5AP4A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
280
structure length
257
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNGWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANMQPDQVGVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 257
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap4A01
3AGLA 3I0QA 5BYLA 4KA3A 2C69A 3C5UA 2BZIB 3OCGA 2YABA 4RLKA 4WNKA 3ZLWA 4C8BA 4QP7A 1U5QA 3R8ZA 2WFYA 2OO8X 1GZNA 5BYZA 5GZ8A 1XWSA 5C8NA 2CN8A 3D5VA 1UU8A 4L46A 4OTIA 3BI6A 2WIHA 5K0XA 5KKRB 5LARA 4CFWA 5BMSA 3T9TA 1P5EA 2BAQA 3DJ7A 3BQCA 2ITPA 3CJGA 2P55A 3FI2A 3HNGA 1U59A 5EDQA 4Z16A 3BYOA 3L9MA 5HGIA 2YWVA 4E4NA 3ZFXA 5BQ0A 1OIQA 4NSTA 3ULZA 3PLAE 2I0YA 2W1HA 2BDFA 4FSZA 1U4DA 4MWIA 2XM9A 3P79A 4NU1A 4NUSA 4W4VA 5K9IA 4V04A 4IB1A 1KE8A 4GFGA 4NKSA 3O7LB 5C8MA 4TT7A 4MNEA 2OI4X 4XG6A 2CCIA 4AZSA 3LPBA 1PJKA 4NTTA 3WF5A 2VX1A 3WE4A 3COMA 4Y85A 3BE2A 4OTQA 4WBBB 2H8HA 5HU3A 5M57A 4O82A 4WKQA 5CAPA 2OF2A 2IVSA 2W5AA 4UV0A 4U5JA 2QU5A 2X4ZA 2RL5A 4ZTNA 1K9AA 4CLJA 1XBAA 2WEIA 2J0KA 3BHTA 4LOQA 4Q9SA 3Q6WA 4LYNA 3VW6A 1Y8YA 3UMXA 3VULA 4M84A 2NPQA 2CNVA 3DZOA 3BKBA 3V8WA 5JMSA 2VX3A 3PVUA 4AUAA 3MESA 3RI1A 3KK9A 3PP0A 1JBPE 3U6HA 4G5JA 4IVBA 1B38A 2XK7A 3GP0A 4BN1A 3CJFA 3W33A 4TPTA 3R22A 4IVCA 3VJNA 3IOPA 4AGCA 1WBOA 4ENXA 3UQCA 1RQQA 4JAIA 3EN5A 5D41A 4GFOA 5A4LA 3FZTA 4OTFA 5DWRA 4RWJA 2PZYA 1RJBA 4D4YA 4ZTLA 4G1WA 3CC6A 3PJCA 4CVAA 3DFCB 4D1ZA 1SVGA 3BLQA 3TNIA 3EFLA 5IA2A 3LFQA 5D11A 2Y4IC 2I6LA 5CF4A 3R7OA 4FTMA 3D5WA 2XNGA 1DAWA 2UZOA 3SW4A 3UIXA 2ITTA 3ZONA 3KREA 1PW2A 4O7WA 4AP7A 4D5HA 4QPSA 2PMIA 5HIEA 4FF8A 4MHAA 3A8XA 3OBJA 4AZEA 4OBPA 2GHMA 2PUPA 2YAAA 1QPEA 3QLFA 2ETKA 4ZTQA 3PA4A 3BV3A 3P5KA 2J5FA 2QHMA 4JR3A 4RIWB 3FAAA 2ITWA 4FI1A 3F2NA 3F6XA 4KS8A 2J0IA 4PMTA 1SYKA 2Z8CA 4PY1A 3ZC5A 5DOSA 4YSJA 1XJDA 4YNEA 2IPXA 4H3PA 5HO8A 4D2TA 2ONLC 2J0LA 1FGIA 2VWXA 5E8WA 5JRSA 4RPVA 1W8CA 3ROCA 4F9AA 3D7TB 4MQ2A 2WU7A 3ANRA 3H4JA 3F3VA 5H3QA 4W4XA 1H28A 2PK9A 3GCPA 2IWIA 3CQWA 4U97A 5EM5A 4H3BA 2QC6A 4D1SA 4FT5A 4X3FA 2WMQA 4WG3A 2XH5A 5M06A 4FV7A 2QKWB 5HTCA 4CZUA 3E87A 5HLNA 5M55A 1JPAA 4G9CA 3DK3A 3AD6A 3WYXA 2OXXA 2R3MA 1AD5A 4XG7A 5AJQA 5EYCA 3OFMA 3RMFA 5D7VA 4BCKA 4Y5HA 3F7WA 4EZ3A 4QTEA 2GNLA 4E6AA 4JG6A 2DUVA 2JGZA 2P2IA 1J1CA 4L00A 2G1TA 4DA5A 2YEXA 3ODYX 3K3IA 5FP6A 4F1MA 2BILB 4QMQA 2X7FA 4QMTA 3RCDA 3M2WA 3ENMA 5TOZA 1H1SA 3TDVA 3EQRA 3HVCA 4M69B 5KMNA 4PDYA 4UXLA 5C1QB 3TG1A 4BI1A 3R71A 4YO6A 4YP8A 4GUEA 3V5LA 5AUYA 1NVQA 3MVMA 2VTHA 1YDSE 2ITNA 4LM5A 4UWBA 1WVYA 1WVXA 2OJ9A 1TQIA 4KRCA 4QMZA 2YISA 4AA0A 1FPUA 3QKKA 2BUJA 2OWBA 3R02A 4D5KA 4M68A 3RPSA 3FYKX 1OL7A 4RMZA 3Q3BA 1DI8A 3DNEA 3GOKA 2RKUA 5BVOA 3WZEA 4GKIA 4GKHA 2Q0BA 3KGAA 4ONAA 3Q4CA 4ALVA 2UZDA 1FINA 2C3KA 3DPKA 3K2LA 4WRGA 2J5EA 2GQSA 2C1AA 4JDIA 1WVWA 4IC7A 4FICA 4BZDA 3NDMA 1OVEA 1YHVA 4IB0A 5M4IA 3RM7A 3FLNC 5BNJA 2UZWE 3Q53A 4ACCA 3BPRA 4USDA 3C51A 3G9LX 4MXAA 4O22A 1W83A 2R5TA 4JBVA 4ZLOA 3R9DA 4F1TA 3NYOA 4U3ZA 2JITA 4AW0A 4F7SA 3P08A 3HV7A 3DNDA 4FVPA 3ZSHA 5GIPE 1URWA 3MSSA 3GU5A 3GC7A 1G8SA 2FA2A 3M11A 4LQMA 1GIJA 3NNXA 3OP5A 3EQFA 4F7LA 4I6BA 2GFSA 5BVKA 5IMEA 3EN9A 4H36A 2PHKA 4M12A 1G5SA 4IH8A 3VS7A 3I0OA 2A0CX 3F5PA 2IW8A 5HVJA 4F6SA 3E88A 3JVSA 3GQIA 1PXIA 3NZ0A 4NW5A 2GHGA 4AGDA 3PJ3A 1KV1A 2R0IA 3H0YA 1DM2A 3QHWA 4JL9A 2JDVA 3JXWA 4R3PA 2QNJA 3FXZA 4EK4A 5F94A 2JKKA 4I5HA 2IN6A 4TWPA 2C6OA 3PZEA 4C61A 3LKMA 2Q0NA 4KKGA 3EN4A 2ZB0A 5I9XA 1OUYA 1XR1A 4ASDA 2I40A 4DITA 2P4IA 4EOJA 2HZNA 4XHKB 2E9NA 4ACHA 4C4HA 3OCSA 4NEUA 2VNWA 4U9AA 3DBQA 3HYHA 5HVKA 2YM8A 3KEXA 5IUGA 3KRWA 1KE7A 4JRVA 4RG0A 3QD3A 4YC8A 3G0FA 5CSXA 3RP9A 2C5YA 2JDOA 3ATSA 2GHLA 4FSTA 4EOIA 3EYGA 4GUBA 3OWLA 3POOA 3ZRLA 5FD2A 4WUAA 3TZ8A 3LQ3A 4OLIA 5M08A 2ZMCA 4M8TA 2GS7A 5DT0A 3ALOA 4JIKA 3D5UA 5LJJA 1Q99A 3B8RA 2WMUA 4UY9A 4GK2A 4FSUA 3OEZA 4WUNA 4ENYA 4U6RA 1YWVA 1UV5A 4JLCA 4Y8DA 3ZUUA 3FI8A 3MIAA 3LJ2A 1IA9A 3TM0A 4EH9A 4IE9A 4EHEA 3U55A 2YM6A 3N9XA 4RIOA 4FV9A 3BU3A 4ID7A 4QNYA 4FVQA 2GU8A 4MXYA 3E3PA 4IX3A 2B9FA 5HORA 4CMTA 3EL7A 3AD5A 4F4PA 3MFUA 4ASXA 1WBNA 3V04A 1WBPA 3NAYA 3PLSA 1PF8A 4ZXTA 2C6TA 3F2AA 3NUNA 4EBWA 1NA7A 3PJ8A 5EHYA 2QU6A 4GIIA 3SQQA 2F49A 1VR2A 2G2HA 3VW8A 2BZJA 2I0VA 3L8XA 4FT0A 5K4JA 1FGKA 2BIKB 2VWYA 5KKRC 2YZAA 2O2UA 4RC3A 2BMCA 1ZARA 1JQHA 5FUTA 3HMIA 4DYMA 4F65A 3RBWA 4D0XA 5EI8A 3M1SA 2QOHA 3TZMA 3SW7A 4J98A 1PMEA 1BL6A 4M15A 4KBKA 4EOKA 1H25A 2PU8A 1YWRA 2R3PA 2OJJA 1MP8A 3SVVA 1CKIA 4BWXA 1UU9A 3FV8A 1M7QA 5EHOA 2F57A 2WTVA 4E5BA 4EKKA 2B4SB 4GJ2A 3FMHA 2OGVA 2I0EA 4AN9A 4C4FA 3CSVA 5HNIX 3HRCA 3VHKA 4EYJA 3BYMA 3EKKA 2GNGA 4YJUA 3R63A 2VTIA 4G6LA 1XBBA 2PY3A 2BIYA 3S1HA 4GL9A 4AT5A 1YOMA 5L8LA 3HKOA 4FBXA 3FLYA 2C6KA 5A4EA 3E8CA 3KCFA 4A4LA 1KE9A 4XV3A 4G3GA 2W5BA 4XRJA 4GRBA 3MH1A 2ITOA 4AOJA 4F7NA 5LWMA 3GCQA 4NJ3A 3AT4A 4ZJIA 3R1YA 2X7GA 3IQ7A 4O7YA 4I6QA 4PRJA 3EYHA 3IPHA 4FG7A 3S4QA 3TKHA 1XHAA 2ITXA 3P4KA 4IB3A 4O1OA 5FXRA 3VS3A 4IHPA 4FEVA 4C7TA 3ZZWA 4AAAA 3I5ZA 5JEBA 3TXOA 3TIYA 5KCVA 3ZLYA 1KV2A 5CU4A 4FV3A 5BUEA 4E4LA 4EOLA 3SAYA 3NYVA 3OMVA 1NW1A 2WMXA 3R83A 1AGWA 1YRPA 3RAKA 2JKMA 5I9ZA 3ERKA 5AP7A 4L01A 3N4VA 2HYYA 2V22A 1UWHA 1JKTA 3E8DA 3VS0A 4FIGA 2ONLA 3S95A 5AP6A 3E5AA 2UW6A 2YM3A 3VF8A 3UTOA 2QODA 4FOBA 4Q5HA 4R1YA 5CSWA 3HUBA 4D9TA 2R0UA 4AE6A 4DEDA 4QP8A 2VZ6A 5AP4A 2OLCA 4O7NA 4K8AA 3OUKA 5DR2A 4CLIA 1ZOHA 1ZYJA 2XP2A 4HNIA 5M07A 5CSPA 3KF7A 4CXAA 2CNQA 2R64A 2O64A 4A9YA 3IW8A 4H1JA 1I44A 3Q9YA 4NCTC 4XS2A 4E5WA 3PA3A 4EH2A 3PSBA 2GTNA 4HVDA 4MYGA 3KRXA 4MQ1A 4H39A 3UPZA 1QPCA 3MVJA 4QMNA 5CF6A 2C1BA 4EK3A 4IDVA 1ZOEA 2HY81 4Y73A 5KHWA 4X6QC 4NM0A 2O63A 2Y0AA 2VO6A 4B7TA 4WNPA 3BYSA 3FXWA 2WD1A 4QMSA 5AEPA 2OFUA 2DQ7X 4N4SA 3PY3A 3FL5A 2ESMA 4Y72A 3E7OA 3MH3A 4Q5EA 3AOXA 1WBSA 2WMVA 3NVKI 4RC2A 4XV9A 3HAVA 3QGWA 3LOKA 2WGJA 4Y5QA 2PL0A 4YNOA 4A07A 1DS5A 5J9YA 1K3AA 3KULA 4ITIA 1UU3A 2WQOA 4IWPA 5GJFA 3IW6A 5I9VA 3G9NA 4EONA 5T3QA 4EI4A 5IH4A 2F4JA 3BGQA 4FEUA 1ATPE 2YITA 4FV4A 2YAKA 5A4TA 4CQEA 5EKOA 4PF4A 2C0OA 4I92A 3AC1A 3OY3A 4IQ6A 4PTGA 4XCUA 4OT5A 3BX5A 3R73A 4FTNA 3D4QA 5HTBA 3WF7A 1Q4LA 3H9RA 4FODA 2XZSA 2GMXA 2C6IA 4YBJA 2BRGA 4P2KA 4ALUA 3QQGA 1U54A 4F0FA 4XG3A 4XX9A 4XBRA 4CCBA 3D9VA 5HTIA 1H1RA 2CKPA 4QD6A 4E5AX 1I09A 2X9FA 3Q2MA 1CKPA 5CT0A 3VUDA 1YVJA 2CGVA 3C1XA 4W4YA 4UYNA 3QQKA 5KBQA 3C4ZA 3HUCA 3NCZA 4FKQA 4J99A 4EQCA 1W82A 2BRHA 2W1CA 5JFVA 1PMUA 3KMMA 2R3OA 4AN2A 3FY2A 5E90A 2OK1A 1SZMA 4FTAA 3FSFA 4UWYA 4U7ZA 3PY0A 1TVOA 2C30A 3E8EA 3I1AA 4NM7A 3LMIA 1L3RE 4RWIA 3IGOA 4LUDA 2QR8A 4ZMFA 2CKOA 5E8VA 1H1QA 2VX0A 4K9YA 3Q96A 4QP9A 2VO0A 3LFCA 4GU9A 4XEYA 3TKUA 3FJQE 4KINA 4M14A 3TIZA 5ETAA 5BUJA 4BGHA 3QC4A 5AP3A 1UNGA 2C3IB 2O65A 2G01A 3CBLA 4IXPA 4RZWA 4XP3A 4BKYA 3NVMB 5GNKA 5JH6A 4YLJA 1IAJA 4BBEA 3OZ6A 4PNIA 3VS2A 4ASEA 3NUPA 3ZFMA 4JBOA 4BZNA 4GS6A 4MXZA 4A7CA 5JQ8A 2ITQA 4TYJA 3SKCA 2R7IA 4FSRA 2VD5A 3QZGA 1Q62A 4BDEA 1Q8YA 3F7ZA 4UN0C 3H3CA 4XMOA 1OUKA 3EQHA 4R1VA 4Z3VA 4E6DA 4LI5A 1J91A 2YHVA 2YCSA 3I6WA 4I3ZA 4IDTA 4FKTA 1NVSA 4RIXB 5LOHA 4RWLA 4EHVA 2PZIA 5CAVA 4MF0A 4M0ZA 3WIKA 3JUHA 5K4IA 2NNWB 5E8ZA 3NLBA 1ZLTA 3BU5A 2IW6A 3ACJA 4M97A 5CY3A 3CCNA 1HCKA 1R3CA 4NL0A 3HZTA 3RJCA 2ZOQA 4YC3A 4MXXA 4X6RA 3HV5A 5L3AA 4RJ3A 4JI9A 2EUFB 5EYDA 3Q4ZA 4DEIA 3HRFA 2VTRA 5E8SA 1JSTA 2UW9A 4S34A 3FKLA 5CALA 2VU3A 4RJ6A 3TKIA 3GBZA 1JOWB 4HOKA 2XNPA 3HV4A 2R3LA 2YIQA 4IAIA 4D4RA 5IPJA 4RZVA 1OL2A 4WA9A 3QTRA 3UO5A 4BHNA 2VV9A 2W06A 3UOHA 2C68A 3ZSIA 3HA8A 1GIHA 1ZZ2A 4EL9A 4MH7A 2A2AA 3K54A 5DEYA 5AUZA 5LVPA 4C3PA 4J96A 5DT4A 4N6YA 4QMWA 3ZO3A 1JSVA 4YPSA 2I1MA 2PVRA 3NX8A 4QTDA 2ZV8A 4IMYA 2C5NA 5ANKA 4AGUA 5B2MA 5J95A 3DKFA 1REKA 4O86A 4CZTA 4YZMA 1YDRE 5H8GA 3WZDA 4XNEA 2E9UA 4DE4A 1O6KA 1OL1A 1ZYDA 2JD5A 4KBCA 3DKOA 3PZHA 4M0YA 3RALA 4JXFA 4FT9A 5C4KA 3T9IA 4ZTHA 4E8AA 3HDMA 4QP4A 1JAMA 1JKSA 2X2LA 4TKSA 4RJ7A 4Y95A 5C01A 2QOOA 2CDZA 4RA5A 2V7OA 4WO5A 5KE0A 4R8QA 4YZ9A 4AQCA 3ZU7A 4U42A 3NS9A 5IU2A 3R04A 5CEQA 1FMOE 4PPCA 5KUPA 4ZTSA 2UVYA 3AG9A 3DB6A 2YIXA 3C4FA 1AQ1A 3CD8A 3NUXA 4LL0A 4V0GA 2UZLA 3BEGA 4GU6A 4DT9A 2XIXA 5JT2A 1PXKA 4CRSA 4OAVB 3Q04A 3C5IA 1M2PA 5E8TA 3UJGA 2YCQA 2Z7QA 2Y9QA 3HL7A 1OMWA 3ORXA 5ACBC 3QRIA 4G3DA 4O38A 2GNHA 4X0MA 4GK3A 1LEZA 4G34A 1A48A 4FKRA 3SA0A 4DCAA 3NW6A 3FHIA 4FX3A 3HMOA 4IM0A 5EW8A 5HO6A 1KE5A 5D10A 2QOQA 2J4ZA 4QYHA 4EK5A 4YGAA 3MPMA 4XOZA 5KMKA 2X81A 4AZVA 3RCJA 3MS9A 4BTMA 4O27B 2A1AB 3DBFA 3MDYA 5FG8A 3HRBA 1Q24A 4MBIA 5CSVA 4XUFA 1PKDA 2UW5A 4J8MA 2OJFE 3FZPA 3IDBA 3TL8A 2HZ4A 3AGMA 3FHRA 2CNUA 1KE6A 3QQLA 4JX7A 2REIA 4AW2A 4BCGA 5LXMA 4O83A 3Q4TA 3G6GA 3UE4A 4FTCA 5HOAA 4WIHA 3GCUA 4DBXA 4DH8A 2VTOA 4BCIA 3DXQA 4FIJA 1H08A 3PPZA 2XNEA 4QRCA 5CWZA 5AUWA 3MB7A 2VRXA 3KU2A 3JR1A 3LLAA 3F3UA 2IJMA 5HHWA 2WQEA 5C03A 4ZJVA 5IA4A 5DN3A 4C0TA 4G3FA 2VWZA 2UZBA 4B4LA 3PVBA 4LOPA 3DB8A 3FBVA 4HYSA 1R39A 4EOSA 5IQEA 3C9WA 5FTGA 2Z7RA 2B54A 5ANDA 1ZRZA 2Z2WA 4UXQA 3RPYA 4FV5A 1ZAOA 4AF3A 4BYJA 5A14A 1R1WA 3QXPA 5AFVA 4HYHA 3HEGA 4ZY4A 3ZMMA 3N4UA 4U0IA 5KHXA 1Z9XA 3D7ZA 3OWKA 4RIWA 3U8WA 1MRYA 4L3LA 2X39A 3NYXA 5HU9A 2JBPA 4GT4A 5CAUA 3FEGA 4GSBA 4PV0A 2R3IA 3Q60A 1T45A 2RFNA 3O2MA 3TUDA 3NEWA 2HW6A 4YU2A 5FM3A 4N0SA 3CTJA 4FNWA 3B8QA 2FSMX 5FBNC 3WF6A 2WKMA 3T3UA 3UYTA 2VWIA 4WOVA 3ZO2A 5AR3A 3U6JA 2QOCA 4I41A 2O3PA 4FT7A 3O0GA 2YM4A 4BFMA 2EVAA 4FKPA 1WBVA 4O0VA 4EJ7A 1YHWA 4OTWA 4ZY5A 3DS6A 3QL8A 4M13A 4DEAA 3U9CA 3PJ1A 4LV8A 4FV8A 4YLKA 4BDJA 1A06A 4YPDA 4BDIA 3C0GA 5AR7A 4O7RA 3C50A 4BL1A 2QI8A 2CGUA 2UV2A 4QT1A 5T6KA 2V5QA 4CCUA 5LMKC 4NM3A 4RQKA 5DA3A 4B0GA 4RLLA 1XH4A 4I5CA 3DA6A 3GENA 4F6UA 4EJNA 2EXCX 2QOFA 4YJPA 4YJNA 3BU6A 3MVHA 4H3QA 4EH4A 4U44A 4KIKA 1M2QA 1W84A 3ZLXA 5GINE 2JAMA 3CTHA 4K77A 4UZHA 4FZFB 2X4FA 3UPXA 5CU3A 1HOWA 3QRTA 5BVNA 4PWNA 4IW0A 4ANLA 3ROYA 4QMOA 4PP9A 4RFMA 4CTBA 3FZSA 5CEMA 2KTYA 3P78A 4FZAB 1CSNA 2W1FA 4ZSLA 4XG4A 4BY9E 3EHAA 3MY1A 4KRDA 3E93A 5M09A 3VVHA 1X8BA 1UVRA 4ANBA 5KMIA 4U43A 4GEOA 5IA5A 4EUTA 5IISA 3VUGA 3TWJA 3LJ1A 3G6HA 3DJ5A 4KABA 5EW3A 3VS6A 2OZAA 1MRVA 3LIJA 1H27A 3TV6A 3CY3A 4C62A 2PUNA 1XH8A 4NT4A 5CENA 2FGIA 4FUXA 2DWBA 3W55A 2P33A 5KMJA 3OY1A 4O7LA 2YLFA 2NRUA 4AFJA 3PUPA 5IQDA 2BRBA 2PVJA 4ALWA 4FKJA 4TNDA 3A4PA 5KBRA 3MWUA 4QMUA 3G15A 2WQMA 5EM7A 3S00A 3OS3A 5F9EA 5ANEA 4G17A 1UA2A 4IAFA 5TKDA 4BRXA 3R8LA 3KN6A 3Q5ZA 4P5QA 3F69A 3NNWA 3RAIA 3KK8A 2B7AA 4MNFA 3ZLSA 1OKWA 2WNTA 2YERA 3MA3A 2RG5A 4RA4A 4X2NA 3PA5A 4A9SA 4BTKA 4JIAA 5M4FA 3HP5A 4R3RA 1ZMVA 4M3QA 2GSFA 4UWCA 4ZOGA 3VWAA 3BLHA 4EORA 2X8IA 5AUUA 3OHTA 5GJGA 4BCHA 5A4QA 2XKCA 3DKGA 1IASA 5GZ9A 2R3GA 5ICPA 2ZV7A 4TYHB 3RK5A 5CX9A 3U87A 3QUDA 3ZRKA 1WFCA 4YJTA 2QVSE 3ORTA 3QAME 3VS5A 4MNEB 4RGJA 3QYZA 5B7VA 3VS4A 5AV2A 3Q9ZA 2Y4PA 3PSCA 1H4LA 4APPA 4USEA 2HIWA 1FVVA 2WTIA 5A9UA 4AZTA 3FQHA 2XK6A 3D94A 4E4MA 1H1WA 2XA4A 1SNXA 2FB8A 2WPAA 4YZDA 4EYMA 3DBCA 4TYGA 4U40A 5E9EA 4M7IA 2C0IA 5DR9A 3WYYA 3H30A 4ZSEA 3R9NA 3V51A 4FZ7A 4Q2AA 4DFXE 1MQBA 4ANOA 4J1RA 3Q5IA 1H00A 2FUMA 5E91A 4GYGA 4Y46A 5CU6A 4HYUA 3UG2A 4FV6A 3UGCA 3FUPA 2UW7A 4AT4A 4EH5A 4HCUA 4M66A 1OL5A 5H2UA 2X1NA 5AV4A 3QRJA 3C4XA 5IDNA 5KNJA 4CV8A 4GW8A 1M7NA 2JFLA 3GEQA 4FOCA 2WOTA 2WMAA 3R9RA 1S9IA 2C6LA 3F61A 2H9VA 2OIBA 1ZYSA 4MF1A 3KF4A 1FVRA 5BVWA 3IKAA 2ITYA 2A19B 3OXIA 4FIIA 3V8TA 4RX5A 1R0PA 2JLDA 3WIGA 1CMKE 2R2PA 3POZA 2B0QA 2PMLX 4FKGA 4D58A 1REJA 2VTTA 5J87A 1P14A 4WBOA 3F82A 3I81A 5C27A 1U46A 3VRYA 4RVMA 3O50A 4KS7A 4UALA 3MVLA 4FTKA 2PVKA 1SNUA 3C7QA 3ET7A 4TTHB 3PXYA 2EXMA 3UP2A 4CKIA 4YJRA 3EQCA 3IONA 5EFQA 5A6OA 1SVHA 3MN3A 5LWNA 2EWAA 4DT8A 3QTUA 3VBYA 2BCJA 2ZDTA 3PIXA 3KB7A 4WT6A 3TJCA 5J9LA 4TWNA 3QD4A 1OZ1A 3LMGA 2J90A 4CYIA 1TKIA 4DGMA 3Q2JA 1XH5A 3KY2A 4QPMA 3HX4A 3A8WA 3FQSA 5FP5A 3VHEA 4IADA 4EWHA 4R78A 1HCLA 2JAVA 2XK3A 5CEPA 4I22A 5LMBA 3EIDA 4C4EA 3R01A 4AFEA 2YM7A 2W7XA 3Q9XA 5KX8A 5HBJA 5E7RA 4BF2A 4C2WA 4O7SA 1NT2A 3QTWA 5G6VA 2BPMA 2BHHA 2GNIA 3TTJA 1WBTA 4F6WA 5IA1A 5CSHA 3UVPA 3ORIA 4KIQA 4CFMA 4RIYA 3MI9A 3UIUA 3ZEPA 4FEXA 5I3RA 4X3FB 3JS2A 3HDNA 3VAPA 1ZYCA 5HIDA 1Z5MA 4HJOA 4IX6A 5DR6A 2IZUA 3ZSGA 4XYFA 5AADA 4IANA 4C34A 2VTMA 2XNBA 4D28A 4DEBA 5IF1A 4D55A 2Y8OA 4I5MA 4X2JA 3OOMA 4NTSA 5G1XA 5H9BA 5HG7A 4WNMA 3O8UA 2HXQA 2CLXA 3COHA 1PXLA 1WAKA 2PTKA 3Q6UA 3MH0A 4ZS4A 3LFNA 4DH7A 3DDPA 4EQMA 2WQBA 4LMNA 4TRLA 5CI7A 2YDKA 3AD4A 3R7IA 3D0EA 3NRMA 4EHGA 3I5NA 3SHEA 4I0TA 3TN8A 4ZSJA 3OTVA 3F3TA 3CQEA 4L44A 4LOOA 5HLPA 3I60A 1JKKA 4L3JA 2X2MA 1UWJA 3VF9A 4L53A 2WQNA 5JGDA 1B39A 2BKZA 4C38A 2C4GA 2BZHB 1CKJA 1YKRA 3KN5A 2NP8A 1K2PA 2PWLA 3NUSA 4DLJA 3O23A 5D9HA 4X7QA 2EB2A 3CLYA 4FSNA 2WMBA 3U6IA 3UC3A 4YLLA 3PTGA 1V1KA 2JC6A 2W05A 4CD0A 3DK7A 3UMWA 4DEGA 5J7HA 5FDXA 3VQHA 3W8QA 5LCJA 5HD7A 2J0MB 4AU8A 4I21A 5E8UA 3KXNA 4FK6A 2BROA 4YJOA 4UMRA 4YTCA 5HX8A 5F4NA 4YURA 5IUIA 4XG9A 1JSUA 1Q41A 3BYVA 5KZIA 3G51A 3AC2A 3ORZA 3QRKA 3MFTA 5DE2A 3UYSA 4GH2A 4PMSA 5EYKA 4AA5A 3DLSA 2XUUA 3KA0A 3DDQA 3NR9A 4IWOA 4KBAA 4UYAA 5DRBA 5AA9A 4HVHA 4O0SA 2OH0E 4PDOA 4R7IA 3UNZA 5LQFA 2QLQA 4PUZA 3C4EA 4NIFB 4L42A 4RVKA 3LVPA 3QALE 1JWHA 2O5KA 2OIQA 1UNLA 3KXGA 4KSQA 4BCPA 2I7QA 1CDKA 3QGYA 3FWQA 4O6EA 3I6UA 4JVGA 3D14A 2VTNA 5CAQA 5AR2A 4AT3A 4O0WA 3VUHA 4YR8A 3CY2A 2QCSA 4FNYA 4OW8A 3FLZA 2QO7A 5EDRA 4BHZA 4DEEA 5ETIA 4BCQA 2AUHA 3QKLA 3ZTXA 4CFNA 4E73A 4PPBA 5DRDA 4BYIA 5IEVA 4HPTE 4HGEA 3SOAA 4XJ0A 4LGGA 4FEQA 3QQUA 4L67A 3PY1A 1PXMA 2V55A 2RFEA 3R1NA 5HCYA 3N4TA 5TO8A 5L6PA 4KIPA 2FSTX 4L9IA 3GUBA 4LGDA 2X8DA 1BL7A 2BHEA 4U80A 2PVLA 4HZRA 4CNHA 5IA3A 4AW5A 5CI6A 5IUHA 2W1DA 3MB6A 4XV2A 2OXYA 3V01A 4BGGA 5K5XA 2J9MA 4N57A 4E93A 3W1FA 4GMYA 4S2ZA 4DN5A 1KSWA 3MGYA 3FPMA 1Y6AA 2W4OA 2Z7LA 4NJDA 1R0EA 3GT8A 4L68A 3E64A 4I23A 4QMMA 4EH6A 5M51A 3H0ZA 3OEFX 3ELJA 4QNAA 3VO3A 4BDCA 3E63A 5CZHA 2V7AA 4D2WA 3RGFA 4LG4A 4TXCA 2R3RA 3UDBA 3IW5A 1KOAA 5K3YA 4FKVA 4D2PA 3EWHA 3PXKA 4YZBA 3V5WA 4O0TA 2PZRA 1M2RA 5HESA 4EUUA 4JDHA 4ZP5A 4IM2A 4CZYB 2EB3A 3UZPA 4DGOA 3F5GA 3LXNA 3Q9WA 4PL4A 5AX3A 2GS2A 2V62A 4F9YA 1XH7A 3NAXA 3QQHA 3E92A 2IZTA 2ETMA 2R4BA 4WHZA 3FKNA 1H01A 4JR7A 2SRCA 1YW2A 1YI6A 3W2OA 3G2FA 4K6ZA 4CT1A 2CSNA 2OW3A 3V5PA 3BV2A 4GV1A 4IZ7A 4D4SA 3KXXA 4L7FA 3PXQA 4O1PA 2W96B 3D2KA 3OF0A 2XB7A 1OPJA 4Z7GA 4ZZOA 3LXLA 5CXHA 4YC6A 2X9EA 4QMXA 4HVIA 4CGAA 3EQGA 4ZK5A 3VUTA 5CEOA 2ZV2A 4F0IA 2XIZA 3R9OA 4IC8A 3UC4A 4RFYA 5AP5A 3FZRA 4IFCA 1ZZLA 3R21A 4MX9A 2XRWA 4GK4A 2Q83A 4O0XA 3KRLA 3SRVA 2XIRA 4IZAA 4TY1A 3AC8A 1MQ4A 1KWPA 2ZM4A 3REPA 4DAWA 3IOKA 3TZ7A 5JGBA 4ZLZA 1PKGA 3TT0A 2H6DA 3FY0A 5AWMA 3TCPA 2VWVA 4RBLA 5JN2A 4S30A 3LFAA 2C6EA 4I6FA 3UQGA 3CPCA 3UO6A 3ITZA 4K18A 3LE6A 1A9UA 2PE1A 3BGPA 3ZOSA 3JY9A 4BC6A 4KIOA 3ETAA 5CEIA 3BHHA 2B53A 3EH9A 2GQRA 1UNHA 3G0EA 4IM3A 3UQFA 3BBWA 4IAZA 3ZRMA 4CYJA 3RPRA 3WF9A 1ZOGA 2ITVA 4I94A 4BTFA 5EQEA 3RTPA 2WB8A 5AM7A 5I3OA 4XP2A 3U4WA 1YXTA 2QURA 4QYYA 4BIDA 4NWMA 3VUKA 2UVZA 2BDWA 3Q52A 4LRJA 4FGBA 3QBNA 3ZUVA 4NH1A 5IEYA 3DTCA 4CFVA 3CS9A 3DKCA 1IRKA 2NO3A 4U81A 4AS0A 4BDFA 1OECA 4C4JA 2C5OA 5IDPA 3SG8A 1PYEA 2PSQA 2YDJA 3QTXA 3FE3A 1WBWA 3DTWA 3HECA 3MPTA 3P9JA 1E9HA 5CU2A 3O71A 4PQNA 1SVEA 4ZZMA 3QZIA 4WD5A 4EQUA 3W2SA 4YUQA 4HNFA 4YZCA 2PUUA 5HCZA 4J71A 3WBLA 4BCJA 1ND4A 4UMPA 2WTWA 5E8XA 5ITAA 1OB3A 2FVDA 5DBXA 4X21A 4A06A 4UMUA 2QQ7A 5DFPA 3QZHA 4BICA 2BFYA 4MBJA 4X2GA 2EU9A 5CNNA 2QOIA 4I6HA 5JQ5A 3RHXA 5DVRA 3ZFYA 4ACMA 5AUTA 3R8PA 4OUCA 4RFZA 2WTCA 4AA4A 5IH6A 5I5ZA 2PUIA 2XKFA 3EKNA 4P4CA 3BCEA 2HWOA 5F95A 4B8LA 5AAGA 4RJ8A 3QKMA 2ZM3A 4WSQA 4FTUA 2RIOA 3BWJA 5FTQA 3CGOA 5IH5A 4BB4A 2XK9A 2WTKB 4OTGA 4FA2A 3QC9A 3QZFA 5CF8A 2W99B 3QF9A 4XV1A 5EW9A 5IEXA 2XNOA 5AV0A 3QX2A 1O6YA 3EFWA 4H05A 4MXOA 2UZVA 3NSZA 1PMVA 3ZXZA 1BYGA 4U3YA 4YJVA 4EKLA 1J7IA 4DF3A 4FV2A 3H9FA 3OUNB 2PMOX 3DAKA 3EFJA 4O91A 3ZDIA 4BVUA 5AA8A 3ID6C 1H26A 2GDOA 1TQPA 3K5VA 2JDRA 2PZPA 3QTZA 2YDIA 4U79A 2QLUA 2JIVA 4K33A 2HY0A 4BCNA 2RFDA 2CLQA 3EL8A 3LJ0A 4DINA 4FTJA 3B2WA 1H0VA 3UZTA 2W0JA 2XNMA 3AXWA 3ENHA 3VIDA 1OIRA 3SXFA 3QQFA 2X6DA 4KWPA 3W10A 2W4JA 5HE2A 1OPLA 3A4OX 4MVFA 3BHYA 3KRJA 4R7BA 5BVDA 3K5UA 2QR7A 2XBJA 4UZDA 5DNRA 3EN7A 4G16A 2BAKA 4UBAA 4HVGA 5IG1A 4X3FC 2BZKB 5J5TA 4O84A 2ZYBA 3RINA 2P3GX 2B52A 1W7HA 1YXUA 2WZJA 2UW4A 3A7HA 3OXZA 3I7CA 4IVDA 4IWDA 4DFNA 1Z57A 3OWPA 5FRIA 3KULB 3NYNA 4JBQA 4BI2A 2YIWA 1P2AA 3E8NA 1JKLA 4UMQA 2JBOA 4TWCA 2GQGA 2R3KA 3FLQA 5AIRA 3RPOA 2CKEA 4FIFA 3W2QA 1FQ1B 1QPDA 3P7CA 4MXCA 4QMPA 4M67A 4CKRA 2UZNA 4WRSA 3F9NA 3KMUA 5AMNA 2BKKA 2FO0A 4L8MA 4IAYA 4FTLA 2V0DA 3BWFA 5CF5A 5EQYA 2WMWA 4S31A 3TUCA 2RF9A 4FL1A 4MBLA 5D12A 1Q8TA 5ETFA 3ZC6A 5EDPA 5I4NA 2ERZE 3TV4A 4EH3A 5IQBA 4FSQA 1VJYA 4G3CA 5HVYA 4MK0A 4BBFA 1U54B 2I0HA 2VO3A 1GJOA 4K11A 5CVHA 4ANQA 1UKHA 4R5SA 4ANSA 4C58A 4DHFA 4IBMA 2X6EA 4DH1A 3SOCA 4BTJA 1KUTA 4FTQA 2JDTA 1EH4A 3W8LA 1ZMUA 4Z55A 1GZOA 5HICA 3BHUA 4BCMA 1XQZA 5EM8A 1P4FA 3DJ6A 4NZWB 4IJPA 5FLFA 3R7VA 4FL3A 2QG7A 4PMMA 2WO6A 2J0JA 3P23A 3CKXA 3BE9A 3MYGA 4JJRA 4FR4A 4EH7A 4J7BA 3RAHA 4C4GA 4GFMA 3UOLA 4JQEA 3RNYA 3NIZA 2BALA 5DEWA 4C2VA 2XVDA 4G6NA 2OH4A 5M4CA 4O7VA 2QOLA 4I1ZA 5HCXA 3DCVA 3EQIA 4ANNA 2VTPA 4RVTA 4A4OA 4BIBA 5CT7A 4KKEA 4JX3A 4MWHA 4ZLYA 2W1GA 2QD9A 3LM0A 3SGCA 3KKVA 4OBQA 1CM8A 4CQGA 2QO9A 5AP2A 3P7BA 3I79A 1SM2A 3OTUA 4ARKA 1UKIA 3FZ1A 3EJ1A 2JKOA 1YWNA 4CFUA 5FM2A 2JFMA 4L3PA 5EQPA 3LW0A 4DEHA 2ZJWA 2IZSA 3R8VA 1FVTA 1OBDA 4ZAUA 3EOCA 5FEQA 3UZRA 4WG5A 2R3HA 2YCRA 2YFXA 1GZ8A 4W9WA 1DI9A 5E4HA 2QOBA 5FDPA 2HXLA 2ZV9A 3H9OA 4AOIA 2XYNA 3QTIA 2PZ5A 3RM6A 5L2SA 2CJMA 3V5TA 3GNIB 4DBNA 4DH3A 1E1VA 3FC1X 3GC0A 5ANIA 3DBDA 3EQDA 3NW7A 4RC4A 5K5NA 3PPKA 3RKBA 4C4IA 1ZYLA 2FSOX 3JYAA 3RPVA 4BIEA 5EK7A 3SXSA 3E7VA 2VTQA 3PG1A 4W4WA 4JBPA 4KSPA 4W8DA 4XP0A 4E6CA 2XK4A 2G2IA 5FGKA 1UU7A 3ZUTA 5JFSA 5FEDA 4OR5A 2UZUE 5AX9A 4DC2A 1Q97A 4TYEA 4XLIA 3QCXA 5HG8A 5HKMA 3QHRA 4FC0A 3VBWA 3ORPA 2YLEA 4C37A 3SV0A 3KXHA 3DQXA 4HYIA 5C26A 4NCTA 2OBJA 3WF8A 3KQ7A 3LXPA 4CKJA 1GZKA 3FKOA 2OICA 4AX8A 2IO6A 2UVXA 1L8TA 2HWPA 2AYPA 3ZM9A 3QD2B 5HQ0A 4EOPA 2B55A 5DH3A 3RK9A 2C5VA 4FSMA 3TI1A 3QD0A 3ZZEA 5L2IA 3E62A 2ZAZA 3GC9A 2XKDA 4JDKA 4BDGA 4XBUA 5IQFA 3D7TA 5KMLA 1G8AA 4CV9A 3LCKA 4U8ZA 4FKIA 3A61A 3V5QA 4JQ8A 5J79A 4FNZA 3CD3A 2YJSA 4FVRA 3DY7A 2XK8A 5DLSA 2BTSA 2CN5A 3CP9A 4CSVA 1IA8A 4XOYA 4BR3A 4G9RA 3DAEA 3LCTA 2PYWA 4AGWA 2JEDA 3QWKA 2CHLA 4PMPA 2B9IA 3RK7A 4TYHA 4KKHA 3P0MA 4G6OA 5CYIA 4YTFA 3BRBA 3GU6A 4J8NA 5JGAA 3A7GA 3N51A 4PNKA 2F2CB 4V0GB 1F3MC 2ITZA 4ZY6A 4BKJA 3FMNA 3NGAA 5EH0A 3HP2A 2G9XA 4LL5A 2XEZA 5LCKA 3PXZA 2O0UA 4C3RA 5CEKA 2VTAA 4FIEA 3L9LA 1PXNA 2XKEA 4F7JA 2OU7A 3C4CA 3H10A 3HV3A 4P90A 3FPQA 2B9HA 3LHJA 4PP7A 2CPKE 2R3JA 5HBEA 1BX6A 1Y8GA 3AMYA 3DAJA 1RW8A 3V3VA 3GU4A 4PL3A 4M69A 3NNUA 4YTIA 3GB2A 2C47A 2HELA 1XKKA 5JFWA 1Y57A 5J9ZA 3DXPA 3R2YA 4UEUA 4EEVA 4NK9A 4E3CA 3W2RA 5E92A 4HCVA 4RWKA 5HE1A 1Q3DA 1VZOA 3LXKA 4HGLA 2FSLX 4PX6A 4O21A 4ZEGA 3A99A 4FYNA 4HPUE 5E1EA 5L2WA 4ACDA 2OXDA 1KOBA 3HLLA 5A4CA 1PYXA 4IZYA 4IB5A 1V0PA 1QPJA 2E2BA 2UW8A 2XIKA 2Z60A 4O0RA 4O0UA 5LVNA 4MKCA 5C4LA 3W2CA 5B2LA 3QCSA 5IKWA 4O96A 4Y83A 4MD9E 2ITUA 1T46A 4QP2A 2X0GA 2A4LA 3PSDA 5JZJA 2XM8A 4N6ZA 4ACGA 4USFA 2IVVA 1W98A 4HGSA 3MH2A 2OSCA 3PYYA 4AACA 3R9HA 1H0WA 3PFQA 5GJDA 4DTAA 2YJRA 3UBDA 3Q4UA 4XG2A 4E4XA 3ZDUA 3A7FA 2IVUA 3MTFA 3RHKA 3F5UA 1PHKA 2W1ZA 3G90X 3ZBFA 4CRLA 5B0XA 3OT8A 4QTCA 3QA8A 1BI7A 2E9PA 3LFSA 2E9VA 3V6SA 3IO7A 2YM5A 4OGRA 3GQLA 4IACA 3OCBA 2BR1A 4R3CA 3PXFA 3GC8A 5D7AA 4YHTA 4CTCA 1PXPA 4MEDA 2XJ1A 1XH6A 4G31A 4CFXA 4QYFA 4ZMEA 1JLUE 4L43A 2J2IB 3FL4A 1NY3A 5B2KA 3L9PA 3F88A 2H96A 3OW3A 5HD4A 3LCDA 3I4BA 3E3BX 5M53A 1XO2B 4NYEA 3AMBA 3EB0A 2QG5A 5LVOA 4IFGA 3KFAA 1F0QA 4FV1A 1U5RA 2VWWA 3KRRA 4LUEA 2WTKC 1GIIA 3ANQA 3HMNA 1ZMWA 3FLSA 5AP1A 5KMOA 5L2TA 3FC2A 5BMMA 4TZRA 3NW5A 5FXSA 4BCFA 4BI0A 2Y7JA 3CKWA 4QP6A 4UMTA 4IVAA 5M56A 4FTRA 3VUIA 4DGNA 4IAKA 4ZIMA 4J97A 2ZDUA 4ZZNA 2R9SA 4P7EA 1BUHA 4DG0E 4H1MA 3COIA 2VTSA 5EOLA 4C02A 4CG9A 4HGTA 3NPCA 5TF9A 3O17A 4S33A 3SD0A 3KMWA 1OGUA 1XBCA 3PWDA 4KIKB 1NVRA 4FNXA 2DYLA 2R3NA 4ZJJA 5K0KA 1GNGA 3PG3A 2VGOA 3TDWA 3CQUA 4A4XA 3RWPA 4B9DA 4FUYA 3D2IA 3MJ2A 3DQWA 1P4OA 5AUXA 4DTKA 5GHVA 4OBOA 3RNIA 3OCTA 5HIBA 3ZH8A 3DU8A 3ZM4A 2FH9A 5LMAA 4FE2A 4V05A 5DMZA 1GY3A 4K1BA 3FI4A 2UUEA 4C33A 2XCKA 2YCFA 3JPVA 4FKSA 4JS8A 1OKVA 2F9GA 3FXXA 3HGKA 3F2RA 2J50A 4RVLA 4BDKA 3QRUA 4R77A 4B6LA 4B99A 2CMWA 3DK6A 3U54A 2OZAB 3BHVA 3ZHPC 3IDCA 3AC5A 2OJIA 4L6QA 4NKAA 4QQ5A 3QXOA 2Y6MA 1H07A 3DV3A 3NUUA 4JT3A 4L45A 4LRKA 3AQVA 1O9UA 2ZMDA 4IWQA 3AC4A 3ACKA 3LCOA 4W8EA 3TEIA 5AUVA 2UZTA 3V5JA 2G2FA 3VBTA 1V0BA 3GCVA 4P5ZA 4BWKA 3MTLA 4KUJA 4EZ5A 3JY0A 3P7AA 3FMEA 2XBAA 5KZ0A 2QO2A 5E8YA 3VRZA 3EMGA 5AR4A 5LVMA 3R7UA 4OTDA 4MD8E 4I5PA 5CXZA 1Y6BA 1V0OA 1URCA 3CGFA 3EQPA 4NIFA 3BZ3A 3O96A 3DXNA 3UIMA 2W4KA 2F7EE 5FXQA 3O7LD 3TNQB 3DZQA 3FQEA 3OC1A 4R5YA 3DT1A 5KMMA 2WHBA 4IIRA 3C0HA 5IQIA 5CU0A 4KAOA 4TWOA 3K3JA 5JK3A 1QCFA 4FTOA 1LR4A 2PPQA 2C6DA 3R00A 3QX4A 1R78A 4PPAA 4QP3A 5JFXA 3ZXTA 2YIRA 4FTTA 5DYJA 4GVJA 3KVWA 4YJQA 5L4QA 4AN3A 1OBGA 4DG2E 2R7BA 3TV7A 1H1PA 4N70A 5DT3A 2G15A 3B2TA 4C36A 1OKZA 1F5QA 5I9UA 4FMQA 4C57A 5L8JA 3TACA 4ZSAA 3A62A 3BQRA 3TNWA 3CR0A 5IQCA 2WU6A 3F5XA 3II5A 3VUMA 3IW7A 3VS1A 3W32A 3WE8A 4E1ZA 2C5XA 3OT3A 4CT2A 4F70A 5IMXA 1WCCA 5IQAA 3NWWA 3PJ2A 4JG7A 2XYUA 4I20A 4S32A 3LQ5A 1IAHA 5J5SA 4K0YA 3U51A 1Q8ZA 3S3IA 2XRUA 1OKYA 2B9JA 3C0IA 4HCTA 4LFIA 3WI6A 5AP0A 3WZUA 4BCOA 5I9YA 4EBVA 4YMJA 3VQUA 3OW4A 2BDJA 5CQWA 2B1PA 2VNYA 3MY5A 2W1IA 3PP1A 3LLTA 2JIIA 5ANOA 3QWJA 4J53A 2DS1A 5CNOA 5EHLA 2PE2A 3PRIA 1YDTE 4APCA 3KCKA 5A46A 3GOPA 5BYYA 1YHSA 2RFSA 1ZY4A 4GIHA 2YZLA 3MPAA 3R28A 4DFYA 1WZYA 4F0GA 5CTPA 3W18A 1LUFA 3ORNA 2VO7A 3QUEA 4C59A 4A9TA 4KNBA 3R8UA 3TJDA 4G3EA 4O6LA 4LMUA 3ZO1A 3FLWA 3TUBA 3SG9A 5DPVA 2GS6A 5HG5A 2XJ0A 4IX4A 3WOWA 3BGZA 3IECA 3GVUA 4BDAA 4EHZA 2CKQA 4QQCA 4EH8A 4PDPA 4AXAA 5HI2A 3WILA 3HMMA 3PRFA 4GVAA 5HX6A 4ZTRA 4FT3A 3TNHA 5AV3A 5DGZA 4D1XA 2NRYA 1YQJA 2AC3A 4QMYA 2F2UA 5J7BA 2YWPA 4F08A 1SMHA 2HAKA 3L8PA 4JDJA 4YO4A 4RT7A 5HO7A 4IZ5A 5EM6A 3WZJA 2WTDA 5CQUA 2CGXA 2OKRA 1DAYA 4FKUA 4I0RA 1QMZA 3LM5A 2OG8A 4FZDB 4EOMA 1IG1A 3P1AA 3R7EA 3FDNA 3SX9A 3QFVA 4TW9A 4E6QA 4KD1A 4ITHA 4X3JA 3FMJA 3R2BA 2OJGA 3G5DA 4YJSA 3BBTB 1LPUA 5C9CA 4NW6A 3KC3A 5L6WL 4IEBA 4RIYB 4FEWA 2PVMA 4CMOA 4BDHA 2JIUA 2ZVAA 5DI1A 5DHJA 5EOBA 3WZKA 4F64A 3L9NA 4FKWA 1ZXEA 4TYIA 3AT3A 3RAWA 5JRQA 4FKOA 3UIBA 2PVYA 1CTPE 4PL5A 1BMKA 2QKRA 4I0SA 4XRLA 3VN9A 4F9WA 4Q9ZA 2WIPA 5HNGA 4DFZE 4ZTMA 1Q3WA 2WOUA 5ANJA 1S9JA 2GPHA 3ORLA 3ZS5A 4AW1A 4F9CA 5A6NA 3FZOA 3JVRA 5JZNA 5JSMA 1LEWA 1VEBA 4O0YA 4G2FA 4XH6A 3UVQA 1VYWA 2W9ZB 5HZNA 3S0OA 4ORKA 4II5A 3UODA 3QUPA 1TQMA 4FIHA 1OIUA 4O2PA 5CVGA 1PRYA 2X2KA 3IDPA 3LFFA 3MW1A 4AG8A 2O8YA 1MUOA 4OTRA 5AR8A 4ITJA 3U4UA 4GG7A 4I4EA 4F09A 2F7ZE 4YTHA 5T68A 3UVRA 1ZWSA 4DGGA 3ATTA 3LMHA 2WMRA 3DFAA 2P2HA 3C13A 2HW7A 4O7ZA 3GGFA 1OITA 4FTIA 5IQHA 4LGHA 3GFEA 4G5PA 1IR3A 3R6XA 4EZ7A 1FOTA 4DTBA 1YOJA 3HV6A 4OAUC 2F7XE 3C4WA 4J52A 3D5XA 4R6VA 2C6MA 5F1ZA 3VNTA 3R7GA 4FSYA 2X8EA 3MY0A 4RX8A 3FSKA 2W17A 5CLPA 3MIYA 5CS6A 4W9XA 5BVFA 3L1SA 2IVTA 4HZSA 1H24A 2VN9A 3NNVA 3R1SA 3CIKA 2EXEA 4AZFA 2LAVA 3THBA 2ZB1A 5ACKA 3BEAA 2XCHA 3LZBA 1FBNA 3D83A 3EZRA 4I24A 1Y91A 4RRVA 4EOQA 2OZOA 3DGKA 1J3HA 1VYZA 2JKQA 5HBHA 1BI8A 4WG4A 5IZFA 4ZSGA 3EFKA 3V6RA 4A9RA 4QOXA 3OWJA 5KO1A 3O8PA 4E7WA 3FI3A 4TNBA 5CVFA 2A27A 3UNJA 4DCEA 5EKNA 5ETCA 5BUIA 3QU0A 2HK5A 1WMKA 1YXVA 5A3XA 4FV0A 4XG8A 3PIYA 5AM6A 3WARA 1OL6A 1Q5KA 2JDSA 3NMUF 2AC5A 2UW0A 4EK8A 4RIXA 4FL2A 5EI6A 2YA9A 2HCKA 3CEKA 3LFBA 1GAGA 3DOGA 2GNJA 1B6CB 3QTSA 4TN6A 4XLVA 3KXZA 4Z9LA 5CANA 3I7BA 3T8OA 4OTHA 4FG8A 5M44A 2GFCA 3CE3A 4QYEA 4EC8A 2Y4IB 1ZY5A 3UOJA 3FMKA 1M52A 3F66A 3VC4A 4FK3A 3QYWA 2QHNA 3DBEA 4LV5A 4NFNA 4FSWA 4MTAA 3U9NA 4C3FA 1MRUA 4QPAA 4BBMA 3PPJA 3R7YA 4GG5A 3O51A 3A2CA 4QMVA 2WAJA 4MCVA 5M4UA 4YHFA 5L6OA 3OD6X 3QQJA 4NM5A 1ERKA 5JKGA 2VTJA 3F3WA 4AE9A 4RJ4A 3OOGA 4EC9A 4QO9A 3R30A 2FYSA 3ULIA 3QLGA 3ZEWA 4CEGA 1PY5A 4OT6A 5H8EA 1Q8WA 4B8MA 2J51A 5GZAA 4BGQA 1O6LA 5TE0A 4DH5A 1YI4A 4KB8A 4FYOA 1J1BA 5AR5A 2CCHA 5FTOA 4IX5A 3UNKA 3IK3A 2RG6A 2QOKA 4BDDA 3GU8A 2R3QA 5EYMA 4NFMA 1FMKA 3MJ1A 5TT7A 2PVNA 3ZO4A 3D15A 2HZ0A 3AMAA 1YI3A 3G33A 5J1WA 1BLXA 4F9BA 2XF0A 3A7JA 3MA6A 4X2KA 2WMSA 4BWPA 2IG7A 3M42A 3OVVA 4JRNA 5L8KA 4I93A 3FMLA 4D4VA 4LRMA 3UP7A 4L7SA 3QA0A 3S2PA 2VWBA 3OG7A 2VAGA 3IS5A 2X7OA 2LGCA 3VBXA 5J1VA 3DLZA 4WNOA 3VBQA 2C0TA 1OPKA 3BYUA 4QQTA 5BPYA 4ERWA 1H8FA 1APME 4GT3A 2VGPA 4ZS0A 2YIYA 4D2VA 3IW4A 1JVPP 4QP1A 1Q61A 3HAMA 1OM1A 5J8IA 3O8TA 5CASA 3PVGA 1GOLA 2ACXA 3IGGA 3P86A 3MBLA 2GNFA 2Z7SA 3PE1A 3LFDA 3LAUA 4I4FA 5ANGA 4D0WA 2ZM1A 4GYIA 4D2SA 2YACA 1OI9A 3AC3A 3KL8A 3QCQA 3NUYA 5AV1A 2ETRA 3ALNA 3BLRA 3SRVB 5I9WA 1YXSA 2PULA 3R0TA 3W16A 5AAEA 5FWKK 3GI3A 2KULA 3L8VA 3MFSA 1M17A 2R3FA 4MD7E 5HNBA 3SC1A 3TTIA 2WMTA 1G3NA 2J7TA 1Q8UA 4TL0A 3LQ8A 3IG7A 3BELA 5TR6A 2BTRA 3NIEA 2XIYA 2OFVA 4DFUA 5EG3A 3ZYAA 2YN8A 5LMKA 2XNNA 3QCYA 4GT5A 3AT2A 5IA0A 3VJOA 2GTMA 4E20A 5EI2A 1IEPA 3SXRA 3NCGA 5IQGA 4IJ9A 4QTAA 4F99A 3COKA 2VUWA 3EZVA 5A54A 1J7LA 4YSMA 2WXVA 3TNPC 5HE0A 2OF4A 3FMDA 4ANMA 4GCJA 1XH9A 2C3LA 4YZNA 4CG8A 4JAJA 5E1SA 1PMNA 1E1XA 3GFWA 3KXMA 4IAAA 3GCSA 1YOLA 4EWQA 4RX9A 2W1EA 1J7UA 2QONA 5FEEA 2W5HA 3PVWA 3QTQA 4DLIA 2WELA 4BZOA 2RGPA 4JNWA 4PDSA 5HG9A 3CXWA 1QL6A 4JG8A 2WTJA 4DGLC 1RE8A 3R8MA 4QTBA 5HE3A 4R7HA 4UX9A 2WEVA 4O7TA 1JNKA 2UW3A 3PIZA 3SDJA 5H8BA 3T3VA 3ZCLA 4C35A 4QQJA 2J6MA 4CFFA 3UG1A 4E26A 2BAJA 1M14A 4OTPA 4H58A 2BRMA 3OROA 4HW7A 3CTQA 3LCSA 1PXOA 4PTEA 3UO4A 3OBGA 2RSVA 4FG9A 4O2ZA 4U45A 3PWYA 4ERKA 1OIYA 5BX0A 5HLWA 3A60A 5L2QA 3MFRA 3MV5A 4DFLA 3ORKA 4FZ6A 2PVHA 3GU7A 4RSSA 5F20A 3BIZA 4DG3E 4PTCA 3NUAA 4DFBA 3F3ZA 1W0XC 3ODZX 4A9UA 4RJ5A 3W2PA 3PXRA 4MAOA 3GXLA 3EN6A 2GCDA 2OIDA 4V01A 3RVGA 3UOKA 5DG5A 2IW9A 3L8SA 4QMLA 2Z02A 2VWUA 1YXXA 2H34A 4K2RA 4U41A 4JOAA 5AAFA 5DIAA 2C3JA 5FQDC 1BKXA 2IZRA 2W9FB 3OXTA 4JQ7A 4FGRA 4RX7A 2HENA 3RZFA 2BFXA 2XS0A 4J95A 5AIKA 4AWIA 5FBOA 4Z7HA 4GJ3A 4YBKA 3PE2A 3RZBA 5C8KA 3FYJX 4AOTA 2VTLA 3LFEA 2P0CA 4QYGA 2UZEA 4YHJA 1RDQE 5HEZA 4BDBA 4BKZA 5CAOA 3HMPA 3PDTA 4D9UA 4O81A 3ZBXA 4F1OA 5LVLA 3EQBA 2Y6OA 2HZIA 4AZWA 3KVXA 4ASZA 4F63A 4UB7A 4FKLA 3FMMA 4WSYA 1STCE 3RWQA 4CMUA 2PVFA 4L52A 2PE0A 2XJ2A 3VBVA 2HOGA 3HA6A 4D2RA 1NXKA 3SLSA 1LP4A 2PMNX 3A7IA 3R1QA 5BVEA 2BVAA 5GIOE 3CPBA 4EOOA 3TZ9A 4RQVA 2BRNA 3ORMA 5CZIA 1PXJA 5D1JA 5I0BA 2XEYA 2CGWA 3V8SA 4HVSA 4EK6A 4X2FA 2ERKA 2XMYA 2E9OA 3Q32A
chains in the Genus database with same CATH superfamily
3AGLA 3I0QA 5BYLA 4KA3A 2C69A 3C5UA 2BZIB 3OCGA 2YABA 4RLKA 4WNKA 3ZLWA 4C8BA 4QP7A 1U5QA 3R8ZA 2WFYA 2OO8X 1GZNA 5BYZA 5GZ8A 1XWSA 5C8NA 2CN8A 3D5VA 1UU8A 4L46A 4OTIA 3BI6A 2WIHA 5K0XA 5KKRB 5LARA 4CFWA 5BMSA 3T9TA 1P5EA 2BAQA 3DJ7A 3BQCA 2ITPA 3CJGA 2P55A 3FI2A 3HNGA 1U59A 5EDQA 4Z16A 3NFGB 3BYOA 3L9MA 5HGIA 2YWVA 4E4NA 3ZFXA 5BQ0A 1OIQA 4NSTA 3ULZA 3PLAE 2I0YA 2W1HA 2BDFA 4FSZA 1U4DA 4MWIA 2XM9A 3P79A 4NU1A 4NUSA 4W4VA 5K9IA 4V04A 4IB1A 3KIOC 1KE8A 4GFGA 4NKSA 3O7LB 5C8MA 4TT7A 4MNEA 2OI4X 4XG6A 2CCIA 4AZSA 3LPBA 1PJKA 4NTTA 3WF5A 2VX1A 3WE4A 3COMA 4Y85A 3BE2A 4OTQA 4WBBB 2H8HA 5HU3A 5M57A 3W0QA 4O82A 4WKQA 5CAPA 2OF2A 2IVSA 2W5AA 4UV0A 4U5JA 2QU5A 2X4ZA 2RL5A 4ZTNA 1K9AA 4CLJA 1XBAA 2WEIA 2J0KA 3BHTA 4LOQA 4Q9SA 3Q6WA 4LYNA 3VW6A 1Y8YA 3UMXA 3VULA 4M84A 2NPQA 2CNVA 3DZOA 3BKBA 3V8WA 5JMSA 2VX3A 3PVUA 4AUAA 3MESA 3RI1A 3KK9A 3PP0A 1JBPE 3U6HA 4G5JA 4IVBA 1B38A 2XK7A 3GP0A 4BN1A 3CJFA 3W33A 4TPTA 3R22A 4IVCA 3VJNA 3IOPA 4AGCA 1WBOA 4ENXA 3UQCA 1RQQA 4JAIA 3EN5A 5D41A 4GFOA 5A4LA 3FZTA 4OTFA 5DWRA 4RWJA 2PZYA 1RJBA 4D4YA 4ZTLA 4G1WA 3CC6A 3PJCA 4CVAA 3DFCB 4D1ZA 1SVGA 3BLQA 3TNIA 3EFLA 5IA2A 3LFQA 5D11A 2Y4IC 2I6LA 5CF4A 3R7OA 4FTMA 3D5WA 2XNGA 1DAWA 2UZOA 3SW4A 3UIXA 2ITTA 3ZONA 3KREA 1PW2A 4O7WA 4AP7A 4D5HA 4QPSA 2PMIA 5HIEA 4FF8A 4MHAA 3A8XA 3OBJA 4AZEA 4OBPA 2GHMA 2PUPA 2YAAA 1QPEA 3QLFA 2ETKA 4ZTQA 3PA4A 3BV3A 3P5KA 2J5FA 2QHMA 4JR3A 4RIWB 3FAAA 2ITWA 4FI1A 3F2NA 3F6XA 4KS8A 2J0IA 4PMTA 1SYKA 1XMLA 4LV7A 2Z8CA 4PY1A 3ZC5A 5DOSA 4YSJA 1XJDA 4YNEA 2IPXA 4H3PA 5HO8A 4D2TA 2ONLC 2J0LA 1FGIA 2VWXA 5E8WA 5JRSA 4RPVA 1W8CA 3ROCA 4F9AA 3D7TB 4MQ2A 2WU7A 3ANRA 3H4JA 3F3VA 5H3QA 4W4XA 1H28A 2PK9A 3GCPA 2IWIA 3CQWA 4U97A 5EM5A 4H3BA 2QC6A 4D1SA 4FT5A 4X3FA 4QDEA 2WMQA 4WG3A 2XH5A 5M06A 4FV7A 2QKWB 5HTCA 4CZUA 3E87A 5HLNA 5M55A 1JPAA 4G9CA 3DK3A 3AD6A 3WYXA 2OXXA 2R3MA 1AD5A 4XG7A 5AJQA 5EYCA 3OFMA 3RMFA 5D7VA 4BCKA 4Y5HA 3F7WA 4EZ3A 4QTEA 2GNLA 4E6AA 4JG6A 2DUVA 2JGZA 2P2IA 1J1CA 4L00A 2G1TA 4DA5A 2YEXA 3ODYX 3K3IA 5FP6A 4F1MA 3O5AA 2BILB 4QMQA 3UDSA 2X7FA 4QMTA 3RCDA 3M2WA 3ENMA 5TOZA 4F78A 1H1SA 4DHJA 3TDVA 3EQRA 3HVCA 4M69B 5KMNA 4PDYA 4UXLA 5C1QB 3TG1A 4BI1A 3R71A 4YO6A 4YP8A 4GUEA 3V5LA 5AUYA 1NVQA 3MVMA 2VTHA 1YDSE 2ITNA 4LM5A 4UWBA 1WVYA 1WVXA 2OJ9A 1TQIA 4KRCA 4QMZA 2YISA 4AA0A 3TMOA 1FPUA 3QKKA 2BUJA 2OWBA 3R02A 4D5KA 4M68A 3RPSA 3FYKX 1OL7A 4RMZA 3Q3BA 1DI8A 3DNEA 3GOKA 2RKUA 5BVOA 3WZEA 4GKIA 4GKHA 2Q0BA 3KGAA 4FRFA 3Q4CA 4ONAA 4ALVA 2UZDA 1FINA 2C3KA 3DPKA 3K2LA 4WRGA 2J5EA 2GQSA 2C1AA 4JDIA 1WVWA 4IC7A 4FICA 4BZDA 3NDMA 1OVEA 1YHVA 4IB0A 5M4IA 3RM7A 3FLNC 5BNJA 2UZWE 3Q53A 4ACCA 3BPRA 4USDA 3C51A 3G9LX 4MXAA 4O22A 1W83A 2R5TA 4JBVA 4ZLOA 3R9DA 4F1TA 3NYOA 4U3ZA 2JITA 4AW0A 4F7SA 3P08A 3HV7A 3DNDA 4FVPA 3ZSHA 5GIPE 1URWA 3MSSA 3GU5A 3GC7A 1G8SA 2FA2A 3M11A 4LQMA 1GIJA 3NNXA 3OP5A 3EQFA 4F7LA 4I6BA 2GFSA 5BVKA 5IMEA 3EN9A 4H36A 2PHKA 4M12A 1G5SA 4DHIB 4IH8A 3VS7A 3I0OA 2A0CX 3F5PA 2IW8A 5HVJA 4F6SA 3E88A 3JVSA 3GQIA 1PXIA 3NZ0A 4NW5A 2GHGA 4AGDA 3PJ3A 1KV1A 2R0IA 3H0YA 1DM2A 3QHWA 4JL9A 2JDVA 3JXWA 4R3PA 1ST0A 2QNJA 3FXZA 4EK4A 5F94A 2JKKA 2X0PA 2IN6A 4I5HA 4TWPA 2C6OA 3PZEA 4C61A 3LKMA 2Q0NA 4KKGA 3EN4A 2ZB0A 5I9XA 1OUYA 1XR1A 4ASDA 2I40A 4DITA 2P4IA 4EOJA 2HZNA 4XHKB 2E9NA 4ACHA 4C4HA 3OCSA 4NEUA 2VNWA 4U9AA 3DBQA 3HYHA 5HVKA 2YM8A 3KEXA 5IUGA 3KRWA 1KE7A 4JRVA 4RG0A 3QD3A 4YC8A 3G0FA 5CSXA 3RP9A 2C5YA 2JDOA 3ATSA 2GHLA 4FSTA 4EOIA 1XMMA 3EYGA 4GUBA 3OWLA 3POOA 3ZRLA 5FD2A 4WUAA 3TZ8A 3LQ3A 4OLIA 5M08A 2ZMCA 4M8TA 2GS7A 4O4EA 3ALOA 4JIKA 3D5UA 5DT0A 1Q99A 5LJJA 3B8RA 2WMUA 4UY9A 4GK2A 4FSUA 3OEZA 4WUNA 4ENYA 4U6RA 1YWVA 1UV5A 4JLCA 4Y8DA 3ZUUA 3FI8A 3MIAA 3LJ2A 1IA9A 3TM0A 4EH9A 4IE9A 4EHEA 3U55A 2YM6A 3N9XA 4RIOA 4FV9A 3BU3A 4ID7A 4QNYA 4FVQA 2GU8A 4MXYA 3E3PA 4IX3A 2B9FA 5HORA 4CMTA 3EL7A 3AD5A 4F4PA 3MFUA 4ASXA 1WBNA 1OGYA 3V04A 1WBPA 3NAYA 3PLSA 1PF8A 1W2FA 4ZXTA 2C6TA 3F2AA 3NUNA 4EBWA 1NA7A 3PJ8A 5EHYA 2QU6A 4GIIA 3SQQA 2F49A 1VR2A 2G2HA 3VW8A 2BZJA 2I0VA 3L8XA 4FT0A 5K4JA 1FGKA 2BIKB 2VWYA 5KKRC 2YZAA 2O2UA 4RC3A 2BMCA 1ZARA 1JQHA 2AQXA 5FUTA 3HMIA 4DYMA 4F65A 3RBWA 4D0XA 5EI8A 3M1SA 2QOHA 3TZMA 3SW7A 4J98A 1PMEA 1BL6A 4M15A 4KBKA 4EOKA 1H25A 2PU8A 1YWRA 2R3PA 2OJJA 1MP8A 3SVVA 1CKIA 4BWXA 1UU9A 3FV8A 1M7QA 5EHOA 2F57A 2WTVA 4E5BA 4EKKA 2B4SB 4GJ2A 3FMHA 2OGVA 2I0EA 4AN9A 4C4FA 3CSVA 5HNIX 3HRCA 3VHKA 4EYJA 3BYMA 3EKKA 2GNGA 4YJUA 3R63A 2VTIA 4G6LA 1XBBA 2PY3A 2BIYA 3S1HA 4GL9A 4AT5A 1YOMA 5L8LA 3HKOA 4AAYA 4FBXA 3FLYA 2C6KA 5A4EA 3E8CA 3KCFA 4A4LA 1KE9A 4XV3A 4G3GA 2W5BA 4XRJA 4GRBA 3MH1A 2ITOA 4AOJA 4F7NA 5LWMA 3GCQA 4NJ3A 3AT4A 4ZJIA 3R1YA 2X7GA 3IQ7A 4O7YA 4I6QA 4PRJA 3EYHA 3IPHA 4FG7A 3S4QA 3TKHA 1XHAA 2ITXA 3P4KA 4IB3A 4O1OA 5FXRA 3VS3A 4IHPA 4FEVA 4C7TA 3ZZWA 4AAAA 3I5ZA 5JEBA 3TXOA 3TIYA 5KCVA 3ZLYA 1KV2A 5CU4A 4FV3A 5BUEA 4E4LA 4EOLA 3SAYA 3NYVA 3OMVA 1NW1A 2WMXA 3R83A 1AGWA 1YRPA 3RAKA 2JKMA 5I9ZA 3ERKA 5AP7A 4L01A 3N4VA 4O4BB 2HYYA 2V22A 1UWHA 1JKTA 3E8DA 3VS0A 4FIGA 2ONLA 3S95A 5AP6A 3E5AA 2UW6A 2YM3A 3VF8A 3UTOA 2QODA 4FOBA 4Q5HA 4R1YA 5CSWA 3HUBA 4D9TA 2R0UA 4AE6A 4DEDA 4QP8A 2VZ6A 5AP4A 2OLCA 4O7NA 4K8AA 3OUKA 5DR2A 4CLIA 1ZOHA 1ZYJA 2XP2A 4HNIA 5M07A 5CSPA 3KF7A 4CXAA 2CNQA 2R64A 2O64A 4A9YA 3IW8A 4H1JA 1I44A 3Q9YA 4NCTC 4XS2A 4E5WA 3PA3A 4EH2A 3PSBA 2GTNA 4HVDA 4MYGA 3KRXA 4MQ1A 3BL7A 4H39A 3UPZA 1QPCA 3MVJA 4QMNA 5CF6A 2C1BA 4EK3A 4IDVA 1ZOEA 2HY81 4Y73A 5KHWA 4X6QC 4NM0A 2O63A 2Y0AA 2VO6A 4B7TA 4WNPA 3BYSA 3FXWA 2WD1A 4QMSA 5AEPA 2OFUA 2DQ7X 4N4SA 3PY3A 3FL5A 2ESMA 4Y72A 3E7OA 3MH3A 4Q5EA 3AOXA 2AEGA 1WBSA 2WMVA 3NVKI 4RC2A 4XV9A 3HAVA 3QGWA 3LOKA 2WGJA 4Y5QA 2PL0A 4YNOA 4A07A 1DS5A 5J9YA 1K3AA 3KULA 4ITIA 1UU3A 2WQOA 4IWPA 5GJFA 3IW6A 5I9VA 3G9NA 4EONA 5T3QA 4EI4A 5IH4A 2F4JA 3BGQA 4FEUA 3UDZA 1ATPE 2YITA 4FV4A 2YAKA 5A4TA 4CQEA 5EKOA 4PF4A 2C0OA 4I92A 3AC1A 3OY3A 4IQ6A 4PTGA 4XCUA 4OT5A 3BX5A 3R73A 4FTNA 3D4QA 5HTBA 3WF7A 1Q4LA 3H9RA 4FODA 2XZSA 2GMXA 2C6IA 4YBJA 2BRGA 4P2KA 4ALUA 3QQGA 1U54A 4F0FA 4XG3A 4XX9A 4XBRA 4CCBA 3D9VA 5HTIA 1H1RA 2CKPA 4QD6A 4E5AX 1I09A 2X9FA 3Q2MA 1CKPA 5CT0A 3VUDA 1YVJA 2CGVA 3C1XA 4W4YA 4UYNA 3QQKA 5KBQA 3C4ZA 3HUCA 3NCZA 4FKQA 4J99A 4EQCA 1W82A 2BRHA 2W1CA 5JFVA 1PMUA 3KMMA 2R3OA 4AN2A 3FY2A 5E90A 2OK1A 1SZMA 4FTAA 3FSFA 4UWYA 4U7ZA 3PY0A 1TVOA 2C30A 3E8EA 3I1AA 4NM7A 3LMIA 1L3RE 4RWIA 3IGOA 4LUDA 2QR8A 4ZMFA 2CKOA 5E8VA 1H1QA 2VX0A 4K9YA 3Q96A 4QP9A 2VO0A 3LFCA 4GU9A 4XEYA 3TKUA 3FJQE 4KINA 4M14A 3TIZA 5ETAA 5BUJA 4BGHA 3QC4A 5AP3A 1UNGA 2C3IB 2O65A 2G01A 3CBLA 4IXPA 4RZWA 4XP3A 4BKYA 3NVMB 5GNKA 5JH6A 4YLJA 1IAJA 4BBEA 3OZ6A 4PNIA 3VS2A 4ASEA 3NUPA 3ZFMA 4JBOA 4BZNA 4GS6A 4MXZA 4A7CA 5JQ8A 2ITQA 4TYJA 3SKCA 2R7IA 4FSRA 1W2DA 2VD5A 3QZGA 1Q62A 4BDEA 1Q8YA 3F7ZA 4UN0C 3H3CA 4XMOA 1OUKA 3EQHA 4R1VA 4Z3VA 4E6DA 4LI5A 1J91A 2YHVA 2YCSA 3I6WA 4I3ZA 4IDTA 4FKTA 1NVSA 4RIXB 5LOHA 4RWLA 4EHVA 2PZIA 5CAVA 4MF0A 4M0ZA 3WIKA 3AKLA 3JUHA 5K4IA 2NNWB 5E8ZA 3NLBA 1ZLTA 3BU5A 2IW6A 3ACJA 4M97A 5CY3A 3CCNA 1HCKA 1R3CA 4NL0A 3HZTA 3RJCA 2ZOQA 4YC3A 4MXXA 4X6RA 3HV5A 5L3AA 4RJ3A 4JI9A 2EUFB 5EYDA 3Q4ZA 4DEIA 3HRFA 2VTRA 5E8SA 1JSTA 2UW9A 4S34A 3FKLA 5CALA 2VU3A 4RJ6A 3TKIA 3GBZA 1JOWB 4HOKA 2XNPA 3HV4A 2R3LA 2YIQA 4IAIA 4D4RA 5IPJA 4RZVA 1OL2A 4WA9A 3QTRA 3UO5A 4BHNA 2VV9A 2W06A 3UOHA 2C68A 3ZSIA 3HA8A 1GIHA 1ZZ2A 4EL9A 4MH7A 2A2AA 3K54A 3AKJA 5DEYA 5AUZA 5LVPA 4C3PA 4J96A 5DT4A 4N6YA 4QMWA 3ZO3A 1JSVA 4YPSA 2I1MA 2PVRA 3NX8A 4QTDA 2ZV8A 4IMYA 2C5NA 5ANKA 4AGUA 5B2MA 5J95A 3DKFA 1REKA 4O86A 4CZTA 4YZMA 1YDRE 5H8GA 3WZDA 4XNEA 2E9UA 4DE4A 1O6KA 1OL1A 1ZYDA 2JD5A 4KBCA 3DKOA 3PZHA 4M0YA 3RALA 4JXFA 4FT9A 4DDGA 5C4KA 3T9IA 4ZTHA 4E8AA 3HDMA 4O4DA 4QP4A 1JAMA 1JKSA 2X2LA 4TKSA 4RJ7A 4Y95A 5C01A 2QOOA 2CDZA 4RA5A 2V7OA 4WO5A 5KE0A 4R8QA 4YZ9A 4AQCA 3ZU7A 4U42A 3NS9A 5IU2A 3R04A 5CEQA 1FMOE 4PPCA 5KUPA 4ZTSA 2UVYA 3AG9A 3DB6A 2YIXA 3C4FA 1AQ1A 3CD8A 3NUXA 4LL0A 4V0GA 2UZLA 3BEGA 4GU6A 4DT9A 2XIXA 5JT2A 1PXKA 4CRSA 4OAVB 3Q04A 3C5IA 1M2PA 2XAMA 5E8TA 3UJGA 2YCQA 2Z7QA 2Y9QA 3HL7A 1OMWA 3ORXA 5ACBC 3QRIA 4G3DA 4O38A 2GNHA 4X0MA 4GK3A 1LEZA 4G34A 1A48A 4FKRA 3SA0A 4DCAA 3NW6A 3FHIA 4FX3A 3HMOA 4IM0A 5EW8A 5HO6A 1KE5A 5D10A 2QOQA 2J4ZA 4QYHA 4EK5A 2XALA 4YGAA 3MPMA 4XOZA 5KMKA 2X81A 4AZVA 3RCJA 3MS9A 4BTMA 4O27B 2A1AB 3DBFA 3MDYA 5FG8A 3HRBA 1Q24A 4MBIA 5CSVA 4XUFA 1PKDA 2UW5A 4J8MA 2OJFE 3FZPA 3IDBA 3TL8A 2HZ4A 3AGMA 3FHRA 2CNUA 1KE6A 3QQLA 4JX7A 2REIA 4AW2A 4BCGA 5LXMA 4O83A 3Q4TA 3G6GA 3UE4A 4FTCA 5HOAA 4WIHA 3GCUA 4DBXA 4DH8A 2VTOA 4BCIA 3DXQA 4FIJA 1H08A 3PPZA 2XNEA 4QRCA 5CWZA 5AUWA 3MB7A 2VRXA 3KU2A 3JR1A 3LLAA 3F3UA 2IJMA 5HHWA 2WQEA 5C03A 4ZJVA 5IA4A 5DN3A 4C0TA 4G3FA 2VWZA 2UZBA 4B4LA 3PVBA 4LOPA 3DB8A 3FBVA 4HYSA 1R39A 4EOSA 5IQEA 3C9WA 5FTGA 2Z7RA 2B54A 5ANDA 1ZRZA 2Z2WA 4UXQA 3RPYA 4FV5A 1ZAOA 4AF3A 4BYJA 5A14A 1R1WA 3QXPA 5AFVA 4HYHA 3HEGA 4ZY4A 3ZMMA 3N4UA 4U0IA 5KHXA 1Z9XA 3D7ZA 3OWKA 4RIWA 3U8WA 1MRYA 4L3LA 2X39A 3NYXA 5HU9A 2JBPA 4GT4A 5CAUA 3FEGA 4GSBA 4PV0A 2R3IA 3Q60A 1T45A 2RFNA 3O2MA 3TUDA 3NEWA 2HW6A 4YU2A 5FM3A 4N0SA 3CTJA 4FNWA 3B8QA 2FSMX 5FBNC 3WF6A 2WKMA 3T3UA 3UYTA 2VWIA 4WOVA 3ZO2A 5AR3A 3U6JA 2QOCA 4I41A 2O3PA 4FT7A 3O0GA 2YM4A 4BFMA 2EVAA 4FKPA 1WBVA 4O0VA 4EJ7A 1YHWA 4OTWA 4ZY5A 3DS6A 3QL8A 4M13A 4DEAA 3U9CA 3W0NA 3PJ1A 4LV8A 4FV8A 4YLKA 4BDJA 1A06A 4YPDA 4BDIA 3C0GA 5AR7A 4O7RA 3C50A 4BL1A 2QI8A 2CGUA 2UV2A 4QT1A 5T6KA 2V5QA 4CCUA 5LMKC 4NM3A 4RQKA 5DA3A 4B0GA 4RLLA 1XH4A 4I5CA 3DA6A 3GENA 4F6UA 4EJNA 2EXCX 2QOFA 4YJPA 4YJNA 3BU6A 3MVHA 4H3QA 4EH4A 4U44A 4KIKA 1M2QA 1W84A 3ZLXA 5GINE 2JAMA 3CTHA 4K77A 4UZHA 4FZFB 2X4FA 3UPXA 5CU3A 1HOWA 3QRTA 5BVNA 4PWNA 4IW0A 4ANLA 3ROYA 4QMOA 4PP9A 4RFMA 4CTBA 3FZSA 5CEMA 2KTYA 3P78A 4FZAB 1CSNA 2W1FA 4ZSLA 4XG4A 4BY9E 2IEWA 3EHAA 3MY1A 3E93A 4KRDA 5M09A 3VVHA 1X8BA 1UVRA 4ANBA 5KMIA 4U43A 4GEOA 5IA5A 4EUTA 5IISA 3VUGA 3TWJA 3LJ1A 3G6HA 3DJ5A 4KABA 5EW3A 3W0RA 3VS6A 2OZAA 1MRVA 3LIJA 1H27A 3TV6A 3CY3A 4C62A 2PUNA 1XH8A 4NT4A 3AKKA 5CENA 2FGIA 4FUXA 2DWBA 3W55A 2P33A 5KMJA 3OY1A 4O7LA 2YLFA 2NRUA 4AFJA 3PUPA 5IQDA 2BRBA 2PVJA 4ALWA 4FKJA 4TNDA 3A4PA 5KBRA 3MWUA 4QMUA 3G15A 2WQMA 5EM7A 3S00A 3OS3A 5F9EA 5ANEA 4G17A 1UA2A 4IAFA 5TKDA 4BRXA 3VONA 3R8LA 3KN6A 3Q5ZA 4P5QA 3F69A 3NNWA 3RAIA 3KK8A 2B7AA 4MNFA 3ZLSA 1OKWA 3PFYA 2WNTA 2YERA 3MA3A 2RG5A 4RA4A 4X2NA 3PA5A 4A9SA 4BTKA 4JIAA 5M4FA 3HP5A 4R3RA 1ZMVA 4M3QA 2GSFA 4UWCA 4ZOGA 3VWAA 3BLHA 4EORA 2X8IA 5AUUA 3OHTA 5GJGA 4BCHA 5A4QA 2XKCA 3DKGA 1IASA 5GZ9A 2R3GA 5ICPA 2ZV7A 4TYHB 3RK5A 5CX9A 3U87A 3QUDA 3ZRKA 1WFCA 4YJTA 2QVSE 3ORTA 3QAME 3VS5A 4MNEB 4RGJA 3QYZA 5B7VA 3VS4A 5AV2A 3Q9ZA 2Y4PA 3PSCA 1H4LA 4APPA 4USEA 2HIWA 1FVVA 2WTIA 5A9UA 4AZTA 3FQHA 2XK6A 3D94A 4E4MA 1H1WA 2XA4A 1SNXA 2FB8A 2WPAA 4YZDA 4EYMA 3DBCA 4TYGA 4U40A 5E9EA 4M7IA 2C0IA 5DR9A 3WYYA 3H30A 4ZSEA 3R9NA 3V51A 4FZ7A 4Q2AA 4DFXE 1MQBA 4ANOA 4J1RA 3Q5IA 1H00A 2FUMA 5E91A 4GYGA 4Y46A 5CU6A 4HYUA 3UG2A 4FV6A 3UGCA 3FUPA 2UW7A 4AT4A 4EH5A 4HCUA 4M66A 1OL5A 5H2UA 2X1NA 5AV4A 3QRJA 3C4XA 5IDNA 5KNJA 2XAOA 4CV8A 4GW8A 1M7NA 2JFLA 3GEQA 4FOCA 2WOTA 2WMAA 3R9RA 1S9IA 2C6LA 3F61A 2H9VA 2OIBA 1ZYSA 4MF1A 3KF4A 1FVRA 5BVWA 3IKAA 2ITYA 2A19B 3OXIA 4FIIA 3V8TA 4RX5A 1R0PA 2JLDA 3WIGA 1CMKE 2R2PA 3POZA 2B0QA 2PMLX 4FKGA 4D58A 1REJA 2VTTA 5J87A 1P14A 4WBOA 3F82A 3I81A 5C27A 1U46A 3VRYA 4RVMA 3O50A 4KS7A 4UALA 3MVLA 4FTKA 3C7QA 2PVKA 1SNUA 3ET7A 4TTHB 3PXYA 2EXMA 3UP2A 4CKIA 2IF8A 4YJRA 3EQCA 3IONA 5EFQA 5A6OA 1SVHA 3MN3A 5LWNA 2EWAA 4DT8A 3QTUA 3VBYA 2BCJA 2ZDTA 3PIXA 3KB7A 4WT6A 3TJCA 5J9LA 4TWNA 3QD4A 1OZ1A 3LMGA 2J90A 4CYIA 1TKIA 2X0OA 4DGMA 1XH5A 3Q2JA 3KY2A 4QPMA 3HX4A 3A8WA 3FQSA 5FP5A 3VHEA 4IADA 4EWHA 4R78A 1HCLA 2JAVA 2XK3A 5CEPA 4I22A 5LMBA 3EIDA 4C4EA 3R01A 3BLAA 4AFEA 2YM7A 2W7XA 3Q9XA 5KX8A 5HBJA 5E7RA 4BF2A 4C2WA 4O7SA 1NT2A 3QTWA 5G6VA 2BPMA 2BHHA 2GNIA 3TTJA 1WBTA 4F6WA 5IA1A 5CSHA 3UVPA 3ORIA 4KIQA 4CFMA 4RIYA 3MI9A 3UIUA 3ZEPA 4FEXA 5I3RA 4X3FB 3JS2A 3HDNA 3VAPA 1ZYCA 5HIDA 1Z5MA 4HJOA 4IX6A 5DR6A 2IZUA 3ZSGA 4XYFA 5AADA 4IANA 4C34A 2VTMA 2XNBA 4D28A 4DEBA 5IF1A 4D55A 2Y8OA 4I5MA 4X2JA 3OOMA 4NTSA 5G1XA 5H9BA 5HG7A 4WNMA 3O8UA 2HXQA 2CLXA 2X0QA 1PXLA 1WAKA 2PTKA 3COHA 3Q6UA 3MH0A 4ZS4A 3LFNA 4DH7A 3DDPA 4EQMA 2WQBA 4LMNA 4TRLA 5CI7A 2YDKA 3AD4A 3R7IA 3D0EA 3NRMA 4EHGA 3I5NA 3SHEA 4I0TA 3TN8A 4ZSJA 3OTVA 3F3TA 3CQEA 4L44A 4LOOA 5HLPA 3I60A 1JKKA 4L3JA 2X2MA 1UWJA 3VF9A 4L53A 2WQNA 5JGDA 1B39A 2BKZA 4C38A 2C4GA 2BZHB 1CKJA 1YKRA 3KN5A 2NP8A 1K2PA 2PWLA 3NUSA 4DLJA 3O23A 5D9HA 4X7QA 2EB2A 3CLYA 4FSNA 2WMBA 3U6IA 3UC3A 4YLLA 3PTGA 1V1KA 2JC6A 2W05A 4CD0A 3DK7A 3UMWA 4DEGA 5J7HA 5FDXA 3VQHA 3W8QA 5LCJA 5HD7A 2J0MB 4AU8A 4I21A 5E8UA 3KXNA 4FK6A 2BROA 4YJOA 4UMRA 4YTCA 5HX8A 5F4NA 4YURA 5IUIA 4XG9A 1JSUA 1Q41A 3BYVA 5KZIA 3G51A 3AC2A 3ORZA 3QRKA 3MFTA 5DE2A 3UYSA 4GH2A 4PMSA 5EYKA 4AA5A 3DLSA 2XUUA 3KA0A 3DDQA 3NR9A 4IWOA 4KBAA 4UYAA 5DRBA 5AA9A 4HVHA 4O0SA 2OH0E 4PDOA 4R7IA 3UNZA 5LQFA 2QLQA 4PUZA 3C4EA 4NIFB 3W0PA 4L42A 4RVKA 3LVPA 3QALE 1JWHA 2O5KA 2OIQA 1UNLA 3KXGA 4KSQA 4BCPA 2I7QA 1CDKA 3QGYA 3FWQA 4O6EA 3I6UA 4JVGA 3D14A 2VTNA 5CAQA 5AR2A 4AT3A 4O0WA 3VUHA 3PUFC 4YR8A 3CY2A 1VLRA 2QCSA 4FNYA 4OW8A 3FLZA 2QO7A 5EDRA 4BHZA 4DEEA 5ETIA 4BCQA 2AUHA 3QKLA 3ZTXA 4CFNA 4AXCA 4E73A 4PPBA 5DRDA 4BYIA 5IEVA 4HPTE 4HGEA 3SOAA 4XJ0A 4LGGA 4FEQA 3QQUA 4L67A 3PY1A 1PXMA 1W2CA 2V55A 2RFEA 3R1NA 5HCYA 3N4TA 5TO8A 5L6PA 4KIPA 2FSTX 4L9IA 3GUBA 4LGDA 2X8DA 1BL7A 2BHEA 4U80A 2PVLA 4HZRA 4CNHA 5IA3A 4AW5A 5CI6A 5IUHA 2W1DA 3MB6A 4XV2A 2OXYA 3V01A 4BGGA 5K5XA 4BJJB 2J9MA 4N57A 4E93A 3W1FA 4GMYA 4S2ZA 4DN5A 1KSWA 3MGYA 3FPMA 1Y6AA 2W4OA 2Z7LA 4NJDA 1R0EA 3GT8A 4L68A 3E64A 4I23A 4QMMA