W81C 4HU8A 1LO5B 1TPXB 4ISVB 2J8UE 2VDNH 4XMPH 3TT1L 4D0DB 4NPKA 3TWYA 5KYYB 4GYBA 2H41A 5ALCH 3HB3D 3MRPA 4BFRA 1XF2A 2BCKB 4G70B 5L8KB 2I07A 1KLGA 1FAIL 2GTZB 4JEGB 3QIBB 4WKXA 1FNGB 4IOSA 3MA9H 3UBXG 4HOZA 2Z91B 2P8MA 2DQGH 3LZLA 4X8XA 1MRDL 3T6ZA 2AGJL 2J5WA 5MP6H 3QUXB 4XCFL 1ZGLA 2LT9A 2NLJA 3IGUA 5E99L 2JQZA 3RKDD 3SGDI 3LRHA 1DN0B 4HJSA 1TTGA 3HZ3A 3FNKA 3KG5A 4BQBA 3GKWL 2CO1A 2PN5A 5E00A 3T3MB 3GLZA 4KKZA 5L9DH 3VXUD 3QG7H 4Z7UF 3QORD 1J18A 1I8MB 2P8PB 5FYLE 4KV5E 2ORBH 3EYSL 1BYOA 2YIHA 4TTDD 2NUPA 2YGVA 3JVGC 2WJ5A 5EUOF 3HZYB 3ARGB 5F8RC 3F7VA 1B9ZA 5F7HA 2BVTA 1UWXH 4V1DD 4FA7B 4JO1L 4OFYD 3GLEA 1QSEB 3F7QA 1L5GB 4MDRA 1UATA 3KH3A 5A16B 3RDTC 4XNUH 5DC0A 3OXRA 4PJIE 4WJ5B 3COOA 4NWTL 2WWNA 1A3ZA 1YJDH 2QVIA 4QXVA 2NSMA 5I76B 1M56B 4KJYB 4LEEA 4OM1L 3CSFA 2NY2D 3HBGA 1EAPA 4GB9A 1MCOL 4YDJA 2P1YA 3ESUF 1DR9A 4RVBA 4UF7C 4DP8X 5KANG 4Z23A 5HYSA 4JKKA 4XMUA 4RGNB 4HZLB 5F97E 3BGMA 1BZDA 4YN3A 2H3NB 4JFZL 1HH9A 1G7HB 4X8JA 1FIEA 2E6JA 4PR5B 2F58H 1OHZA 4P5MA 2NY5H 3QXUA 1HZHL 3MFFA 3ETTA 4P9ML 1TJXA 3V4VA 3D4ZA 4LSVL 5E24E 2EXWC 5ESQB 1U8IB 5F70A 3ASWA 3RIFF 2Z8RA 5GQBA 1QLEB 4JG9A 4M3HA 1WT5C 5ID0B 32C2A 3L3JA 2HKHH 4WW2B 4BJLA 4L5FE 1CLOL 3BWAA 1U8CA 2EDLA 5I18L 4PI0A 1UM5H 5EU6E 4KRPB 4OLWH 3LH2L 3VI3F 3G3LA 3PDDA 1MWAH 3SPIA 4JG0L 3RU8H 4H0GA 4R5XA 4CU7A 3R1GL 4YXKH 5E1HB 2VN3A 1DZ0A 1YAIA 4YHZH 4GQPH 4MD0B 4LLVB 1IZJA 2YGPA 3MRQA 1JF6A 2EE2A 4LESA 4XHJC 4NRXB 4B95C 3V79C 2AAAA 3IDMB 3WDHA 4K3JH 3UACA 1MCNA 2Y2WA 4ZAKD 5IBLD 4KKCD 1MJ8H 1JTTA 4AH2B 3ARSA 4E5XB 4UQ2A 5B8CC 3MLZH 2BP3A 1ACCA 2A6IB 3V6ZB 3SD2A 3CZJA 3RZCC 1AHWC 3BPOB 3OHMB 4WV1A 1RUMH 2NY7L 1OGAA 2HT3D 4Y9GA 1TDQA 3M86A 2HX9A 4LCIH 3FFOA 1CI3M 1KCVH 1G9NC 5EEZA 4GG6A 4ECNA 3MR9B 1X5AA 4W70A 1YEKH 5HDQL 1BF5A 4X4ME 4AIZB 3HE6A 3U36A 5IJVA 2J73A 3VFNB 2FYVA 1MCQA 4KXBA 3WHE1 3IPEA 3CGTA 3RBSA 3KS0H 3O6ML 4FNLH 4ORGA 4AQ8C 2NDGA 4BE5A 3ECBA 2HWZH 2QADB 4HT1H 3ZUNC 1IGYA 4A2GA 2APXA 4PJGF 3CXDL 4HEME 2ENJA 2J1ZA 2DBJA 1KJVA 3VB8A 1L7TL 3B9KD 3PAVA 2MPAL 2VMFA 3JV5A 3NSCA 5CMAB 1IE4A 3OC8A 2DEXX 2BP8A 5TK4A 9PCYA 4A6YA 4U1KB 2YKLL 4ZFZA 3C09B 4GKNA 5HYJA 4ZPTB 4MA7H 4Z0XB 4Z7WA 2DD8L 5D4JA 1G9MH 2Y6SD 3HC3H 2DH3A 2V9TA 3BSGA 2TSBA 1O5DT 2IAND 5E95B 3X13B 1UWEH 2AABL 4DEUA 1GGTA 2VDRB 1F4YL 1G7QB 2YPLE 3BVVA 5FKPA 3RA7H 4LGSB 3ILEA 3T77A 2VZUA 3LXAA 2X1XR 2H26A 3QUYC 1B90A 4X83A 5CKGA 3H2QA 4KRNA 4DFIA 2A2QT 1F41A 5KBKA 4ICWA 1G9EA 5IVXF 5DD0H 1MLBB 4QHMB 4ANKA 5JQ6L 1HHJA 1WWAX 2AVGA 3EZJB 5IMLA 3BYTA 2MQGA 3SSGA 4YBHA 3AXIA 3HI5L 4N2EA 1ZK5A 1EFXD 5IFJA 1L9OA 3R0MA 3VFWA 1D2OA 2A9NL 4KMQA 4GXVL 3FF7A 5MEQA 2XXFA 4HGMA 5JXAL 3ETBF 2YD8A 5GRUH 3QDGD 1XF4A 3VXRA 4PJAF 5CZVL 3VSQA 4K5OA 1BLNB 2CO6B 1QP1A 4XMVA 3SCMC 2VO8A 3BXNB 4NRYA 2YQ2A 2NY1C 5AKRA 1BVZA 4OF7A 1D7FA 1BAWA 1BVNP 1WH0A 4PJHE 1NAMA 4N5ED 2EJ1A 4LDEB 3DGGA 4NQVA 5D1XD 3NIFE 5GISH 1QG3A 4CL7A 1BM3H 1G0YR 2B9BA 4OCWL 1M6OB 2YFOA 4M43H 3G6JF 4N9OB 2LLGA 2ZUYA 4FFWC 1OK8A 1N7ML 1MHCA 1NPJA 1WBZA 5AB1A 1KFAH 1VZGA 3C9NA 3OKOA 3S8GB 2V17H 4YDLC 1KN4H 1IGMH 3LAFA 3DVNB 3OJDB 4ONFH 3GI8L 1H0DB 3EHBB 3ZDWA 2X4OA 1DQKA 4ZW6A 1QBML 3FF8A 1TZGL 3I6LD 4X6CF 4NIYE 2R2BB 1C7SA 1WA2X 2VLJD 4YHIA 5F3BA 2G9HA 1IGIH 4MAZA 1F58L 1VRSA 2ID5A 3WL9B 1WBYB 1R46A 3G5XB 1J1PH 5JPMC 1CIDA 2VDNL 1Z32X 4ZQKB 4XPFH 2WXFA 3EF7A 4FEMA 1CVSC 1KXVC 2K45A 5E2UL 2K7QA 12E8H 1N0XH 3I02A 2ZX9A 1P4BL 1F3JA 4J3TA 1E9PA 4O02A 2OCCB 3CH1B 4HH9A 4ZFFA 4WWNA 3L4UA 1EWHA 1UJ3C 3QNFA 3FPXA 4YSPA 4XP4L 2OL3B 3HMWL 4QXWA 1JWSA 4DWHA 1KY7A 1IGTB 4NN6C 5CSGA 2LTQB 5FX3A 4PB9L 2A9MH 2FGWL 4FNTA 2QPUA 1Z5LB 2BZCA 2O5XH 1J8SA 3DSFL 3MLVH 1GL4B 1KG0A 3DRTB 2BOCA 2V2XB 3U9PL 5L2JB 3ZE2F 4L8CB 1WV7T 1XSIA 3DX9B 1PX4A 2AFNA 4OI8A 4NZTL 1NSNL 3FT9A 5D4HA 3ECVA 3GI9L 4HIIA 4L8SA 2EEBA 4LAQL 5IREA 4GRLD 3IRZA 3GLDA 3W3BA 4GUPA 4YDIH 2K0RA 3ARWA 2UWEE 3HEIB 4MB5A 3ZSSA 4M8QA 4MNQA 4AX3A 3RKPA 4P2RB 4X5WA 2B3RA 3HI6H 1YNTF 3WG7B 5T5FL 5J1AB 2ATKA 1ZJBA 3B7YA 4K71C 3MV9A 3WKPA 2A0LC 3RHWF 3HE7A 1CDJA 4AKOA 1IAMA 2K9FB 3MXWH 3QWQB 4OTXL 2ZWKA 3JZYA 5FAAA 5F7YC 4OJDH 2W60A 4U1SB 2V8MA 4LOUD 1HXMB 5CJ8A 2G5UA 3NA9L 3TIDB 2X2JA 5IT2L 1XO8A 3GXPA 2OTWA 2DICA 3MV7A 3BVTA 3HC0A 1DBKL 1OE3A 3IFLL 2VLRD 3I6KA 4PI2A 1WEJL 2B3IA 3H56A 4ZUSA 2BVPB 4JPQA 1ZS2A 4MXWH 2ZSVB 3BQUC 5I1JH 4XNDA 2JJSA 5A40E 4QMEA 1UZ6F 1D7DA 3VG0H 1M1XA 3KVPA 1N64H 3DI3B 3IDGA 4S2SA 4JFFA 3RVXC 2KQMA 3N43B 2DH2A 4BH7A 5JNYA 1JZ4A 4S1DD 3PWPD 1N67A 2CPUA 1A1NB 4XNZC 1TNMA 3TNNB 3QYNA 4H13C 2HFFA 5DGRA 5FK9A 1AYRA 2XXCB 5DJZB 3AITA 3WFHB 3BMVA 1Y07A 2EIMB 2V5TA 1UA6H 4K3HA 3OKKB 3FH8A 3PHOB 4APQB 2V37A 3QZMA 2XTLA 5C0ND 3WS6A 4L9LC 4ZX5A 3WDJA 3VXUE 2IQ9L 2WNKA 4K8RL 4OLWL 3KCWA 3C60A 2DAVA 3Q5OA 1JXJA 5EC1A 3ATBA 3LB6D 1OZUA 3LKSA 4WKZA 1M7IA 3VD5A 1GYVA 4P23D 1OE1A 2J88L 3VCLB 4H8WH 4ERSH 1MAKA 1HTYA 3AAZA 3F01A 1YNKL 4V1DE 3SYAA 4LCVA 2GJJA 5ESVB 5AUMA 2XFXB 5E2VH 1OP5K 3P0VL 3T8XA 5D7SL 1E5YA 1HWGB 1NCDL 4JRFA 2F15A 4QHUA 1I3UA 5EZLA 4FNRA 4PWGA 2R2HB 4IEFB 5CZXC 2OMYA 1XGZA 1B3JA 4OFPA 4ZQTA 5KWYC 4KFMA 1GAFL 2AKRB 2NXYC 5DEGA 1UM6L 4RAVA 3RWJA 4W9DC 2MOGA 3UEZA 3PJSB 1DVFA 1MCWM 1SPDA 3OVUB 5CU5A 4ALAC 1IL1B 1YEKL 2ATPB 5JHDD 3IE9A 3PGDA 3TIEB 1RK7A 2DMBA 2FQDA 2P5PA 3BZ5A 5IGXL 3D08A 3MA7A 3EO9L 1W72A 3GXDA 3HS0C 3DBXB 2VLKD 2YBRB 4UILH 3MRHA 1U3YA 5AW1B 3C5SA 1IQDB 1JV5B 4A2LA 3ZVVA 4BRVA 3H9HB 3U7WL 4MJIA 4KI5D 1JWMA 3HI1B 3OAUL 1NCGA 1IC1A 3IDJA 2FD6H 2XPGB 4LARH 2WWKT 1VENA 4P4KB 3T0AA 2A6KA 2XYBA 3BFWA 4UQBA 3O9WD 5LNGA 5E56A 5KVDE 4KROD 4AC4A 3SPVB 2OS7A 2ETWA 2OTUA 3L3KB 1E40A 2ZXAA 5JOPE 1VF5C 3UTSD 3IBOA 1SDDA 1M7DB 3M1CA 4TQEH 4YPGA 5F89A 4YIQA 5I17B 1NGZA 1O75A 1Z7JA 4XNXH 1IIKA 2DQEL 5EBWA 2XLLA 3RUGA 1RPKA 5B3JE 1YDPA 2ZKHL 1JNNL 4K3GA 4Y4HC 2BOBA 2O93L 1SM3H 2UZXB 4JAMA 3GZQA 4N2MA 3UG4A 2OJZH 4Y4FC 3VFRA 3T3PE 3AY4A 4FE9A 5AW4B 1LILA 5IBUB 2IWGA 3UZEC 4U33A 4BCYA 2WYHA 1XVSA 2DIBA 5F9WB 3B7SA 1A3LL 4OZGE 1RZGA 3BZFA 1PCSA 2VSMB 3GGWB 2XBDA 4XODA 4GUQA 1HI6A 4EZJA 4ZFOA 2NX5B 4FNQA 5D7LD 2BWDA 1CFQA 1V10A 1TCRB 4GO9A 1KZYA 4EUPB 1KPVA 3VFUB 5AW6B 2HT4D 3L16A 3OXSB 4YMPA 3O3DA 4PJDF 3LJ3A 3B9VA 3T2PA 3HHMA 1JMXA 1YEJH 5IQ7H 5CO1A 1CMOA 2NW3A 4ENED 2G4EA 2R0WH 1MVYA 3VXTB 4F3FB 1KN2L 1KCRL 3MZGB 4WUUD 2EIJB 5KEZA 1AS6A 3CFCL 2WXLA 5TF1H 2F8XC 5AYUL 4HQQH 3K2UH 3QPKA 4PV9A 5KTEH 4JY5L 2HX7A 1BZ7A 2IANE 4YUEL 2E76C 5IHZB 5FKAB 4QRQB 5EF0A 4U0RB 2BWQA 1UXLA 3MRLA 1YA5A 3SOTA 1BECA 4XWOC 1N6UA 5HVGB 3BAYA 3ARDB 3GHPA 5H2BB 4EOWL 2P24A 2YPLA 4XPFL 3Q5YA 4OZHF 3BW9B 3QIBD 4PJ7A 3H85A 4NQSA 5MI0B 5I75C 1NMBH 3B7TA 3WBDA 1XIWA 2XN9A 4R26H 1X9LA 3QEQD 3V4PA 4A7UA 4MNHA 2W94A 4LVNC 2O6EA 1D5XB 1E2ZA 4R96B 4HGWA 1KIUB 4C4BA 3O4LA 3KNBA 5K9QG 3AG1B 2ENSA 1RJZA 2N4IA 4O5LH 4H8QA 4NDMB 3QDGE 1R0AL 4QYOA 2YAQA 4HCRL 4MQXC 1JL8A 1PBYA 4OD3L 2HVJA 5JTWA 4RGOH 4U2ZA 3B8YA 4HIJA 3PP3K 4TQIA 4AENA 1WG3A 3GINA 2JB6A 5D1XE 4XCNA 2E7DA 4L3CB 2JE8A 3QUZB 4KX9A 4XT1C 2HPOA 3VMNA 2I5YL 2UZPA 3JWNE 1Z2KA 2ZXGA 2AJVL 4IK7A 4MFHA 3WELA 4LHUG 4OM0L 5C0FA 4G7RB 1BHGA 3KE0A 2OMNA 3S4SB 4RFNB 4Z18A 1QBAA 4X6DE 2VZSA 2VR7A 3GC3A 4OGAC 4CVUA 1NTDA 4LCCC 1T2QL 1FL3A 4N0UA 2W5PA 2BSED 1BBJA 3VFPA 2CHWA 4WSGA 3I6LE 2OYPA 4P3CL 2WXPA 1CU4H 3EOAB 5DD6B 2VLLB 5F7BA 2VLJE 2VUYA 4XXCC 3B5HA 4Z7VB 5B38B 3BIBX 5I1JL 4UU9B 3IMTA 2AEWA 1YG9A 3P73A 2WWOA 4AT6B 5I8EA 3LSOA 1OL0A 1SBSH 4FFVC 2YRLA 4M48L 4ALAL 3VG0L 4I0PC 1E2WA 4BZ2A 4JRYE 2MFNA 5GGRB 5JYMA 3PIQA 4KTEH 4R3SA 3DVGA 3L5IA 2V3FA 5F7EL 3KLDA 1T0NB 5H35B 5FLUA 3VWKA 2AV7A 4X98A 5AVQB 5FYJH 2CGZA 4JM4L 4FG6D 1QABA 1VACA 4APQC 3ZR6A 2EVGA 3WIHH 5I1GH 2G3ZA 5I1LB 2FL5B 1MFDL 3H53A 2CDFA 1UXSA 3VGDA 3SN6N 3KM1A 1GY1A 3CFTA 3MRKA 1UD8A 2BSRB 2CK0L 1QO3B 4JBSA 1AIFB 1D5BA 1PDKA 4LEXH 5D1QE 5IB4A 1CFVL 3VM5A 4NQEA 5JUEH 1RZKH 1MAMH 2XVKA 1MFVA 3MYZA 2XCMC 2CHDA 3BP4A 3C75A 1NMAL 2XQYK 2WUCH 3HRPA 3TNMB 3NJHA 3IKCB 3SY0A 1AGBA 3ABZA 4H8WL 1RUPH 4YHOH 1IZKA 3IMWA 3TTYA 3BP5B 3WJMB 5H94B 1FFOA 5HPMB 1FGVL 3NIGF 1CLYH 3LKRB 4PJ5A 5K1VA 3V4LA 4F58L 5JW3L 5AAMA 1DO6A 1MKFA 3QQ4A 3TN0C 3GRWA 1MRFH 1U8NA 4GKLA 1HCFX 1OQOA 1QAWA 1NMCC 1F5WA 5I6PA 1T1XB 3LOWA 3CLWA 3KWXA 1QWHA 3AWGA 3BGFC 5D1ZD 1NFIB 4Z3JA 1FN4A 5IK3B 2VLRE 1UA7A 2A9AA 3MNZA 4TOYH 4EDXA 2CU9A 2ZXQA 4QRBA 1XD1A 1A4KB 1WD8A 1W91A 1FSKC 4LU5H 2XY1A 5C0CA 1S78D 3VXOA 3HRZC 1CGTA 1G1CA 1SVBA 3QZWB 5I24A 5AOMA 1BVLB 4PGDB 4JGMA 4XWGH 1VSCA 1U8MA 1S7QB 1U8PB 2OR9H 4AIXA 2WXJA 4FQIH 4LRIA 5CJOH 5FF6A 1LE9B 3K4AA 1U93B 2Q7YA 2XVLA 1ETB1 1CFSB 2BSSB 4QRTB 2Q86B 3PWPE 3VRIA 5HHPA 4YK4B 3CSBA 5LNDA 5ACMA 3KPPB 1HZKA 5LBGA 2ZP8A 1T20B 4ZUTA 4HWZB 4M5TA 4UNUA 4AQEB 2FJHA 5EWIL 5BVJA 5LXGL 1W6LA 3UYRL 1AQMA 1HQRA 4EVNB 3VB9A 3FUHA 1H3PH 2FZ3B 5DUPH 2A4EA 5L4MA 3FSOA 3V52H 2Y24A 4TL4A 4NZRL 2JB5H 3KPMB 1ZKAA 2A99A 1BVNT 1Z9OA 2OMWA 2Y25A 4U6VL 4UQAA 1XMWA 1Q90A 3T0XA 2BVOB 3MNVA 3TJHD 4MMZB 3AM8C 5EO1A 1EQWA 2F53D 3CSYA 2HSIA 4XNXL 1CT8B 3QYMA 2D31A 4LAJH 1JDCA 2QSQA 5K39B 1W8EA 5GPRA 4HIXH 4I2XB 5EZOH 2EXSA 5EDXA 2ICCA 1JGDB 1WAAF 1SFHA 3QO0B 2L0DA 2LLNA 4PBDA 3SDCA 1G7IA 2YD0A 4Q6IB 3LIZH 2XHNA 4RFOL 1ESOA 1GPOL 2E7CA 2W92A 4JO4H 4G80A 3I9AA 1F4WH 3BE1H 4GS7B 4FAAB 1O6VA 3VRLE 3NAAL 4ZXBD 4PRNA 5I8OL 3K6FA 1DP0A 3MU3A 4YNYA 3ZKXC 1ZVYA 4NN7C 5CN1A 4G6AD 1RZ8A 1A3RH 4KXZI 4XCYB 2DLGA 4L8BB 1BQSA 3MC0A 2X4TA 1LEIA 1FO0A 3D39A 5JHDE 1NBZB 1XF5A 1SXZA 4GRMA 5DHVA 4B53A 2WIIB 4FFZL 1BGXL 3P77B 1JZIA 5F6HJ 2BZ7A 3KLQA 3T0ED 1GS7A 2CO2A 1CXLA 4HDIB 1LO0L 2WBXA 5GGVY 5FEBA 4XCCH 3MMEB 2J8HA 5DVKA 4U1MB 2X70A 1J8HA 3QO1B 2AMGA 4JL2A 1ZT7B 4FZEH 4KI5E 4YH6A 5ID1B 1QKZH 3WDIA 1B4LA 3LPGA 2ZOWA 2W0FB 1HHKA 2C7UB 5B7FA 4YDZA 5T3ZH 1AXTH 1NFDB 2EKJA 3AQXA 2R4SH 4N2FA 2VW6A 4XPGL 2R51A 4F5CA 1LVEA 4XMZA 2E7LC 1UOKA 1L9QA 3IKKA 2B4CC 1OTUC 2X6VA 15C8H 4G6KH 2X4UB 1JI2A 4AQ1C 3SOBL 1XL6A 4WUKL 3WY3A 3MV9D 2L7JA 4NI6A 5JQIB 4QUOA 4AJYV 3REWB 3HNSL 5GXBB 7PCYA 1I8IA 4UTBH 4G7VL 4YSOA 1MPAH 4GKZA 4EN3D 4MJ5A 4BFFA 4DPRA 4NAMA 1EZVX 4YBQD 2KPWA 5E8PA 3BVWA 1Z3GH 1N59B 5JLZB 3IDIA 3E6HA 1N9PA 5I6KA 2NTFA 4FNPA 3P11L 4DP2X 1OEZW 4OB5H 5LO7A 5C0EB 4JQIL 3VD9A 4IMKA 4APXB 1OAXH 4UUJA 1GRWA 3Q7JA 4ZNEE 2VN4A 4LKXB 1FE8H 4MA8L 1YUHB 4JQVC 1BXAA 3E8UH 3V9CA 3CHRA 4H25A 2WK2A 2ZKYA 3FUKA 2JI3A 1LXMA 2C1OB 3VJ6A 4A2DA 1PZUB 2DQDH 1REIA 4IS6B 4UM9D 3NESA 4MQ7A 5D7LE 4V11A 4UNIA 5HI4C 1YQ2A 3KPNA 1WBXA 2IDCA 3DPDA 4LHQB 3MUUA 4I3RL 3U1SH 1XGRA 3QDAA 1SFDA 3QRGL 5SWQA 3RVWC 1MFBH 3PWJB 1BMZA 5EN3A 3IXTB 2FBRA 2GTQA 3QJUB 1FNHA 1XZ0B 2XVGA 1QHPA 4AITA 4JO2H 4J7RA 4WUUE 3PY9A 4U1NA 1ETZA 2K4WA 3QR2A 5IBTH 2BSTB 4H0HB 2BIQA 1SY6L 4JZOB 4F1ZA 1H8OA 4HIHA 4WO4D 1JCVA 5TGBA 1LWHA 3I6GA 5CEYA 4G5AA 3QJVB 4AEHH 2WV3A 2UUDH 1H8LA 2VDML 4C83A 1H9VA 3ULVF 1YY9D 3KLAB 1P4IL 3EDEA 4YL9A 3NSYA 1NLBL 1MJJA 2GK0B 3IN2A 4XH2B 5FHAH 3VUAA 4FA6A 5KJ7E 4HUWB 4PLOB 1NUGA 2RAMA 3TLRA 5DTFB 2ZOKB 1J10A 4QY8A 5I1CH 1HEZA 1XXDC 3MOBH 2R8SL 3FCSB 3GF8A 1UURA 2DWTA 1TSHA 1OSZA 4JKMA 2PLTA 4PJFF 4WQOA 4IRZL 1ZHLA 3IXAB 5EEVA 1MG2C 3PJLA 5F7FA 3V5DA 4NKOA 3EJSA 4PJ8A 4YVNA 5KVFH 3NP4A 2ZUVA 4Q4IA 3QEQE 4M6NH 4FOMA 3H9SB 1A4BA 4G5ZH 1XZWA 2OW7A 3EYFA 4FQLL 4N0FA 1UC6A 3LZOA 2J25A 3PDOA 3KDPB 3Q13A 1FFRA 5HI3C 3CFQA 1IM3B 5C1MB 3AGVA 1M2VA 1NDMB 3EYUH 5GS0H 5EPMA 4N0YH 3T3ME 3M17A 1JGLH 3V55A 4HUXB 1J87A 1YYLL 4G43B 2CZNA 3GMMB 2CDGA 5HYJD 4W6WB 1RZKL 2IH1A 1U8LB 2OYLA 3Q8AA 1SJHA 1CDHA 4IBQA 5C09B 2CRIA 4HUMB 3VXNA 5J13C 4JPVH 1L7IH 1XGPB 5ITBH 3NOIA 4NNXA 4PBVC 2ZYRA 3DX1A 3ZN6A 1NCOA 5ERWB 3GMRA 4AKPA 4Q9QL 4DZ8A 4Y1AB 3M8OL 4JB9H 1MUJB 3MV8B 1LO2H 4GAJH 4I18B 1F6AA 4P5TC 3P9MA 3VWJA 3T6VA 5E8OA 1MW3A 4NPYB 4QRRA 2CBMA 3IAGC 4Q8BA 4Y7MA 2D2OA 4NLAA 5IFHH 1BAGA 3NCJH 1G0XA 4I7ZC 4PGBB 4FQ1H 3U0PB 3ZT6A 5HDBF 1RCYA 5JIQA 3W9EA 2WTRB 5EULV 5EU7E 1I1RA 1ZXKA 1BCIA 3VFOB 4DEPB 2AJUH 3PU7A 4OCLC 4NHUB 4HUVB 2ADYA 2SEBA 1UVQA 4OSUH 3NFPB 2WLIA 2ICEC 4MA3A 4KXCA 5ICXB 2P49B 25C8H 3V6OA 4HJGA 1WTLA 5E1QA 2FBJH 4R5VA 1SXSA 1XBRA 3SE9H 4IU3A 1OANA 2W65B 1GGIH 1I8LA 2IXQB 4M03A 1NINA 1YMMB 3MBEA 2FEDC 2GI0A 3G08B 4HWBL 1OTTC 3ES6A 4IGBC 2FX8L 4C56A 5F7NC 4FTVA 1I7RA 3FK3A 3II1A 1K3ZA 2VDNB 1JYWA 1PZSA 4U3XA 3CZUB 4F27A 2QLVB 1DLFH 2X1QA 2B4CL 8CGTA 2UVFA 3MRMA 4PJCF 2GVYA 5ES4B 4CAGA 3DMMC 3LRSA 4PJBB 1FIGL 2W59A 5E7FA 2UXVA 4L4JA 2X44D 4JN2B 3LRLA 4KTDH 2MHAA 3IDUA 5ANMB 2YQ3A 1M6UA 2Y22A 3ZDZF 3QJOA 2GABA 3DHMA 3JVGA 5C0RL 4GBXD 3F6LA 1A6WH 3BUQA 3IMRA 1TQCB 1U8KA 1XGUA 1MFMA 4OAWA 3T9WA 4ZW8A 4S1RL 5JHMA 5DVOA 1LJMA 1X5KA 3MHZA 4HS6B 3BKYH 3PUUA 4JQXA 5A2JH 1JFQH 1UACH 3LQAL 4G1MA 4MDJA 2QHRL 2FUQA 3H6JA 3ZQWA 4DUWA 3V6BR 1YEIH 3BD4A 4D0CA 1KDIA 3STLA 4NC0B 5SX5K 3TZVB 2ZYIA 4B3EA 1F13A 3FB5B 4N22A 4UTAH 1HKFA 5K69A 4AJ0A 4YSDA 1F3DJ 3P40A 3Q6GL 3QS3A 1C12A 2P5EA 1FJ1A 4NENA 5J3HC 4NP4H 2F54B 3VQMA 4NO0A 5E5UB 5KW9L 2R7EB 1MCSA 4YHMH 3KDMB 5JW4M 1X6NA 3PE9A 5F1SA 1PZBA 3EF4A 2VERN 5EOQL 2Z7ZA 1JNHB 4DZBA 2ADIA 1S3RA 2JVUA 3CZLA 3K1KC 3QQ3A 1RMFH 2HFGL 3BFOA 4IK6A 4EIBA 5C7XL 4Y9EA 3NJIA 2I60H 3WNKA 3FTZA 2GUOB 3GSQB 1WT5A 1JDDA 3H55A 3RWIA 1RHHA 3EBAA 4YHYB 1XGQA 3JTSA 3KPQB 2WXQA 1FV1B 4HP5A 4DAGL 4FQ2L 3WFCH 2F53E 3HHSB 4GG6B 4X42A 3P1VA 2Y1YA 3MJ7B 3LPOA 1B0RA 4ELMF 4PM1A 3NJJA 1RVFH 1U3HC 3LDBC 4MVBD 3OB0H 2B5IB 3ULVC 2GIXA 4OCSL 2OW6A 1SBBA 2AJZB 3BH8A 1A1MB 3DX8A 3GB7B 4IW4C 3B6SB 5F6IC 2WSPA 2AXHA 3G5VB 4HD9A 1W0YT 3C8DA 5B39B 1ADQA 4HS3A 4RMSA 1CLZL 3NEEA 4G42A 5I1EL 3G5ZA 1X4YA 1DBML 1K8DA 2JNZA 5D93C 2HLAA 3DJTA 3VG9B 5B8CA 1MWAB 1PKQA 1XGTA 3CCHA 1G43A 4JZNA 1FUNA 1THCA 4IOFC 2KI6A 2X28A 4Y5VB 4ZMXA 3DURB 3K74B 3NVQA 3RZCA 2KZBA 3ZTNH 4XCEB 3TA3B 1SOXA 2A83A 3KLLA 4LIQE 5LAPA 3T0EE 4XN9A 1JV2A 1PIFA 4LSPL 3RVUD 5ACZB 5K59F 4D7BA 4EKXA 1I1YB 2DLHA 3UAJD 5JPNB 4HKBB 4NYLB 1T04B 1D5MB 4X4KA 4PB0L 4WI0B 5I1KL 5DMKB 4PV8A 1MDTA 3KEDA 1MVFA 4R2GC 3KBFA 3KYOA 3U0TA 3MUZ1 1JXGA 5A2AA 1MI5A 1VIWA 4AXWA 1ZEAH 5PAZA 1JZGA 5GRXG 2JKLA 4JFEB 2VAJA 5LGYA 4HMDA 2R29A 3O2VL 1B0GB 5C0BA 3ZKSD 4PTUB 3O3AA 1A8ZA 2LVEA 1QRND 3MCG1 5CN3A 3IJHA 3A6BL 4HVBA 3SGKC 3EFDL 1FDLH 4GQ9L 4NO5A 3QFDB 3UJJH 1TZ8A 1YMHB 1U91B 2NXZC 2ZKMX 4DIXA 3BIKB 3TM6A 3QIUB 4PJ5D 2E3VA 2J2ZA 2OR8A 1NEPA 1IUZA 2RTTA 2VDQH 1F86A 3LQZA 3MFGB 5F7DB 3WTVA 5I74B 1A1OA 2Z7UA 4HPOL 4AGLA 4BA0A 4N24A 5DFAA 2YSSB 3VD3A 3BLBA 4XX1G 3QUYA 2VMCA 1G7LA 4GXUN 4KOCA 5DUML 3GJEB 2G3NA 1CLCA 3FN0H 3PNWB 4XE5B 3K46A 4KKAD 4AIOA 4NO2A 2HG5A 4P3DB 5FYLH 1FH5H 4KK8D 3STZB 5GIRA 5C7ZA 1W0WB 3BT2H 5CU9A 2BM3A 5H8DA 5CLTA 3OAZK 3N2JA 1KNOB 5IB1A 1KBBA 1EJOL 2JI2A 3O8XC 3VGEA 2X4RB 2FEJA 2BSBA 5D5MA 5CGYC 4AE0A 5DJ6A 5IUSA 1IAIH 2WTPA 1JPSL 4LP5A 5DK0B 1EHNA 3UBXB 4PWJA 1ZPLA 1LEKB 4JG1H 4HD5A 1E5ZA 5DA4A 4ZTPH 1TQTA 3IDNB 5DYOB 2VITB 3KXFA 1T7ZA 1JD7A 1K4CB 2WNWA 1C5DB 3BAJA 1G6VK 3QJFB 1T4WA 2QSCH 2F1BA 4XP9H 2CUHA 2PW1A 1X9RA 3CLFH 3VTTA 4WFHD 1I1AA 3QHFL 2FLRT 5D7JA 3F5WB 2DWEA 2FX9H 3T5WA 5I1HH 1JZEA 3FU8A 1Q1PA 1F11A 2LVCA 1J0HA 3EXLA 1A6AA 2E47A 1P6FA 3D0LA 4HSCX 4QTFA 3VXMB 4K3EH 2Q76B 4OV6F 4YGVA 5DSCB 5FO7B 3LNDA 3REVB 5SWZD 1SEBA 3RFZB 2VXVL 2JIXA 1D5IH 3HZMB 4HUUA 3TH4T 3ZIMA 1LO5A 1NBVL 1RUAL 3MRBB 5I0DA 4D0DA 1FHGA 3PQYD 3ZE0F 4N8UA 2BCKA 3WTSA 5FYJU 3V0DA 4I9XA 5FO8A 4L5FH 4XN2A 1BMWA 3N85H 2R56H 1MY7A 2GTZA 3BPCB 3G9VA 4XP1H 4QTIL 1FNGA 1Q0YH 4F8LA 4OFQA 3D18B 4X6EA 5KYXB 5HD8C 1QSFB 2Y3AA 2Z91A 3ZBMA 3OHXB 1AJ7L 5BOZG 1AS8A 4PJXB 3QUXA 5GJTH 2VL4A 5G4NA 4WGWB 1WC7B 1PW3A 2C3XA 5I6NA 1UWGH 2FHCA 5EEYA 1KWGA 1DN0A 3C5ZD 3O2DA 2J6EA 2O30A 2RIKA 2EDKA 2WWMC 4GSUA 3RTQB 1I8KA 1KMGA 4JANB 1AD0B 3A4AA 2M8XA 4OIAA 5LCVA 3CQPA 3O6LL 3H2PA 5B21A 3KPRB 2R2EB 1PG7W 1I8MA 5B4MC 2EDHA 2DMGA 1P1VA 1UB6B 3M88A 5EIIB 2Q3ZA 4LFHG 2QQLH 1AP2B 3NSFA 1A6UH 3ARGA 3HZYA 3HTLX 3QC6X 2YD9A 1A7RH 1V05A 3C5XA 3D8MA 4FQHB 1QSEA 5AEAA 3NIDB 2BNQB 1L5GA 3VFVB 4G7QB 4P2OB 3Q3GB 4R7NB 2VAAB 3MQIA 4WJ5A 3CZKA 3PAZA 3TEWA 3VI3A 4WHDA 3SGEH 3KWWB 1PFOA 3RVVD 5I76A 3MV01 4DUVA 3TPKA 5FR3A 4MA1B 4G6FB 1UOWA 5DT1L 1TJMA 3FQ2A 2EYSA 3OB8A 4PJGB 3HW7A 2Y0SA 3KWVA 5M95B 1CXFA 5EB9A 4HZLA 4HJIA 3ROLA 1J1XH 1P5VB 4CBZA 3D69B 1GGBL 1R34A 4I3SH 1YJDC 1CK0L 2UV3A 2YD6A 3L5HA 4NHCH 5D4IA 3AQDA 4IIQC 5A6LA 1N4XH 5EBLB 1JWUB 3DX6B 4XXDA 4L37A 2GBTA 1JERA 1LP9B 5ESQA 4UAOB 1U8IA 5E4OA 4FQCH 3ARFC 4S0SD 3CX2A 4N1CA 4U05A 5AZEL 1HYSD 3VU1A 4LVOB 3WIIH 2EIEA 4L1BA 4JVUA 2UXTA 1T6VN 4WW2A 3T08A 2NY5C 4NERA 4YHNA 1NWOA 3O41B 3DO7B 3FS9A 5DUBB 2HT2C 3TTSA 3CVDA 1NCAL 3EJPA 4L9LA 4CADB 3MGTB 5G5DB 2C3GA 2WVSA 2FWOB 4OT1L 1QUPA 1CGSL 4LLVA 3SKJL 3WV0A 2H6UA 2NUTB 1B6UA 2CA3A 2IDTA 4WO0A 3IDMA 3PAUA 1UEMA 1RFDH 4OCMC 3RIAK 1J5DA 1ZANL 3LEVL 2XZZA 1UH4A 1IFGA 1TOXA 1JHKL 1DHKA 4DP1X 1M05B 1JXDA 1DFBH 2DQFB 3PL6C 3G6JB 5ALBL 1B6DA 4DP7X 4FCHA 4YXLL 1G1YA 3MR9A 4OCRL 2PYFB 3WFDL 3UH8A 4AIZA 2XA8L 1N5YL 1JJUA 5K9JH 1KCLA 1FZKA 2DI9A 5KYWB 1X5IA 3R19A 1LO3L 3JQOB 5JDSB 7PAZA 1IBGL 4KXAA 5GZOD 2Q2LA 5E9DA 4Q56A 1BOGB 4TQ8A 2XTJC 1U6AH 2BNUA 4N86A 3D4GA 4M5ZL 1N70A 1XXFC 4B6ZA 5FFLA 3SDXE 3QWRD 3HS0A 4WWID 3S7GA 4UT9H 3AROA 4MXQC 1IKNC 3GIZH 5FW7A 5CMAA 1DSFH 3CD4A 4OGZA 5DEJA 3NK4A 4MZRA 3IDXL 2AXWA 3EGSB 1T2JA 4U1KA 1MFCL 4JNXA 4ZPTA 2PR4H 1PFCA 3E6FB 4LLDB 4Z0XA 3IGAB 1H6FA 3B2PA 3VX1A 5I71B 3T6XA 5D72H 2FWSA 1SHSA 2EABA 4ZJ9A 4K07A 2V2TB 1FFPA 2R0LH 1QW9A 4NM4H 2OR7A 5E4IA 5DZJA 3X13A 1I3RB 4OZIA 2F7QA 4IJTA 3D9AH 2AK4A 1G7QA 1PZ3A 4I1PA 1U92B 1D9KB 2C5DC 5ABAA 3GMPB 2VDQL 4WK0B 4WWKD 2C9AA 3E2HB 4PRHD 4Z76B 5DXWA 4UB0H 4JM2B 2P45B 4ZK8A 5KYUB 1BEYH 2KERA 4EBQL 2DEYX 4QHMA 4K7PX 4TL5A 1O7VA 3CFBB 2BFVL 4B7IA 4KK6C 3E3QC 2RB8A 1F8TH 1B2WH 3H42L 5BO1H 5D7IB 5E6YA 3GSXA 1WD9A 1WCBA 1I3GL 2CHZA 3C6LC 4GIPD 4N8VB 1XB6A 2DMCA 2NY6B 4O58L 5E4EC 1DBJL 4RMRA 5BUGA 2YQBA 2CKNA 4JRXA 3SYOA 3UZEA 5JHLH 1TJIH 3FU9A 5HY9B 3IFOB 4DN3L 1BLNA 2CO6A 4YPJA 4IBVA 3BAEH 3BXNA 3DX4A 5DI8B 3NCWA 3RI5K 3SE6A 4A37A 4ZUVB 1YEWA 2FK9A 2O6DA 3GBML 2YJLA 4WLCA 4YDKH 5FDYA 3K6IA 4HX1B 4KNUA 4PG2C 1RIVL 1QASA 3G7TA 4CMHB 3WNMA 1RIUL 4X6FB 1M6OA 5AW5B 4KY1H 1KIRB 4BDVB 1FVEB 2C7FA 4QT5B 3X1EA 2VQ1B 3FSAA 2UY6A 2X89A 1HJBC 1QI5A 3CN3A 1O7DE 3FCBA 4HJ1A 4IHOB 4K23H 5EO0B 3U7YH 5I19L 1J5CA 3DVNA 3OJDA 1UYWL 3HLAB 3OPZH 1Q9WB 3EGXB 1TQWA 1U42A 2R83A 5CCGE 1QRNE 1J5IA 4KAQL 1UCBH 5K93A 2IDFA 5FWQA 1A3QA 5DJAB 1YPZB 2DYPB 5D2NC 5IEHA 1Q9LB 3S5YA 2JCCB 1M3JA 2R2BA 3CSTA 3WL9A 3G5XA 3VAEA 1J0ZA 5T3XL 1J5OH 5IW1A 4TNWK 4B96A 1KFGA 5MERB 4DPCX 2E9GA 4ZQKA 1R5IB 2UVEA 2VB5A 3DOSB 4Z3HA 4BKLB 1TEFA 2J4WL 3SQOH 1MCCA 3GS7A 2JKTM 1FNEB 3CH1A 3RDTD 2QDWA 1OZTG 3M07A 3HVNA 1IKFL 3K3QA 3WHE0 3FC8A 1N5AB 1TU2B 2DJSA 4YOKA 5PCYA 2OL3A 3GHBL 3S3SA 1YMMD 2E9BA 1LMIA 3OV6A 4H2CA 1YEHL 1OP5H 1IGTA 4GW5B 2CWRA 2RACA 5GJTL 3QDMA 1MQKL 3L4ZA 5CR8A 4NZ8A 5JDJA 4LDLB 1SZNA 1U58B 4GJTB 1VADB 4EI5B 2V2XA 1PS3A 5L2JA 2X6BA 1J8RA 3X3GH 4MCYB 2WXRA 4NNYB 1PZAA 3DX9A 3MCYA 5T1KB 3KPOB 2WGNB 2W9LA 2WXIA 4JCWA 1RAMA 5JO5B 2X4SB 2P3YA 2DQUL 4K5PA 3HNTL 2OSWA 1IBZA 1ID5I 2F5AH 4YDVB 4H44C 4WEBL 1NGXB 5DLLA 2BRRL 2CSPA 2MJWA 1EHAA 4KGLA 4MB1A 4F2EA 4KY2A 2R23A 4P2RA 4PWKA 3OKNB 4I4WB 2CGRL 1USQA 2EXWD 4LMQI 3JWOL 2Y36L 4JVWA 1MEXL 3K2KA 4OLUH 1V55B 5I66A 1EERB 3F6IA 4IU2A 4X9HA 2A77L 2V7HA 2B39A 2WUBL 4X7CC 2VLMD 1QEWB 1G4RA 4GUCA 4KX7A 4U1SA 3EXJA 3GNMH 1HXMA 5E6IC 3H3PH 4QJ3B 3TIDA 2HA1A 3ZR5A 4F7TB 4LCCA 3FJTA 3I6SA 5IOPB 3TO4C 3ESNA 4KKBC 4OF6A 3RY4A 1PNCA 2R69H 2HMIC 3X12B 4OCXH 5SWZE 2Q8AH 2KPNA 1EVTC 4TSAL 4KRMB 1WF5A 3T1WA 4XXCA 3X1GA 2LU7A 4KUCF 2YLHA 1TO4A 3PQYE 4OIBA 2NDFA 5AB2A 2W8CA 2OKMA 4QJ4B 5KVDH 2HXAA 3CN1A 4HUNB 5A43C 3DTXA 3ZHDA 1A1NA 3ILPB 2AXJA 2VDMB 4FQCL 4XN1A 4D3CL 1A4JB 1ACYH 4XZUB 5DJZA 3K91A 4OZFH 4X4ZA 3UAFA 2XRAL 4E41B 4U3SA 3ZJAA 3OKKA 3VYNA 3PHOA 1MN4A 4APQA 4H1LG 4D94A 5TD4A 5E0FA 1WAEA 3P30L 3QDJD 3D52A 3NA4A 3KEHA 5DLML 5EORL 5LWYH 3B5TA 4LOVA 3LTVA 2D7TH 1QFWL 1NWPA 3VW3H 5D6DC 3DA0A 3ISRA 2B0SL 1KXQA 3VCLA 3LKQB 5EOTB 1FGNL 4YWGH 4OVUA 3U46A 4HBCL 2B1HL 3U83A 4UMGA 4DVRL 4TNVK 2KZ1B 3POHA 4OY9A 5D2LE 3WE1A 1RFDL 5F1KC 4KGJA 4DETA 4WHTA 1M7UA 1P2CA 3TP4A 1INQA 4HHAB 2W9EH 5C8JB 3GZKA 3FOMB 3SIKA 1KB5L 1E4WL 3GTVA 1RSFA 2FLMA 2NY3B 2R2HA 3GSVA 4K8RD 4ZD3L 4CSZA 2X87A 1KT2B 1S7SB 2WKGA 3I2CH 5CCJA 1ULVA 3HS9A 2ADFL 3EFFA 4TYUA 1FZJB 2AKRA 2GCYB 1T5KA 4QRFA 5I0ZA 5JOFB 4WNSA 3HAEG 1TSRA 4AG4L 5KSBA 1JZJA 4ODXB 4KPHH 4AVIA 3HG5A 4Q97A 3P4NB 2NY4B 2CCWA 2CLRB 3AFLA 3QEHA 4AZ8B 5E1GA 3QWNA 1A2YB 3MOAL 1MCIA 3BKCL 5IHUH 2DJMA 5I0WA 5KSAC 1NIAA 2EILB 1UD5A 2NYZA 3DBXA 5KS9B 5I6XC 1KWKA 3HRZA 2YBRA 4FQXB 3DTUB 3A47A 1AFVL 3QPXL 4R7DA 4OU3A 1IQDA 2W07B 3P9WB 4PRIB 3H9HA 2EIBA 3OQ3B 4PD4J 2X1OA 3HI1A 3A0OA 3D0AA 1KBGL 1QFHA 2XPGA 3DO7A 4FD0A 4P4KA 1A7QL 1WQVT 2C9XA 5CP3H 3QCVL 5K1JA 1E2VA 3RB5A 3SPVA 3H7LA 5DRZA 3SCMD 4PGCB 4WDIB 1TJHL 3HZVB 4R0LB 2NY1D 3WJJA 4B9KC 5E9AA 5DMYA 3QCUL 3S3BB 3FQXA 4FQJL 3EO1B 5GRJH 4DP6X 4DKTA 4PCTA 4L18A 4PJDA 1IFRA 1NPNA 4K7PL 5I17A 3RWGB 3WNNA 3ZSTA 5ICUA 2YEZB 4FFWD 2BHUA 1S7XB 3AM8A 1BJMA 4MS6A 2XPYA 4HC1H 1U30A 2CH8A 2PWFA 1QI4A 3C6SB 2Y5EA 1DJZA 3KR3H 1YEDA 4NBZB 3HVDA 2QPFA 3TFKD 2V2WA 1DLHA 3ESOA 4XNYL 5A6MA 1TVBB 2CMRH 4OLYH 1FVCB 5E2WH 2D0GA 5FHBH 3ECQA 4F8PA 1CBVL 3FONA 1KJ3L 4XAWL 4X99B 5IVOA 2WBJC 2VQTA 3JWNH 5T1MA 1NOAA 4B41A 3MBXH 3GGWA 2QL1A 4OZHA 3DUHA 5IROC 2IPKA 2VSDA 2K6WA 2NX5A 3QAZB 2AZAA 4RESB 2AEQL 4F33B 1TCRA 3NSDA 4FZ8H 3KBHE 3VFUA 3OXSA 3SDDC 1GY2A 4KY1L 1DJWA 1EFQA 1KTDA 1EO8L 5CBAB 3KPSD 1KLUB 3S3PA 1RURH 3TBTA 3VXTA 4F3FA 1HL9A 5C3IA 2IALB 1TQBC 1WO2A 3RTLA 3V6FB 4D0BA 4J6IA 1XAKA 3S3CB 3VDAA 3ZLQC 2A1WH 3VM7A 1X5MA 3B2DC 1IBBA 3ZL2A 1XD0A 4FP8H 4UQ3A 3QWOB 3UPCA 4Z7QB 4Z7OB 4RFEB 4KKLC 2BDNH 3UBXI 5HHMD 2H1LM 4LHUB 3BVXA 2NR6C 2E7LA 1CGXA 3MLYH 1ZVSB 4PRHE 3ARDA 2D7MA 5H2BA 4NQDB 5C86A 1IEBB 4E0RB 4DEWA 3SO5A 3EAKA 2HCZX 3BW9A 5C07D 2A0LD 4N2KA 1J12A 2C9UA 5CBEB 2GAZB 1QQDB 3F7KA 1QSFD 4HIEB 1BM7A 1A9EB 3OKEA 3PDGA 1NKOA 3ZU8A 1OAZH 1D5XA 3DK0A 3T4YA 1KIUA 4HETA 2Y5TB 3OAYK 1DVQA 1BG9A 4MASA 2NSXA 2IH3B 8PAZA 5BRZD 3NIGB 4XVTL 3FQRB 2IQAB 3QB7C 3BQUD 4RCAA 4KQ4L 2C9RA 4PQXA 5K9OB 3NTCH 4GMTL 1XB3A 2YZ1A 2H0JA 4ZMNA 1QFWM 5EIQA 3DDGA 2VSKB 3TJEL 3CHOA 3RVXD 3ZYIA 5DD3L 3QUZA 2YR3A 5E2TH 4Q9CA 4N2CA 2FUTA 4KVCH 2D4FA 4XMKH 5ISZA 5LHDA 3ZQXA 3IETA 2JQMA 4FXGB 1UT9A 5G2NA 3NGBC 1RZJH 2VO5A 3NJVA 3H54A 4OLUL 3FQWB 3DGCR 5KJ4A 3S4SA 1FCGA 3LCYA 1XH3B 1DZBA 3MKKA 3UGUA 1I7ZA 2IBZY 4K7FB 4LBEB 1VGKB 1LK2B 1C7TA 1CR9L 1CZ8L 2OMXB 1BQHB 4MMXC 4N20A 2H32A 1KYOJ 4B9IA 3HG1A 4K2UL 3ENEA 3TF7C 4FJZA 2VLLA 1HCYA 1HWHB 1M1SA 2ZPKH 2YD2A 1Y6MR 3O6FB 4Z7VA 3A6OA 5B38A 4Y4KB 3MRNA 2GUYA 1SYSB 3MCLL 4RSYA 1GTFA 4UU9A 2CKBL 4AT6A 3LD8C 4GP8B 1WWWX 4PRAB 4FKEA 1RI8A 4OD1H 5HYSG 3NABL 2DM4A 3AREB 4Z95H 2E74C 3GFUA 5GGRA 3W38A 5GSRA 5KVDL 1CFMA 3HUJE 2C8NA 4UCFA 5KOMC 4LXFA 2YK1H 5CZXD 3TBBA 1URIA 3HKFA 1YMME 1PLBA 1X5YA 3LKPA 4DPAX 4DGIH 5I1LA 1D6VH 2IPUK 2NXYD 2WCPA 3HPJA 2K3TA 1T1YB 4OJFL 4IRJB 3VACA 1V3KA 1YQVL 5DJ2B 3V0VB 5E8NB 2IAMB 2GJRA 2CLZB 1OF2A 4ZZFA 5IHBA 4JFDA 3EYVB 5ADOH 3ISYA 2PXYC 4EI6B 2HUEA 4U6XA 2PO6C 3TBCA 3ZE1B 1EVUA 5LWYL 4LPUA 3QFJA 4PJBE 3G04A 1CG9A 2IADA 1NDTA 2WBWB 3IKCA 4OKDA 4DKFL 2KQNA 3WJMA 4FL4B 1UD2A 5H94A 3UP6A 5HPMA 5AW0B 1BFTA 1J7VR 3SJVD 4KVNH 3C5JA 2EE9A 2W9EL 3LV3B 3RY5A 1BQUA 5CJQH 2VLME 3DJ9A 3VI4B 2J21A 5FGBA 1T1XA 2AK4D 3CMOL 4AM0A 1K72A 4K9EL 3ZDXE 1NFIA 4EI0A 4FMVA 2Q20A 1NL0H 3MJ9H 4FG2A 4HJJH 1H8NA 2VUKA 3VYPA 3AG4B 3MZTA 2D3JA 1A4KA 1B4JH 3OG6B 1JRHH 3WE6B 1NGWB 1ED3A 2XWRA 4ABQA 4MGXA 4N6QA 1WAAA 3T6WA 4OVVA 1O5PA 1DANT 3IDYC 3M46A 3FTXA 3H0TB 4Y4HD 1BVLA 5LGJA 4W9GC 5SWSD 1NZRA 2O5YL 2VXTL 4PGDA 1M53A 4LVHB 1S7QA 4Y4FD 1WFIA 2DI7A 3D1MC 4J4PA 3ZW3A 4QRTA 5FA3B 1CFSA 2Q86A 4WK4B 4JRXD 2WY3B 1RK1B 2ICEA 3KPPA 3CSGA 1YECH 1T20A 4AQEA 4HWZA 2H2PC 3OL2A 4TSCL 4XBGB 2HKAA 4NIKB 5CUSH 2TSAA 1I8UA 3UG3A 3FOLB 2P46B 2G9KA 4XC1L 2AEIT 4UT7L 5B22A 4KU1A 5CHNA 4LPCA 1MCDA 3VSVA 1X5JA 4Y1SA 3FPYA 1U8JB 5ITFB 3Q2CA 4JM2D 3A4EA 1A14H 4MMZA 3MNWB 4I77H 1BF8A 2Y7SA 1CT8A 4MXVE 2VM3A 1QVOB 4KJWC 1MG3C 3A6CL 5GSVB 4M29A 5K39A 4H88L 3IFPB 1Q0EA 2APBA 4I2XA 3F65A 1JGDA 3CN0A 4OJAA 3QO0A 4F9LA 2ESVB 3DMMA 1OLZA 2GTWB 5L7XH 2VRKA 3ATDA 4CUCA 4J12A 2ENQA 2CO7B 5J6GB 1XB8A 2CUMA 2WOYA 5DJDA 1N8ZB 5DHYB 5D9SB 3SQBA 4LP8A 4GFTB 4XCYA 1MJ7L 2ZCZA 3O11B 4XWOD 1EO5A 3IMBA 3I84A 3NP3A 4TNGA 4TLSA 1DJIA 4UBDC 1NBZA 4JPSA 3P77A 5BZZA 5LBSA 4PJEF 4Y5YC 4JO3H 4JZJB 3NH7H 3VFGH 3N44B 4HDIA 1KYAA 3VRJB 1JNLH 1TITA 5GRVK 3NPSC 3QDMD 3MMEA 1NJ9B 3T04D 3FN9A 3MLWL 4KK5C 4N90D 4U1MA 3QO1A 1ZT7A 2F7RA 5HHOB 2XNAB 1WCQA 3B34A 1JOIA 4MCZB 2W0FA 5DRXB 4ETQB 2C7UA 2DYPD 2CBTA 3V9EA 4QRAA 2QBWA 1NFDA 5CWSB 2KZWA 4MQXD 4A7TA 8FABB 1HQ4B 2BNRB 4XRCA 3KJ6L 1E42A 1UXWB 3R8BB 3FB6B 4P46B 5KN5B 1ZTXL 1HL5A 1RIHH 4XNBA 4YBLC 4B3VA 5EDSA 1EJ8A 4Z7NF 3A5VA 2XQ0A 1NOLA 3CUPB 3AXHA 3QPQD 5KVMC 5BMFH 3FQ1A 1OQXA 1BOYA 2X4UA 4JUTA 3R4RA 5F72S 1EXUB 2AJYL 2EO9A 4I13B 4NZUL 2XX1A 1V7ML 3BP6B 3KYAA 3REWA 5F9JB 4ZRGA 2GJ6B 5F71A 5HHVL 4Z7UE 4AQOA 3SKNB 1WIPA 2J5LC 3EH2A 4RISH 4OGAD 1U3HA 1KTKE 1N59A 5JLZA 3CFMA 4A38A 5DMIH 5DJCB 3W2DH 3LN4B 2OZNA 4N28A 1SN5A 1OAZL 5EUOE 5C0EA 1TCMA 1F0LA 4R8WH 5BVPL 4EI5D 3HNVL 4J6RL 4LKXA 1JUFA 4MDIB 2B8OT 1IAKB 1G7JA 1YUHA 2WPGA 3UDWA 1NDGB 3FFCB 3WEMA 5GS3A 2DTMH 4X80H 3W9DA 1TF4A 2C1OA 4G7YH 4MAUL 4M3JA 4FFVD 4IS6A 5JOEA 1G6RH 4I0PD 4W4OC 3ZL4L 4AYSA 1ANUA 1OOWA 2QTEA 1F4HA 2DQHH 1YC8A 1AD9A 4J1UB 4IYKA 1ZT4B 1L4IA 4Z1PA 4O9HL 1AXSB 4YFDB 1TZHB 1GZHA 1DUYA 2UZIL 3S37H 1WWBX 4DGVH 1GC1L 1KCSH 3PWJA 3KMDA 1C1EH 5GGTA 2GPZA 3IXTA 4CSTA 2GY5A 2VC2L 2LE9A 3KPSE 3S37X 4NQXA 4X7DC 2ZONA 5H37H 2OZ4L 1Y18B 3IK2A 4MKTA 1PMYA 5FM4A 1G7PA 1Z9NA 4FGMA 3V2AR 5GHWH 4Y19A 4J3XA 3WXVH 3SDAC 3CE1A 2ZPKL 1NEZB 4ODUA 2GK0A 3TL5A 3P0YL 4H8VA 5HHME 1BZ9B 1QLEH 3OKDB 4XH2A 2FATH 2EUXA 3I9GL 2H8PB 2NNAA 2UYLA 3PXLA 4ZSOB 1IBYA 2AS5M 5IKCB 2BVQA 2ZOKA 3QNZB 4PGEB 3VFTA 4IM8A 1CL7L 2ZAHA 1HKLH 4ZTOH 1TLMA 2QFPA 4X9FA 4H0IA 4Z8FL 2Z4TA 2B14A 1RUKH 3JTBA 3IXAA 3RIFK 3SKUD 1JN6B 2J3SA 4RSVA 1WZLA 1HOCB 4U1GC 5C07E 5C0GB 4AYMC 3M45A 4NJAL 4JCLA 3TN0D 2I9LB 1DE4A 1QSFE 4LSRH 3CIAA 3B2UC 2VISB 3DOHA 2EACA 3PFUA 4PJXE 4XVSH 4YZFF 3TT3H 2J8UB 3H9SA 4OLVH 3RL1A 1UADC 3ZHFA 1H8SA 2IAMC 4R4ND 2W88A 5DDHA 3L3OB 3LVEA 2ZD0A 2SODB 1DVUA 4OIFA 5L0QC 1IM3A 3ZKNC 5KVGL 2WLLA 1FYTD 2IGLA 1JZFA 5BRZE 4KITB 3EJTA 3NSXA 1CIUA 5GGRY 1SEQL 1K85A 2APVA 3IU3B 4HUXA 1NKGA 4NUMA 3GPSA 2VDQB 4OW6A 5I6MA 4G43A 5I0YA 3GMMA 1N6QL 1EV2E 4NAJA 3MAWA 4X7EC 3ME0B 1QYGH 3AS3A 2K9UA 2VXQL 4M6MH 2JKSA 3O8XA 2AEPL 5C09A 4LCWB 3BESR 4IOIA 3NIDE 2PF6A 2NY0B 1NAKH 2YA0A 4N9GB 2OTPA 1S7UB 2XIIA 5BNXD 3SE8L 1ZSDB 5I1AA 1S7VA 4Y1AA 5E7BA 4FABL 4FLHA 3VXPA 5SV3A 1IGJB 2N56A 3HMXA 3W82A 1MUJA 3MV8A 4I18A 5E4AA 1DBBH 1BEXA 4NPYA 4M8RA 4WV1C 4PJGE 3ARBB 3MGOB 3ROOB 2GC4C 1PSKH 1UUNA 4PJCA 2QR0A 5FGCE 4PGBA 3MNDA 3KPLB 1MCPH 5I1IH 3L9YA 3U0PA 5IF0B 1ZT1B 4FNSA 3FT3B 3L1FA 4AGNA 1IC5L 3D33A 2WTRA 5I8CB 4YX2H 2MPVA 3OZ9H 5DO8A 1PZ2A 3MLTB 2V0AA 1V54B 3OMZA 4KZ0A 2FX7L 4MAYB 4TRPH 4GSRA 5T1DL 3VFOA 4AGMA 5BQDA 2EYRB 4NHUA 2ZXEB 2IGFH 3BZ4B 4HUVA 5F93C 4X4XB 1EEYB 3NFPA 2Z31C 3MVSA 4I0CC 5INCB 6FABH 3PS6A 3QI9B 1AG6A 1SJEB 1AGCA 1GTNA 4F9PC 4KWUA 2AITA 1CICB 4KXZH 4PJ9B 1MSPA 5IVXE 5J7CC 3B3IA 1HFUA 1WITA 1ZRUA 3VGAB 5BZWB 2J1WA 3SZKC 2IXQA 3DPBB 4YR6B 3G08A 4XN5A 4WTWA 4GO6B 3ML9A 2VR9A 1MREH 5ECJE 3RNQB 2P4AB 4B9ZA 2WVVB 1JVOA 3BKJL 5DO2C 4EZMA 3E8VA 1E6JL 1PD6A 3THML 2G30A 4ODHH 2OMZB 1IAOB 4PJAE 4POYA 3N1FC 1UHVA 2VR8A 3EG9A 3D4CA 3HN8A 1EAOA 1RLWA 4JFPB 4PJIF 5AWNL 5E1AB 2GEEA 4PJBA 3C6EA 2R1XA 2WMPB 1NGQH 4NKMB 2ZOUA 3SJVE 5ANMA 5I5MA 2WB1A 1JCKA 3HFFA 1CYGA 2CO4A 5DU7A 4TQHA 1I1FB 3U6XA 3PGCB 1A6VL 2Z0UA 4N1EA 4K9JA 3P2BA 3G6JE 1HSAB 2DB8A 1GOGA 4LIQH 5AOKA 1T89A 4HS6A 4E9VA 3Q48A 1OTUD 3GSRA 2ZCKL 5KOVC 1O9WA 1KCKA 4X9IA 3V7AG 5IQ9B 1C16B 4XVJH 1BIIB 2WOBA 3MUGB 3BX7C 4KHXL 2EDBA 3NUKA 2NQ3A 5TE4H 4EIUA 2RFXB 3ZMEA 1GYWA 3E0GA 3TZVA 1Y1UA 5I6OA 3FB5A 4PRPB 3QHTC 3HBPA 4UQIM 4X6CE 4BXVA 3L45A 5SWSE 4ZMWA 3QIWB 3GMQB 1O9VA 1JF1A 3FT2B 5AW8B 4E9XA 3QHZL 2F54A 1SOQA 4F2ME 3T2NL 1L6ZA 4N5UA 1MFAL 4PRDB 5TE6L 2R7EA 1J88A 1S3KH 1KYOK 3KDMA 1OM3H 2XBZA 2YOCA 5GGSA 4PEEA 2BHZA 3KBPA 1L0QA 3VTAA 1EGJH 3AU1B 4OKVA 4IIQA 4AY0A 4O2FB 1HYRC 3SBRA 1JNHA 2HB0A 3B2VH 5CIPB 4PIRF 1HT6A 2DLFL 2Z8SA 4O4YL 2A73B 4AMKH 3RUGF 1IGCH 1QA9B 2MNJB 5B7MA 4L3ED 2Z4QB 1KGUA 2GUOA 3ARFA 3GSQA 2RALA 1UA3A 5C9KA 1XGYH 1DUZA 2YO3A 4LHUD 5I73C 3KPQA 1FV1A 5HI4D 4YZWA 4A2MA 2A5UA 1BJ1J 1K4DA 4FF9A 1R3IH 1LLAA 4GW4B 4IHBA 4WU5B 1HWWA 2Q8BL 3IYLW 3MJ7A 5DWPA 3ZE2E 3RVWD 1QWUA 3FB7B 1YN7B 1DO5A 4HPYL 4HV8B 2AJZA 3DC0A 1A1MA 5I9QC 1I8AA 4RISL 3UTZB 5AB9A 1ZHBB 2PYED 2X09A 3B6SA 3D07A 4I5BA 3S5LB 1GOHA 2KBGA 3G5VA 2GSGB 3W2DL 3V4VL 1AKJB 3QJTB 4Q89A 2DPKA 4L4TB 3F58H 1KGIA 4IBUA 1MWAA 1JZ8A 2KLRA 3ETSA 1XX9C 1ITCA 1GZPA 2XWTB 1J0YA 3FQNB 5GRZA 4X5XB 1HOEA 4Y5VA 4O2CB 4QD2E 5HGAB 4AEEA 4L8SC 2Y06H 3PL6A 5DQDL 3L9EA 3RWHB 1RULH 4M7JH 4XMTA 3IGFA 3TA3A 3JWDH 3ISWA 1EDHA 4JY4B 5CLZA 4R97B 5G4OA 5ACZA 3RHWK 3H3BC 3HCVB 4F80A 1LMKA 1RJCA 1I1YA 5JPNA 4HKBA 2R0KL 2WN3A 4NYLA 4WI0A 5T33H 2IV9A 1HIMH 2XFGB 4N90E 3UTTD 3HE7C 2Y7LA 3NJKA 5HI3D 1D5ZB 2BHYA 4JFEA 2VOTA 3BUYB 1B0GA 4AMXA 3B1TA 4ZW5A 3TO2B 3QUMH 2LGNA 3BZEA 1IKNA 3BO8A 4PJ7F 4JGJA 5MHSE 4PN6A 3WOVA 1YMHA 1U91A 4B9PA 5DZNA 1IC4L 1T7YA 3U30B 3QIUA 4ZMOA 3EJYC 1OK0A 2EUWA 3SDYH 3MRIA 3ARED 2MKWA 2DL9A 1LO4L 3VXQB 4GSDL 1C8QA 2XG4B 4HFWB 4P2QD 4DUXA 1T5WB 1E30A 1OLLA 2D7NA 3BUIA 4IDJH 2RR3A 1TJGL 2ZYHA 3D05A 3PABB 1MAJA 1XH0A 5BOPA 2P43B 4QXUH 4KKRA 1PX3A 4P5TD 4QRUB 4BWWA 3PGFH 4PCKA 3O4OB 3OKLB 4LASH 4M62L 4P3DA 1E4XH 2FAUA 1RP8A 3U9UB 4PJHF 5FOBB 3CDGA 1W0WA 2AQQA 2WZ6A 3WS6C 3NCYP 3NJLA 4Q0XL 5IVZA 3WEOA 4A6YL 4KQ3L 3TVMC 3KH4A 1KNOA 2DQIL 2ADGB 3BRDA 3F3HA 4F8QA 2FB4L 3C60C 1TKWB 2CDEA 5EZIL 4JPKL 5GJSH 3UO1L 3L1OL 3QEGL 1S2EA 3PWLB 3QULB 1OAKH 2WLYA 2OULB 4KVPA 1SHWA 5AQ0A 2X5PA 1F45A 4ZO8A 1LEKA 4M5YH 1FNAA 5DYOA 3IDNA 2IFFL 5HYFA 2VITA 3DRQB 1C5DA 3WN5B 4PG2A 2JKWA 1AR1C 1BFOB 5TTRA 4JHZA 1GSMA 3SKMB 1FAKT 1Q72H 4UOZA 4AM0Q 5DMGD 3RJQB 1OTTD 3F5WA 3MXVH 2W0KA 4IGBD 2NQDA 4Y5XB 2B7DT 3ARYA 2AANA 4M7KL 4QRPD 2ERJB 1PSKL 1WK0A 1ZV2A 3MRDB 4Y7OC 2D3VA 2VTFA 4FQQB 4GW1B 1DVFC 2L04A 1KJ2H 2QQNH 3VXMA 1ZGLM 2Q76A 5D2NA 4L05A 5DSCA 4R90H 3FO2B 4NQQA 1E6OH 1FFNB 3K5SA 4JGNA 3DMMD 3HZMA 4IJ3C 4TVPD 4ELKB 5AVSB 2CCVA 4D8PB 3KZ8A 3MRBA 4P3WA 1IQWH 4JREB 2YN5A 4Y16B 2AQ2A 4QXTA 4RDQG 1NAML 3F62A 5AZ2L 3A67L 2NNFA 2BVYA 3X11B 4KH2A 2H3XC 2PPFA 3D18A 3FHAA 4LPVA 3INUL 4J5VA 1AY1H 5KJRL 1ZLDA 5IW6B 4PS4L 4MJ6B 4UIMB 1FYTE 1VZHA 1WC7A 4ZMQA 3QZNA 5HHXH 2NYYC 1X4XA 4KHTL 3V0WH 4MZ3A 2ZSWB 1MZYA 3A24A 2UWEF 4GI6A 2FYYA 1FORL 4JHAL 4X7SH 3RTQA 4G9FD 4JANA 3RE0A 3N5AA 2VDLL 5E8DH 4WY7L 4UNVA 1HU8A 4J8RB 3KPRA 2R2EA 3WUWB 4FQPA 5J3HD 4LLWB 2V5MA 1C5CL 2EDEA 4W9EC 1UB6A 2NCEA 3K8KA 1BZQK 2Y07L 4G6JL 2ESVD 5F2FA 3O2WH 4L3AA 3VXUB 3QORB 1P84K 2G2NA 3FO0L 1Z9PA 4PTTB 4TUKH 3TBSB 1GJIA 1MF2H 1TTRA 3LKNA 2BNQA 2N7SA 1DQJB 3FKUS 3VFVA 4RDQF 5TK2A 1E67A 4R7NA 4WJG3 4O02L 4OGXL 3T8VA 4MLSA 5LNEA 1QW8A 5EC2B 5CCKH 2AMUA 4RMUA 4WFED 1GCYA 2EDJA 4EUPH 2D03L 3KW8A 2LFEA 3KWWA 3MCKB 2NZ1A 1K6QH 3C2AH 1AHMA 2IDUA 1FNSL 4P9HH 2ODHA 4XX5A 2BHFA 2E86A 4WW1B 3X3FL 2L8AA 2NY2B 1VEPA 4PP2B 1P5VA 4AJWA 3IJYB 1O7SA 4Q9RL 5KS9E 3LPPA 2WXKA 3ULUF 4KJPC 4M61A 3LKOA 3ULVD 3LN5B 3S3DB 3FHQA 2V3EA 2EH8H 4MYWB 1VEMA 3D2UD 2CRMA 3B37A 4NNPH 3ZXAC 1EEZB 3QQ9C 1HHIA 4S1QL 1JWUA 1S3KL 4EMZA 4CMMB 4PW4A 2EDWA 1I7UB 1IBDA 1CDCA 2EO7A 4PS8A 1LP9A 3HPLB 2AXFB 1KCUH 5DJ8A 4X8CA 3WYRA 4IOFD 1AO7D 4JPWL 3UBGA 3ZIYA 4ZMLA 2G4GA 5A6IA 3O41A 1P7QD 2CKBB 3NK3A 4ZPVB 4G1EA 5EU5B 2XZCL 4AGPA 6CGTA 3I3EA 2Q9OA 3CG8A 4P57B 3MGTA 3NZHL 4OGYL 1S9WB 3GK8H 4TLKA 4DKEH 1FBIL 1JVKA 4R2GD 4MNGE 5D6DA 3US0A 1Z1WA 4MMYB 1I82A 2KLSA 4QNPF 9CGTA 2OK0L 1FC2D 4PS7A 1XIWC 2IV8A 3U4EA 4OZFB 4BKTC 3IVKB 4IRSB 2IMMA 1KXTB 2VYRE 1IJ9A 2IF7A 4A1RA 4BZYA 5HGHA 4BUQA 1FL6B 1M05A 3NFSL 3FFCD 4ZAKB 4UOQA 3TEZA 2E0PA 2ZUQC 3S34H 43CAA 4PIBA 1SGKA 3PHQA 3Q01A 1H9DA 2PYFA 1F3DH 3OLIA 5FW6A 4M5SA 4EJ1C 1SUHA 1W0VB 2XV6B 1S9VB 3QXAB 5TQ2H 5KYWA 5E5MB 2CG9X 7FABL 3EGDA 4PS3A 1JMZA 4OUUA 4OZGB 3TCLA 5TE7L 3VD2A 4FYRA 1W8NA 4CNIB 2PTUA 2CK2A 3L3GA 2ROYA 5JXEA 2YPVH 2R9HC 3BSZH 5HBBA 5DD5H 1MELA 5KSAA 3HZKB 4EF3A 1ZDSA 4POZC 3CFEB 2GITA 3NCXA 4WU7B 1IBHA 4OD2B 1G94A 4L1HA 1RLBA 3EGSA 5DZAA 5HSFA 3GBEA 1CFTB 1LE5B 3QUML 4L3EE 2L7UA 4LLDA 4Z7QE 3L5XH 1X9UA 2CNYA 3O8XD 1ZLUK 1NCTA 4YE4L 5DHDA 2V2TA 2DDQH 1GIGH 4NQDE 5LGHH 4YFEA 4RQQB 3SPHA 3UC2A 1U92A 5BQ7A 5JQHC 2Y9RT 4Z76A 1J1OH 2HFEB 2KC0A 5KYUA 2QVTA 3WO4B 1JYXA 1SLXA 3D12B 3IGKA 4NUPA 2YUXA 3DX0A 3FTGA 4M7LL 5DD1L 2FJGB 4JUSA 4EXPX 5ISZB 5DK2A 2EDNA 4TMPA 3CFBA 1GKEA 2WINB 4LLUB 4YXHH 1WZ1L 2PYEE 1W72L 1YYML 1ROWA 2PW2B 4LPXA 4WI4A 3HC2A 2YA2A 2VRQA 5D7IA 1EA9C 2CBOA 2OMVA 4DTGH 3CVHL 3U1QA 3BRGC 4G7SB 4GEJA 4LEOB 4N8VA 3NIGE 3U2IA 2WJ7A 2XG5B 4HS8L 1ILUA 2Q2EB 2VDPH 1ONQB 3K6SB 3CLEL 5I8KL 5C2BH 5HJ3B 3NBNA 2H1PH 3DXAD 1O6SB 1EFXB 4BHUI 1I9RH 1DQLH 1PYWA 1WIUA 5HY9A 1P6WA 2YRBA 2Q87A 4HJEA 4NGHL 5IMMA 2WBJA 4LCWD 3SBWC 3P3TA 4JVPA 5E94A 3QDGB 4BRJA 1I9IL 4N2AA 4Y9BA 5D6CB 4AEIH 3MLRL 3CVCA 4HX1A 5IROA 4NSKB 1PEWA 2K3HA 2OX5A 3D5OF 4X6FA 5A7BA 4FN0A 3PWVB 4BDVA 1KIRA 2H2SD 4QT5A 3NMEA 2WXOA 3WN6A 4EZKA 1P7HL 2K78A 5HD8D 1PLGL 3QH3B 5EO0A 3FMGL 4IHOA 5AAMC 4KZDH 5D1XB 2RJMA 2YAFA 3SDDA 1V7NH 2E9JA 2DYRB 3HLAA 3EGXA 5ETUB 4HEPA 4OQTH 1MFEH 1JS4A 5D70L 1TETH 2WWMD 5DJAA 1YPZA 2AXGA 1JZ7A 2DI8A 1Q9LA 2JCCA 2VJ0A 3BYYA 5C0JA 3NACL 3NCEB 1KTLB 5B4MD 2J1KA 2O6PA 2FJFA 5AFAA 4FFYL 1DQDH 1BG1A 5K9KB 1N0LB 5MERA 2R0ZH 3MROB 2OFQA 2VLJB 4ZFOL 4DVBB 1R5IA 3QI9D 2DMHA 3DOSA 4LRIC 3JV6B 4BKLA 1RUQL 3HB3C 3TT1H 1FNEA 3CAFA 4AL8H 2QMJA 4NC1C 3KYNB 2ZICA 4N2BA 4ODWA 3PCYA 5IB5B 1EHXA 3TONA 1FAIH 2FDBP 2GEQA 4OJYA 2ZNWA 4M6OH 5B7EA 3UX9B 4XNQB 4GKSB 3WIFB 3ULUC 1XF3B 1IAII 3J07A 4DP0X 1JK9B 2YMXL 5T3XD 3FULA 4PAZA 5D8JL 3OKMB 1U58A 1MRDH 4FX5A 1VADA 2AGJH 4XCFH 2P7TA 3NEOA 2NRDA 4MCYA 5T1KA 3CFJB 4I48B 3KPOA 1P7KB 5EF1A 2ZG2A 4LLMA 4BK4A 3QXVA 1KACB 1LWJA 1MQ8A 3GKWH 5JZ7D 5F1OB 5E6SB 2OJEB 4B9JA 3R4DA 1UCTA 4ZOBA 1NGXA 1K8IA 4QO1B 5JIHA 4RMTA 4I4WA 3EYSH 3SDCC 4JQIA 2WYIA 4GRLB 2V5RA 4B9FA 2MIZA 3ARFD 5BV7L 2CA4A 4N8CL 4H1LB 1VGEL 3T4AC