5AOKA

Structure of the p53 cancer mutant y220c with bound small molecule phikan7099
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aokA00
5AOLA 4L0YA 4MZIA 2VUKA 3KMDA 3EXLA 3QYMA 4GUOA 2J1WA 3WTUA 4IBTA 4IBWA 5AOKA 2AC0A 5G4NA 3D0AA 1TSRA 3US0A 3IGKA 2IOOA 4IJTA 2X0UA 1CO1A 2MEJB 2PCXA 3D05A 2J1ZA 2FEJA 5AOIA 3WTYA 3Q06A 2J20A 4LO9A 1HJCA 1IO4C 2YBGA 2J1XA 3D06A 3WTXA 1TUPA 1GZHC 4AGOA 3EXJA 1LJMA 2J1YA 2P52A 3VD0A 3WTVA 5ECGA 5ABAA 3WTTA 2OCJA 4L0ZA 4AGLA 5G4MA 4AGNA 2IOMA 1UOLA 1EANA 5A7BA 3WU1A 2BIMA 3D07A 4IBQA 4HJEA 2H1LM 2X0VA 5AOJA 3US1A 1EAOA 3VD1A 4G83A 2ATAA 2J21A 3D08A 4LOEA 4IBVA 5G4OA 4GUQA 4AGMA 3IGLA 1T4WA 1EAQA 4A63A 5BUAA 4AGPA 3WTSA 5AOMA 1H9DA 2BIPA 4IBSA 2GEQA 4L18A 2BINA 2RMNA 5KBDA 4XR8C 5LGYA 4G82A 1GZHA 2IOIA 2XWCA 3QYNA 2AHIA 4KVPA 3ZMEA 2WGXA 3KZ8A 3Q05A 1CMOA 4LOFA 2ADYA 2BIOA 2J6WA 3TS8A 4IBUA 3Q01A 4MZRA 4AGQA 4IBZA 1HU8A 3D09A 3VD2A 2XWRA 1KZYA 5AB9A 1HJBC 2BIQA 4QO1B 1YCSA 2X0WA 5LAPA 1E50A 4IBYA 3WTWA
chains in the Genus database with same CATH superfamily
2OP4L 4AENB 4F5CA 1J5HA 3BUYA 5I74C 1JV2A 1X5IA 3PXHA 4G9DA 1CFSA 1G7JA 1WFOA 2SEBB 4Y19E 4N2KA 4G43A 1Z66A 3GSQA 3VXRD 3GUTB 4FG4A 3MLUH 5DI8B 1P1ZB 3E9TA 4P04A 5K9QG 2V7NB 5IW1B 3DX3A 2C9VA 4PWHA 3Q1SH 4PSPA 1NL0H 1T2QL 4X9GA 1EJ6A 3K2UL 3T3MF 1KOAA 3N85H 3RWIB 3Q6FA 1I8IA 4OZ4A 4HU8A 2J88L 4OLYL 3FNKA 4J39A 4YDKL 1A7QH 3GD1C 1CE1H 3WN5A 2J44A 1Z3GH 1L6PA 1CF1A 1SBSH 1DQQB 4QRPB 5FPIA 2XWJB 2FEEL 5DJ0B 2JKLA 3LEVH 3S5LA 3THML 3ZZQA 4NRXA 2X1WL 3V4PB 1Q9KA 1SF5A 4FXGA 4AQEA 1A7NH 4YE4H 1PCSA 1QBMH 4HFUL 1KYOK 3G04B 1MI5A 1ZXKA 2HB0A 2XVLA 2E9IA 1NAKH 4L3EE 4CGUB 5IGXH 1HEHC 1P4LB 3KPOA 2X4QA 2VDRL 4JPWL 3BE1H 3Q0HA 1OTUC 3PHSA 5B3SB 1T5XB 2NTSP 3RGVD 1Y18A 3BVUA 1U3NA 2F58L 3QJFA 3PHOA 1FWXA 3VWJD 3GTNA 3I02A 4NQQA 4QDGA 5J0BA 5JPNA 1A5FL 3A47A 3VXTB 3D34A 1U8IB 4PAZA 1WIOA 1J18A 3BN9D 3JTBA 5D1QD 4PVBA 3HW7A 3QZOA 5EF2A 5HHXH 3QAZB 2DLHA 7FABL 1T03L 2NY7L 5BQDA 1MZYA 1A6AB 4FNTA 4NJ9L 5BOZG 4N8VB 3SYAA 4WFGD 4WU5A 5A6IA 2DH2A 3S3SA 2GEQA 1YN6A 4GJTB 4MYPA 4I4WB 2XKNB 3RVTC 1EHXA 3N6YA 2BZDA 1NC4B 3ZQWA 2GI0A 2R1YA 3VGGA 3S8FB 1RAMA 1YRKA 1TTGA 4AV5A 2NPLX 3F83A 4GW1A 2O6DA 2VIRA 2CKBL 3TV8A 4J3VA 4YBLB 4LVOB 1F4XH 5L9DH 4R4BB 3RAJH 1RFDL 5E9DB 3MDJA 1CDIA 3P3TA 3WN5C 5JNYB 1I8MB 1RD6A 3IWVA 4HWBA 5C8JA 2O93L 2W59A 4CVXA 4J12A 2GI7A 5HHMD 2C9AA 1S9WB 4FXGC 3BJ91 1NGXA 4MNQE 4G6MH 3ZKXB 5B4MC 1A6WL 5C0RH 1M1XA 1QQDA 3NA9H 3EHBC 1AD0A 1CGUA 1UWGL 4UIMB 4KZEL 1TXKA 3ZYJA 3QIBD 3IXAA 4UQAA 3O9WB 3AAZB 4G8EB 3ZGHA 3NRFA 3TCTA 5EF3A 5C0BA 4MASA 4YHNA 1XGPB 2ADJB 1FRGL 1LEKA 2UZXA 4AEEA 3NFNB 1CBVH 4JRYD 5KBDA 3Q8AA 1NGZA 3BKCH 1M7IB 2FBRA 3WFHB 4L9LB 3EGDA 5M94B 1S7UB 5JPNC 2E5EA 3QHFL 1AS8A 1FZKB 3IAQA 5ID0A 2FX8H 4HHGA 2ENQA 2Y06H 2H0FA 1OD9A 1XIWB 3MSPA 5C0CD 1M42A 3P0YL 1AXSB 5DZVA 5DS8A 3NJGA 1FZJB 4K0OA 5F7MC 1JCVA 4AG4H 2NTFB 4HSAC 4XC3H 2AVGA 5DRXB 3WTXA 2AEWA 5ICXA 3MRKB 3RDJA 1I1RA 4PS4L 3BWSA 4I1NB 2CD0A 3C6LD 1GGYA 1WEJL 1SJMA 1W9XA 1PY4A 2BSRA 5IVOA 3WIAA 1BQHB 2Y9RT 1M05A 2G4EA 1BZ9A 5A2AA 1C12B 1FORL 3OAYH 3BZEB 4CNIA 2OYLA 5F6HJ 1WA0X 2ZYRA 2IXQB 1XXDC 4LNRB 4RIRA 4OFVA 4PRIA 4NZ8A 3VFRA 1B4RA 5EUOE 4QRQB 3G6JA 1FVEA 1TSHA 1I3RB 4P46D 4X7CC 4LAQL 5CJXA 4PJ9A 3GNMH 2YPLE 3MOAH 1OSEA 4XP5H 3TV3H 3PNWA 3RZCC 1N7ML 2V5RA 4HJUA 4C83A 4GUCA 1AD9A 4EN3B 2HSIA 1ZRUA 3MBWA 4ZUUA 3DYPA 43CAB 1ZDQA 2F9BT 5DHYB 3UACA 1F6FB 1HZHH 2AMUA 4BCYA 5C2UB 2Y6SC 4NIKB 5IVNA 4JRXB 2OL3A 3NOIA 3U9WA 3V52L 4K9EL 4EBQL 5CN3A 5EU3B 5KN5A 2AGJL 4UQ3B 4RLDA 4MNGA 5LBSL 5T1LB 2D2OA 1A3RL 1S8DA 4GBXB 4X7SH 1KSRA 5GS0H 3MJ8B 1KT2B 3ATDA 1RZKH 1CYWA 4JFYA 2QR0A 1DQKA 2X12A 4GAGL 4PRNB 3INUH 3JVFC 3S37L 4E5XA 2ZCKL 2YEZB 1MRCH 3OVUB 5GS1B 3U0TA 3SO3C 2XYBA 4WWKB 1XCWA 4JKPL 4XGZA 3ZQXA 2CO7B 1Z9NA 2Y24A 1FGNH 1OF2B 3EOBA 3ESOA 4M1GL 4FEIA 5HXMA 4JFXA 3EYQC 3CVIH 5FYJD 3D4YA 5SV4A 1G7LB 4QAMB 4CGTA 3UAJD 1B0RB 3MRJB 1X7SA 3UZEA 4RAUA 5EBMB 1CDBA 4ZS7L 1VFUA 3ZTJH 5EIQA 2Y69B 3LEXA 4WO4D 4NO5A 4Q0XH 2UXVA 5FA4B 4QLWA 2QZQA 3H56A 1KBWA 4E41A 3GSNA 3H7BA 1RJZB 3AXIA 4BZ1L 2GIMA 3FCSA 2WW8A 1J5OL 3DX7A 1NSNH 5EC1A 5CJXC 3W9EB 1FVDB 4PJ9C 3CH1A 3H4HA 3SQOL 1TYEB 4LU5H 2EYSA 2VUYA 4POZC 4S0TD 2J4WL 4FFZA 4HIJA 1DVZA 4RMSA 3W39B 1Q0EA 4HETA 1AHWB 4L8CB 1GW6A 3O4LA 2Y7NA 3QDME 1O6TA 1UEYA 2R59A 1YEIH 4X2UA 3TNMB 2F5BH 3LZQA 1OSPL 5I1AB 1YPZA 5JMOC 3OSKA 3PL6A 3LZPA 4L4VE 3C5JB 4L0ZA 2ZYHA 1II4E 3C8KA 1IIKA 3EO1B 3KYKH 1EJFA 1PKQE 1DJGA 4FTVB 3TBVB 1A4JA 3T0WA 3HMXA 5FYKU 4A38A 1OCZB 4X5PA 4JY4B 5J12B 5DJDB 1OAZH 2CMRL 4OCNC 3CFDA 3H54A 2WNGA 5EU6B 4KQ3L 3SGEH 5TE4L 1F02I 1QSFA 4JPKL 4WJ5A 5F3BA 4PS3A 1HDMA 2Z3FA 4JG9A 4PYGA 2D73A 5C7ZA 1AR2A 1NDMB 4XH2A 3OR7B 4BQ8A 1HHIA 1KPUB 3MODH 5F1IA 1CICC 1ZEAH 1AE6H 1YEDB 4YNYB 1M7XA 3DJSA 4QI3A 5F97E 1LK2A 3KWWA 5KEZA 4AE0A 1NCNA 3UZEC 1KIQB 2CXGA 3U46B 1RXLA 3TBWB 5C3IA 2XN9D 3UBFA 1GOFA 2QT6A 3P73A 4ZX3A 4ONFH 4XCFH 2VDNH 3ZMEA 2GJ6B 5I74B 4UI2A 4B3VA 4XMLH 2R23B 1R5VB 3TWYA 5EORL 1KIPA 4HAFA 5D5MF 5EZPA 4ZX5A 3SPVA 1Z5LB 3D51A 4CKVX 3C09C 1KELL 5FIEA 4QIRA 1F1GA 1HWGB 4HK0A 3BAEH 5C0JB 2CCVA 1U3HA 5TQ0L 3RNKA 1UXWA 5IOPB 4BGLA 1R3KB 3MMEB 4AYDC 3MRBA 3PL6C 1CDCA 3WY1A 1FN4A 4U6HB 3O6FC 3K3QA 5CFAA 4WTWA 2B0SL 3I9IA 2A9DA 3LSOB 5JW3H 2HJKA 2FNWA 3N5AA 5J1AA 4JY5H 5E6ZA 2AEQL 3VG0H 1INQA 1TDQA 2A77H 3IDIB 2ZG3A 5AKRA 3GHEL 2OSYA 1WBZA 4JUTA 4LSPL 4M61A 3L4WA 4A39A 1QKZH 2L4OA 1FIGH 1XVSA 1CLOH 2MEJB 5E4OA 3M7FB 1M4KA 4GKNB 1ZGLM 4XO3A 4RCAA 2XT1B 1MFVA 4R4FH 1L6ZA 4F93B 3KYAA 3JWNG 4Y4KB 2W07A 5HHNB 1TVBB 5EPMA 2ZNWA 2V17H 4YFDB 3OZKA 3TX4A 1DQVA 2MOVA 3BAYA 1LJMA 2F5AL 1GR7A 1LO2H 5IROA 2X3BA 4K2UH 4V2BA 3VFGL 4KZCA 1IIIA 2WNKA 3OBAA 1JV2B 3LY6A 1U21A 4G9DB 1CFSB 1G7JB 2FZ3A 3BDYH 3E8UL 4G43B 3GSQB 2DYSB 4FQXD 2R29L 4NX0A 4Z7VE 4OIIL 1I1FA 1Z2KA 1YUKB 1SOSA 3CX2A 3F3HA 1VEPA 1Y7VA 4QWWC 2I9TA 3CHRA 1I3GL 1U3HC 1WUNT 3Q6FB 1I8IB 2BSSA 4HCGA 3QCVL 1XR9A 5L7XL 3WN5B 4LOEA 3AUWB 4OSUL 4J8RA 2O1AA 1UT2A 2Q3ZA 4NNPL 5DCCA 3ZT5A 2L0DA 4FKEA 4H44C 3S5LB 5FYLE 1IM3D 4YHPA 4FQHA 4NRXB 4JO5A 1Q9KB 1WO2A 2DLFH 4FXGB 1AGFA 1OLLA 4AQEB 1N68A 4FXKA 1G7PB 5HHOD 4XMWA 3QRFM 3EHBB 4LASL 1QFUH 1QRNE 2ITCB 4NS0A 1C08A 2F8XC 1FNFA 1FDLL 1GGCL 3KPOB 2ZP0T 2X4QB 1IMHC 1CGSL 1JS4A 2DM2A 2EKJA 4HXBH 1PW3A 4PV9A 2YEVB 1Y18B 2PPFA 5HVFB 1IC5H 1AC6A 1DJZA 3PHOB 3QJFB 4UCFA 2F15A 2YAQA 3RX9A 3I02B 1AGEA 5GGSY 2C4FT 3M46A 1ILSA 2PYEE 3D6GA 4JFOA 5JPNB 4HT1H 3G3LA 4X4MA 4H13C 5DWUL 3SHSA 1UWEL 4FQ1H 3RILA 1AMYA 3CXHK 5CMAA 4MTMA 2XSKA 3DECA 1VB9A 5IROC 1TZGH 3WEAA 1EZVY 5D1QE 3TJPA 4K3HA 1MXDA 2OMUA 4TPRL 1NBVL 2WQVA 4S1QH 3HKFA 4AI7A 4DGVL 4DN3H 1YN6B 5DMGC 4LCWB 3BRDA 3II2A 1ZTXH 2NY4C 3CK0H 4UTAL 3L3DB 4DVBA 5JMRA 2CHDA 2R1YB 3VFMA 2F7OA 4IBWA 3FU9A 4NP9A 2XIDA 4GW1B 4JHUA 4AUYA 1RIUH 5F7LB 3WLBA 1RLBA 2WIIA 4NKIL 1GHFH 5JOFA 3STBA 5B7EA 1EJOH 1NCWL 3SDYH 4YHLH 3UTPD 3KLHD 2XFXB 3ZU8A 4DQAA 3SBRA 3VWKA 1NICA 5C8JB 2R0LL 1J8HA 1YYMH 4DN4L 1NQBA 4TSCH 1RMFL 3DO7A 5JW4Q 4ZAKC 1XF5B 3TT1H 1E5BA 5KVFL 2F18A 4Y16C 4FXKC 1M1XB 1QQDB 2FB4L 2FRGP 1AD0B 1WRFA 1BJMA 2H9GA 2RACA 3F7QA 1I9EA 1M2VA 2J1YA 3RZCB 4OV5A 2YQ3A 3TZVA 1N6UA 4X0KA 5C0BB 4BA0A 5JQIB 4X8GA 5K9OA 1LEKB 2OR8A 2UZXB 4XC1L 3QRGL 4Z7UE 1NGZB 4DGUA 1DLFL 2DTML 3EGDB 3A6CL 5F9DC 3B7RL 1JGUH 3FO0H 3BUDA 3GRWH 4KNSA 3SKJL 4FAAB 5ID0B 1CYXA 2NXYC 5JIMA 2UXTA 3CQFA 5C0AE 3AY2A 4NQTA 3UAAA 4GNKB 2DQGH 2DM7A 5DS8B 4R84A 2MPAL 5AUMA 3SEPA 1JNNL 5I5JA 4U6TA 3VU1A 3JWDL 1Q90A 4HKBB 3REVA 5MEPA 5MI0C 1PD1A 4LGPB 4BH7A 3GXUB 5ICXB 3SO3B 2SODB 1DO5A 4ORZC 4EDXB 3WEXA 3IU3A 2CO2A 1S9XA 1FPTL 4LCYA 1MF2L 4G1MB 4G9FD 4ZFFA 1B9KA 1T1YA 4PHXA 4OIBA 4FLHA 2BSRB 4LB8A 4A7VA 4KJQC 1M05B 1E8WA 2N4IA 4WTQA 1BZ9B 4FC3E 5GS0C 1OAXL 1MQKL 3RL2A 1RZKC 1RURL 5ERWA 1JZDC 2IAMA 2E6JA 3VWKC 2P24A 1D6VH 2Y07L 4ELMA 5F7KC 5DZJA 2ED8A 5I1GH 3KM2A 4DETA 4MCMA 4PRIB 3VFRB 3D09A 2WLMA 3G6JB 1FL5B 1FVEB 1AVAA 3RIFK 2NY3C 2XLLA 1PMYA 4N0FA 5DRNA 4EI5D 4CSPA 3MO1A 1MJUH 3COOA 3CN1A 4PJ9B 5GIRB 4AYGA 4S0SD 3PNWB 1D9KD 1U3ZA 4UMSA 2ISDA 4C83B 4HPYL 1NCUA 3VXSD 1AD9B 1YUHA 4LEXH 1MHPL 3TZVC 4ZUUB 3MBWB 2JJSC 1JDCA 4LKXA 2VCOA 3V5DA 3KPQA 4GO8A 4ISVA 4WJG3 3KS0H 1KGWA 3WCYA 2G2PA 2WGNB 3MKGA 4OD1H 3OQ3B 5D7LA 2VDOH 3LKRA 2OL3B 2Z31C 3DSFH 2HX8A 4IDJL 4LL1A 4PJ5E 4QRBA 4QRRD 1PAMA 1ZS8A 4OLWL 5AVSB 2BOBA 5ENWA 1NEZG 4ZMAT 4PJIE 1PZCA 3VFTB 3UEQA 3BWZA 4DGWC 1H6FA 5EOCL 3B9AA 4OGXH 5E1GA 3UYRH 4JFYB 4GW4A 2QR0B 1UB5A 3BT2L 3LPFA 4R7DA 4A7SA 5EB9A 2JB6A 4E5XB 1ZHBA 1CFBA 4G7VH 3U0TB 4YQXL 3BWUF 1IBGL 3GB7A 2N0MA 4X9BA 1UTDA 1IGMH 4XGZB 5GRWA 3PAVA 4WJKB 5D7IF 2P47B 2ZOTA 3ULUE 4HWBL 3EOBB 4JFDA 2BNQE 4TUUA 1CICB 4NAJA 1DVXA 1WBXA 4JFXB 5SWSA 1AZCA 4LFHD 5I9QC 4WI9A 5DEGA 2R0KH 1FAIH 2AF2A 1ORSA 1A6ZB 3U30C 1L0XA 3LIZL 4RAUB 1IKOP 1UM4H 4XN2A 2IAMC 1KJ3H 4MB5A 4PJCF 3EJZC 3LEXB 2X2HA 4TMPA 5DC2A 3GSWA 4FD0A 1J8SA 3DV6B 5J6HA 4E41B 3GSNB 1BOGA 3H7BB 2APXA 3FCSB 5IESH 3GSUA 1EO8H 2E27H 5EC1B 3CH1B 4ABQA 2EYSB 3FO9B 4QR7A 5FUOL 3MRIB 4L8SA 3HC0B 3F04A 4HIJB 3C09B 4UNUA 2A9BA 5KG9A 4DTGH 2EDRA 5EDXA 1L9QA 3O4LB 2XDHA 3C6SA 5D1ZC 5DS1A 3RGBA 3WIIL 3TURA 4R26L 1YPZB 2N7AA 2ENJA 4IU2B 3PL6B 4KKLD 3LNGA 4K3EL 1DEEA 1Q9OB 5T3XD 4UTBL 2YOCA 3O6FB 2AJSL 2QMKA 1A14L 4FGMA 2Q87A 4H8HA 1TJIL 2YSTA 3HI6L 4ODTL 3N1FC 1SN2A 4JE0A 3KGSA 4NO0D 3QZWG 5MEND 3KPNA 5E8DL 3CFDB 2YK1H 3BIAX 3TBBA 5E2JA 2NQDA 4WJ5B 3NGBB 4K15A 5F3BB 2NT1A 3IFPB 4Z7NE 1EFQA 4KK8D 4XH2B 2ZXAA 1XCTA 1C7SA 1HHIB 25C8H 4K71C 5F1IB 1KMGA 4OIFA 1DLHA 1LK2B 3FBQA 3KWWB 5ANMA 2G0LA 4JKKA 3K7UA 4QF1A 3B43A 1JYNA 4DCQA 3K80A 1KTKE 3B7SA 3C2AH 3TESA 2QQKL 5D71L 5LUMA 3ULVC 3D8MA 4HH8A 1HH9A 2XQ0A 3O2WH 5GGQH 2XQBH 3NCCB 2ZAIA 3OAZK 4U4IA 1IT9H 1VEOA 5KS9F 4OZIA 3T3MB 3JT0A 5TGBA 4FQQB 1AGDA 1KIPB 3SPVB 2OL3L 4L8SC 3L4XA 1T04A 4YL4A 4E9QA 4A7GF 3LRSA 3GZPA 4HK0B 4JFZL 4MJJA 4R2GD 2H3XC 4DESA 1U3HB 4HCFA 4XNAA 2C9XA 1DL7L 1UXWB 3CVDA 15C8L 4KTDL 5D93B 3RNKB 5AW3B 5DHXB 4GINA 1KNOB 3DWTA 4I2XA 3V5HA 1FC1A 2KZKA 4JDEA 5CGYC 1JFHA 1NAMH 5HHPA 1U2CA 4BE5A 2HJLA 4CSZA 2VLRE 3ZZSA 4X83A 4XP9H 1A9BB 4RSYA 2HPTA 4AEFA 1TENA 5J1AB 5BRZE 5JOPE 2ZOOA 1FSKC 1CL7I 3WV0A 2FX7H 3EJYD 2H3NA 5TFSH 2XZQH 3ZSTA 4LSVL 4ZYKA 1INQB 1J1XH 4JREC 1BD2A 1NIBA 1NLDL 1WBZB 2IGFH 2PXYD 3T77A 2KQNA 1U36A 4CA4A 3KPSD 3VI4A 3UBXA 1WIPA 1DQIA 1OPGL 1KCWA 3L7EA 1D5MA 3SGKA 4WWOA 2BNRE 1OHZA 2JKRM 1XGRA 3IPFA 3S0PA 1BM7A 1SYVB 1YNTA 2W07B 2VR5A 4DOHB 4QXTB 3AU1A 3NQIA 1YYCA 5BV7H 5K1VA 1V05A 3V4VH 5C70A 1ID5I 4R3SA 1T5KA 2N7BA 1CFVH 3PQYA 5MEOA 3P30H 3LPGA 4W9HC 1BBDH 4ZMVA 2FZ3B 1OTTC 3TH4T 4HWEL 1NFDF 4EIBA 4PJFA 2A4CA 2NY4B 2OMWA 3FTGA 3HHMA 2NZ9C 3LV3A 3P4LA 1I1FB 1CXIA 1D2PA 2AJ3A 3RJDA 1C5DB 4DFHA 4PJHE 3GRWA 4UQCA 1KTCA 4I9WE 4MXQD 3UAEA 2GT9B 2YLHA 4AGQA 1CD1B 3VSTA 2BSSB 5CWSB 4P5TB 5GRUH 3L1EA 5ALCL 3HMXL 3QIWD 5E2TL 3Q1SL 4ETQA 3AREA 4IHBA 4U6VH 4J8RB 2X0WA 3AMLA 4KXZI 5IQ9A 4XI5C 5D7JD 1JF6A 3U0PB 4YHPB 4FQHB 2LABA 4QY8B 4ZAKB 1VIWA 1Q1PA 4AYMC 3RTQD 4Y16B 1Z9MA 4FXKB 3GXFA 5DLMH 4Z8FL 3L4YA 5HYSG 3S4SA 2R4SL 4G7SB 1PZ5A 4KH9A 3RJOA 1C08B 5IKCA 2NT0A 5EBWA 4NKMA 3H9HA 1JG9A 1OIOA 3NIFE 2EEBA 3EUDA 1N70A 5ANHA 1N10A 5EEXA 2NUTA 4PV9B 2G60H 2VDMH 2EIBA 3MZTA 2N1TE 3SGKC 4KK9C 3DX0A 2Q8AL 3TM6A 4BBWA 4D2NA 1AGEB 1EZVX 5F6HI 2EDBA 2D9CA 4JFOB 2EIDA 1ZLVH 4G1EA 4O2CB 4QAWA 4AH2A 2Y2WA 3APDA 4PRPD 1VGEH 1INDL 2JJWA 2NXYB 1NKRA 5CMAB 4QHKJ 2CK0H 2ZWYA 2HKHH 5I66A 1DQTA 1HSAA 2Y3NA 2HVKA 2XX1A 4YXHH 4TQHA 3GMOA 2OMUB 4B5EA 5LGKA 2O26U 2NNAA 5ALBL 1YMMD 2QADC 2Z8WC 5MI0B 4UT7L 4A1RA 1AIZA 5I71C 3VAEA 3ARFA 3MCG1 4GMSH 1AHKA 1RZJL 4G5ZH 1DJWA 1P9MA 1AS6A 2KHAA 4FMVA 5AD0A 4PCKA 5TPWL 3WLBB 4R8WL 2WIIB 4HAKA 3X13A 3QS2A 5JOFB 3RLSA 2QJDA 2HLFC 3QDHA 1KCSH 2AZAA 2ESVB 3AREC 3VWKB 2GABA 4ENEC 1VJSA 3ESVF 2MFNA 3QPQC 4ZPVA 3M86A 1J8HB 3P0VL 5IB4A 3U7YH 2KQMA 5HDOA 2CM5A 1MRFH 2QVIA 3L2NA 3TU6A 1F8TL 5DQDL 2DI8A 1EO7A 4NZRH 4ZQKA 2NY3B 1MCNA 4YWGH 2H9GB 3F65A 4APQA 5BUAA 3HG0A 4OD3L 4NZFA 4XVSH 3VI3E 1M2VB 3VGEA 1ZA6A 3GXIA 2Z64C 1EEZA 4XRCA 3EFFA 1J0KA 2CRZA 3TJEL 3TZVB 2V0AA 4X0KB 5I0ZA 4MJ2A 1WAPA 1PKOA 1TEGA 3RGHA 1DANU 5SWQA 3N43F 5BOPA 4J3WA 5AKTA 1E9OA 2FD6H 4X4KA 3VQLA 3ZKQD 2Z31B 2NSXA 4EO5A 2F2HA 4QHLA 4TLUA 3U2JA 2CDFB 3GGWA 1DN2A 4OAWA 3LPOA 3KDPB 1FNEA 3WY4A 4TL5A 5JHAA 4ES9A 1VKXA 2J73A 4XPFH 1EZSA 5DQJA 1I9JH 3HUJE 3REVB 5MEPB 1OCRB 4BH7B 3M1CA 5IJVA 4XPGH 3V5KB 3ARFC 4HZLA 5CP3H 5L2KA 1MCDA 3IU3B 1P9MC 3WEXB 2VUKA 2J5LC 1S9XB 2ZJSL 3RIFF 2BXYA 8FABA 3NCYS 4ZFFB 2VM9A 4WSJA 1FO0B 2JJVA 2C34A 3MV9A 4BFFA 2XKSA 3ILQC 3MLVH 1UM5H 3U30B 4LHUG 5DHVH 2X4PA 1LILA 3QA3A 3RL2B 2EEXA 4D9LH 1MW2A 1GSKA 2IAMB 2P24B 2H45A 3H1ZA 5D2LF 4ELMB 1FLRH 4M3KB 4FXTA 4OM1H 3SE4A 4DZ8A 4HWNA 2LV4A 1NCDL 2FEJA 1PNDA 1ZLWK 3T0BA 3OWRA 4H5SA 4N0FB 5DRNB 4M8QA 4ACTA 4APQC 1T4KA 1EGJH 1RZ7L 4PJGA 1IGFL 1UQSA 2CGRL 2YA1A 2GTZB 3HEIB 3WKQA 1YUHB 3P3RA 4DP8X 4ZFOA 3VXQA 1C8QA 5FM5M 4LKXB 3NMEA 3V5DB 3KPQB 2ERJC 5A3IC 2ICWJ 4PJAE 4J6RH 3MNVA 5D1ZB 4XMKH 2VDNB 5D7LB 3LKRB 1SJEA 3OJ2C 4E9YA 5HDLA 2TRHA 2V8LA 3CMOL 1ZS8B 4X6CE 4BQ9A 3HB3C 2BOBB 4KFMA 4M7ZC 1ZAGA 3CSPA 4UQ2A 1KCLA 3IU4H 4DK5A 2HYMA 3K8MA 2FHFA 3GWJA 3WKYA 2DLGA 4GW4B 4KKAD 2ZX5A 5E2VH 1KJ2H 1UB5B 4R7DB 2YMOA 3OG6B 4IKLA 2FHBA 1JWSB 3E3QC 2JB6B 3HLKA 1JHKL 1WZKA 4GQ9H 4F9PA 5LXGL 1ETJA 3GB7B 3MJ7A 1DQJA 4PYHA 3VD4A 1T4WA 2P45B 5IVXF 1A6VL 4GS7C 5EO1A 2H0PA 1NAMA 2CNYA 3BH8A 4JFDB 4OB5L 2XCMC 1NPUA 3LZNA 4K71B 5GGSA 4P9HH 1WBXB 5SWSB 5DEGB 1FI8C 2JXMA 1ORSB 1ORQA 4TVPL 4WUUE 1S7VA 4M7LH 2GK0A 2YS4A 4MQSB 4OGYL 4B50A 5KSBF 1I7ZA 3INOA 1KY6A 3GSWB 1QSEE 4PLJC 5KS9A 3NCWA 3BZFA 2B59B 1W15A 4JANB 3SE4C 9CGTA 5J6HB 1BOGB 4NNXA 4NT6B 2ZKHH 3GSUB 4IJ3C 4J3OG 4NHCH 3VRIA 3CDGA 3R4RA 4HDIA 3I6LE 1A4AA 2HTLC 1BXAA 3ELQA 2OQJA 4L8SB 1MFBH 1T6BX 2FO8A 5HPMA 1E28B 1DANT 3K6SA 5KG9B 3Q2LA 2C1OA 1CLVA 5CXPA 1U42A 1WAAA 4LLYA 3SKMB 3V4VA 3LKPA 4NQXA 2XACC 5I1CH 1AACA 4FFYH 5J3HD 1W6WA 1HXMB 3QYMA 1FFNA 1DEEB 3IFOB 3F7RA 3MJGX 1XSOA 5AOKA 4MMYA 3NAAH 1HNGA 3ARUA 1WZ1L 1BXUA 5FS5A 3QNZA 5CZXC 1FSKB 2WBJA 3AM8A 5C0ND 1GXEA 1OGAE 4M1CC 4JO8A 2BIHA 3KPNB 3J27A 4H20L 4F9PC 5CJOH 3QXUA 5FGBC 1C16A 1PZ3A 4PRDB 3TASA 4ZMWA 1OAZL 1GC1L 5C09E 2FHCA 5BS0A 3HPLA 1XCTB 2UVFA 4IK6A 5IFAH 5JXAH 3I3DA 4PBDA 1WFTA 4QF1B 2Y5QA 3FOMA 4H0IA 3RGVA 1PQZA 2DW5A 1IKNA 4DCQB 3MKKA 5ACLA 2VLLA 3CFNA 3IN2A 2GC7C 3MUY1 2GSGA 1R3LA 1UWFA 1HH9B 1NCTA 2F7RA 1U58A 4P2RD 1ZMYA 1S4IA 1NEPA 4OZIB 4WZ9A 5EIIB 5C3LD 3FT2A 5TGBB 3LMJL 1DN0B 4E36A 3C5XA 3IAPA 1LE5A 2PWGA 4QLRA 4M5TA 2GTWA 1T04B 3QI9D 3TO4A 3LRSB 4PWEA 3GEFA 5BV7C 2HWZH 5JOEA 1IC1A 3QFGA 3OAZH 2P5EE 2X38A 3C6EA 4LPVA 2YFNA 4U6XA 1FHGA 3DVGA 4YE0A 5D4IA 3BQUA 2F61A 2CGYA 3V5HB 4JDEB 3DUHA 4HJ0C 5GGVL 3POCA 5CLZA 5CU9A 2A6KA 5CAYB 2HJLB 2FGWH 1H6EA 4FERA 1BQHG 4HV8A 4JCMA 4XO5A 4GQPH 2TSBA 5CKGA 5IHZB 3QDGD 1UZ6E 5CZVH 2WBJC 3AM8C 1TVDA 4ILDA 2GY5A 3H85A 4MHHG 2H3NB 1J1PL 4ZYKB 1B6UA 1UYWL 1BD2B 2B2XH 3X17A 5BO1H 5D70L 2D7MA 1IU1A 3VI4B 3UBXB 2VW4A 1W16A 5LG1A 1D5MB 3S3DB 2MCPH 1F3DJ 1HILA 4L5FH 3ZDYE 3NJVA 3ULVL 4V1DD 1XGRB 4Z7QF 2BY0A 1YNTB 3U1SL 4YEEA 3AU1B 2ZOWA 1KC5H 2WLHA 4ODWA 3MLZH 3QS3A 3RGVC 1IKNC 2BC4B 4Z0XA 3MNWB 4R3SB 4YOKA 3CFUA 4ABVA 3PQYB 4ZMPA 3V4UL 3VQ2C 4HJ1A 2ODHA 4N90D 4EDWL 4BQ6A 5IMKA 1SM3H 2DMCA 1OEZW 2V17L 3BN9C 2NY1C 3H42L 3ZKMC 3DMMA 2QADB 3LN9A 1PTZA 4PJFB 3NZUA 3FTGB 1TQCC 5I71B 4WY7L 1HKLH 1N6VA 3LV3B 5TDNA 3IKKA 2AJ3B 4E9SA 1RZ8A 1A6PA 1H6UA 3BDYL 3TO4C 3ZE1F 4NGHH 4X9HA 2FATL 4O9HL 4P23B 1I7UA 1QLEH 5C6PB 1OE1A 3MBED 5DZAA 2A6JA 3BQUC 3MV8E 1L9SA 4ETQB 3AREB 5DTFA 1OE2A 5LN8A 4AM0A 2IWEA 4UILH 1PG7H 4JFHD 5EWIL 5IQ9B 2BIIA 1MRDL 3VM7A 4BCZA 3ABKB 4X6DF 2Y2YA 4JFFD 5CP3A 1T22A 4Z3EA 1AOHA 2D3LA 4XTRC 2G4GA 3PAYA 1UG9A 4A6YL 3S4SB 3ZSSA 3CWGA 1PZ5B 5IKCB 1LP9F 4NKMB 3H9HB 4JR9L 1BP3B 3EDDA 5DZ9A 4HUVA 5DHVA 1UURA 2NUTB 3LNIA 5JLZB 3ARBA 1JXDA 1UWXK 2W80C 4QGYA 1BFVH 2LQRA 5DUBA 3SD5A 3Q6GH 2B4CH 3CFKA 2PW2A 3HFMH 5INCA 1HX0A 2G9HB 3NPSC 2R56L 4UYPA 4G1EB 3UTTB 4HXAH 4KOBA 4TLSA 4Z3HA 3TH2T 4HIEB 1EGJA 1AY1L 4HJSA 3T2QA 5I66B 1CBJA 1HSAB 4FG6D 2HVKB 4RMTA 3GMOB 1FZOA 4A66A 2NNAB 3DMMC 2BRRL 1JPTL 4UZUA 2ZKMX 1TFPA 1UC6A 2VLKA 4H88H 4I88A 4HUKB 4I87A 3ARFB 4FN0A 5D8JL 4X7DC 4KVNH 1C7TA 2YJQA 2J5LB 2VDOB 4AJ0A 1BF5A 4RFOH 1YA5A 5AD0B 1XF1A 1ZT4A 1E27A 3X13B 4NB7A 4XVTL 2CHZA 4LSTH 3FTXA 4L4TA 2EDOA 2AAAA 4NQCA 3TPKA 1DFXA 2Y7MA 3NCMA 3OJDB 1J9RA 1KZYA 1KJ2A 3FB8B 4N0UE 2ZPKL 4M6OL 3GPEA 4ZPVB 3OZLA 1JIBA 5HDBE 3UJTL 1KPRA 3MOBL 5IB4B 4HLZH 4IOSD 4JO3L 2GW5A 3CFBA 3K6IA 4DAGL 4ZQKB 4M8RA 4PY8I 4APQB 3WJLA 4MJIB 1ZA6B 1PG7X 1EEZB 3AG1B 4XRCB 2Z35B 3EFFB 5I6MA 5FKAA 5I15H 1M6OA 4FI6A 4P46C 5DD5H 3ARBC 5DU7A 3DXAE 5G4NA 2ERJB 5SWQB 1BQLH 2MOGA 4C4UA 1E9OB 2JKIS 3G6AB 4F80A 1Y1DA 1FNLA 4QHLB 4W9IC 1YEKL 3GGWB 4OAWB 5GJSL 1HFUA 3MLSH 4D0DA 3HB3B 5MERA 4M7ZB 4AWJC 4ZUTA 2KZWA 1FAKT 3WIFB 3TBTB 1S9YB 1VKXB 1YG9A 3LPPA 3MCLL 3FT3A 3ZDWA 5DQJB 5IVXA 3Q2WA 3N0PB 6FABH 4UOW1 1C8PA 2VZ1A 4CADA 3NDYE 4DPRA 2GSMB 3HNSL 4HZLB 1CQYA 2BP5M 5JW4R 1SMOA 5L2KB 3EYOA 4GXVL 1ACYH 2R0WL 1PLAA 2WNXA 8FABB 4GS7B 1OALA 1F1AA 1EBAA 3FZUC 3X12A 1JGVL 4BSWA 5IUCA 4PJEE 2VN5A 3MV9B 2A73A 1OK8A 4N6RA 3GT6A 2WKOA 2X4PB 3HLAB 4L9DA 4KTGA 2ZCHH 4J6IA 4C54A 1BFTA 4URTB 3BAJA 4DZ8B 1IJ9A 4M48H 4UIKL 5DMIH 3MJ6A 3RA7L 4IJ3B 3NT0A 5I1IL 4H5SB 1GAFH 3D08A 1T4KB 5I1EL 3WJLC 3ZQ9A 1CGXA 1BEXA 4P57B 4P9HC 1C1EL 5HI4C 2WXRA 4KKZA 4Z7OE 4ZI8A 1RL1A 4ZFOB 4JDTL 1FFRA 3O4OC 1ZLWH 4XR8C 4N0CD 4JJ5A 2AVFA 3GINA 1FZMA 4LSDA 4V11A 3UPCA 1BIIA 3NRPA 1NGWA 4A2GA 3MNVB 3AQZA 2I07A 4NZTH 1YJDH 5EDSA 5ISZD 1SJEB 1MHEA 1JD9A 4IIQB 1E0OB 4GRWF 4BIKA 5A2IH 1HHKA 1RI8A 2AJXL 1SJXA 2QEJA 3S2AA 2OR9L 3LB6D 2JLLA 4LOUD 4UQ2B 4O2FA 4H2AA 2BO0A 2JKXA 4GAJH 3T6XA 1MCFA 1NMBH 5DJZA 1D5RA 4GKLA 1OTSD 3S5LG 3AT0A 4QOKA 3VTTA 4OLVL 2IBBA 1OP5K 1DQJB 2WXJA 4YC2C 3GUFA 1TMQA 4GSUA 3T71A 4Q9RH 3BH8B 3NN8B 5IBUB 5GGSB 1GKOA 3T0EE 4MA8L 3DHUA 1LEGA 1HEZA 4MCYA 2JXMB 4AMWA 1ORQB 4MJ5A 5AW1B 1S7VB 3HNVH 4YLQT 3FFCD 2GK0B 2RD0A 1J0YA 1ETB1 1I7ZB 2D0FA 5D1XA 1AZVA 1FYTD 3UO1L 3WHXB 1EDYA 2J3SA 5KS9B 5DURB 3BZFB 1DYZA 2O5XL 4NNXB 3EJCA 1T66D 2VR3A 3QEQD 1GZPA 3UG3A 4M1DL 4W4OC 3ZT6A 2I60H 4JFVA 4PQXA 4AJVA 1TTBA 4I0PA 3CDGB 3VRIB 4TF4A 4ZW8A 3TT3L 2FX9H 3F7VA 3O8XD 3ZDZB 5C6TL 2YKLH 4IRSD 1B4JH 2FSEA 1HJCA 1UXSA 4RGNC 2OQJB 2R51A 3D9AH 3GS7A 5T3XH 5HPMB 1MJ7L 2IBGA 3K6SB 4Q6KA 2PABA 5BV7B 2C1OB 4LLYB 3V4VB 3JTTA 3LKPB 1BLNA 4WKZB 3Q48A 4W9KC 2OZNA 3FT4A 4XP1L 2AK4A 4AL8H 4E0RA 3A4AA 3PXLA 4PWFA 4GUPA 1CFQA 1A3LL 4QD2E 4XMUA 2XY1A 4YPJA 2BJMH 3U4BL 2C8NA 1MJ8H 4YDJA 3OGCB 4O58H 4KGJA 3ULSA 3IT8D 2GAZA 2HRHA 2P28B 3BHBA 2WBJB 1NIFA 3VXPA 4X5XA 3CU1A 1NCAH 3IFLL 1LDPH 3AXHA 2WTRA 1C16B 2YAPA 1KCVH 2ATAA 4Z18A 1F4WL 1Q72L 3HHSB 5D7KD 3VYPA 3IK2A 3QUKA 3HPLB 5BS0B 4CILA 1BZQK 2ZXEB 1A7BA 1P4BH 3KW8A 2WZ6A 5JORA 1CL7H 2QPSA 5DZPA 3FOMB 4M43L 5LQBL 2AV1A 1LDSA 1PQZB 4OLEA 3RGVB 2VLLB 2XWCA 3P3UA 3PU7A 5D1XC 2MCMA 5IEHA 2ZSWA 3QWRA 3O41A 2GSGB 4ZK8A 4RA0C 5AW0B 2LVCA 5FA3A 2NY1B 4IK7A 2ZWNA 2VDMB 2MTPA 1BFOA 4XBEH 1SOKA 4YHML 4I0PC 1LO3L 1ANUA 2VDPL 1TQCB 1U8JA 3FT2B 3IDXH 1JGLL 3JWNE 1MWAL 1SLVA 3N2JA 1LE5B 4Z7AA 1ET7A 4X6FA 3TO4B 4GRLD 2J8OA 1GPOL 4XBPA 2EXYD 1P84K 4FQXC 3UROR 1VFOA 5EHFA 2MSPA 5DJ6A 4PJXE 5IMOA 4MYWB 4U6XB 3DVGB 4DERA 4YXLL 3FKUS 3BQUB 3EJUA 3MX0A 4X6DA 4HGKC 3VQMA 2R4RH 2XJKA 4GKSA 2LLLA 4M29A 5DJXA 2A6KB 3FBKA 4Y1AA 4P5KA 3F84A 1F86A 3HAEB 1NA8A 1NAML 1N5AA 3AGWA 2B8OT 2HKAA 4HHAA 3V6OE 5F8RC 4QRFA 2VN3A 2Y1ZA 1LD9A 1BGXH 1N3NB 1BHGA 1RIVH 2J6EH 4KXZH 5EOCJ 4AIXA 2AW2A 4JFEE 4JN2A 1HILB 4KHXH 5JZ7D 1FGVH 1N18A 3B2UC 4PJBF 1NMAH 1AGCA 2C9SA 3NPSB 4RAHA 5KANI 4LLQA 1NPJA 1T0NA 5DS2A 4ODWB 2UY7A 3KPRE 4V1DE 4AV4A 4Z0XB 3L3JA 4JRYB 4OQTH 2VR7A 1AYRA 4NC1E 2DQCH 2CJUH 1LMIA 3FUMA 1S3RA 5IMKB 5FEBA 4N5UA 3DMMB 1OHQA 2HUHA 2WUCL 2MKLC 2XTLA 3HZYA 5C0CB 2B4CC 3TYGL 1QR1A 4EI6A 5E8OB 1H3TA 3OMIB 3LVTA 4WI5A 5TDNB 1ADWA 4HSQA 3IPEA 2KH2B 3UBHA 2K70A 4AK1A 1RZ8B 5DC4B 1VESA 2WZPA 1O7DC 3TH3T 1DBBL 2JTDA 4XNXL 1F2QA 3GI8H 2ZKXA 4KQ4H 5CP7A 3RY6A 4E5XG 1PVHA 3HG2A 2W9EH 2ZOKA 1ZOXA 2ZXBA 3P0GB 2A6JB 1NCCL 4KDVA 4R9HA 3W11D 4TULL 3EYUH 4NM4L 5DTFB 4K5OA 3MLRH 5E8NA 3SE8L 1BVOA 2R2BA 2VM4A 4NQUA 5IQLA 3L5XL 1NDGA 3LXAA 5IJKA 5I30H 1T22B 4L2LA 2XVKA 4PIBA 2XZCL 2VITA 3DX8A 1BPLB 4KX7A 1M1SA 4ODHL 2KYIA 3IEAA 3N43B 5L2JA 1KEGL 4HUVB 5DHVB 2GCYA 4P46B 3NABL 1KBGH 2X53A 3ARBB 1PFCA 1PD0A 4PJ8D 5DUBB 2LR4A 3CFKB 1ZT7A 1DUYA 3TONA 5INCB 5J6SA 4S1DD 4IM8A 3QORA 1UWXH 4N1HB 3KWTA 3NJHA 4YSSA 3FN3A 4YDVB 1WA2X 2A83A 1FZOB 3IBOA 4ODVL 5LO7A 3BO8A 1TF4A 4TNWK 1MHCA 2VDLL 3CVHL 2V9QA 3FAWA 3KR3L 1KIUA 3PYCA 3C08L 3RKPA 5GISL 1AFVL 2VLKB 1Q9WB 1W0WB 2C4XA 2ICWI 2JCCF 4MQXC 4CVZA 2AK1H 2JELL 4X50A 2QLYA 1OT4A 3S3JA 4ORGA 5M7QA 4NC0B 2OA9A 3N1MC 3US0A 4AYSA 1ZIBA 2ZAHA 2CHNA 2Q7YA 3RY6C 1ZT4B 4OCRH 2YD0A 1E27B 1A4KA 1L9OA 3N40F 4L4TB 4F8PA 1REIA 2XN2A 3HJEA 4FFVC 2PCXA 4NQCB 4OKVB 2X4RA 4MCNA 4BFJA 1FH2A 3F2LA 3PG2A 2W92A 4UT6L 5DJCA 5GRJH 3Q5TA 5LWYL 1KJ2B 2WINA 1KPRB 5HYJA 1HL8A 1GGTA 4IKJA 1FNAA 3DRTA 3PGDA 4WI0A 5GGUB 4ZOEA 3FUHA 4PCSA 4LHUD 1XH3A 4NQEE 3D3VD 5TTRA 4U1HA 4GG6E 1H3XA 5F44A 2D31A 2E47A 3GSOA 4ATTA 4PLKC 2DIAA 3FU5A 5FKAB 1V55B 1M6OB 2CU9A 2KI6A 3O4OB 1TQUA 4JPIB 1LO0H 1XGYL 3B9DA 3GEWB 4TN9A 1TPXC 5F7DA 5F1KC 1HKFA 1RZFL 2VKWA 1D9KC 4M6AA 5CEZD 3PUCA 4I0CC 3RI5F 3QORC 2QVTA 3WYRA 1E4KA 1XB6A 3DIFB 1JCKA 2YZ1A 3UGEA 4D0DB 2Q2LA 5MERB 4KVCL 5BCAA 4ZUTB 2Z7WA 1VACA 4YS4A 3LHPL 3ABZA 4M5SA 3ZUCA 4RZKA 1BAFL 3VVVA 4Z7WE 2EVIA 3MACH 5IVXB 3ZL2A 4A63A 3QJTB 2JSFA 4CADB 3MROA 2BMKA 4N2CA 3C8DA 5AW9B 4HUMB 2BSEA 1TU2A 1YJDC 3OHXA 2ADIA 3WELA 1O7VA 4MS6A 1GGBL 2Y22A 5JHDA 2G2RB 4HLEA 2D7PA 2H2SD 3GDBA 1DBML 3X11A 1F58H 3X12B 4BSWB 1CC3A 4XAKE 4BHUI 2A73B 4AC2A 4B9ZA 4XNQB 5D7SL 5I0DA 4N6RB 3QPXL 5AW5B 3NFPA 2VN4A 4MQ7A 4IHOA 5E0FA 3RJQB 2OMNA 1OT1A 4RBPH 4GAFB 3C87A 3MGAA 1ESOA 1KGCE 3MLVL 1YAZA 4JFSA 5AWNH 2JI3A 3Q2NA 5CJQL 4J7RA 2B1AL 1EPFA 2IAAC 2QV2A 4N2GA 4H0LC 4U1LA 3LVEA 4V33A 3W0WE 4MQTB 2F68X 5LAPA 3VFUA 5EOQH 1RJCA 4RGNB 4TVPE 3H2WA 5DHMC 1UKTA 2HT3C 2UXGA 1RH8A 4OFDA 1KLFA 4WWPA 2Q2EB 4JJ5B 3IDJA 6CGTA 3VJ6B 1BIIB 2J1WA 1NGWB 1HOEA 4J3OD 4S1SH 1TETL 3UJIL 2I07B 4A2HA 2D0HA 4LOVA 3B2PA 1MHEB 1KYFA 1E4KC 1HHKB 1W8EA 4X5LA 2YMXH 3ZR6A 1OM9A 4BKSC 2LT9A 4Y1TA 4N0YL 3VCLA 3V9EA 2OX5A 1UXMA 1HNYA 4O2FB 1PYWA 1CXFA 1XTLA 1NC4D 1RULH 2IPKA 4G7RB 2WAHA 2LU5A 5DJZB 1KTLA 4KPHH 4BWUA 2APVA 2Y5TA 2HFFB 4G6FB 4QOKB 2IGLA 4WEBH 5AG8A 3O11A 4AL8C 4F8TA 5EOTA 3OHXC 4P5RA 4R0LA 2ZF9A 3CNKA 1E9QA 3RUGA 4OGZA 1RERA 1MW0A 3CHXA 2E76C 3SJVA 1HSBA 2NY5H 1IVLA 5ESAB 1LEGB 3VG9B 4WNSA 2FBJL 3RKDC 2QQNL 4MJ5B 4POUB 1P7HL 2ORBL 4KK8C 3ZE2B 1OP5H 1NBYA 3H2QA 4XNYL 5FOBA 5FO8A 5D1XB 2QZ5A 1JVLA 2FGZA 3I9GH 3L8QA 3TNNA 2WQRA 1GZPB 1FYTE 2JI1A 1M3IA 3O9WD 2PMZA 2J6EA 4B9KC 1EAOA 2DQDH 1IFHL 2D7TL 4I0PB 4OCXH 4YJZL 3R4DA 2YPKB 4L37A 2W0FA 4N8PA 5AFAA 2J21A 5ITFA 5J13C 2FSEB 3L9EA 1UXSB 3VU2A 4G3YH 4NWTH 3OXRA 4YHOH 2Q3AA 4HIPA 5I18H 2RCSL 1NCBH 2XRAL 3JTTB 4OQTA 3P77A 1BLNB 4FQXB 4K8RD 2IBZY 2AQPA 3FT4B 4E0RB 2AK4B 2I7SA 1HQ4A 4GUPB 1CFQB 1XIWD 1PZSA 4XN8A 4CN1A 4WHCA 4P4RA 4YDJB 1K5NA 3HMWH 1B0GB 4I8DA 1KTRL 3S48A 5GS2D 3I3EA 3ULSB 1ETZA 2VL5A 2GAZB 3BHBB 3U6XS 2FYYA 5LGJA 3TS8A 3VXPB 4NUGH 4U1MA 4YZFF 4G6AC 1JP5A 5KVDE 1IM3B 1QLEB 2YD1A 2WTRB 4A7QA 1JGEA 2W1NA 4R0LC 4Z7QB 3BOVA 2EUXA 3QUKB 5I1DA 3OMAB 5B1BB 2JLPA 2J8UF 3ORJA 3ZK0A 1KB9K 2N7SA 1SQ2N 4ZRGA 3GM0A 1DBJH 1YY9D 1Z7JA 2AV1B 1P4UA 5AW6B 5JXAL 5IEHB 3EH4B 2ZSWB 4H40A 2OK0H 3O41B 5B3NA 4Y19A 1K72A 4DSYA 3IVKB 1MY5A 5F7BA 5FA3B 4R4ND 3DYOA 2L7QA 2QTVA 3EAKA 4XZUA 5E51A 5A16B 3LQZA 2BVPA 1BFOB 1G9ML 3K6FA 4EIZC 3ZE1B 2UWEE 1U8JB 3GBML 4ZTPL 4N1CA 2PTVA 1NBQA 5DFVC 2J1ZA 5DT1L 1MIEH 4LLAA 1QYGL 4X6FB 2WC7A 5EFIA 4KK5C 4XBPB 1WFJA 4JRXD 5MP6H 1X7TA 2P5PA 3ETBJ 4FF9A 1KN2H 1KWKA 5IMOB 1A64A 5DJ6B 2EDXA 1A0QH 4NRYA 2DIJA 2EDLA 3MX0B 4X6DB 5T1LD 5H2BA 2CCLA 1I85A 4GBXD 3ROOA 2JKWA 4GKSB 1EVUA 1HCFX 5DJXB 4Y1AB 3T2OA 3OMNB 4P5KB 4L3EA 1CCZA 4YH6A 3QIWC 3WXWH 3QUYA 4L4JA 3F7KA 3BXNA 2ZZUT 4JQIA 3HC2A 1T6VN 4WWKD 2RIKA 5DR5H 1XSJA 1WD9A 4FNPA 2YUVA 4HHAB 2ITDA 2Q10A 1T20A 4RQQA 3FC8A 2DBLH 1LD9B 4KFZC 3RTQC 2Z91A 4OD2A 1G7QA 1WGVA 3PDDA 3NPZB 4JN2B 2IH9A 1IFGA 3D1MC 4NUMA 4OW6A 1IQDA 1TTCA 1AGCB 1JJUA 4M00A 4LLQB 3FUFA 3OPZH 1T0NB 2XWTA 3KEHA 1S46A 1RUQL 2BOLA 3ECUA 4L3FA 3N41B 2UZYA 1CFTA 3L3JB 4MA3A 1TQTA 2CXKA 4F2ME 2XWEA 3QUMA 3DUSA 3DX9A 2WLZA 5LJYH 1Y1UA 4WRLA 4AUUA 2CO1A 1TO4A 2WPGA 4MA7H 2H6OA 2OJZH 3ASWA 1ZGLP 4NBXB 3ZRSA 1F97A 3HZYB 1PZ2A 4EI6B 5ID1B 1ZLUK 3M8OL 1LXMA 2G5RA 3KLSA 1QO3A 4W4NA 1DQLL 3FN0H 2CALA 3ZHLA 5CP7B 1WA1X 3B9EA 1R0AH 5CM1A 4L23A 1IILE 2VW6A 3IDYC 4LHQB 4DKFH 4XNUH 2YD2A 2ZOKB 3PPSA 1USQA 1TJMA 2QV4A 3OKLA 2C9RA 3OF6A 1I85C 5HVHC 4FTVD 1C9SA 1UZGA 3LJ3A 3M17B 1QLEL 2R2BB 4MNQA 3M88A 4EQ3A 1NDGB 3US1A 2NDGA 4KUZH 5AOLA 5EU6D 3QUYC 2VITB 4GI8A 3DX8B 4PD4K 3EH3B 2EADA 2Y7QA 2B1HL 2HFGH 2MIZA 2Y3AA 1CLCA 1MLBA 2HKFL 2F53A 5GGTH 1J0JA 5L2JB 2GCYB 4HC1H 4TNWF 3EYSL 3LYRA 3VYNA 3FUKA 4HS6A 1K4CA 4GI9A 3IJ8A 1TPXB 4FNRA 4HCRH 5K9QI 2UX6A 1ZT7B 1DUYB 1D9KB 3A3YB 1OT2A 2YD6A 3VXSB 5IB3B 4MKTA 5I1HL 3QORB 1CFNA 43C9A 1OXYA 3J8F7 4MKMA 5KTEH 1PDKA 2FO1A 2GYSA 4P59H 3STZA 4DGYH 2AP2A 5JIKA 4WW2F 1RVFH 2GJ6D 2IADA 4QJ5B 2WXFA 4P06A 1JD7A 3D06A 1DDTA 2XWDA 3LZFH 2A83B 3MRGA 5T3ZL 3BO8B 3CSGA 3AGVA 1MHCB 5FYLH 1GMEA 1ASPA 4XWOC 4QKTA 4Q9CA 1KIUB 2EO7A 4H4NA 1TQVA 3LEYL 1OZTG 2WAQA 3GIVA 4NZDA 3FPXA 2DMGA 4CVZB 5E08H 2YXFA 1BYPA 3LH2L 3MPCA 4ORGB 4DWHA 5A2FA 4AVIA 1BZOA 2Q7YB 4H88L 3T0DA 3AUVA 4I48B 4RX4A 1WSST 4LIQE 1TR7A 3DX4A 3HG1A 4ZW7A 2X4RB 3H3BC 1UM6H 5DJCB 5EZJB 4HKXA 5F7EH 2X28A 2EICA 2WINB 5EUOA 3CQPA 3FQWA 1RZPA 5A7EA 3BIKB 4XP6L 4ZDHA 2YPLA 4PGDB 3PGDB 1UACL 3DRTB 4WI0B 3I2CL 2Y72A 5TH2A 3EZ8A 4U1HB 1T1WA 1OTUD 3NIGE 1J0ZA 3FU3A 3MV7E 2D31B 3GSOB 1NKGA 1N0LB 1WLHA 3QHZL 3MA9H 2NCMA 4UZGA 2APFA 4XMZA 2EDJA 3SO5A 5BMFL 2XN1A 5DJ2B 3L9YA 5EIIG 3QDJA 5F7DB 1IC7L 2HH0H 4GAAA 2Y25A 3FRUA 1DJIA 2EH8H 2OV0A 1OD7A 4KJPC 5GGRY 3I50L 2YPVL 1T7YA 2BHFA 1F90L 1KENL 4Q58C 4RGOL 5TE6H 5CEZE 2A6DA 1DZ0A 3FW6A 1KXHA 1R4XA 1VACB 4UINH 4KZ0A 2ZXDA 3MLSL 4DKAA 4HUNB 4EZMA 2BNUA 1G6RL 3FB7A 1A7OL 1U30A 2XQYK 2BMKB 3MROB 5PCYA 3UO8B 3X1EA 1X5XA 2FT8A 3DBXA 5IZ7A 1TU2B 3OHXB 2ADIB 3FU7A 3TPUA 3CFCL 1P4IH 5JHDB 1U4FA 2YXWA 2RH0A 4GFTB 1A4BA 5ILTL 6FABL 3X11B 2QVFB 4JRLA 3VGAC 1E2VA 3NSDA 1PGRB 4WI2A 4WSKA 4YSRA 3NFPB 1MLCA 2IOOA 4IHOB 5FO9A 4OLXH 4W9ZA 3UBXG 4JO4H 1TYRA 2C26A 3P4OA 1CO1A 4QRPE 3EO9L 4QTIL 5B4MD 3NTCL 1BQRA 4D8PA 1ZT1A 1MI5D 3EHBD 3FTVA 3JV5A 1CFMA 2JMRA 2V2WB 1DQDL 4UQ9A 2OSLA 4PM1A 3ZTNH 4OJDH 4U3CA 2F74A 2NR6A 2OYPA 1E65A 1E5YA 2YBGA 3DV4A 5IFHH 1ET5A 4U1LB 2NY5C 1D5IL 5J13B 2WUBH 3VFUB 4FS0A 4Z9KB 5JUEL 2QELA 2EYRA 3QDMA 5EN2A 1JTOA 3L7FA 2QGCA 1KLFB 5AW2B 1CLZL 4OLZL 3IDJB 1HT6A 5JR1H 3EH1A 4GG8A 3EJSA 4BSVB 5I76A 3TXAA 3ARGA 3K6OA 1B2WL 4HHWA 2WVVB 4HIIB 1R3IL 4J1UA 4PVNA 3QFJE 2XWBB 4JHAH 4NZTL 1YJDL 4QYOA 1JZ7A 2OX5B 2DD8L 4O5LL 2IPKB 5F7HA 1XEDA 1X9UA 1JNLL 1KTLB 1W8NA 2VGLM 1TZIA 5DMKA 1B0IA 2Y5TB 4IBVA 3APFA 4AYFA 3O11B 5EOTB 2BERA 4R0LB 2BFGA 3ZX1A 1SMDA 1E9QB 1NMBL 1XMEB 3RUGB 3W2DH 4AKQA 5DJYA 3S4SG 3SJVB 1HSBB 4TNFA 5LGYA 4HOXA 3D7PA 3K0WA 3SKUD 2DQIL 1MCOL 1UCBH 5FHAH 5DGQA 5E9DE 1WGOA 4URKA 3F58L 1NBYB 2NY0C 3A21A 5FOBB 5FO8B 5CILL 4X5QA 1IGIL 1OARL 1KJMA 5B22A 3T6WA 1E8YA 1DFBL 1GH7A 4ESKA 3TNNB 1H3PL 1LK3H 5E94A 2A74C 2NR6C 4EOWH 5C0BD 5LN4A 4L37B 5IV2A 1FFPA 1AZNA 2IBZX 2W0FB 3PGCB 4LLWA 5FYKL 5ITFB 3UPAA 3WY2A 3D33A 2Y1YA 4F15C 2VERA 1YCSA 2NNFA 1XGTA 4Z7IA 3ARTA 3F01A 4YHKH 4F7MA 2ROXA 3P77B 1J9TA 1BM3H 3UPRB 2DEWX 2M83A 2YKLL 2UWEF 3ULUH 5E5MA 4PJ7E 3ARGC 4P4KA 4QGTA 4HJJL 1N26A 1ZV2A 3ELAT 4FOMA 3ZJAA 1WIUA 2ZUWA 3KJ6H 3EH2A 1OAKL 1K5NB 5LG6A 2GG1A 1XGUB 5DC0A 1Z0MA 3DJZA 1ETZB 3X3GL 3QIWB 5HD8C 2VL5B 3AS3A 5LGJB 2FYYB 4Q2ZA 1IAKA 2MMXA 4GKZA 1IGCH 5HYQA 4U1MB 1QFWL 2BXZA 4KRPC 4UB0L 2TAAA 1JGEB 3ARDA 3RTQB 4PRAA 1QG3A 3SKNA 2I26N 2DQHL 1XZWA 5F9JA 5FX3A 3DNKA 2X1OA 5I6OA 1MW3A 1CR9L 2ZP8A 4YLBA 2P5WE 3LNFA 5I1DB 3EXJA 4H8PA 5CUSH 3QBTB 4XNDA 5F96H 4AC4A 3QC5X 4PRID 1QSVA 3IGFA 2WM0A 2WANA 3TL5A 1CDYA 3UADA 4AGLA 4K3GA 5GGTA 4C4BA 4PJ9D 1CYGA 1WH0A 2V9RA 1ROWA 2B3IA 3N04A 1MCEA 3SPCA 4DIXA 1I3VA 5C1MB 1I9IH 2CA4A 4XZUB 4Z7VA 3LQZB 2YBRA 2BVPB 3L2LA 1CE6A 1NMCC 4QNPF 3CHQA 4HCRA 6TAAA 1RSFA 4KKBC 2I25N 3GSVA 3GKWH 1D5XA 5EEVA 3KL0A 3AJ7A 3ZE0F 2EXWC 4KMQA 5I19L 5JIDA 12E8L 3QO0A 4E9LA 3IDYB 2CRYA 2Z9TA 1FNGA 2LTQC 3FH5A 4GSDH 2XV2A 3QWOB 5D6DA 4P4KC 4NRYB 1I8AA 5I17A 3MGOA 3B9VA 3WFBH 5H2BB 2WQXA 3IDGA 5FWQA 5HVHB 3ROOB 3STLA 1K6QH 3ECBB 3I3BA 4RDBA 4UOQA 1OAYH 4JW3A 1CD9B 4L3EB 2FQDA 3EF7A 1QRNA 3QR0A 4V2CB 4CDGC 3QUYB 1MDTA 4LSQL 4J3SA 3VW3L 3BXNB 1SXNA 4JHWL 1BQUA 4PBWD 1GIGH 2ITDB 2YQ2A 1T20B 1UB6A 5C0GA 4RQQB 2IMNA 3G9VA 3ARDC 2GUOA 1B3IA 2VH5H 2Z91B 4OD2B 1I31A 2VN6A 3GXNA 1G7QB 1HL9A 1NCOA 2PYEA 4LQFL 2NW3A 3FU0A 3FJTA 4FYSA 2Y36L 1M71A 2XWTB 5CEYA 4PJDE 5FV1L 2OP4H 4ZS6C 2CHXA 4E41D 4KNUA 2W65A 2UZYB 3HIZA 4MA3B 1U8NA 1ICTA 5JYMA 4L0YA 3DUSB 1JK9A 5FFLA 4W1TA 3R19A 1DDHA 3W37A 3FFDB 2AC0A 2BSCA 2Q8BL 1G7HA 3CG8A 5F3HA 1T2QH 4NHUA 3VGDA 3K2UH 4JKMA 2RTTA 3O4LD 4KUCD 1ZLDA 3IPBA 1QO3B 1FE8L 5E4AA 4B60A 2RB8A 2J88H 5GSRA 4OLYH 1U33A 1UJTA 3PL6D 5IWLA 4YDKH 1CIDA 5D6DC 4PW4A 3PWPE 3T2PA 5E6IA 3OKLB 3SSGA 1PIGA 1ZLUH 3THMH 1QEWA 7PCYA 2WB7A 3QJHA 4BA8A 5FFOA 5IBUG 1SN5A 4PLOB 4HFUH 4MNQB 1KTJA 4W81A 4FTVE 2BWQA 3ISWA 3T8MA 2ZWLT 1QSFD 3K2IA 1MDAA 1SN0A 1NLBL 2Y7QB 2VDRH 4JPWH 3OC5A 4EEEA 2AJZA 5EU6E 1MLBB 2F53B 3UYOD 4RZCB 1PFOA 2F58H 4MXVE 1KGIA 4Z7UA 3IDNA 4OZHF 4BH8A 5KVGL 2GB2A 4HS6B 1A5FH 1K4CB 1OAJA 3LQMA 1LNUA 3QT2A 4KX9A 4QUOA 4TUOB 2WQ8A 4GFXA 5CSBA 2H8PA 4EMZA 1JOIA 1X7QB 5C0AA 1CFNB 7FABH 1T03H 1HHHB 2HFEA 2NY7H 2YZ8A 1FFTB 3STZB 3HS8A 1G4RA 4NJ9H 5EZLA 5KUMA 1RUAL 1KGJA 1YEWA 4YVUA 3MRGB 4XX1E 5L8JB 2CUAA 2XU9A 2CHWA 3SBWC 4HEME 2DF3A 2H3KA 2GITA 2WTOA 2UX7A 4QWWD 1T0MA 3GIVB 4P0DA 5DFTA 1U3HD 2CKBH 5ITBL 1RFDH 1H15A 3B1TA 5EU5A 5IWLC 1LVEA 3VGAB 3G6DL 4DGIL 1PIFA 2OMXA 3MC0A 3UTOA 4F2EA 3HG1B 5E6IC 3ARYA 2WXGA 1V3JA 4JQIL 1T3FB 3WFDL 4HKXB 2JFCA 4NZUL 2OXGA 1G0DA 3FTYA 5EUOB 2C9PA 4EF3A 2G75A 1A6WH 3FQWB 2WYHA 1UWGH 4KZEH 2H0EA 2YPLB 5BQ7A 3JVGA 4FFWC 3OLEA 1HI6A 1T1WB 1V8HA 4YGVA 2A1WL 1FRGH 3CBJB 1X9RA 1JXJA 4M3JA 5C92A 5DQ9A 3VFWA 3QHFH 5IHWA 3QUML 3QDJB 1MNNA 1KXTB 4PJ5A 3QJQB 2N1KA 5DO8A 4Q89A 4QHMB 1ZS2A 2W9DL 4KDTA 3X1NA 5HJBA 5I0VA 4WEUD 2W0PA 3A24A 4DNLA 2XTJE 4PJIA 3V0GA 5K9JL 3FQXA 5IROD 3DC0A 2DS4A 3K5RA 1WAEA 4HEPG 1OW0A 4KHTL 1RUPL 2A6DB 32C2A 3P3YA 4HBQA 2ZF8A 3GHPA 5DMGD 4FMFA 4F5CE 2CG9X 2NY4D 5I1JL 4HH9A 2UXFA 3IRPX 4P8QA 4TQEL 1OB0A 2IALA 1ZVSA 4J3OF 4PS4H 3LB6C 3O6ML 2BNUB 3UG5A 3FB7B 3ZDXE 2BP8A 4LEOA 4RFNC 4ZMYA 2VLME 2YGNA 1WEJH 2BNQA 4HOMA 3FU7B 3HAEG 3TPUB 3CZKA 4FQCL 4LDOB 3WSQL 2YD5A 1E5AA 1T7XA 1O0VA 3BAWA 5HPOA 5AQ0A 1I7TA 3VGHA 1FORH 4Y8AA 2K3HA 1MLCB 5FO9B 1FC2D 2NX5E 3QHTC 4GO6B 2NY0B 5IY5B 5CINL 3P4OB 3A23A 3MN8A 2C5DC 4J27A 2CPUA 5G5DA 4RRPA 5CR8A 3Q2VA 4LAQH 1ZT1B 4D8PB 4LCVA 2OSLB 2NUPA 5AVQB 3JVGC 5FOJA 2A74B 2F74B 5E00A 3UGXA 1JK8B 3DV4B 3RB5A 3CDYA 3N06B 2EYTA 3D2UA 2R0ZH 3VRLE 5IJCC 3S36X 4F15B 1YECL 4KBPA 2EYRB 1IV8A 2CNZA 2Y7SA 3QDMB 3H3PH 4P48A 4R90L 3N1GC 2C7FA 1HCYA 1QZ1A 3QNXA 3QQNA 2AEOA 3C8HA 4NCC2 4ECNA 1QBLL 3HRZA 3RWFA 3V52H 4K9EH 4GG8B 5I76B 4EBQH 3ARGB 2LLNA 4KDTC 2AGJH 2NYYC 3QI9B 5LBSH 4JM4L 1A3RH 1EMTL 2V8MA 3U36A 4LOFA 4XVUC 2O5YL 3M7OA 4J1UB 1OW0C 1F3DH 3QEUA 4I89A 1I8LA 1N4XL 1PEWA 2WXHA 4QYOB 3S37H 2ZCKH 4JN1L 1EXGA 1KBBA 4LCWE 2Z4QA 4W70A 1R5IA 2HLEB 1TZIB 4JKPH 4KRPB 3W56A 3ULUC 4AYFB 5ESVA 3CX5K 5J11C 5KZCB 1F4HA 1RP8A 2J8UB 2R83A 4NN5C 3BWAA 1UUSA 4Y2DD 4KJQD 1RJLA 5DJYB 5GS0D 4OFQA 4YFEA 4WEBL 4Q14A 3CE1A 1J1OL 3GTVA 4ZS7H 2W5PA 3UYPA 3VWKD 3QNYA 3AQYA 1J8HD 3KBPA 3MRCA 2A0LC 3BGMA 4PGBB 5HP5A 1J5OH 1Q9LB 3O3AA 2Z8SA 3ZL1A 4XP4H 2NY3D 4Z76A 1KJMB 4MJ6A 1HNFA 2P7TA 3SQOH 1TQSA 4OUOA 1AXTL 4YMPA 4EE2A 2PKDA 5E94B 3UFIA 3TZVD 1NMCB 3QJOA 1EEYA 2BHZA 1NINA 1WS7A 1EFXA 1FFPB 2X10A 2C9UA 4KC3B 4LLWB 4OZGE 5IV2B 4YDLB 1L0YA 3RIKA 1UD4A 1XGTB 1OSPH 5ABZA 3W82A 4F7MB 2KERA 3HRZC 4M8VA 3SYOA 4DP6X 5GS2H 3N9GL 2E74C 3E1F1 2LTQB 4P4KB 4KO7A 4NQVB 1CD8A 1U8PA 2VLRA 3AS0A 4GRLC 2KZBA 2IQ9L 5IG7A 3HC4L 3QZMA 1I8LC 4NFCA 5BRZA 5JIPA 1I1CA 3GXDA 1B4TA 2CMRH 3DTXA 4WNJA 4PJ6A 4U7SA 4KQ3H 5TE4H 4B96A 4Q2ZB 4GKZB 1MFUA 3UC0L 1CN4A 3UTZA 2IPTL 4Y5XA 4YUEL 5I8EB 1CWVA 4HWUA 2MKWA 1BBJA 2FJFA 4M03A 3ARDB 4NM8L 2VDQL 5EEZA 2BNRA 2FT6A 3A67L 3S37X 3NESA 3SKNB 4AQOA 5F9JB 4WI8A 4LLDA 5I8KL 2UZPA 3VE0A 1BZ8A 2IAMD 2ICWA 3IXTA 3P11L 4O02L 4YDIL 5DZNA 5GGRA 3QEGL 1Z32X 2ZE0A 3DIVA 4OCSL 3MV11 1ID2A 1S5HA 5JZ7C 4RH4A 1D2OA 4I7ZC 4WGVB 4CC1A 3DETC 3G6JE 3ILDA 4HZ1A 4L0PB 1UOKA 4Z7VB 5EORH 1U93A 2YBRB 3L3GA 4DP4X 2HLAB 1IAIM 1UGNA 1FF5A 1UH3A 1XZ0A 4PJHA 1KELH 1WZAA 3KW7A 4F33B 2FWOA 1SEQL 2B77A 2I5YL 3L5WA 4EKXA 2PO6A 5F0JB 3TFKC 5TQ0H 1U0QA 1DBAL 2FECL 1ECYA 2Y1AA 5IW3A 1FVCA 2RA1A 3EFOA 4G5AA 5D7LD 1M7DB 3QO0B 4OY9A 5J8OA 5BUGA 1FNSL 2BS71 3WNLA 4LPTA 1FNGB 3MYZA 3PHAA 3PUUA 4OBRA 5AL8A 5DRZA 1MIEL 4MA1C 4F7TA 3O3BA 3Q2CA 2EXTA 4YBHA 2B0SH 3IDGB 4JQVA 3STLB 1N2RA 4M3HA 4CBPA 5AVUB 1TEYA 3ZL4L 2EDEA 4DK3A 3LZLA 3VD5A 2AEQH 2Z8VC 3MLPA 1QRNB 3H53A 2CKBA 4PP2A 3GHEH 2N3JA 4LSPH 4LCCA 1R46A 2X87A 3T3PF 5EU4A 1UB6B 2JQMA 1PS3A 5DYFA 1GCYA 4Y5XC 4JFDD 3TN0A 2LGNA 3W1ZA 5IT2L 1Q4NX 2GUOB 5SWSD 1J0IA 2UYLA 5DR5L 2E7MA 2PYEB 2NW3B 3NIDE 1Q38A 2LFEA 4WW2B 4D9RE 1RUML 2KC0A 1PZDA 3ZR5A 1G9EA 1G6VK 4L8DA 1M71B 3RWEA 5CEYB 2F5AH 1PX3A 4BZ2L 3ULVD 3VFGH 1P5VA 2W65B 1K9TA 4N85A 4BHUA 4E9RA 1VSCA 5ETUB 4E41E 1Z5HA 1AAJA 3E8UH 4D8OA 1DDHB 2R29H 5G4MA 5IW6A 3KVDD 4O51A 4OIIH 2Q76A 2EO1A 5L4JA 1G7HB 4Z3TA 2X9YA 5AVXB 4ZMNA 1RY7B 4HUXA 1P7KA 4NHUB 4HD5A 4JCLA 1I3GH 4TYUA 5T5NF 3U7AA 3KL3A 1DJYA 5JA9A 3QCVH 5GSRB 3DGDA 5CJ5A 4OI7A 3SYCA 3H9SE 3O4LE 5K33A 1J11A 5CGYD 3NEOA 3VFOA 5L7XH 4MLSA 4OSUH 3P54A 1GGIL 4F7PA 3RWCA 4NNPH 5E6IB 5T3ZE 1EAPA 2TSAA 1QEWB 3QJHB 4OJFL 2MQ0A 2BIPA 2V5TA 4LASH 1L4IA 3QQDA 3VI3A 1WZLA 3UP1A 1GGCH 1FDLH 1MCPL 2AQ3A 4LCCC 5B7FA 4A37A 4ZO8A 4OVUA 2IG2L 1CGSH 2AJZB 2P80A 3PWVA 2A3TA 2OS7A 3N3EA 3TN0C 4LLMB 1EA9C 3IDNB 4Z7UB 1JN6A 1BVZA 2E46A 4XCYA 4CBZA 5K59E 2K9FB 2CLVA 5KBPA 4OJYA 2BW5A 1LNUB 5TF1L 1EWHA 5DWUH 1UWEH 3MXVL 2H8PB 3R8BB 4HD9A 4PH8A 4X5RA 5C0AB 3AXLA 3C60A 1AG0A 3TGXA 5EZLB 4OCYL 2OZ4L 3IJYA 1S7RA 4TPRH 3ZY7A 1NBVH 4IEFA 1OTTD 3S97C 4DGVH 5IBTL 5C7XL 3HUJA 3PWJB 2AS5M 4U0RC 4UTAH 2NZ9D 1QTPA 4ODXA 1Z9OA 5E5LA 3D39E 3T3ME 3DPDA 4XMPL 2GITB 2WD0A 3ZZLA 4AX3A 1T0MB 3KLQA 1BF2A 5C08E 4I18A 35C8L 5FLUA 2WVTA 4NKIH 5KJRL 5LBSA 1NCWH 1F6AB 2CQVA 5EULV 1OZUA 1AZBA 1H15B 4P3WA 5EU5B 2NYZA 4AUJA 2OMXB 3BIBX 2R0LH 1A8JH 2EE3A 4MBRA 2YD9A 4XI5D 4DN4H 4M5YH 1PZAA 1RMFH 2VN7A 4GSRA 3T2NL 2OXGB 3WLWC 5KVFH 1Z5YD 3VYOA 1NPNA 2G75B 5CEXA 2FB4H 2HVJA 3MHZA 4XPHL 5E2UL 1BD2D 3QFDB 2CIIA 1CVRA 2P9RA 1HI6B 1SXSA 1HQRA 3LHAA 4YGVB 3V0IA 4XC1H 3T0VA 4AW7A 3GLDA 4MD5A 3PY9A 3QJVB 4JQXA 4KK9D 4X98A 4XNBA 5DD3L 4ETYA 4PJAA 1DLFH 3TEWA 4HG4J 3FSOA 5DQ9B 3I85A 3VNYA 1BG1A 4JFUA 3VFWB 1JNJA 2ITFA 2WOBA 3P3SA 1GJWA 4PJ5B 3SKJH 4DOHE 2VXUL 2IANE 2OI9C 4X6CA 3V9CA 3PQYD 3H4FA 1OAQL 4PJIB 3C60C 1NC2A 3FQXB 3VXMA 4ZD3L 3QULA 2MPAH 2X4UA 1S9KC 1JNNH 3TEYA 3UCRA 32C2B 3JWDH 3U6RB 2E4TA 3UAFA 2WSPA 5T5FL 5DD6A 2EH8L 4N8CH 5JPMA 3S88L 4Q97A 4HH9B 3ROLA 4NP4H 2ZUVA 4U1IA 2IALB 1EAQA 1ZVSB 4XCCL 1HVXA 1FPTH 2RMNA 2BP8B 2D3NA 4K9EC 1MF2H 4LEOB 3VACA 4MB4A 4YEFA 3Q43A 5J11B 2DL2A 3CN2A 4I18C 4NN5B 4ICWA 3WDHA 1HC1A 1MY7A 3QEHA 2A38A 4ZOCA 2HLFD 3NZ8A 5B38A 2Z34A 2YGVA 3DHPA 4L05A 4RETB 1OAXH 1MQKH 4WUUA 3ARED 1RURH 1I7TB 3BGAA 4MBOA 4ENED 4XMTA 4TQPA 2Y07H 3AY4A 3QPQD 4OI9A 3LKQA 1QSEA 3A4EA 5L0QC 4BFGA 2LOEA 3FQTA 1NOAA 1SUHA 4J3XA 4N8UA 4NJAL 4LXFA 4WFFE 4HLZG 4F7CA 4ODSL 1YEHL 2NUPB 1J9QA 4PB9L 3RY4A 5E00B 4HPYH 1ERNA 1MHPH 1D5BA 2EYTB 3D2UB 3E6HA 4PBVC 3NACL 4JQXC 5SWZE 2JTYA 5LNGA 3PPEA 2ALAA 3QNXB 4OR1A 4F37K 1XH0A 1PEZA 4Q74A 3HRZB 4WI7A 3QP3A 2WQSA 4HGWA 3DJ9A 3C9NB 4OFPA 5FUCE 2XOTA 3V9FA 1KYAA 1U9KA 4OLWH 4G8GE 1M2OA 4U3SA 4KY1L 2FLRT 5CGBA 1ASOA 3FQYA 4GRLB 5EOCH 3U36B 5EUKB 3F6LA 3SE9L 3QEUB 2GUYA 2ETWA 3S7GA 3BT2H 1OGAA 4M02A 3MUGA 5JPMC 3PP4L 2E8ZA 2P8PB 3NEXA 5AOIA 2KMWA 3ARFD 1TT6A 1IBGH 2Z4QB 3SPGA 4NN7C 5AALA 3L5HA 1U3JA 2M26A 5ESVB 5C09A 1ZCRA 3LS5L 5LVEA 1TJGL 3BWAB 4BZYA 5I23A 5LLIC 3VX0A 3ILQD 3VD3A 1RJLB 4NCC1 2FNBA 4A68A 4CC0A 3LIZH 3WNNA 4JLRA 2ZCLL 5HSFA 3UYPB 2AFNA 3QNYB 3AY4C 3BSZL 4O00A 1A7RL 5E5RB 4C56E 2ESVE 3HFFA 3BGMB 4RWHA 3OLIA 3O3AB 5BVPL 1AI1L 1NIDA 4Z76B 4APQD 4BK8A 4MJ6B 2NZIA 4HBCL 2P7TB 4GLRI 5EH1A 4B6ZA 5CCHE 5AL0A 5FUOH 2CR0A 1UFUA 2GIYA 2ADGA 1EEYB 4HUUA 4MWFA 1DVUA 5E23A 5F7NC 2NCEA 5GHWL 5HI5C 5A3ID 4S2SA 4GQRA 4UANA 2X89A 3QZLA 1TCRA 2P5EA 4XPBL 3GBNH 4R26H 3RWDB 1FYHB 4K3EH 4DP1X 3SKOA 2DKUA 1VFBA 4UTBH 2AJSH 5AB0A 3HB3D 1A14H 3DGGA 4MA1B 1WF5A 1L3WA 1U8PB 4JDZA 4M5ZL 1TJIH 3HI6H 4ODTH 5IG7B 4AQ8A 4I3SL 4LRIA 5BRZB 1RLWA 1Z1WA 2E6PA 3LAFA 4OTXL 3DTXB 2Z1KA 5E8DH 1ZWIB 5L2KD 1K8IB 1HU8A 3UTZB 1OCWL 1Q94A 4Y5XB 5FYJL 2YEQA 1NCIA 4UYQA 3MV9D 3B7TA 3CPLA 4RMUA 1N9PA 1KYUA 2BNRB 3SCMA 1BDYA 2WNWA 5B1KA 4Q9QL 3IXTB 2ICWB 4WTXA 5GGRB 3CVBA 5DUPL 2QQKH 2OJEA 2YUXA 5D71H 5EZIL 4U1GB 5FM8A 4U3HA 1JZ4A 4PJ8B 2VDRB 1XO8A 3BVDB 1S5HB 4YBQC 1INEL 1DBKL 4YDMA 1TQWA 2ZG1A 3Q7JA 1E3XA 4YX2L 2HTLD 2NNCA 4NPJA 4EXKA 1U93B 3L3GB 4YSUA 4XB7A 1XZ0B 4UDTA 3KLAA 4PJHB 2XPYA 3NCJL 3L5WB 4JFZH 5ICUA 1DL7H 4KXAA 15C8H 4KTDH 3EFOB 2PWDA 4Z5RA 4P2QE 4WFEE 2HPOA 4WFHD 2ZT9C 5DRZB 4YXKL 3Q8CA 4U2YA 3O3BB 4UTAA 4F7TB 1UFGA 4ANKA 1N2RB 1SXCA 1HH6A 3CLEL 3GIZL 4BDVB 1IFRA 2A7BA 4AQ8C 4LRIC 1BFSA 4K5NA 2YSSA 2IH8A 4M1CD 2ZKWA 1EX0A 1NUGA 1E3ZA 2VQUA 4KUCF 4X5WA 3EUUA 2FR4A 4LSVH 4PP2B 2CKBB 2IOMA 5MHSE 1YPZF 1NLDH 1XGZA 2EECA 4LCCB 3NIFB 3REWA 1XWVA 1U8HA 4B9CA 5EU4B 1OPGH 3TN0B 4LCUA 5JHMA 3JYCA 5AZEL 4Y9FA 2FL5A 2XY2A 3SCMC 5DFWH 2ZOLA 2UYLB 3JWNH 2XA8L 5DZOA 3LNEA 1JPST 4L8DB 5IFJA 4RMVA 4KTEL 3W5NA 3BZ5A 3B6SA 4KMTL 5IIEA 3GM8A 3WTSA 1P5VB 3BD4A 1I8KA 3CSTA 3C75A 2NNRA 4LLVA 3L08A 1EZUA 5B8CA 2J43A 5HGHA 4HWEH 5KVGE 5D5ME 4U0RB 5AW7B 5IW6B 4Y0GA 4O51B 2AABH 2Q76B 2E8YA 5DVMA 4HUXB 3BN3B 5E1HB 1P7KB 1KYDA 3NCEB 4LF3A 3MZGB 2BIOA 5IHLB 4MHHI 4QXVA 4N2LA 3UGUA 5ALCH 3RNQA 3HMXH 2L7UA 3CDZA 5E2TH 2X6CA 4ANUA 3VFOB 4HJ0D 1P6WA 1S3KL 3BEVB 4G59C 5CGMA 4HULB 5HHQA 3T8XA 4N0UA 4KO5A 3MLYL 3UIYA 4L8BA 4F7PB 3MGTA 1EAPB 4A2MA 1FV1A 5EZOL 3AITA 2WBJD 5DRWA 4Z8FH 3JV4A 4K3JH 2R4SH 2GJJA 3VI3B 4FABL 5LDUA 1GTFA 2V33A 5LCVL 3WNMA 1MOEA 1J48A 5AB1A 2JIXA 2ITEA 1TLMA 5BS0D 1Z9PA 3DXAA 1PSKL 2K6WA 2VMFA 2HZHA 3ZT7A 4N2AA 2Q8AH 2ZUQC 1JN6B 2RJMA 5GGVY 4TUKL 1N5YL 2KDGA 1V7ML 2CLVB 3D0VA 4OFIA 3FTUA 4C59B 3NJMA 3B5TA 3NVQA 2EKSA 1INDH 1WBYA 2ZXGA 4BUQA 2OI9B 3D25A 3CZSA 3AXLB 2ZICA 3FRPG 1NFAA 4FQIL 1VZGA 3BPOC 3S3CB 2NY1D 1IGJB 5E6YA 3ZKMD 5B8CC 3W5MA 4B0MB 5ALBH 3LN5A 1H8LA 1OSZA 1FBIL 1O6VA 3HUJB 4UT7H 4NYLA 4GY4A 4K94L 2WSKA 2D3VA 4ODXB 1RZJH 1XL4A 4Z78A 4LESA 1RV6X 3TO4D 1PLGL 1UGKA 2BDNL 3ILPA 5I26A 3BVVA 1PD6A 4I18B 5TPWH 4ZTOL 4R8WH 1ZANH 1H6TA 4MGXA 3ZGIA 4GP4B 2BW4A 1E8ZA 3BQUD 1N64L 4XBGA 2WP3O 4YDZA 3E6FA 3BVWA 3L4VA 3JWDC 4PG9A 3TLRA 2QFRA 1AYOA 3LN4A 3L1OL 3P0VH 1QR4A 2R7EB 5L0QB 5LBVA 3SOTA 1BQKA 1MVYA 3V0WH 1F13A 1F8TH 5DQDH 4F57L 4XTRD 5CEXB 4QEGA 1I9RL 2HVJB 5I8CA 4OD3H 1LLAA 1UD6A 3ETSA 1CF8L 4OUUA 2CIIB 2V9TA 3KGRA 4NSKA 1AH1A 4X4XA 3TJEH 3W3BA 1HQRB 4NXSA 1ACCA 3LIZA 3S36L 4Y2NA 1Q1JL 1BD2E 3EYFA 1RHFA 3QXVA 4X98B 2N56A 1U92A 4PJAB 4N3TA 1RK7A 3UTQA 5FECA 4OH2A 4LARL 1HCVA 4H7VA 4TVSa 5H4ZA 2VOTA 1UOVA 2OMYA 5GZOA 3MJ9L 4X6CB 3S35L 1NC2B 3VXMB 2XWRA 2X4UB 3AVEA 4EKJA 3GKZA 2X6MA 4JZNA 5HJGA 3DMMD 1TNMA 3BUBA 3BRFA 5JPMB 4PI2A 2YARA 2O6PA 3BUTA 3ROLB 1UH4A 4UAOC 2VM3A 3HE7A 4U1IB 4ZTEA 3U2IA 4NN7B 1XSIA 1QVOA 2X4OA 5CIPH 2C3HA 1U8CA 2ZJSH 3VH8A 4UTBA 2D4FA 5I2IA 3QARA 2F0CA 3D5OF 1GYVA 3T0EA 1CD0A 4NNYA