5AP4A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
280
structure length
257
Chain Sequence
b'FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNGWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANMQPDQVGVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 257
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap4A01
2BKZA 2OW3A 2W05A 4F6WA 3E64A 5JMSA 4FYNA 3QYWA 3VW8A 2GQSA 2YWPA 1PXNA 3VUMA 1ZYCA 5L8JA 4AXAA 2WQNA 1PXOA 2BAJA 2F49A 5K5XA 5ETAA 4FL1A 4RSSA 2PVLA 3O71A 2HWOA 2QURA 4FNXA 4YJOA 5HCYA 3R9NA 5FD2A 1WVYA 4M13A 3EFLA 1PXKA 3CBLA 2W1DA 4C4HA 3F88A 3KRRA 4U45A 4DH1A 3ORIA 1NXKA 4IM2A 4C02A 1G3NA 2QOBA 2FGIA 3QZFA 4O7SA 2RSVA 4USEA 5J7BA 2XKFA 3DNDA 1Q61A 3IK3A 4MK0A 4XP3A 1OKYA 3DQXA 3FMKA 4OTGA 4WNKA 3RPYA 3EKNA 3W8QA 4Z7HA 4IDTA 5ANGA 5I9XA 3LOKA 4RRVA 2WU7A 3MJ2A 5GHVA 1WFCA 3TACA 4II5A 4AE9A 3HP2A 1XH9A 4L7FA 4YJQA 5FRIA 2G9XA 3O51A 4O96A 1CMKE 4QMTA 3W2OA 3P4KA 3PSBA 4I5HA 5J8IA 4WHZA 4I0TA 5CEIA 3H3CA 5C4KA 5E1EA 3G2FA 1UU7A 2ESMA 4W9WA 4FR4A 3AQVA 3UO4A 3TV6A 5IQIA 5CNOA 4FIGA 4I4EA 4O6LA 1Q8YA 2GQRA 3DTWA 4ALWA 3BBTB 5EM5A 4QMOA 2B54A 5A4EA 3CXWA 4JDJA 2ZJWA 4TZRA 5TKDA 3TXOA 4Z7GA 5CQUA 3ACJA 4JIKA 2XH5A 4NW6A 4R5YA 5EQPA 3NYOA 4QRCA 3TV4A 3KXXA 4BCHA 4TNDA 2ZOQA 3A99A 3DB6A 4RJ3A 4PTCA 4RVKA 5AV0A 4MD7E 2B9HA 5EHOA 3IO7A 5EOLA 3KF4A 2YLFA 4KWPA 4GVAA 4BCFA 3KC3A 4P5ZA 1LEZA 3O50A 4CYJA 5CAUA 4AZVA 2XZSA 3RP9A 2QONA 2J7TA 4XX9A 3WF8A 4FX3A 2OH0E 4JX7A 4BIDA 1VYWA 2XNGA 1ZMVA 3BZ3A 3VAPA 1JLUE 4FT0A 4IAYA 4MVFA 4L00A 3RAKA 3RI1A 3ZEWA 3F69A 3JUHA 4OT5A 4HVSA 5A6NA 4OTIA 3UQGA 5IEXA 3LPBA 3T3UA 2YDKA 1CTPE 1TQIA 1GNGA 2VWYA 4L53A 4U6RA 1OKVA 1XH8A 3SOAA 2CLXA 2R64A 2Y4PA 4FTKA 3THBA 3TNWA 3BLQA 4HVDA 2I0HA 3OOMA 4EKLA 2W9FB 3KKVA 4WRSA 4U9AA 5DHJA 3UJGA 3UZRA 5C27A 4O84A 4D4VA 3KFAA 3FPMA 4EJNA 4DG3E 1Y8YA 4I6BA 5CU0A 3TUBA 2ZDUA 3IOPA 4JR3A 4HW7A 2PZPA 3GQLA 5KNJA 3UG1A 4B4LA 3QGWA 3QUDA 4X21A 3QBNA 1WBVA 4PWNA 3K3IA 4YR8A 2C5OA 3IECA 4MH7A 4Y72A 3CE3A 5AM6A 1XH4A 4F4PA 3CY2A 2UZDA 2H6DA 2P33A 3NUXA 5HO8A 1FGKA 2BROA 1YVJA 2QOKA 4J7BA 4YC3A 2OH4A 5HVYA 4D58A 5JFWA 5BUEA 3K54A 4EWHA 3DOGA 3C4EA 2W96B 1BL7A 2X2KA 1W84A 2H8HA 3PVUA 4K6ZA 3WYYA 1OIUA 3VN9A 5KCVA 4GUEA 2OJIA 2JFLA 3E7VA 3W16A 1U5QA 3S1HA 2ITPA 3M42A 1FINA 3G0EA 4IB1A 2JIVA 4ANNA 5BVFA 3RNYA 3PVWA 5HIEA 4LM5A 3PVBA 4R8QA 3TT0A 3KB7A 3NMUF 2EU9A 3NYXA 4PNKA 3FZSA 4YMJA 4FSWA 2XYUA 3LFAA 4E7WA 2ZM3A 4O7ZA 5E9EA 3LZBA 4D4SA 3ZFXA 3PSCA 4CKJA 5BYZA 3NDMA 5DT3A 4BTJA 1YWVA 1XR1A 2VO7A 2UZLA 4S32A 1BX6A 2BHHA 3AT2A 3QCQA 3R01A 3R0TA 3UYTA 4BGHA 4KIOA 4TW9A 2O65A 2YA9A 3HV3A 1I44A 3LXNA 3R28A 5FG8A 5IA1A 4ITJA 5FTQA 4FV7A 2VNWA 4YLKA 2E9OA 4K8AA 4LOOA 3KN5A 3HLLA 4QP3A 4R6VA 5BVEA 2ZV8A 4F0IA 2HELA 2JIUA 4UWBA 2GHMA 4HNIA 5CENA 4F99A 1JSUA 3CP9A 3NGAA 3S2PA 4AW1A 4BKZA 2F7XE 3VS3A 3UP2A 3GCPA 1AGWA 3MVMA 4H1MA 4DFLA 3LCKA 4JXFA 5JGDA 3UO5A 3BHTA 1REJA 2F2CB 4BDEA 4ACHA 2JKOA 4WIHA 4G3EA 3KGAA 4DTBA 2YM8A 5IF1A 3TZ9A 2CCIA 3CTJA 1KSWA 1XH5A 3HYHA 5LWNA 3QTIA 2E9VA 4IW0A 3S95A 4RIWB 3DBFA 3OXTA 2X0GA 2HCKA 3N4TA 3U55A 4JS8A 4IZ5A 3K3JA 3LXLA 4CFXA 2WTKC 3CEKA 4D0XA 2VWZA 2KTYA 3ET7A 3R30A 2PVKA 4FTQA 5CQWA 5AR2A 4C2VA 3KVXA 3ODYX 4IX6A 4O7RA 3MY0A 4L6QA 5L4QA 1SVEA 3BLRA 5L2QA 3E92A 3EQFA 5ACKA 4C62A 3REPA 1J3HA 4OW8A 3DU8A 4C61A 3UIUA 1W82A 3KXNA 3UPZA 3P7CA 4OTWA 5HU3A 4Y95A 2GNLA 3BHYA 3EN4A 4IX5A 4Q9SA 4EKKA 4HZSA 4UZHA 4AFJA 3OBJA 1GAGA 1GZNA 5L2IA 1PMEA 5J9YA 3KREA 3U4WA 2W9ZB 4C4FA 2B7AA 4IM3A 3OW3A 2YDJA 4KBCA 4H05A 4C3RA 4AG8A 2QO2A 3KXHA 5CVHA 2PE2A 4X3FB 4IANA 4O2ZA 3DAJA 3D15A 1E1VA 2C6OA 2BDFA 4FIJA 3GC8A 2VU3A 4H3PA 4AZEA 1OM1A 3QC9A 2WMTA 3IKAA 3RAHA 4YURA 4J8NA 4FKVA 5I0BA 4U42A 3HGKA 3LW0A 5EW9A 4U43A 5GIPE 3FUPA 4K18A 1JPAA 2W0JA 3BBWA 1KE8A 4D9UA 4YTCA 3KA0A 4ZLZA 2BTRA 4EH9A 3GCSA 1JNKA 4C2WA 4FZDB 3FLNC 4BYIA 2JDRA 3BU3A 4AW2A 4YLJA 4PDPA 5D7VA 3C7QA 3PG1A 2QKWB 3R02A 4O7YA 5M07A 3EQBA 2J2IB 3BKBA 3PXZA 4O38A 5EDQA 4EZ5A 2UVYA 5FXSA 1A9UA 3MN3A 3QQUA 3ZZEA 1M17A 2Y4IC 2W99B 3O0GA 4PMMA 1GJOA 4TWCA 2P2IA 2IVUA 1S9JA 4I92A 4FOBA 3UO6A 4B8MA 5JN2A 4GKIA 4P2KA 2YISA 4BICA 3MIYA 5M06A 3I4BA 4I6HA 4XUFA 5CXZA 2G2FA 3R71A 2IZUA 4TWOA 4UMPA 4TT7A 4OTHA 4ZTNA 1FMOE 4QD6A 4JIAA 2PVFA 1SMHA 2X39A 4ZSLA 2R3GA 3MA6A 3R8MA 1LUFA 2ACXA 2ZMDA 3ORPA 3BCEA 3ZXTA 4JAIA 2PUPA 2OJ9A 1JKKA 3Q4UA 4QPMA 2CMWA 4E5BA 5JKGA 2GU8A 3HUBA 4F0FA 3SRVA 3FQSA 1RQQA 5J1VA 3DA6A 3ZFYA 5C8MA 2YFXA 4HGLA 2VTJA 4MEDA 4D2RA 4BWKA 4L9IA 3KK9A 3ORMA 3FBVA 3QX2A 4ZIMA 2XMYA 5CSPA 4QMSA 4D4YA 2R3PA 4I21A 2PMNX 3MTLA 4EONA 3OVVA 3UDBA 3TUDA 4L52A 2PUNA 3MTFA 3P9JA 4OTDA 4WG3A 1FOTA 2WMBA 4O86A 4WO5A 3V04A 3NVKI 3OUNB 3FEGA 5B0XA 4ASXA 4IJPA 5CVFA 3Q53A 5FM3A 2R3LA 3IOKA 3UODA 2B53A 2EWAA 2GMXA 4FF8A 4GK2A 3VWAA 3EYHA 1R0EA 4FV6A 5BVWA 5TO8A 4IB3A 2FUMA 1ZRZA 5IA5A 2QO7A 2YJRA 5E92A 3H0ZA 3TCPA 1O6KA 3Q4ZA 3ZC6A 3PRIA 5GJGA 3ZSHA 3D2KA 4D1XA 2HW7A 2CLQA 3OCBA 4FYOA 5FUTA 4FTIA 2YIWA 4YC8A 3QUEA 5HO6A 4ENYA 2UW3A 3DAKA 2R3NA 1BMKA 2YCRA 2WMQA 4BI0A 4YZNA 5F94A 4JX3A 1PXLA 3IW7A 4M8TA 5ANJA 5H8GA 4FSNA 4IC8A 4KSPA 2ONLA 4JL9A 3WBLA 4DFZE 5KMIA 4RIYB 5DVRA 2BZJA 3PXFA 3OOGA 4CZYB 4FT3A 4CT2A 3HECA 3TWJA 5I3RA 5CLPA 3OT3A 4A07A 2V55A 3DNEA 4F7LA 1Z5MA 2UW6A 4WD5A 4D0WA 3CD8A 4EK4A 4BR3A 2YM6A 3SW4A 4O2PA 4O0UA 5A9UA 1WCCA 2HZ0A 2YIXA 4G16A 3JXWA 4HVGA 4FTMA 4ZY4A 2B9JA 1MRUA 2IZRA 5CANA 3C4WA 3NSZA 3OS3A 1IEPA 1PY5A 4YJSA 4BWPA 4TNBA 5A6OA 4EBVA 2OIBA 1U46A 5HIBA 3GFEA 4E20A 4NCTC 3UTOA 4AX8A 4D2PA 3RWPA 1OBGA 3OP5A 3KEXA 4JQ7A 4LRMA 4OUCA 4IACA 4RJ5A 3MVJA 1J7UA 4CFUA 3IGGA 2BRGA 5AP4A 2W1ZA 3G6HA 2R3IA 3O7LD 5CZIA 4KNBA 3AC8A 2YHVA 5KMKA 4G9RA 3BYOA 3TIYA 5C1QB 4RQKA 5FBOA 4I20A 5IA4A 3AGMA 1K3AA 4WNPA 4S34A 2ZV9A 4KKHA 3RKBA 3FMHA 3TKUA 1DI8A 2C5NA 3WZUA 5L6PA 2Z7LA 3L8VA 4DEDA 2XM9A 4BBFA 2WMSA 2CNUA 2RFDA 3FYKX 1ZY4A 4ZS0A 3BIZA 4FZFB 1YQJA 3DS6A 3ORTA 3ORZA 3Q9ZA 4I23A 4UMRA 3LE6A 2BUJA 4MQ1A 2IG7A 5JGAA 2V62A 4QYYA 4MQ2A 3C5UA 3BRBA 5D41A 4WOVA 3QYZA 3V8WA 3VULA 4BKJA 2B0QA 1XH7A 2UVZA 5L2TA 5KMJA 1ATPE 2BZKB 3WZDA 2P2HA 4A7CA 5BQ0A 3VJOA 5M4UA 5HG8A 3FLWA 1NVQA 4FV8A 4FV2A 3F5XA 3U8WA 3IDCA 3VHEA 4F63A 3OCSA 4AOIA 4RLKA 2CHLA 5DEYA 2GTNA 5C8KA 4F7JA 4FGBA 4KS7A 5DR6A 4U41A 2VO6A 4GU6A 3W18A 2Y8OA 4J53A 2R2PA 2XM8A 2CKEA 2ETMA 3DJ6A 3UVQA 1OIRA 1YXSA 3MH1A 5HU9A 2F2UA 2C0TA 5E4HA 4YBKA 4RVTA 4FTCA 4XYFA 3CS9A 4QO9A 5I9WA 5HG5A 4FNWA 2OLCA 2C3KA 2IZSA 5AAEA 4D55A 2XKDA 3GU8A 2IN6A 5GZAA 3KU2A 4V01A 2OXYA 2OI4X 2C69A 2V7AA 3SVVA 3C9WA 4LMNA 5DR2A 4QYGA 1H26A 4MD8E 2B1PA 4XH6A 4BBEA 3ITZA 4CFWA 1UNHA 1W83A 4L44A 4O7WA 2VX0A 3B2WA 5HCZA 3LFDA 4O0WA 4QQTA 3VBTA 4QYFA 4AGDA 5J79A 2CKOA 5FTOA 4GIHA 3DDPA 3VBXA 2PTKA 2R3HA 2FVDA 5JFXA 4J96A 4NCTA 4C3FA 3CLYA 5ANIA 5AUUA 4BDCA 3W1FA 4RMZA 5L2SA 1APME 4G1WA 4O7NA 3OWKA 4FKOA 4ORKA 3L9MA 2WD1A 3F2NA 4YC6A 5C03A 3VS2A 1JSVA 3FZRA 5KE0A 4FSZA 5DG5A 3TI1A 2IVVA 3EQPA 3UIXA 4DCAA 3RM6A 4FK3A 5CI6A 3BWFA 5KHWA 2Y6OA 3EQIA 3JVSA 4FSMA 4FTRA 4PPAA 5EW3A 3TNQB 3A8XA 3UVPA 1UNGA 5CAQA 5CEOA 4XOYA 5HBHA 3SV0A 4BCOA 3EQGA 4GT4A 5AWMA 3MS9A 3VS4A 4E73A 2CKPA 2QG5A 3E62A 4FNZA 5IPJA 2J5EA 2A4LA 4LMUA 3BGQA 1KOBA 4CG9A 3KN6A 5DGZA 3P5KA 5K3YA 3HA8A 2BILB 2CGVA 3EN5A 2CDZA 2B4SB 4Z3VA 3WILA 2X7OA 3BX5A 3LFQA 4V04A 2R9SA 4ZY5A 5DRDA 2YWVA 4P5QA 5M55A 2XCKA 5EG3A 5KMOA 3FWQA 4RGJA 4CFMA 1IG1A 3OHTA 1PXMA 1YXUA 4A9YA 2JDSA 5CNNA 3NAXA 5KKRC 2X81A 2YM5A 3NUSA 4M12A 4XNEA 4YHTA 2FYSA 3I0OA 3RCJA 4E93A 2Z8CA 3FKLA 4I1ZA 4IBMA 4ITIA 5CT7A 3AOXA 4E4XA 4PTEA 3ZH8A 3DAEA 2HK5A 3NNXA 3VBQA 2UZWE 4WG5A 4Z9LA 3W8LA 3EHAA 2PZ5A 4PDYA 3ZLYA 5AUTA 3F3ZA 1DS5A 3FLZA 4ZLYA 1OZ1A 3II5A 3G90X 4G3CA 3IGOA 5IH6A 2UZVA 2XIXA 5AP5A 3SXFA 4EH6A 5IQFA 1P4OA 4DFNA 5A4LA 5E8YA 3LCSA 3ZBXA 5JFVA 3HRBA 4AP7A 2J50A 1REKA 2R0IA 4QMYA 5J87A 3HNGA 4M7IA 3VS5A 4ZTRA 4HYHA 4IJ9A 4Y5HA 4B9DA 3R1YA 2E9UA 4I5PA 2WQMA 4E26A 2WTJA 3VUIA 5AV2A 2VTOA 1QPEA 3FHIA 1JAMA 2OXXA 3A4PA 3PE2A 3GU5A 4F1OA 2WMAA 5BYLA 4RIOA 3JY0A 1XH6A 3OTVA 4EJ7A 2PE1A 5IQGA 4FSYA 4S33A 1G8AA 2RG6A 4U80A 4RLLA 5HHWA 5CXHA 3V3VA 4IVCA 4OBQA 4FV0A 4IFCA 4E3CA 4GUBA 2YJSA 4YJUA 3VS1A 3DBCA 3TDWA 3EFKA 3PZEA 1PMUA 3VC4A 3A7JA 2RF9A 4IAKA 1XKKA 3LLTA 1JKLA 1M7QA 4XV2A 1FVTA 1PXJA 3O23A 4LGGA 4CNHA 3MIAA 4CZTA 3ALNA 3K5VA 3KL8A 5KMNA 2BHEA 4JBOA 4PV0A 4AF3A 1OGUA 2VTIA 3QQKA 2EB3A 2PVJA 5CI7A 3FPQA 1ZOGA 4AOTA 1B39A 3MY1A 5ANKA 3RZBA 4WNOA 4OAVB 3VQUA 2HWPA 1GIIA 3I60A 4KBAA 2I7QA 5HVKA 3CTQA 4UMTA 2Z2WA 3R73A 1XBBA 2VRXA 3GUBA 4UYAA 4IHPA 2YITA 3UGCA 3DZOA 3W2SA 3R9RA 2X9EA 2IZTA 3FY0A 4JBQA 4BCMA 4DG0E 4XG6A 3U6HA 3COMA 3WF7A 1MQ4A 4UWCA 4D2SA 2OIDA 4G3DA 5I3OA 2IJMA 3D9VA 3FL4A 4O0TA 5JRSA 3MJ1A 2I6LA 3HZTA 4BCIA 2VTHA 2W1HA 3MSSA 5JRQA 1YDRE 3H9RA 4C33A 5IUIA 2JITA 4EOJA 3NIEA 3WF9A 3VVHA 4D5HA 3Q52A 4G17A 3C4ZA 4USDA 2OF2A 1OIYA 4AZWA 4FA2A 2XP2A 4CEGA 3TTJA 3HMPA 3POZA 2X2MA 4BI2A 1UV5A 3ANQA 4FIFA 4I41A 4HYSA 4UZDA 2LGCA 2WZJA 4K0YA 2GDOA 2ITNA 2JC6A 5B7VA 3F3TA 3TJCA 4RX5A 3V8SA 2BALA 4LG4A 5E90A 1DAWA 4CT1A 2AUHA 2BCJA 3F61A 3HV4A 1JVPP 3IS5A 4NTSA 2C6KA 5DBXA 1LR4A 1F5QA 3ZDIA 5HZNA 4FVPA 2F57A 2YCQA 4MXZA 3ZO1A 2PHKA 2OIQA 3NX8A 4ZSEA 4EC9A 4JI9A 4I24A 3LCOA 4E4LA 5IA2A 2VTAA 3QWJA 4EOSA 5IA3A 4EZ7A 1WBSA 2OGVA 4UWYA 2UZUE 1B38A 4MBIA 4MWIA 4F9YA 3EQRA 4GCJA 4L42A 5LVPA 3RPVA 2VX1A 4X2JA 4QTAA 4CFNA 4P7EA 5CWZA 3IW4A 4BYJA 1E1XA 2PZYA 4FG9A 2SRCA 4FKLA 4ASEA 3ID6C 4EQCA 4LOQA 2VTSA 4U5JA 2CJMA 4FSQA 5FDXA 5DWRA 3SX9A 4XRLA 5JSMA 4Y73A 1OKZA 2J0IA 4GU9A 4FIHA 4JNWA 2WTKB 5JFSA 4OAUC 3SQQA 4RWJA 3SHEA 3NNUA 4RC2A 3VRYA 5DNRA 4OR5A 3RTPA 3QTXA 4QPAA 3SRVB 4JQEA 5EYMA 3SD0A 5GZ8A 3RNIA 4O1OA 5DE2A 2QI8A 4YLLA 5DA3A 4TTHB 2CNQA 4YPDA 3UOLA 4NM0A 3ZYAA 4HCVA 4XLVA 3QGYA 2YZLA 1CSNA 1PXIA 2QHNA 3L8XA 2GCDA 2ITZA 1Y8GA 4ZXTA 1KE5A 4MNEB 4X6QC 4XG3A 1F3MC 2XJ1A 3QAME 2P4IA 4RFMA 1YI3A 2FO0A 2VO3A 3MFRA 3PXKA 2VWBA 3PZHA 3JPVA 4QP2A 2GS2A 3KK8A 4MKCA 4PDOA 5JZNA 1H4LA 4GL9A 5E91A 4AZTA 4EK3A 5L8LA 1GOLA 5A14A 4CFFA 2IW8A 4IAFA 4HVHA 4C0TA 5CZHA 1WBTA 3PRFA 5HORA 4FVQA 3CJGA 3Q32A 1ZYJA 5HE1A 2VTNA 1O6YA 4AUAA 2W1CA 5IQHA 4X2KA 3BU5A 4RZWA 2OFVA 3EQCA 1AQ1A 3PA3A 4AZSA 4DBNA 3DCVA 4JVGA 1KUTA 1UU3A 4AA4A 3FAAA 1K2PA 1SVHA 3FHRA 4I5MA 3C5IA 2FA2A 4DEHA 3N4VA 3MESA 5CSVA 2XK4A 2YM4A 2W5AA 3WIGA 3AG9A 3ETAA 3FSFA 5C9CA 4DEBA 1KV1A 5KMLA 4W4VA 4F7SA 2R3OA 1MP8A 2ITTA 3AC3A 5IQBA 4C4EA 2VX3A 4O0YA 3PPJA 3QTSA 4KABA 2VWXA 2C30A 3A60A 2YM3A 4JG6A 4JT3A 2ITOA 3TV7A 4CKIA 5DYJA 4WT6A 5LCKA 5F1ZA 4R3RA 4MTAA 2Y4IB 5FGKA 2Y6MA 5FBNC 3T3VA 4F9CA 4EH2A 4RWLA 4ASDA 3F2AA 1WMKA 3EQHA 4DE4A 4JRVA 1JKTA 4M0YA 3R1NA 4YO6A 3QA0A 1V0BA 5D7AA 5J9ZA 4QP8A 3R2YA 1PMNA 5LARA 4HNFA 5EM8A 3NRMA 4C7TA 5IH4A 3R8PA 3R6XA 2RG5A 3RPRA 3C13A 1ZWSA 1K9AA 4WG4A 2RIOA 4NKSA 4BN1A 3D4QA 2XK9A 3V5QA 2C6LA 1P2AA 3I0QA 3ZM4A 4AAAA 3PA5A 2OSCA 3LFFA 5AUWA 4BDDA 4IDVA 4UV0A 4EHZA 5L2WA 4O83A 4FG8A 4NH1A 2OXDA 3VRZA 3ZM9A 3NNWA 4ZTQA 3D0EA 4G9CA 3PSDA 3P7BA 4KRCA 5LVOA 1Q97A 4QYEA 4F9AA 3EZRA 3LAUA 4EC8A 3QKMA 2WTDA 3F5UA 2Z02A 3NWWA 4MXXA 4XP0A 5K4JA 3RMFA 1NY3A 4IQ6A 5CEMA 1URCA 3BLHA 3D5XA 3FL5A 3MDYA 2X4FA 3PJCA 4RG0A 3NUYA 1FVRA 1YOMA 3NVMB 3FMJA 3Q4CA 4XRJA 3VNTA 2XKCA 4GH2A 4RBLA 3ZZWA 5HIDA 1ZMWA 4OT6A 4ACDA 4DGOA 2F7EE 4RT7A 1P5EA 2WGJA 4FT5A 1UKIA 4G6LA 4QTBA 1OKWA 2YDIA 3QD3A 3NR9A 4O0XA 4IB5A 4Y5QA 3BGPA 1J91A 4FTLA 2X7FA 3ZDUA 4IEBA 4K33A 4CFVA 5HE0A 3ZTXA 4QQJA 3S00A 4B0GA 2CGWA 1YI4A 3NUPA 4P4CA 3HV6A 3F5PA 1BL6A 3POOA 3D83A 3QXOA 3DFAA 3Q04A 3LKMA 4QQ5A 3PJ1A 3BHHA 2B9IA 5HCXA 4GK4A 5FXQA 4CKRA 2XIKA 4KA3A 3FMEA 3FSKA 3FMLA 4FSRA 5J95A 3M1SA 3NPCA 4USFA 4ZTHA 3LMGA 5HNIX 3GVUA 5HO7A 2Z7RA 4TPTA 2I1MA 3N9XA 3ORKA 3OY1A 3PLSA 3FI8A 1CKJA 5LQFA 4EORA 3QTRA 4W9XA 2UVXA 1SM2A 4M14A 3I6WA 2JBPA 3RAIA 2Q83A 2NO3A 4E8AA 4IC7A 1ZY5A 1Y6BA 4DGMA 5T3QA 4TYHA 3MI9A 3QC4A 4O21A 3RK7A 1GZKA 3ZMMA 4U97A 1J7IA 2PVHA 3ZRMA 5HBEA 3AGLA 2BRMA 5HESA 4WSYA 1O6LA 3E8NA 4U0IA 4YO4A 3QHWA 4FI1A 4N70A 3NW7A 3LJ2A 5I9VA 2UW0A 2C6IA 3HRCA 3CQWA 3ZLSA 5AA8A 2BMCA 4B8LA 5HX8A 3DK7A 1Q4LA 3ROCA 3ATSA 3DXPA 4BGQA 4BZOA 5AM7A 3IW5A 4BB4A 5HLNA 3CQEA 4LQMA 3JVRA 3MPAA 3KQ7A 4GYIA 4APPA 3G15A 3AXWA 3H10A 3G9LX 2HZIA 2W4OA 4EH4A 5IG1A 3PUPA 2QKRA 3C4XA 4PDSA 2V5QA 3FQHA 5LWMA 4XLIA 3VIDA 4C4IA 2OG8A 3K2LA 3OWLA 3AD6A 5JT2A 3UPXA 1PYEA 5HNBA 1KWPA 5BVDA 5GINE 4EHEA 1A48A 3ZOSA 4FEVA 4BC6A 5L3AA 5CAPA 4IADA 4BDHA 3VHKA 4EYMA 4FL2A 4FC0A 4K77A 2F9GA 4IH8A 2BZIB 2ONLC 3ALOA 4XBUA 5FP5A 4C35A 4EK5A 1MRVA 3SLSA 4YNOA 5HTCA 4DT8A 1RE8A 3R7GA 2WMUA 5A54A 4N4SA 1AD5A 3QCYA 4RVLA 4EL9A 2GNJA 3DY7A 5EQYA 1SZMA 4QOXA 4FV9A 3U4UA 5CT0A 4CRSA 4FTTA 1U54A 3DBEA 2ITWA 4H36A 5KMMA 1FBNA 1QMZA 5E8SA 3OCTA 3F3UA 4AW0A 5IMXA 4QMUA 4LFIA 1PF8A 4ZMFA 3EFJA 4ANLA 5CF4A 4IWOA 3E3PA 3A7FA 3JY9A 3UIBA 3EL7A 5D9HA 5HG9A 3DQWA 1W8CA 4YPSA 3EN9A 5AP2A 5ETCA 2GNIA 3RM7A 2JIIA 4GFGA 4RA4A 3MV5A 4ANBA 3P78A 2VTRA 2IWIA 4UX9A 2JDVA 2V0DA 3N51A 4XG2A 4BY9E 5DOSA 3UC4A 5EM6A 1W98A 2CGUA 2PVYA 3R8LA 2WMRA 5FM2A 4UN0C 2C3LA 3L8SA 5AJQA 5CEQA 4EEVA 4X2FA 4LUEA 1Q3WA 1YRPA 5EKNA 4NK9A 1WBWA 2QVSE 2VWWA 3AC4A 4W4YA 4XG8A 3SXRA 3U87A 3V6RA 4BDKA 5FTGA 1MUOA 5CX9A 3O2MA 2XYNA 2GQGA 1ZMUA 1PJKA 3L9NA 4WNMA 5M4CA 2UUEA 3SXSA 3HAVA 2JGZA 4N0SA 3Q6WA 3C50A 3Q96A 4XS2A 5EW8A 3RALA 2O64A 1YWNA 5HEZA 2G01A 4QMWA 5I9UA 4PL5A 3GBZA 4FV1A 4E6CA 2HXLA 4PNIA 1PYXA 2GSFA 1STCE 2PUIA 4F0GA 2RFEA 4H58A 4PQNA 4A9UA 1BI8A 4YU2A 4V05A 3PJ2A 3R8ZA 4BDGA 4BDAA 1OL5A 3FLSA 3F7WA 3MH0A 2JDOA 4XCUA 4ZTMA 2X8EA 1T46A 2XS0A 5M51A 2GFSA 4LYNA 5AUVA 4ZEGA 3R2BA 2BVAA 3F7ZA 4U3YA 3FZPA 2GHGA 3JR1A 4BDBA 4MBLA 1P4FA 3DKFA 4G3FA 3GU4A 4JDIA 2UZNA 4EQMA 3HV7A 2AYPA 4OTFA 2YABA 3D94A 2H96A 3R7OA 4ZMEA 5KKRB 5HICA 5A4QA 3AC2A 3BE2A 1URWA 3UQFA 1ZLTA 1Q41A 1HCKA 2W5HA 5C01A 1Q62A 4G34A 2ETKA 3DXNA 2BFYA 3GU6A 3QTWA 3LFBA 4IVDA 2QR8A 4LGHA 4NM7A 4R5SA 4EOPA 5BVNA 5J5SA 4KIKA 1Y6AA 4BCKA 3GGFA 1UU9A 4FNYA 5BVKA 3V01A 4FIIA 4I94A 5HD7A 3UOHA 4NT4A 4IVAA 5EH0A 4FICA 3NLBA 5JQ5A 3I79A 3ZO3A 1PMVA 4AN2A 1M2QA 1Z57A 3R9DA 3DFCB 5CU3A 4YGAA 2OU7A 2CPKE 5AEPA 5AAFA 5KHXA 1Q5KA 3CKWA 2WOTA 1W0XC 4KIPA 2PE0A 2PULA 4M66A 5IDPA 3NUNA 3Q2MA 2CN8A 3HMOA 4GT3A 3ZHPC 1V1KA 3MGYA 3ZEPA 3ZSIA 1IAHA 4EH7A 4AT3A 5EDRA 4PP9A 3IW8A 1F0QA 4GW8A 4CLIA 2NP8A 1JSTA 4ZJVA 2UV2A 4ZJJA 5E1SA 3SA0A 2BPMA 2UW4A 3A2CA 5HKMA 4EHVA 3KVWA 2IW6A 4W4XA 3FKNA 3ZUTA 4F9WA 4RZVA 1GZ8A 4K1BA 2QCSA 1E9HA 5E8UA 5IUHA 1LEWA 4AN3A 3R7VA 3Q2JA 3CKXA 3NW5A 3RVGA 3KULA 4FKPA 4PMPA 1JKSA 2CCHA 4EH8A 4PMSA 3LCTA 5M4FA 4GSBA 3EB0A 4KKGA 4NFMA 2XK7A 1YOLA 1IASA 3COIA 4TRLA 4U7ZA 4R7IA 5D12A 3DGKA 1Q24A 2YCSA 2FSMX 3G33A 3PIZA 5I4NA 2YIYA 4IVBA 3MVLA 4TWPA 2JDTA 5M56A 3NUAA 4I6FA 3LQ8A 4JR7A 5ICPA 4XV3A 4X6RA 3H30A 3KXGA 3TUCA 5CSHA 3P0MA 4FG7A 1DI9A 4I22A 4D2TA 5CU6A 5BPYA 2PMLX 2HAKA 3OY3A 4CVAA 4W8DA 3UMWA 1ZOEA 3O8UA 5IH5A 2JKMA 2R3FA 1H1SA 3AD4A 2C6TA 3CGFA 4J97A 4L43A 2WEVA 3BV3A 5M08A 4YHJA 4FUXA 4BTMA 2C1AA 4DH8A 5M53A 3GXLA 2WTCA 2O5KA 2VZ6A 5KO1A 4L67A 2BRBA 4F7NA 5A4CA 3NIZA 4XV9A 3F2RA 1FMKA 4CG8A 4MCVA 2EB2A 3R1QA 3CTHA 4FUYA 5IQCA 5IQAA 4APCA 1ZZLA 4EOKA 4BIEA 4GS6A 3MH2A 3R63A 3LQ3A 2WU6A 3A7HA 3GC7A 3LMIA 5AV4A 2VTQA 1OIQA 2ERKA 4IZ7A 2WQBA 3ZS5A 4NWMA 1NW1A 2CKQA 5C4LA 4UB7A 3GENA 2VWVA 4ITHA 3MYGA 2PZRA 3BHUA 4L46A 4UXQA 4RIWA 5DMZA 1UA2A 2PSQA 2Z60A 3DLSA 2GS6A 2B9FA 3PWYA 2JLDA 4QQCA 4UYNA 1NVSA 3GFWA 2XBAA 3LM5A 4FK6A 4RJ6A 3W2CA 1EH4A 3LLAA 4O91A 3VUHA 3V5WA 3WE8A 4IX4A 1CKIA 3FZTA 1GIJA 4XHKB 1CDKA 3JYAA 4CYIA 3HA6A 3FXWA 4Q5HA 2PY3A 4M68A 2OBJA 3GC0A 3GOPA 4AZFA 2UZTA 5AIKA 3LJ1A 5CF8A 4BZDA 2WIHA 3PA4A 4DLIA 2C3IB 1IRKA 3MPTA 4CCBA 4TKSA 2OO8X 3LJ0A 3OUKA 5ETFA 4CXAA 5EI8A 4FT9A 4YBJA 2JFMA 4ALVA 2YZAA 5L8KA 1H25A 4F65A 1HCLA 2XVDA 2PK9A 2QG7A 5J1WA 4DA5A 2YIQA 3QTZA 5I9YA 2R4BA 1RDQE 4NU1A 3TIZA 5KX8A 4NFNA 4C36A 4EOIA 5K0XA 1QPDA 1MRYA 1R3CA 3DLZA 5ANOA 3NZ0A 4QYHA 3R22A 1YWRA 2XCHA 5IEVA 3QTUA 4O0SA 3ZBFA 4E6AA 5K0KA 4F1TA 4O81A 4OTPA 2KULA 2R3KA 3CR0A 2BRNA 4KKEA 3MY5A 4C38A 3MFSA 4M0ZA 4MWHA 4FZ6A 4EBWA 4ANSA 3EYGA 4V0GA 5T68A 4Z55A 4PL3A 4H1JA 4PX6A 1R39A 3UE4A 3LIJA 2ZB1A 3OTUA 2ZM1A 5BMMA 5EHLA 4LI5A 5EYCA 1OL6A 1TQPA 4HYIA 3QQLA 5F9EA 1OUYA 4S2ZA 2E9NA 3ORLA 4DTKA 3MA3A 4CV8A 3QU0A 5G1XA 2XUUA 1XJDA 2XIYA 2R3JA 4FKIA 1JOWB 2E2BA 4YJPA 2OZOA 2WTWA 1YI6A 5AR7A 3UIMA 4W4WA 3IPHA 3HRFA 5AIRA 5CASA 1VZOA 1YDSE 2HW6A 3WI6A 2FSLX 5HE2A 3Q5ZA 3VBVA 2PVNA 3PE1A 1H01A 3BPRA 2OK1A 1NVRA 4JDHA 2RGPA 3QF9A 3I5ZA 4FKUA 5A4TA 5JZJA 3U9NA 4FL3A 2W1FA 3MBLA 3HP5A 3PFQA 4Y83A 3PY0A 5EYDA 3DK3A 4FEWA 2JD5A 4HGTA 2J51A 3H9OA 5EI6A 3C51A 5IMEA 2Y0AA 5AUZA 4M67A 1DM2A 4X2NA 3DXQA 4N57A 3ENHA 2FSTX 4AN9A 3BV2A 3IONA 3QTQA 4CTCA 5CAOA 1Q8ZA 2VD5A 4XG7A 2PYWA 3W10A 1UWHA 2PUUA 4BCGA 3HV5A 2QHMA 3OBGA 1ZYLA 3NEWA 5C26A 4ANMA 5FEQA 1RW8A 3QD0A 3QCXA 4ZSGA 2BDJA 1XBCA 2VGOA 4FKWA 2H9VA 3VF8A 1V0PA 4FTUA 3W2RA 3TJDA 3DJ7A 4A4XA 4CSVA 2BKKA 4BKYA 3H4JA 3GCUA 4TYHB 2Y7JA 3CPCA 4BI1A 5HX6A 3CC6A 1OB3A 3R83A 4EOLA 4EHGA 5IISA 3PJ3A 3HL7A 5AX9A 3VS7A 5CF6A 4A9SA 4O7VA 5L6OA 3CY3A 5CU2A 3FZOA 3R8VA 4JAJA 2CGXA 4BRXA 1OBDA 2O2UA 4LRJA 3HKOA 3I1AA 4I0RA 4RIXA 5DT4A 4A9RA 5AMNA 4IWQA 2DS1A 1UVRA 2P3GX 2F4JA 3DZQA 4DEGA 3DB8A 4TXCA 4DH3A 3IW6A 2WNTA 3OFMA 4JBVA 3D7ZA 3P1AA 2WQOA 3UG2A 3W2QA 3ZRKA 4IAZA 2QOQA 2WPAA 4D5KA 4GT5A 4DITA 5A46A 4FTOA 2G15A 5AP3A 1NT2A 2BIYA 4KS8A 4RX7A 1KE6A 4B99A 4PUZA 4FE2A 4I3ZA 3Q9XA 1OPJA 3I81A 4BCNA 3F5GA 3RK5A 4M69A 1WBOA 4FMQA 2HENA 3QLGA 3ZCLA 3PP0A 4DCEA 4I4FA 1YKRA 3VUKA 1TKIA 4ANOA 3AC5A 4CCUA 4QMVA 3R9OA 3TKIA 2GS7A 2G2HA 4E4NA 3ELJA 4YZCA 2XNNA 2B55A 1QL6A 2YACA 2JBOA 2YAAA 3FI2A 4DHFA 5GJFA 4RJ8A 1PRYA 3PPZA 3C4FA 3QUPA 3EL8A 5CYIA 4JBPA 3AT4A 2A19B 4RIYA 4ZP5A 4EQUA 3HAMA 2OJFE 4D1SA 3MFTA 3LXPA 5FQDC 1PHKA 3C0HA 5AP1A 3R7YA 3TNPC 4QP9A 3NUUA 2VTLA 5EDPA 3A4OX 3GNIB 4QTDA 1OL2A 5FLFA 4RFYA 5L6WL 3KY2A 4F09A 1BUHA 3PJ8A 2QU6A 3Q60A 3WF5A 4U44A 3G5DA 4OGRA 2I40A 4BDJA 3ACKA 4ARKA 3P79A 4AA0A 2WFYA 1YXXA 3A62A 5DFPA 4OLIA 5AR3A 2YAKA 2ETRA 4FV4A 4PTGA 5DPVA 5DI1A 3PG3A 3R7EA 4A06A 3D5UA 4QP4A 1R1WA 2UW5A 1H27A 2BFXA 3FV8A 2AC3A 3BYUA 3BYVA 4HGSA 3AMBA 3E8CA 4A4LA 4HJOA 4TWNA 3BGZA 4LRKA 4BL1A 1M2RA 3BEGA 4U3ZA 4QP6A 4G3GA 1VJYA 4TY1A 4HOKA 2JKKA 4ERWA 1HOWA 1Q99A 5B2MA 2OZAA 3ERKA 4GEOA 4RA5A 4BFMA 2WTVA 3MFUA 3L1SA 4FZ7A 2QU5A 3LFNA 3QKLA 5HTIA 3UZTA 3DKOA 1WBPA 5AUYA 3GP0A 3HDNA 3M2WA 3OEZA 3VF9A 3AMAA 4IB0A 4A9TA 1H24A 5TOZA 2XRUA 3WOWA 1Q8TA 1H1WA 5AX3A 3KMWA 2W17A 2LAVA 4NSTA 3P86A 1S9IA 4EYJA 4YTFA 2BTSA 2UZEA 3RHXA 3O8TA 4GKHA 4LOPA 2XKEA 4U79A 4BDIA 4J52A 3LVPA 5F95A 3QRKA 4G2FA 4HPTE 5DT0A 3E88A 3PTGA 3I6UA 4AW5A 4ASZA 2YLEA 4PPBA 3QRTA 1ZXEA 1XWSA 5E8VA 4O6EA 4MF1A 2R5TA 4KINA 4MBJA 4UALA 4QMXA 2C6DA 1ND4A 1R78A 4M84A 4I6QA 5EK7A 1H00A 3QRJA 4G5JA 4JOAA 2NPQA 3S0OA 5H8BA 2I0EA 2ZYBA 4RX9A 4YHFA 3DJ5A 4O27B 4AGCA 4PP7A 5M57A 3PDTA 5M4IA 4KUJA 4OTQA 1G5SA 4L01A 4C37A 3TL8A 2WMWA 4BTKA 1ZOHA 3AT3A 2GHLA 3H0YA 5AV3A 5BMSA 3HDMA 3OMVA 3GEQA 2BAQA 5AAGA 2QOHA 1FGIA 4ANQA 3R1SA 1JBPE 3SOCA 3U51A 4YUQA 1OVEA 5AR5A 3NCGA 1KV2A 2XJ0A 3AC1A 5GNKA 3MB6A 4F1MA 5EI2A 4QMPA 3HMNA 4J71A 3V5TA 3ZU7A 1BLXA 4MX9A 4KIKB 3EIDA 4QNAA 4X2GA 3VW6A 4F64A 5JK3A 2VNYA 3MW1A 4GG5A 4H39A 2WIPA 4Y46A 5K9IA 3Q5IA 2OFUA 3I7CA 2X4ZA 1QPJA 4MYGA 4ZZMA 3QQFA 4BWXA 4MXYA 3PXQA 5FDPA 3O7LB 4LGDA 4D2WA 3SDJA 3FLYA 1YHVA 4L68A 4J8MA 2VV9A 2FSOX 2WMVA 4Y85A 2UZBA 5CSXA 4BVUA 2Q0BA 4WSQA 3BI6A 1DAYA 3CPBA 3EH9A 4ZJIA 3MPMA 3D7TA 1BI7A 4BCJA 4BCQA 4NW5A 2C6EA 3Q4TA 4L7SA 3UNZA 2C0IA 3WF6A 1SVGA 4F9BA 5IA0A 2WKMA 4AGUA 2V7OA 4J98A 3QZIA 5IUGA 5EHYA 4KAOA 4C8BA 4R7BA 4FGRA 1H1RA 5TR6A 5KBRA 3QHRA 1WVXA 2GFCA 4IX3A 2OWBA 4AQCA 3QRIA 3MVHA 4AU8A 1RJBA 4F6SA 3KF7A 4PRJA 2C4GA 4WKQA 1G8SA 3FQEA 2ITXA 3UBDA 1LPUA 1PW2A 2JAMA 3KRLA 4GFMA 5ACBC 3C4CA 5E8TA 4E4MA 3CCNA 3DV3A 4FTJA 1ERKA 2VWUA 3KULB 4WBBB 5HQ0A 5BYYA 4W8EA 3A7IA 4ENXA 5J5TA 4HYUA 4AS0A 3QL8A 3R9HA 3EJ1A 4YTHA 5LXMA 3E5AA 5LOHA 3F9NA 5I9ZA 2J5FA 2W4KA 4GRBA 2WAJA 5JGBA 3GOKA 4C34A 2UW9A 1XQZA 2VTPA 3F3VA 4DF3A 3A61A 2RKUA 1H07A 3OEFX 3WARA 4H3QA 3GCVA 4QP1A 5CVGA 5K4IA 4FT7A 5T6KA 3LXKA 3SG8A 4D28A 4D9TA 3UP7A 2XJ2A 3IDPA 3P7AA 2YM7A 3KRWA 4FKJA 4IWPA 3WYXA 4YJRA 1YHWA 5F20A 4XEYA 2G1TA 3FKOA 3EZVA 4CMOA 4DEIA 5M44A 5CU4A 2DQ7X 5B2KA 2R3QA 1L8TA 1H1QA 3FMNA 2ZV2A 3K5UA 3LM0A 4MF0A 3BWJA 4BHZA 4IFGA 5LCJA 4ACGA 5KUPA 3ZFMA 3ZO2A 4ZZNA 3LQ5A 5H2UA 2J0LA 3PXRA 3IQ7A 1Q8UA 4RJ4A 4PL4A 2PVMA 3OF0A 4ZLOA 4GMYA 4I0SA 4DINA 3FXZA 5E8WA 3CSVA 2PVRA 4Y8DA 2XEYA 4IM0A 4YJNA 5EYKA 2IVSA 2HY0A 2PWLA 3BU6A 4IMYA 5IKWA 4I5CA 3LCDA 2C5YA 3H9FA 2XIZA 4HZRA 2QLUA 5TT7A 4DLJA 2DWBA 4TYIA 3FMDA 3LHJA 4J95A 4DYMA 3V5JA 1M14A 1CM8A 4L8MA 4D4RA 1KOAA 2XRWA 4ACCA 4DFYA 3N4UA 3ZUVA 2QOIA 4PY1A 4UMQA 3DKCA 4XBRA 2J0KA 4O0VA 3FC1X 3R7IA 4GG7A 2G2IA 5KBQA 2YEXA 3ZC5A 4AOJA 4RWKA 3E8DA 4CTBA 3L9LA 4OBOA 5H3QA 2B52A 3ZSGA 4L45A 3LFEA 5DH3A 5E7RA 2X7GA 3B8RA 3R7UA 3P08A 4BZNA 5F4NA 5HOAA 5IQDA 1SNXA 1NA7A 1OPKA 1J1CA 1FVVA 2VTMA 1FPUA 4AT5A 4ERKA 2I0VA 3OWPA 4ZSAA 3U6IA 4G6NA 2X1NA 1JWHA 3UOJA 4DFUA 5DN3A 3LFCA 2EVAA 4PMTA 2ZVAA 5HLPA 2FH9A 3DDQA 3PY1A 4TYEA 4B6LA 4C3PA 2IVTA 3NNVA 3OD6X 4K9YA 5CS6A 5EOBA 4RC4A 5AFVA 3CGOA 4RQVA 3PLAE 4FVRA 3BHVA 3BYMA 2REIA 3QD2B 2IO6A 2H34A 4FKQA 5GJDA 4DH7A 3HMIA 4D1ZA 1YXVA 4CQEA 4FSUA 3VBWA 3HX4A 4JDKA 2QLQA 2GNHA 4V0GB 4F08A 2YCFA 3UOKA 3QFVA 4GIIA 4TYJA 3PYYA 4ZK5A 4DT9A 5AP7A 3VUDA 5DR9A 2WOUA 5KZIA 3IDBA 2Z7SA 4NIFA 4AA5A 3DBQA 2J90A 3ODZX 4GK3A 4EUUA 4QMQA 4NKAA 2QQ7A 4RJ7A 4XV1A 2P55A 1SNUA 4R1YA 4HGEA 4X7QA 3W33A 5H8EA 2RFSA 3NCZA 4BF2A 5LVMA 3SGCA 2ERZE 2HXQA 2PL0A 3UNJA 4CQGA 3O17A 3R8UA 4C59A 5AADA 5FXRA 4PPCA 3QX4A 1IA8A 3DBDA 4L3PA 2CN5A 2BIKB 2C47A 3DPKA 1Y91A 3BELA 4JJRA 5JEBA 5FEDA 3KMUA 2C3JA 3UZPA 2J0JA 2WXVA 4NZWB 5DLSA 5HBJA 2C5XA 3BEAA 3D14A 5DEWA 3RHKA 4G31A 1WBNA 1UNLA 3IG7A 3NS9A 4RWIA 3FYJX 2CNVA 3RPSA 4JG8A 3UVRA 4DAWA 5LVLA 2VO0A 4ZS4A 4RC3A 3RINA 4AE6A 3R04A 2FB8A 3PPKA 4HVIA 5K5NA 2UW7A 3JS2A 2OJJA 5H9BA 3OXZA 3OCGA 5HVJA 4E6DA 3W32A 5HD4A 3ANRA 3TZMA 3QZGA 4EK8A 3U6JA 4QP7A 4K11A 3F82A 4Z16A 5AUXA 2ITQA 2W4JA 3A8WA 2NRUA 5LMAA 2ZB0A 5IZFA 4QMMA 1M52A 3R21A 3COHA 3TNHA 3MB7A 2HY81 1H1PA 2AC5A 2WEIA 1H08A 3I5NA 4IXPA 3D5WA 3OZ6A 1SYKA 2OJGA 2HYYA 1VEBA 2XNPA 3DTCA 3FC2A 3OROA 1Y57A 4JQ8A 4JRNA 4U81A 5A3XA 3VBYA 5J9LA 3Q6UA 2RL5A 4G5PA 2NNWB 3PY3A 4QMLA 1U4DA 4FKGA 4IE9A 4O7TA 3FI4A 3HUCA 3EN7A 3UYSA 4UMUA 1A06A 2C0OA 3GQIA 3BYSA 5GZ9A 4BGGA 3O8PA 2W06A 4O7LA 4E1ZA 4MNEA 2EXMA 3ZRLA 3BQRA 4BDFA 1J7LA 3ZXZA 4RIXB 1GIHA 4RX8A 3V51A 1P14A 3G51A 4ZSJA 3TTIA 1J1BA 1O9UA 2P0CA 2WELA 1Z9XA 2XEZA 4TN6A 3DK6A 4ID7A 2GTMA 2Q0NA 4N6ZA 1V0OA 4L3JA 5ANDA 3C1XA 4X0MA 4HPUE 4AT4A 3E93A 4R3PA 2YERA 4NJ3A 5HTBA 3NW6A 2W5BA 4BCPA 3CQUA 4M69B 5D1JA 4FEXA 4DTAA 1KE7A 1ZARA 3S3IA 1OI9A 4XMOA 3RK9A 2OKRA 4C58A 1H8FA 2NRYA 3SG9A 4M97A 4QMNA 3VUTA 4LL5A 5ETIA 4CZUA 3EFWA 2XNOA 1OUKA 2XIRA 3LFSA 4Q5EA 2R7IA 4YZDA 4UXLA 3ZONA 2C1BA 2Y9QA 1U59A 5IU2A 3PIXA 4WA9A 3T8OA 3GB2A 4MXAA 1BYGA 5E8XA 2QODA 3LMHA 4NL0A 3V8TA 4CLJA 3TEIA 4KRDA 4WBOA 3ZUUA 4IZYA 5HGIA 1U5RA 5IDNA 2XK8A 3ORNA 4ZOGA 4IIRA 4LV8A 4Q9ZA 4KIQA 3I7BA 5FWKK 2YN8A 5EFQA 2BR1A 3NYNA 4NJDA 3V5PA 4DC2A 3HMMA 3FJQE 2J6MA 1PKGA 5CTPA 4N6YA 1ZYSA 2XNMA 3QLFA 4MHAA 3MWUA 4FKSA 4KB8A 5DIAA 5CEPA 3WIKA 3F3WA 2ZM4A 3FE3A 4QTCA 4J1RA 3QZHA 1IAJA 5BUIA 2EUFB 4YSJA 3SW7A 2HZNA 4O1PA 4E5AX 4PF4A 4GJ3A 2XF0A 2O63A 4BTFA 3U54A 2J4ZA 4MNFA 3V5LA 4DH5A 4F70A 4CMUA 4X3FC 5HG7A 4NYEA 3EMGA 4GJ2A 3RCDA 2A2AA 2OZAB 2QOLA 4YJTA 3WZJA 1OITA 4K2RA 4FTNA 4FBXA 3QD4A 1VYZA 3QQJA 3P23A 2BRHA 3ZO4A 3D2IA 3FDNA 1IA9A 2VN9A 4RFZA 5TE0A 1M7NA 2C68A 4DGGA 3DT1A 2BAKA 3R00A 1MQBA 3L9PA 3A7GA 4QTEA 3M11A 3OT8A 5HE3A 1QCFA 3DKGA 5EQEA 3KCFA 4UY9A 2O0UA 3FMMA 4JG7A 4RPVA 2PU8A 3PWDA 5HLWA 1L3RE 3F66A 3FXXA 3SC1A 3W2PA 5CALA 1OECA 3TM0A 5LMBA 5B2LA 4ZTSA 5BVOA 2QD9A 3VS0A 3AD5A 4YZ9A 1ZAOA 2X8DA 4GFOA 1PKDA 2VUWA 3PVGA 4NUSA 3UQCA 2X9FA 2QC6A 4IAAA 4OTRA 4NEUA 5D11A 4C4JA 2E9PA 3QQGA 3E63A 3C0IA 3EOCA 3OWJA 4O0RA 2O3PA 4E5WA 4AFEA 4AWIA 2A0CX 4EUTA 5EKOA 4HCTA 1UU8A 2JKQA 2UW8A 2XNEA 4QT1A 4O82A 5E8ZA 3U9CA 5CSWA 2XBJA 2OICA 4BIBA 2XB7A 3CIKA 4CGAA 3PIYA 2QR7A 4QPSA 3RWQA 3FZ1A 4EI4A 2PMOX 3BQCA 4R77A 3QALE 4ACMA 5AV1A 5J7HA 2O8YA 1YHSA 4DFBA 3OXIA 5CEKA 2DYLA 4MAOA 4E6QA 2IPXA 1B6CB 4KBKA 3C0GA 4ONAA 4XG9A 3TZ7A 3KXZA 3O96A 4YSMA 4DGNA 1BKXA 4EZ3A 4QMZA 1ZYDA 5DRBA 4JLCA 1X8BA 4U40A 1PXPA 2GNGA 1H0WA 2Z7QA 4R3CA 4XG4A 3G6GA 4D2VA 3GC9A 1M2PA 2WQEA 3HVCA 3E8EA 1OPLA 1WVWA 4R1VA 2ZMCA 3KRJA 5KZ0A 1T45A 4U8ZA 2QOCA 5M09A 3D7TB 4YZBA 2DUVA 4HCUA 4X3FA 3VUGA 4EOQA 5AA9A 2ITUA 4YTIA 3WZEA 2X6EA 3KMMA 1FQ1B 3UNKA 2C5VA 3T9IA 4CRLA 4CV9A 4EH3A 4ZZOA 4IZAA 5IQEA 4C57A 1ZZ2A 4RVMA 2W7XA 4S30A 2V22A 5AP0A 3OW4A 2ZAZA 1WZYA 4NM3A 4R78A 1XHAA 3W55A 3WZKA 3PXYA 2WTIA 5AP6A 3Q3BA 3HEGA 3KXMA 3RPOA 2A1AB 4M15A 4G6OA 1H28A 3VQHA 1WAKA 2XA4A 1Q8WA 4ZAUA 4NTTA 1GZOA 4I93A 4AGWA 4GV1A 3RAWA 3OC1A 4H3BA 5ITAA 5LMKC 4FZAB 2R3MA 3TZ8A 5BX0A 4C4GA 4A4OA 3BE9A 5TF9A 1JQHA 2R0UA 3KRXA 3TG1A 3GI3A 2YIRA 3G9NA 3G0FA 3B2TA 3CJFA 5ANEA 2R3RA 4XJ0A 4YP8A 4CMTA 3E87A 4DEEA 4TL0A 4FIEA 3S4QA 1OMWA 3V6SA 2CSNA 2ZV7A 5D10A 4MXOA 4XP2A 3MH3A 5C8NA 2PPQA 3E7OA 1GY3A 1LP4A 4WUNA 4FSTA 4EK6A 4DGLC 2W1IA 3WE4A 1UWJA 1VR2A 2HZ4A 2PMIA 4ALUA 3F6XA 3ATTA 3SKCA 3OG7A 3KCKA 2W1GA 4WUAA 4B7TA 2GNFA 2HIWA 4DG2E 3PP1A 4EH5A 2C6MA 2PZIA 2VWIA 5I5ZA 1XBAA 3ORXA 3CD3A 2XK3A 1YXTA 3Q9YA 4FODA 3EN6A 3ULZA 5BNJA 2QO9A 3Q9WA 1Q3DA 2XNBA 2X8IA 1R0PA 4IAIA 4EOMA 4FTAA 4DN5A 4UEUA 4FOCA 5HNGA 3RGFA 4CD0A 5HI2A 5LVNA 1XO2B 3VS6A 4UBAA 3QRUA 2A27A 4J99A 3TNIA 2VAGA 2X2LA 3ULIA 3ROYA 5LJJA 5GIOE 3EWHA 2EXEA 4IWDA 2W1EA 2JAVA 1TVOA 4QNYA 3VJNA 1IR3A 3TN8A 4FEUA 3COKA 4FKRA 4KD1A 4YZMA 5JQ8A 1YW2A 3RZFA 2F7ZE 3SAYA 3D5VA 5FEEA 3FI3A 2IW9A 1QPCA 2QOOA 4S31A 2I0YA 1OL1A 4DFXE 4DBXA 2GPHA 4R7HA 4BBMA 2WB8A 1KE9A 4BHNA 3FY2A 4MD9E 3QA8A 4AACA 3AMYA 2ITVA 3GT8A 2VGPA 3GU7A 2RFNA 2WMXA 4NM5A 4O22A 4FKTA 4EOOA 3QCSA 3L8PA 4OBPA 5AR4A 4F6UA 1OL7A 3TDVA 4FV5A 1CKPA 4L3LA 4FV3A 5G6VA 3ZLWA 3QKKA 3NYVA 4ZTLA 2XK6A 4LV5A 4GYGA 4LL0A 3VO3A 5IEYA 2JEDA 2J0MB 3E3BX 3ZLXA 2WHBA 2ITYA 4Q2AA 4XOZA 2EXCX 2ZDTA 3QXPA 2J9MA 4YJVA 3RJCA 2QOFA 3UMXA 4TYGA 3GCQA 5BUJA 5LMKA 3NAYA 4KSQA 2UZOA 5AR8A 3B8QA 1YOJA 3QWKA 2BDWA 4EWQA 1TQMA 5CF5A 4LUDA 4P90A 4DEAA 3FLQA 3EQDA 4WRGA 1UKHA 2QNJA 2VTTA 5CAVA 2R7BA 1W7HA 2HOGA 2WO6A 4ZY6A 1I09A 3UC3A 4GVJA 5JH6A 4FEQA 1YDTE 3RBWA 4MXCA 3T9TA 1H0VA 3QQHA 3EKKA 2X6DA 2OF4A 2BZHB 4X3JA 4YNEA 5FP6A 1U54B 3ENMA 3TKHA 5EM7A 4M3QA 5CY3A 4NIFB
chains in the Genus database with same CATH superfamily
2BKZA 2OW3A 2W05A 4F6WA 3E64A 5JMSA 4FYNA 3QYWA 3VW8A 4O4DA 2GQSA 2YWPA 1PXNA 3VUMA 1ZYCA 5L8JA 4AXAA 2WQNA 1PXOA 2BAJA 2F49A 5K5XA 5ETAA 4FL1A 4RSSA 2PVLA 3O71A 2HWOA 2QURA 4FNXA 4YJOA 5HCYA 3R9NA 5FD2A 1WVYA 4M13A 3EFLA 1PXKA 3CBLA 2W1DA 4C4HA 3F88A 3KRRA 4U45A 4DH1A 3ORIA 1NXKA 4IM2A 4C02A 1G3NA 2QOBA 2FGIA 3QZFA 4O7SA 2RSVA 4USEA 5J7BA 2XKFA 3DNDA 1Q61A 3IK3A 4MK0A 4XP3A 1OKYA 3DQXA 3FMKA 4OTGA 4WNKA 3RPYA 3EKNA 3W8QA 4Z7HA 4IDTA 5ANGA 5I9XA 3LOKA 4RRVA 2WU7A 3MJ2A 5GHVA 1WFCA 3TACA 4II5A 4AE9A 3HP2A 1XH9A 4L7FA 4YJQA 5FRIA 2G9XA 3O51A 4O96A 1CMKE 4QMTA 3W2OA 4QEBA 3P4KA 3PSBA 4I5HA 5J8IA 4WHZA 4I0TA 5CEIA 3H3CA 5C4KA 5E1EA 3G2FA 1UU7A 2ESMA 4W9WA 4FR4A 3AQVA 3UO4A 3TV6A 5IQIA 5CNOA 4FIGA 4I4EA 4O6LA 1Q8YA 2GQRA 3DTWA 4ALWA 3BBTB 5EM5A 4QMOA 2B54A 5A4EA 3CXWA 4JDJA 2ZJWA 4TZRA 5TKDA 3TXOA 4Z7GA 5CQUA 3ACJA 4JIKA 2XH5A 4NW6A 4R5YA 5EQPA 3NYOA 4QRCA 3TV4A 3KXXA 4BCHA 4TNDA 2ZOQA 3A99A 3DB6A 4RJ3A 1G8KA 3W0QA 4PTCA 4RVKA 5AV0A 4MD7E 2B9HA 5EHOA 3IO7A 5EOLA 3KF4A 2YLFA 4KWPA 4GVAA 4BCFA 3KC3A 4P5ZA 1LEZA 3O50A 4CYJA 5CAUA 4AZVA 2XZSA 3RP9A 2QONA 2J7TA 4XX9A 3WF8A 4FX3A 2OH0E 4JX7A 4BIDA 1VYWA 2XNGA 1ZMVA 3BZ3A 3VAPA 1JLUE 4FT0A 4IAYA 4MVFA 4L00A 3RAKA 3RI1A 3ZEWA 3F69A 3JUHA 4OT5A 4HVSA 5A6NA 4OTIA 3UQGA 5IEXA 3LPBA 3T3UA 2YDKA 1CTPE 1TQIA 1GNGA 2VWYA 4L53A 4U6RA 1OKVA 1XH8A 3SOAA 2CLXA 2R64A 2Y4PA 4FTKA 3THBA 3TNWA 3BLQA 4HVDA 2I0HA 3OOMA 4EKLA 2W9FB 3KKVA 4WRSA 4U9AA 5DHJA 3UJGA 3UZRA 5C27A 4O84A 4D4VA 3KFAA 3FPMA 4EJNA 4DG3E 1Y8YA 4I6BA 5CU0A 3TUBA 2ZDUA 3IOPA 4JR3A 4HW7A 2PZPA 3GQLA 5KNJA 3UG1A 4B4LA 3QGWA 3QUDA 4X21A 3QBNA 1WBVA 4PWNA 3K3IA 4YR8A 2C5OA 3IECA 4MH7A 4Y72A 3CE3A 5AM6A 1XH4A 4F4PA 3CY2A 2UZDA 2H6DA 2P33A 3NUXA 5HO8A 1FGKA 2BROA 1YVJA 2QOKA 4J7BA 4YC3A 2OH4A 5HVYA 4D58A 5JFWA 5BUEA 3K54A 4EWHA 3DOGA 3C4EA 2W96B 1BL7A 2X2KA 1W84A 2H8HA 3PVUA 4K6ZA 3WYYA 1OIUA 3VN9A 5KCVA 4GUEA 2OJIA 2JFLA 3E7VA 3W16A 1U5QA 3S1HA 2ITPA 3M42A 1FINA 3G0EA 4IB1A 2JIVA 4ANNA 5BVFA 3RNYA 3PVWA 5HIEA 4LM5A 3PVBA 4R8QA 3TT0A 3KB7A 2AEGA 3NMUF 2EU9A 3NYXA 4PNKA 3FZSA 4YMJA 4FSWA 2XYUA 3LFAA 4E7WA 2ZM3A 4O7ZA 5E9EA 3LZBA 4D4SA 5BV3A 3ZFXA 3PSCA 4CKJA 5BYZA 3NDMA 5DT3A 4BTJA 1YWVA 1XR1A 2VO7A 2UZLA 4S32A 1BX6A 2BHHA 3AT2A 3QCQA 3R01A 3R0TA 3UYTA 4BGHA 4KIOA 4TW9A 2O65A 2YA9A 3HV3A 1I44A 3LXNA 3R28A 5FG8A 5IA1A 4ITJA 5FTQA 4FV7A 2VNWA 4YLKA 2E9OA 4K8AA 4LOOA 3KN5A 3HLLA 4QP3A 4R6VA 5BVEA 2ZV8A 4F0IA 2HELA 2JIUA 4UWBA 2GHMA 4HNIA 5CENA 4F99A 1JSUA 3CP9A 3NGAA 3S2PA 4AW1A 4BKZA 2F7XE 3VS3A 3UP2A 3GCPA 1AGWA 3MVMA 4H1MA 4DFLA 3LCKA 4JXFA 5JGDA 3UO5A 3BHTA 1REJA 2F2CB 4BDEA 4ACHA 2JKOA 4WIHA 4G3EA 3KGAA 4DTBA 2YM8A 5IF1A 3TZ9A 2CCIA 3CTJA 1KSWA 1XH5A 3HYHA 5LWNA 3QTIA 2E9VA 4IW0A 3S95A 4RIWB 3DBFA 3OXTA 2X0GA 2HCKA 3N4TA 3U55A 4JS8A 4IZ5A 3K3JA 3LXLA 4CFXA 2WTKC 3CEKA 4D0XA 2VWZA 2KTYA 3ET7A 3R30A 2PVKA 4FTQA 5CQWA 5AR2A 4C2VA 3KVXA 3ODYX 4IX6A 3BLAA 4O7RA 3MY0A 4L6QA 5L4QA 1SVEA 3BLRA 5L2QA 3E92A 3EQFA 5ACKA 4C62A 3REPA 1J3HA 4OW8A 3DU8A 4C61A 3UIUA 1W82A 3KXNA 3UPZA 3P7CA 3UDSA 4OTWA 5HU3A 4Y95A 2GNLA 3BHYA 3EN4A 4IX5A 4Q9SA 4EKKA 4HZSA 4UZHA 4AFJA 3OBJA 1GAGA 3BL7A 1GZNA 5L2IA 1PMEA 5J9YA 3KREA 3U4WA 2W9ZB 4C4FA 2B7AA 4IM3A 3OW3A 2YDJA 4KBCA 4H05A 4C3RA 4AG8A 2QO2A 3KXHA 5CVHA 2PE2A 4X3FB 4IANA 4O2ZA 3DAJA 3D15A 1E1VA 2C6OA 2BDFA 4FIJA 3GC8A 2VU3A 4H3PA 4AZEA 1OM1A 3QC9A 2WMTA 3IKAA 3RAHA 4YURA 4J8NA 4FKVA 5I0BA 4U42A 1XMMA 3HGKA 3LW0A 5EW9A 4U43A 5GIPE 3FUPA 4K18A 1JPAA 2W0JA 3BBWA 1KE8A 4D9UA 4YTCA 3KA0A 4ZLZA 2BTRA 4EH9A 3GCSA 1JNKA 4C2WA 4FZDB 3FLNC 4BYIA 2JDRA 3BU3A 4AW2A 4YLJA 4PDPA 5D7VA 3C7QA 3PG1A 2QKWB 3R02A 4O7YA 5M07A 3EQBA 2J2IB 3BKBA 3PXZA 4O38A 5EDQA 4EZ5A 2UVYA 5FXSA 1A9UA 3MN3A 3QQUA 3ZZEA 1M17A 2Y4IC 2W99B 3O0GA 4PMMA 1GJOA 4TWCA 2P2IA 2IVUA 1S9JA 4I92A 4FOBA 3UO6A 4B8MA 5JN2A 4GKIA 4P2KA 2YISA 4BICA 3MIYA 5M06A 3I4BA 4I6HA 4XUFA 5CXZA 2G2FA 3R71A 2IZUA 4TWOA 4UMPA 4TT7A 4OTHA 4ZTNA 1FMOE 4QD6A 4JIAA 2PVFA 1SMHA 2X39A 4ZSLA 2R3GA 3MA6A 3R8MA 1LUFA 2ACXA 2ZMDA 3ORPA 3BCEA 3ZXTA 4JAIA 2PUPA 2OJ9A 1JKKA 3Q4UA 4QPMA 2CMWA 4E5BA 5JKGA 2GU8A 3HUBA 4F0FA 3SRVA 3FQSA 1RQQA 5J1VA 3DA6A 3ZFYA 5C8MA 2YFXA 4HGLA 2VTJA 4MEDA 4D2RA 4BWKA 4L9IA 3KK9A 3ORMA 3FBVA 3QX2A 4ZIMA 2XMYA 5CSPA 4QMSA 4D4YA 2R3PA 2XALA 4I21A 2PMNX 3MTLA 4EONA 3OVVA 3UDBA 3TUDA 4L52A 2PUNA 3MTFA 3P9JA 4OTDA 4WG3A 1FOTA 2WMBA 4O86A 4WO5A 3V04A 3NVKI 3OUNB 3FEGA 5B0XA 4ASXA 4IJPA 5CVFA 3Q53A 5FM3A 2R3LA 3IOKA 3UODA 2B53A 2EWAA 2GMXA 4FF8A 4GK2A 3VWAA 3EYHA 1R0EA 4FV6A 5BVWA 5TO8A 4IB3A 2FUMA 1ZRZA 5IA5A 4JMQA 2QO7A 2YJRA 5E92A 3H0ZA 3TCPA 1O6KA 3Q4ZA 3ZC6A 3PRIA 5GJGA 3ZSHA 3D2KA 4D1XA 2HW7A 2CLQA 3OCBA 4FYOA 4AXFA 5FUTA 4FTIA 2YIWA 4YC8A 3QUEA 5HO6A 4ENYA 2UW3A 3DAKA 2R3NA 1BMKA 2YCRA 2WMQA 4BI0A 4YZNA 5F94A 4JX3A 1PXLA 3IW7A 4M8TA 5ANJA 5H8GA 4FSNA 4IC8A 4KSPA 2ONLA 4JL9A 3WBLA 4DFZE 5KMIA 4RIYB 5DVRA 2A98A 2BZJA 3PUFC 3PXFA 3OOGA 4CZYB 4FT3A 4CT2A 3HECA 3TWJA 5I3RA 5CLPA 3OT3A 4A07A 2V55A 3DNEA 4F7LA 1Z5MA 2UW6A 4WD5A 4D0WA 3CD8A 4EK4A 4BR3A 2YM6A 3SW4A 4O2PA 4O0UA 4DHZA 5A9UA 1WCCA 2HZ0A 2YIXA 4G16A 3JXWA 4HVGA 4FTMA 4ZY4A 2XAMA 2B9JA 1MRUA 2IZRA 5CANA 3C4WA 3NSZA 3OS3A 1IEPA 1PY5A 4YJSA 3AKKA 4BWPA 4TNBA 5A6OA 4EBVA 2OIBA 1U46A 5HIBA 1W2DA 3GFEA 4E20A 4NCTC 3UTOA 4AX8A 4D2PA 3RWPA 1OBGA 3OP5A 3KEXA 4JQ7A 4LRMA 4OUCA 4IACA 4RJ5A 3MVJA 1J7UA 4CFUA 3IGGA 2BRGA 5AP4A 2W1ZA 3G6HA 2R3IA 3O7LD 5CZIA 4KNBA 3AC8A 2YHVA 5KMKA 4G9RA 3BYOA 3TIYA 5C1QB 4RQKA 5FBOA 4I20A 5IA4A 3AGMA 1K3AA 4WNPA 4S34A 2ZV9A 4KKHA 3RKBA 3FMHA 3TKUA 1DI8A 2C5NA 3WZUA 5L6PA 2Z7LA 4DDIA 3L8VA 4DEDA 2XM9A 4BBFA 2WMSA 2CNUA 2RFDA 3FYKX 1ZY4A 4ZS0A 3BIZA 4FZFB 1YQJA 3DS6A 3ORTA 3ORZA 3Q9ZA 4I23A 4UMRA 3LE6A 2BUJA 4MQ1A 2IG7A 5JGAA 2V62A 4QYYA 4MQ2A 3C5UA 3BRBA 5D41A 4WOVA 3QYZA 3V8WA 3VULA 4BKJA 2B0QA 1XH7A 2UVZA 5L2TA 5KMJA 1ATPE 2BZKB 3WZDA 2P2HA 4A7CA 5BQ0A 3VJOA 5M4UA 5HG8A 3FLWA 1NVQA 4FV8A 4FV2A 3F5XA 3U8WA 3IDCA 3VHEA 4F63A 3OCSA 4AOIA 4RLKA 2CHLA 5DEYA 2GTNA 5C8KA 4F7JA 4FGBA 4KS7A 5DR6A 4U41A 2VO6A 4GU6A 3W18A 2Y8OA 4J53A 2R2PA 2XM8A 2CKEA 2ETMA 3DJ6A 3UVQA 1OIRA 1YXSA 3MH1A 5HU9A 2F2UA 2C0TA 5E4HA 4YBKA 4RVTA 4FTCA 4XYFA 3CS9A 4QO9A 5I9WA 5HG5A 4FNWA 2OLCA 2C3KA 2IZSA 5AAEA 4D55A 2XKDA 3GU8A 2IN6A 5GZAA 3KU2A 4V01A 2OXYA 2OI4X 2C69A 2V7AA 3SVVA 3C9WA 4LMNA 5DR2A 4QYGA 1H26A 4MD8E 2B1PA 4XH6A 4BBEA 3ITZA 4CFWA 1UNHA 1W83A 4L44A 4O7WA 2VX0A 3B2WA 5HCZA 3LFDA 4O0WA 4QQTA 3VBTA 4QYFA 4AGDA 5J79A 2CKOA 5FTOA 4GIHA 3DDPA 3VBXA 2PTKA 2R3HA 2FVDA 5JFXA 2XAOA 4J96A 4NCTA 4C3FA 3CLYA 5ANIA 5AUUA 4BDCA 3W1FA 4RMZA 5L2SA 1APME 4G1WA 4O7NA 3OWKA 4FKOA 4ORKA 3L9MA 2WD1A 3F2NA 4YC6A 5C03A 3VS2A 1JSVA 3FZRA 5KE0A 4FSZA 5DG5A 3TI1A 2IVVA 3EQPA 3UIXA 4DCAA 3RM6A 4FK3A 5CI6A 3BWFA 5KHWA 2Y6OA 3EQIA 3JVSA 4FSMA 4FTRA 4PPAA 5EW3A 3TNQB 3A8XA 3UVPA 1UNGA 5CAQA 5CEOA 4XOYA 5HBHA 3SV0A 4BCOA 3EQGA 4GT4A 5AWMA 3MS9A 3VS4A 4E73A 2CKPA 2QG5A 3E62A 4FNZA 5IPJA 2J5EA 2A4LA 4LMUA 3BGQA 1KOBA 4CG9A 3KN6A 5DGZA 3P5KA 5K3YA 3HA8A 2BILB 2CGVA 3EN5A 2CDZA 2B4SB 4Z3VA 3WILA 2X7OA 3BX5A 3LFQA 4V04A 2R9SA 4ZY5A 5DRDA 2YWVA 4P5QA 5M55A 2XCKA 5EG3A 5KMOA 3FWQA 4RGJA 4CFMA 1IG1A 3OHTA 1PXMA 1YXUA 4A9YA 2JDSA 5CNNA 3NAXA 5KKRC 2X81A 2YM5A 3NUSA 4M12A 4XNEA 4YHTA 2FYSA 3I0OA 3RCJA 4E93A 2Z8CA 3FKLA 4I1ZA 4IBMA 4ITIA 5CT7A 3AOXA 4E4XA 4PTEA 3ZH8A 3DAEA 2HK5A 3NNXA 3VBQA 2UZWE 4WG5A 4Z9LA 3W8LA 3EHAA 2PZ5A 4PDYA 3ZLYA 5AUTA 3F3ZA 1DS5A 3FLZA 4ZLYA 1OZ1A 3II5A 3G90X 4G3CA 3IGOA 5IH6A 2UZVA 2XIXA 5AP5A 3SXFA 4EH6A 5IQFA 1P4OA 4DFNA 5A4LA 5E8YA 3LCSA 3ZBXA 5JFVA 3HRBA 4AP7A 2J50A 1REKA 2R0IA 4QMYA 5J87A 3HNGA 4M7IA 3VS5A 4ZTRA 4HYHA 4IJ9A 4Y5HA 4B9DA 3R1YA 2IF8A 4LV7A 2E9UA 4I5PA 2WQMA 4E26A 2WTJA 3VUIA 5AV2A 2VTOA 1QPEA 3FHIA 1JAMA 2OXXA 3A4PA 3PE2A 3GU5A 4F1OA 2WMAA 5BYLA 4RIOA 3JY0A 1XH6A 3OTVA 4EJ7A 2PE1A 5IQGA 4FSYA 4S33A 1G8AA 2RG6A 4U80A 4RLLA 5HHWA 5CXHA 3V3VA 4IVCA 4OBQA 4FV0A 4IFCA 4E3CA 4GUBA 2YJSA 4YJUA 3VS1A 3DBCA 3TDWA 3EFKA 3PZEA 1PMUA 3VC4A 3A7JA 2RF9A 4IAKA 1XKKA 3LLTA 1JKLA 1M7QA 4XV2A 1FVTA 1PXJA 3O23A 4LGGA 4CNHA 3MIAA 4CZTA 3ALNA 3K5VA 3KL8A 5KMNA 2BHEA 4JBOA 4PV0A 4AF3A 1OGUA 2VTIA 3QQKA 2EB3A 2PVJA 5CI7A 3FPQA 1ZOGA 4AOTA 1B39A 3MY1A 5ANKA 3RZBA 4WNOA 4OAVB 3VQUA 2HWPA 1GIIA 3I60A 4KBAA 2I7QA 5HVKA 3CTQA 4UMTA 2Z2WA 3R73A 1XBBA 2VRXA 3GUBA 4UYAA 4IHPA 2YITA 3UGCA 3DZOA 3W2SA 3R9RA 2X9EA 2IZTA 3FY0A 4JBQA 4BCMA 4DG0E 4XG6A 3U6HA 3COMA 3WF7A 1MQ4A 4UWCA 4D2SA 2OIDA 4G3DA 5I3OA 2IJMA 3D9VA 3FL4A 4O0TA 5JRSA 3MJ1A 2I6LA 3HZTA 4BCIA 2VTHA 2W1HA 3MSSA 5JRQA 1YDRE 3H9RA 4C33A 5IUIA 2JITA 4EOJA 3NIEA 3WF9A 3VVHA 4D5HA 3Q52A 4G17A 3C4ZA 4USDA 2OF2A 1W2CA 1OIYA 4AZWA 4FA2A 2XP2A 4CEGA 3TTJA 3HMPA 3POZA 2X2MA 4BI2A 1UV5A 3ANQA 4FIFA 4I41A 4HYSA 4UZDA 2LGCA 2WZJA 4K0YA 2GDOA 2ITNA 2JC6A 5B7VA 3F3TA 3TJCA 4RX5A 3V8SA 2BALA 4LG4A 5E90A 1DAWA 4CT1A 2AUHA 2BCJA 3F61A 3HV4A 1JVPP 3IS5A 4NTSA 2C6KA 5DBXA 1LR4A 1F5QA 3ZDIA 5HZNA 4FVPA 2F57A 2YCQA 4MXZA 3ZO1A 2PHKA 2OIQA 3NX8A 4ZSEA 4EC9A 4JI9A 4I24A 3LCOA 4E4LA 5IA2A 2VTAA 3QWJA 4EOSA 5IA3A 4EZ7A 1WBSA 2OGVA 4UWYA 2UZUE 1B38A 4MBIA 4MWIA 4F9YA 3EQRA 4GCJA 4L42A 5LVPA 3RPVA 2VX1A 4X2JA 4QTAA 4CFNA 4P7EA 4MUQA 5CWZA 3IW4A 4BYJA 1E1XA 2PZYA 4FG9A 2SRCA 4FKLA 4ASEA 3ID6C 4EQCA 4LOQA 2VTSA 4U5JA 2CJMA 4FSQA 5FDXA 5DWRA 3SX9A 4XRLA 5JSMA 4Y73A 1OKZA 2J0IA 4GU9A 4FIHA 4JNWA 2WTKB 5JFSA 4OAUC 3SQQA 4RWJA 3SHEA 3NNUA 4RC2A 3NFFB 4FRFA 3VRYA 5DNRA 4OR5A 3RTPA 3W0OA 3QTXA 4QPAA 3SRVB 4JQEA 5EYMA 3SD0A 5GZ8A 3RNIA 4O1OA 5DE2A 2QI8A 4YLLA 5DA3A 4TTHB 2CNQA 4YPDA 3UOLA 4NM0A 3ZYAA 4HCVA 4XLVA 3QGYA 2YZLA 1CSNA 1PXIA 2QHNA 3L8XA 2GCDA 2ITZA 1Y8GA 4ZXTA 1KE5A 4MNEB 4X6QC 4XG3A 1F3MC 2XJ1A 3QAME 2P4IA 4RFMA 1YI3A 2FO0A 2VO3A 3MFRA 3PXKA 2VWBA 3PZHA 3JPVA 4QP2A 2GS2A 3KK8A 4MKCA 4PDOA 5JZNA 1H4LA 4GL9A 5E91A 4AZTA 4EK3A 5L8LA 1GOLA 5A14A 4CFFA 2IW8A 4IAFA 4HVHA 4C0TA 5CZHA 1WBTA 3PRFA 5HORA 4FVQA 3CJGA 3Q32A 1ZYJA 5HE1A 2VTNA 1O6YA 4AUAA 2W1CA 5IQHA 4X2KA 3BU5A 4RZWA 2OFVA 3EQCA 1AQ1A 3PA3A 4AZSA 4DBNA 3DCVA 4JVGA 1KUTA 1UU3A 4AA4A 3FAAA 1K2PA 1SVHA 3FHRA 4I5MA 3C5IA 2FA2A 4DEHA 3N4VA 3MESA 5CSVA 3O5AA 2XK4A 2YM4A 2W5AA 3WIGA 3AG9A 3ETAA 3FSFA 5C9CA 4DEBA 1KV1A 5KMLA 4W4VA 4F7SA 2R3OA 1MP8A 2ITTA 3AC3A 5IQBA 4C4EA 2VX3A 4O0YA 3PPJA 3QTSA 4KABA 2VWXA 2C30A 3A60A 2YM3A 4JG6A 4JT3A 2ITOA 3TV7A 4CKIA 5DYJA 4WT6A 5LCKA 5F1ZA 4R3RA 4MTAA 2Y4IB 5FGKA 2Y6MA 5FBNC 3T3VA 4F9CA 4EH2A 4RWLA 4ASDA 3F2AA 1WMKA 3EQHA 4DE4A 4JRVA 1JKTA 4M0YA 3R1NA 4YO6A 3QA0A 1V0BA 5D7AA 5J9ZA 4QP8A 3R2YA 1PMNA 5LARA 4HNFA 5EM8A 3NRMA 4C7TA 5IH4A 3R8PA 3R6XA 2RG5A 3RPRA 3C13A 1ZWSA 1K9AA 4WG4A 2RIOA 4NKSA 4BN1A 4FJVA 3D4QA 2XK9A 3V5QA 2C6LA 1P2AA 3I0QA 3ZM4A 4AAAA 3PA5A 2OSCA 3LFFA 5AUWA 4BDDA 4IDVA 4UV0A 4EHZA 5L2WA 4O83A 4FG8A 4NH1A 2OXDA 3VRZA 3ZM9A 3NNWA 4ZTQA 3D0EA 4G9CA 3PSDA 1VLRA 3P7BA 4KRCA 5LVOA 1Q97A 4QYEA 4F9AA 3EZRA 3LAUA 4EC8A 3QKMA 2WTDA 3F5UA 4AXDA 2Z02A 3NWWA 4MXXA 4XP0A 5K4JA 3RMFA 1NY3A 4IQ6A 5CEMA 1URCA 3BLHA 3D5XA 3FL5A 3MDYA 2X4FA 3PJCA 4RG0A 3NUYA 1FVRA 1YOMA 3NVMB 3FMJA 3Q4CA 4XRJA 3VNTA 2XKCA 4GH2A 2AQXA 4RBLA 3ZZWA 5HIDA 1ZMWA 4OT6A 4ACDA 1TZDA 4DGOA 2F7EE 4RT7A 1P5EA 2WGJA 4FT5A 1UKIA 4G6LA 4QTBA 1OKWA 2YDIA 3QD3A 3NR9A 4O0XA 4IB5A 4Y5QA 3BGPA 1J91A 4FTLA 2X7FA 3ZDUA 4IEBA 4K33A 4CFVA 5HE0A 3ZTXA 4QQJA 3S00A 4B0GA 2CGWA 1YI4A 3NUPA 4P4CA 3HV6A 3F5PA 1BL6A 3POOA 3D83A 3QXOA 3DFAA 3Q04A 3LKMA 4QQ5A 3PJ1A 3BHHA 2B9IA 5HCXA 4GK4A 5FXQA 4CKRA 2XIKA 4KA3A 3FMEA 3FSKA 3FMLA 4FSRA 5J95A 3M1SA 3NPCA 4USFA 4ZTHA 3LMGA 5HNIX 3GVUA 5HO7A 2Z7RA 4TPTA 2I1MA 3N9XA 3ORKA 3OY1A 3PLSA 3FI8A 1CKJA 5LQFA 4EORA 3QTRA 4W9XA 2UVXA 1SM2A 4M14A 3I6WA 2JBPA 3RAIA 2Q83A 2NO3A 4E8AA 4IC7A 1ZY5A 1Y6BA 4DGMA 5T3QA 4TYHA 3MI9A 3QC4A 4O21A 3RK7A 1GZKA 3ZMMA 4U97A 1J7IA 2PVHA 3ZRMA 5HBEA 3AGLA 2BRMA 5HESA 4WSYA 1O6LA 3E8NA 4U0IA 4YO4A 3QHWA 4FI1A 4N70A 3NW7A 3LJ2A 5I9VA 2UW0A 2C6IA 3HRCA 3CQWA 3ZLSA 5AA8A 2BMCA 4B8LA 5HX8A 3DK7A 1Q4LA 3ROCA 3ATSA 3DXPA 4BGQA 4BZOA 4BJJA 5AM7A 3IW5A 4BB4A 5HLNA 3CQEA 4LQMA 3JVRA 3MPAA 3KQ7A 4GYIA 4APPA 3G15A 3AXWA 3H10A 3G9LX 2HZIA 2W4OA 4EH4A 5IG1A 3PUPA 2QKRA 3C4XA 4PDSA 2V5QA 3FQHA 5LWMA 4XLIA 3VIDA 4C4IA 2OG8A 3K2LA 3OWLA 3AD6A 5JT2A 3UPXA 1PYEA 5HNBA 1KWPA 5BVDA 5GINE 4EHEA 1A48A 3ZOSA 4FEVA 4BC6A 5L3AA 5CAPA 2X0OA 4IADA 4BDHA 3VHKA 4EYMA 4FL2A 4FC0A 4K77A 2F9GA 4IH8A 2BZIB 2ONLC 3ALOA 4XBUA 5FP5A 4C35A 4EK5A 1MRVA 3SLSA 4YNOA 5HTCA 4DT8A 1RE8A 3R7GA 2WMUA 5A54A 2IEWA 4N4SA 1AD5A 3QCYA 4RVLA 4EL9A 2GNJA 3DY7A 5EQYA 1SZMA 4QOXA 4FV9A 3U4UA 5CT0A 4CRSA 4FTTA 1U54A 3DBEA 2ITWA 4H36A 5KMMA 1FBNA 1QMZA 5E8SA 3OCTA 3F3UA 4AW0A 5IMXA 4QMUA 4LFIA 1PF8A 4ZMFA 3EFJA 4ANLA 5CF4A 4IWOA 3E3PA 3A7FA 3JY9A 3UIBA 3EL7A 5D9HA 5HG9A 3DQWA 1W8CA 4YPSA 3EN9A 5AP2A 5ETCA 2GNIA 3RM7A 2JIIA 4GFGA 4RA4A 3MV5A 4ANBA 3P78A 2VTRA 2IWIA 4UX9A 2JDVA 2V0DA 4LDTA 3N51A 4XG2A 4BY9E 5DOSA 3UC4A 5EM6A 3TYKA 1W98A 2CGUA 2PVYA 3R8LA 2WMRA 5FM2A 4UN0C 2C3LA 3L8SA 5AJQA 5CEQA 4EEVA 4X2FA 4LUEA 1Q3WA 1YRPA 5EKNA 4NK9A 1WBWA 2QVSE 2VWWA 3AC4A 4W4YA 4XG8A 3SXRA 3U87A 3V6RA 4BDKA 5FTGA 1MUOA 5CX9A 3O2MA 2XYNA 2GQGA 1ZMUA 1PJKA 3L9NA 4WNMA 5M4CA 2UUEA 3SXSA 3HAVA 2JGZA 4N0SA 3Q6WA 3C50A 3Q96A 4XS2A 5EW8A 3RALA 2O64A 1YWNA 5HEZA 2G01A 4QMWA 5I9UA 4PL5A 3GBZA 4FV1A 4E6CA 2HXLA 4PNIA 1PYXA 2GSFA 1STCE 2PUIA 4F0GA 2RFEA 4H58A 4PQNA 4A9UA 1BI8A 4YU2A 4V05A 3PJ2A 3R8ZA 4BDGA 4BDAA 1OL5A 3FLSA 3F7WA 3MH0A 2JDOA 4XCUA 4ZTMA 2X8EA 1T46A 2XS0A 5M51A 2GFSA 4LYNA 5AUVA 4ZEGA 3R2BA 2BVAA 3F7ZA 4U3YA 3FZPA 2GHGA 3JR1A 4BDBA 4MBLA 1P4FA 3DKFA 4G3FA 3GU4A 4JDIA 2UZNA 4EQMA 3HV7A 2AYPA 4OTFA 4F78A 2YABA 3D94A 2H96A 3R7OA 4ZMEA 5KKRB 5HICA 5A4QA 3AC2A 3BE2A 1URWA 3UQFA 1ZLTA 1Q41A 1HCKA 2W5HA 5C01A 1Q62A 4G34A 2ETKA 3DXNA