5APSA

Sequence ienkkad inserted between gcn4 adaptors - structure a7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
EDKVEELLSKVYHLENEVARLKKLIENKKADMKQLEDKVEELLSKVYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apsA00
4I6MC 3L37A 3T97A 4JYCA 5AVUB 3UIAA 1GU5A 2P67A 4XE5B 1OWAA 2IPPA 2W6AA 2XV5A 3HE5B 1GZLA 3M0AA 3P8MC 4C46A 3VMXA 1SP4A 3VMYA 5AW1B 1IO4A 2WWWA 1CI6B 1HBWA 3LIDA 1SLQA 1H88A 1JUNA 4HYTB 1HJBA 3A7OA 2C9LY 1JNMA 2Q5UA 1S9KE 2VRSA 3HTKA 5APYA 3VYIA 1T2KC 1GTWA 3NMDA 1A02F 2C9NY 3L36A 4AUWA 1FOSE 2YNYA 2WT7A 1NWQA 4C7NB 1GD2E 2ZXEB 1MV8A 2Q3IA 3O8ZA 5AVQB 2P2UA 2R3CA 4M3LA 5AW2B 5AVSB 5AW6B 2JJLA 5AVWB 1DH3A 5APVA 3LIEA 2QM8A 1GU4A 2WTYA 3TYYA 5AW8B 5AVVB 3VN0A 5AVYB 3TNUB 5APTA 3I5CA 3V4QA 1H89A 2BASA 5APSA 4RESB 1S9KD 1J2JB 1X8YA 3VTPC 2QM7A 1MFZA 3HE4A 1OXZA 3NFQA 4JYBA 3HE5A 3OAKA 4AYCA 2H7HA 3KQGA 1FAVA 3A3YB 2WT7B 1YYCA 5AW0B 2XU6A 1MUUA 2W27A 5AW7B 1CI6A 2N9BA 3M0DA 3MGNA 1H8AA 5APXA 1A02J 2YO2A 5AVRB 1G2CB 5AVTB 1GK6A 2ZFCA 4GKGA 5AW9B 3M9HA 3VMZA 1NAFA 1CZQA 5AVZB 2R5DA 5APQA 1GK4A 5CMZA 3TK1A 3IR9A 2R32A 4C7NA 2R5BA 3V5BA 2XZRA 5AW4B 4GT1A 5APUA 4B86A 4DZOA 3HE4B 3MD0A 2Q7CA 3B8EB 3P32A 1KQLA 3P7KA 4LC1A 2KP8A 3TNUA 3M9BA 4KHXA 2WPRA 3A5TA 2P7JA 5APWA 1HWTC 2E43A 4I2LC 1CSBA 3M91A 5AW5B 1HUCA 3NTNA 2Z5IA 3V4WA 2WPSA 3KDPB 4EOTA 3A2AA 3NXSA 4AQRD 5AW3B 3L35A 2E42A 3M06A 3SWFA 5AVXB 2Z5HA 2YO3A 2WPQA 1FOSF 1T2KD
chains in the Genus database with same CATH superfamily
4WY4A 2OGUA 1LT9B 2QJPB 1W2BO 1NU1G 3H25A 1PIXA 1KB9H 1IO4A 1NTKJ 1HVVA 3V2PA 1UIXA 1LNQA 3QH9A 1VQPP 2YXRB 3AE8C 4D6TG 1NWQA 5CJ4A 1SQQG 2O01N 1NTKE 1GW3A 2ZT9C 2Q3EA 1NTMJ 1FJPA 4PD4D 3MUDC 3TYYA 3VN0A 2CPBA 1U7MA 2XNXA 1FZBA 2E5YA 4I7ZC 3WUVA 1LTSC 2QSIA 2LR2A 2FFDC 4NPEA 1RF0A 1RE4A 5AVRB 1AQ5A 1G1JA 3BVHA 3M9HA 4ASVA 1BDCA 1S2EA 2L91A 1E5WA 4C7NA 3AEEC 3MD0A 3B71A 1T3JA 4HKZH 2JDIH 4U7JA 1KILD 2KP8A 3A5TA 2XKMA 1T6AA 4WWIA 2Y0CA 1VQOP 2XDJA 1ZRTD 1YQ4C 2QA4P 2WPSA 3FWLA 2NPSC 3PP5A 1K73Q 1BGYD 2WSEH 4DT0A 1S4XA 5BU5A 2ZYAA 2OQQA 2D2CD 3T97A 1BDDA 1GZLA 1KYOH 4C46A 3HD7D 3RL0D 4PD4E 3LIDA 1RQUA 2FYNB 3G6EP 1JNMA 2JR8A 1T2KC 2C0WA 1D7MA 1NTKG 1L4AD 4H13C 3CX5D 2ZXEB 5K5GB 2JWDA 2QM8A 1NOHA 2IBZI 1NTMG 1PP9D 4HB1A 5CCGA 1N73B 2K9JA 3CXHD 1J1EB 2H89C 4AYCA 3E1IA 1NKNA 2RN0A 3PTZA 3KQGA 4IL6H 1KILE 5B66H 4HJGH 3B5NB 4O9BA 2HLOA 2KXPB 2I1JA 2QJPC 2E75B 1KB9D 3AEDC 1ZRTE 2NRGA 1MZ9A 4BRYB 3L70J 5M1BA 4OH8B 2WSSH 1LTJB 3AE3C 1FJKA 1L0LJ 1Q7YQ 2KZIA 4EDFA 1PGJA 2E74D 2M5AA 3SFDC 3NXSA 2WZ7A 3II6A 2NPSD 3L37A 3GHGB 3R2PA 4ZMDA 5KJ7C 3CX5E 1GU5A 1PP9J 2IPPA 2B87A 3Q5PA 1NGMB 1PP9E 3ABVC 2FYUK 3CXHE 2C9NY 1OZHA 1JTHA 5BVZA 3SSUA 4EI2A 1M8OB 2RMZA 1URQA 4WY4B 1VQ5P 1RF1C 4Y99B 2A45H 1KB9E 3HUSB 4R4LA 2BEQD 4TT3H 1LTBC 2P1JA 2FYZA 2RH0A 1H8AA 3V2QA 2YO2A 2K37A 3CCLP 1KTMA 1GK6A 4GKGA 1VPCA 1KORA 2YKPA 2GUSA 4L75A 2FYNC 3F5HA 1P84I 2N1TB 3L70G 1LT1A 2M8RA 2XNDH 2B89A 1VQKP 1L0LG 2J5UA 3KDPB 4ZKPA 1NAYA 1KMIZ 1HH0A 2HFED 4OVNF 2AEMA 1N73C 1K04A 5AVUB 3ITKA 2K9YA 1SP4A 1PFIA 2WSEJ 1KB9I 3AECC 1PP9G 2DW3A 1RQVA 4L73A 3B5NC 2Q5UA 3O6QB 1T8ZA 2CK3H 1OVUA 2Q3IA 1JO5A 1JB0J 5AVSB 3TSIA 1LTJC 5AVVB 2QIWA 3I5CA 2JO1A 5KAFH 3EQ2A 4WVZA 1MFZA 1QEXA 5KAIH 1FZCA 3RBZA 1Q2NA 3RBXA 2H7HA 1IJDB 1VQ4P 2JKVA 1KFMA 2OYHA 3PH0A 2YMKA 1AV1A 3GHGC 3L73D 1VQ6P 1GL2B 3KZIH 1JMMA 3FXEA 5AVZB 5CMZA 2Y0DA 3SWYA 3G9RA 1FE6A 3D6YA 1FDIA 2K9JB 3GG2A 3H1ID 5GTIH 1NVOA 1HWTC 5B66E 1VF5B 1LTTC 2Z5IA 3Q3DA 2Z4EA 1JY2O 4K35A 2SPZA 2WPQA 4I6MC 3HUSC 3H1KG 1KYOI 1WT6A 3VMYA 2W8ZA 2NZ2A 3A0BE 1PGQA 3D6ZA 2FXMA 1EC5A 1IZNB 4UB6E 1QL1A 3B5ND 1Q82Q 3AEBC 3CL3D 2E75D 1L0NG 1HGVA 4XFJA 3LIEA 3FWNA 3L73E 2N1TC 4OWFA 1LTGC 1OW6A 2WPVB 3H1IJ 2IFMA 2WSFH 2O01J 1NO4A 1SQXG 1JTHB 1SQBK 1CI6A 1OMIA 3H1IE 2V7QJ 1GK4A 1N7SB 1KFNA 2R5BA 3KYQA 4B86A 1M1JA 3CC7P 4W7YA 2HODA 1SS1A 2FXOA 1KQLA 2BCCD 3S4RA 2P7JA 5APWA 3CD6P 4CPGA 4WB4A 4RJTA 2GM4A 1OW7A 1NJIQ 2JP3A 3H6PA 3CMEP 4WY4D 4YXDC 3SWFA 3M0DC 1VQMP 2HG5D 1BE3J 2ZAEB 1SFCB 2PGDA 5KKZB 2WWWA 1VQ8P 1SLQA 1HJBA 2WSCJ 2KB7P 3LW5J 2IBZD 1PZQA 2WQYC 4EYYQ 3HD7C 3RL0C 1XTCC 1OVRA 1SQQK 2IDBA 2YKQA 2A45I 1H89A 2KNCB 1J2JB 2Q6QA 1L4AC 2PAJA 2N1TD 3KPEA 3HE4A 1JCCA 2FXPA 3MHVA 4JYBA 3HE5A 2W83C 5CJ0A 1DEBA 3H1IG 3G71P 1YYCA 2BCCE 2W27A 4GOEA 2N9BA 3B4SA 5AW9B 2JWAA 2AXTH 3Q2YA 1FZCB 1Y47A 2Q9IA 3CCQP 4L76A 2WPRA 2OYHB 3CCEP 1S72P 4RKUJ 1CSBA 3IFMA 3NTNA 1KQSO 4JF7A 2IBZE 5B5EE 1EDIA 1N2DC 4BXLA 2QRXA 1S3JA 2E74C 3AE9C 2BEZF 3S1KA 1H88A 5GTIE 1BE3G 2FYUD 1AJYA 1U57A 1EZVD 1XTGB 1OW8A 1N7SC 1GL2D 3H1HD 3TGUD 3E1RA 3V2NA 1M56D 3PLNA 4PV1B 3D70A 1K05A 4RESB 1FDOA 1T3UA 1H0TB 1NTMK 3FX0A 2QJYB 2KK7A 1Q90D 1OFCX 2K1AA 1VF5D 2XU6A 1LGHB 3M0DA 1FZEA 5EFWB 1G2CB 1P84D 1KILA 3BCCD 1N8RQ 1LWUA 1SFCC 5KKZC 1UIIA 5CCHC 1R8EA 1HTLC 2H43A 2WMMA 2WITA 2QE7H 2M3BA 3SFEC 1FZGA 3TNUA 1BGYJ 2OYIC 3CC4P 2E43A 2HYNA 3H1HJ 1LT9C 5GTHE 2FYUE 4GODA 1EZVE 1ZP0C 1BGYE 3MIWA 1YIJP 1FC2C 5E79H 3H1HE 1JY3N 1L4AA 3TGUE 1J1DB 3G3ZA 1OVVA 4R4MA 3CCMP 3VYIA 1WMKA 2PRRA 3MUDA 3BCCJ 1Y8AA 3C9IA 2ZJSE 2R3CA 1N7SD 4NPFX 1DEEG 2M3EA 3L75D 3WMM0 1P84E 3H32A 3BCCE 2FFDA 1L2PA 3A0HH 2HPCA 1JY3P 1S5LH 3R4YA 1BSHA 4N78D 3A3YB 2ZXXA 4EIJA 1IK9A 1IK7A 1TU3F 1EZVI 1BCCD 4I1LA 1LTAC 1CW5A 3L72D 1SFCD 3HE4B 1X0TA 1USDA 5CCHD 2NPSA 1MFTA 4ASWA 4LC1A 1KYOD 1YJNP 1HUCA 3VMAA 1BGYG 1S1CX 1L0LK 4AQRD 3IAOA 4PV1C 2QEXP 3H1HG 1IFPA 2AXTE 3OJAB 3GF7A 1EXIA 4Z1MH 5CHXA 3ZDMA 3M9QA 2ZVNB 1RE3C 5AW1B 2E76B 3L75E 1EDJA 3A7OA 2KUBA 1A02F 1FOSE 4C7NB 1LP1A 4N78E 1SQPK 2P2UA 1J1EC 5AW6B 5TJHA 1VL2A 3H1LD 3AEAC 1GU4A 3BCCG 2W6JH 2RKLA 1S9KD 3RK3B 1ZOYC 1BCCE 2E75C 1LT9A 3L72E 2WVRA 4ZKUA 1SQBD 2K3RA 2V4HA 3AEFC 2Y9YA 3T97B 3CCSP 1KYOE 1J1DC 3MP7B 3CPWO 1JY2N 3IN6A 2QVAA 3AE2C 2KSEA 3WUUA 1JM0A 3RL0g 3OA7A 3M9BA 1SQVK 5KJ7A 3V4WA 3C1LA 3U59A 1OIPA 3WU2H 1LWUB 3Q5SA 2E42A 4KJMA 2IYPA 2Z5HA 1IFJA 2AEFA 1YQ3C 3W68A 4JYCA 4PV1D 1NTZK 4GIFA 1K8AQ 4C7RA 1YJ9P 2O1KA 1RY3A 4IL6E 5BU8B 2G3AA 2M0BA 1SQBJ 1NH4A 4WY4C 4QMAA 3L71D 2ZYGA 1S9KE 5APYA 4Y99C 1RF1A 2YIUB 4YXWH 2YNYA 2WT7A 3O8ZA 3U1AA 1WRGA 1DX7A 1SQQD 2W90A 1SQBE 3F89A 5KLVK 3GLMA 3C8VA 1X9VA 5APVA 1L0NK 2AEJA 1AFOA 1LTIC 2M5AB 1X8YA 3VTPC 1E79H 2ZT9B 3L73J 4PD4H 1A02J 1SQXK 4RO0A 1NAFA 2B87B 3HRNA 2HR3A 2R32A 3P8CD 1Q86Q 1RE4C 2KLUA 2POHA 1PL5A 3B8EB 3A0HE 3P32A 3L71J 1S5LE 3P7KA 1QX8A 3GW6A 5KTBA 3AEGC 2J58A 4I2LC 1URQB 1N73A 1SQQJ 1VQ9P 4GOFA 3L71E 1SVFA 3CC2P 3RK3C 4IL6X 3B5NA 2A06D 1OWAA 1SQQE 2W6AA 2KZJA 3JC22 2E5TA 2OARA 3EFFK 1IFMA 3JCUH 1LTJA 4DJGA 1SQBG 1AA0A 1GD2E 3IF4A 1AQTA 1MV8A 2K88A 5AVQB 3N4XA 1Y9BA 5CBOA 2FY8A 2P10A 2IFNA 3L74D 2GUVA 3V2RA 4H13B 1USEA 1NU1K 1NTMD 3I55P 1ZV8A 3GHGA 1GL2C 3CX5H 3P8CE 3Q1MA 2R44A 5CBNA 2Q1KA 1W2EA 5CCGC 3L73G 4IOIH 3USSA 1HGZA 3BRTB 2J59M 1EDLA 4IFMA 2BCCJ 1K9MQ 4IFFA 1GMJA 2YMYA 1VF5C 2E76D 1KN7A 2YKOA 2YIUC 2A06E 4U3FD 1W5CE 4KHXA 1PPJD 2O1JA 4KT0J 4YTPC 5AW5B 3HUSA 3L71G 2A45G 4TLFA 2IX7C 4EOTA 5AW3B 4N3YB 3M06A 1KD1Q 5KAFE 4WBAA 3L74J 3RGUA 1Q81Q 1KC8Q 2P67A 4XE5B 5KAIE 3RK3D 4UB8H 3M0AA 3P8MC 2H88C 3L74E 3HTKA 2QJKB 1N7LA 1NTME 3KZIE 5C39A 3OW2O 1GTWA 1IFDA 3WU2E 2N1TA 3RK2B 1YHQP 1DD4A 4BWNA 4PJ0H 1QVFO 3G4SP 1YBKA 2WTYA 5TISH 2PFXA 3GMAA 1FZFA 5APTA 1G1IA 1YJWP 1QLED 3JSVC 1HF9A 5APSA 4U3FJ 1FS0E 1URQC 3OAKA 2G8YA 1RF1B 1FZAA 1NTKK 3WUTA 2WT7B 5AW0B 3GF3A 3FGAD 4U3FE 1NKZB 3KXDA 1VQ7P 1PPJE 2I1KA 2ZFCA 5CCGD 3O6QA 1CZQA 1PGOA 3TK1A 1YI2P 4W80A 5AW4B 5APUA 3CCUP 2A06G 2KYVA 1PGPA 2BCCG 2KSJA 3RK3E 3L70D 1L0LD 2WSFJ 3W67A 1FOSF 3UIAA 3SWKA 2FYUJ 1GL2A 1KZUB 2ZT9D 3L74G 1EXJA 1M57D 1CI6B 3HD7A 2P58A 2IBZG 3TGUJ 3NMDA 5KLIB 4H44B 3QWOC 1M1KQ 4AUWA 1SQPD 1M1JB 2Y0EA 4M3LA 1U7JA 2HODB 1FU1A 1GW4A 2IYOA 5AVYB 2LXBA 4IFDK 4W7ZA 3V4QA 4Y28J 3BATA 3PHLA 4H0LB 2OTLP 3NFQA 1NYHA 2B9BA 3JCUE 1PV3A 3TF5A 1URQD 1EDKA 4U3FG 1HJ0A 3A0BH 1FAVA 3MTUE 4PD4I 1PPJG 3PRJA 4A7PA 2W6BA 1FZCC 3L70E 1QL2A 4UB6H 2KOGA 2R5DA 2OTJP 5APQA 1L0LE 2OYHC 1AVYA 1R5LA 3TDKA 2QJKC 1JOCA 1KV4A 1SQVD 2OYOA 1N86A 1ZW0A 2KIKA 4LLHA 1X79B 3RK2C 4K3AA 3PJSK 3M91A 1SQPJ 3A2AA 1T2KD 1NTZD 1BSNA 3FXDA 1JY3O 1SQPE 4H13D 1RHZB 3CLQA 3HE5B 2B88A 3H1KD 4OGQB 2O01H 2KS1A 1DD3A 1N7SA 1ZN5A 1HBWA 2FYUG 4HYTB 2C9LY 1EZVG 2YXQB 2VRSA 5H2FH 2V7QH 1AVOA 3L36A 3L75J 3MZWB 5KLVD 1IFIA 3TGUG 1L0ND 2JJLA 2QJYC 1DH3A 1ZMEC 4UB8E 3VOPA 4JPZB 2ITAA 1SQVJ 3CWBD 1X22A 1IC2A 5DJUB 4LGDE 3CX5I 3HTKB 2FKWB 1QGKB 4YPCA 1KQGB 2OTKE 1SQXD 1SFCA 2IZ0A 1BCCJ 2MKVA 5CCHA 1SQVE 3MGNA 3S9OA 1FBMA 1NTZJ 3L72J 3VMZA 4PJ0E 4N6JA 3CXHI 5TISE 3H1KJ 2OYIA 3V5BA 2CPSA 3AE4C 2WSCH 3LW5H 3AE6C 1NTZE 4JBZA 2ZYDA 5KLIC 3CCRP 4H44C 3H1JD 2ZVOB 5KJ7D 2O3JA 3H1KE 2KNCA 2MJZA 3AE1C 1M1JC 5KLVJ 3RK2D 3D71A 1L0NJ 2FBWC 3L35A 3EWKA 3U1CA 1SQPG 4H0LC 2I8DA 5KLVE 3CWBJ 4XA4A 2XV5A 3CMAP 1L0NE 1KQFB 3EFGA 1KILB 1MKMA 1SQXJ 2PP6A 3CWBE 3H1LJ 1FDMA 3K5BA 2H8PD 1ZXGA 5AW2B 1SQXE 5AVWB 3L75G 5AW8B 3H1LE 2D2CB 3TNUB 1NU1D 2BASA 1JY2P 3H1JJ 5B5EH 1R5SA 4JQ0D 3I56P 3HD7B 3RL0B 2UWJE 4NPDA 1YTZI 4GDOA 1SQVG 4D6TD 3H1JE 5AW7B 5APXA 5E79E 3CCJP 1L4AB 4OGQC 5L8RJ 1BCCG 3BRVB 1NTZG 2XZRA 3L72G 3CI9A 4DZOA 1RH5B 3AE7C 1EQ7A 1YTZT 1ZR2A 2GA1A 1OX3A 4H44D 2IZ1A 3L4FA 1JEKA 1H0TA 4I7ZB 1ZR4A 1DIPA 3KHUA 3CCVP 3H32B 2Y9ZA 2E76C 1RE3A 1VDFA 5AVXB 2FFDB 2YO3A 1RF0C 5KLVG 1GDTA 1NU1J 4MN4C 3N7NA 2HPCB 1G2CA 2KI7B 2N9YB 4H0LD 1VQNP 3VMXA 1M90Q 2JEEA 4ZNCA 3CWBG 4D6TJ 1JUNA 1NU1E 1LJ2A 1NHLA 1BE3D 2KLVA 2C0XA 4L74A 2AXCA 1JCDA 2E74B 2LXCB 1IFNA 3VP9A 4D6TE 2R3SA 3H1LG 4DOJA 2NPSB 5GTHH 2KS1B 2LKMA 4HH2A 4BRYA 5DJTB 2QM7A 1OXZA 2L5GB 4DCKA 5H2FE 1NTKD 3H1JG 1MUUA 5AVTB 1YITP 3AE5C 1VQLP 1M7LA 3IR9A 4OGQD 3BASA 3V6IA 4GT1A 3Q5RA 1KILC 2Q7CA 1LWUC 1P84H 1JMBA 3VP8A 1LP1B 1Z56A 1QVGO 3CXHH 1ZLLA 3E7KA 1BE3E 2D2CC 1S5LX 2QG4A 2OYIB
chains in the Genus database with same CATH topology
4I6MC 3HUSC 4WY4A 3UIAA 1GL2A 5CHXA 1LT9B 3M9QA 1KZUB 1WT6A 1RE3C 3VMYA 5AW1B 1IO4A 1CI6B 1HVVA 3V2PA 3HD7A 3A7OA 2FXMA 1A02F 3NMDA 1QL1A 3B5ND 4AUWA 1FOSE 1NWQA 4C7NB 5CJ4A 1GW3A 3CL3D 4N78E 1M1JB 1SQPK 1HGVA 2P2UA 4M3LA 1J1EC 5AW6B 2HODB 1FU1A 1FJPA 3LIEA 1GU4A 1GW4A 3TYYA 3VN0A 5AVYB 4IFDK 4W7ZA 2N1TC 3V4QA 1LTGC 1S9KD 2CPBA 3BATA 3RK3B 2IFMA 2XNXA 1FZBA 3NFQA 2WSFH 1LTSC 1LT9A 4ZKUA 1URQD 1NO4A 1FAVA 1JTHB 2FFDC 3MTUE 1SQBK 1CI6A 1RF0A 1RE4A 5AVRB 2W6BA 1FZCC 1G1JA 1AQ5A 3BVHA 1QL2A 3M9HA 2KOGA 2R5DA 1J1DC 5APQA 1E5WA 1GK4A 1N7SB 2OYHC 1JY2N 1KFNA 4C7NA 2R5BA 3KYQA 4B86A 1M1JA 4W7YA 3MD0A 2HODA 1T3JA 1JOCA 1KQLA 1KILD 3OA7A 2KP8A 3M9BA 1N86A 1SQVK 4LLHA 1X79B 3A5TA 2P7JA 5APWA 3RK2C 2XKMA 4WB4A 3M91A 2GM4A 5KJ7A 2XDJA 3V4WA 2WPSA 2NPSC 3PP5A 3U59A 3H6PA 3A2AA 1LWUB 2WSEH 4WY4D 2E42A 3SWFA 3M0DC 2Z5HA 1IFJA 5BU5A 1T2KD 3T97A 4JYCA 1JY3O 1NTZK 4GIFA 3CLQA 4C7RA 3HE5B 2HG5D 1GZLA 4C46A 2O01H 3HD7D 3RL0D 2O1KA 1RY3A 1SFCB 1N7SA 1ZN5A 2WWWA 5BU8B 1HBWA 3LIDA 1SLQA 4HYTB 1HJBA 1NH4A 2KB7P 4WY4C 2C9LY 1JNMA 1S9KE 2VRSA 5APYA 1T2KC 4Y99C 1RF1A 2C0WA 3L36A 1L4AD 2YNYA 2WT7A 2ZXEB 1IFIA 3O8ZA 3U1AA 1WRGA 3HD7C 1DX7A 3RL0C 5KLVK 1XTCC 1SQQK 2JJLA 1X9VA 1DH3A 5APVA 1L0NK 2QM8A 1NOHA 3VOPA 2YKQA 2A45I 1H89A 1AFOA 1J2JB 1LTIC 1X8YA 3VTPC 1IC2A 5CCGA 1N73B 1L4AC 2PAJA 2N1TD 3KPEA 4LGDE 3HE4A 1J1EB 3HTKB 2FKWB 1JCCA 4JYBA 3HE5A 4AYCA 3E1IA 1NKNA 5CJ0A 1DEBA 3KQGA 1SFCA 1YYCA 2W27A 5CCHA 2N9BA 3MGNA 1A02J 1SQXK 3B5NB 4O9BA 2HLOA 5AW9B 1FBMA 3VMZA 2I1JA 1NAFA 4N6JA 3HRNA 1MZ9A 2R32A 3P8CD 2OYIA 3V5BA 2CPSA 1RE4C 2POHA 2WSCH 3LW5H 3B8EB 4OH8B 1FZCB 1LTJB 3P32A 1FJKA 2Q9IA 3P7KA 5KJ7D 2WPRA 2OYHB 5KTBA 2MJZA 2J58A 1M1JC 4I2LC 1CSBA 1URQB 3IFMA 1N73A 3NTNA 3RK2D 4JF7A 1SVFA 3NXSA 2WZ7A 3L35A 3II6A 2NPSD 3U1CA 3RK3C 3L37A 3GHGB 3R2PA 5KJ7C 3B5NA 1GU5A 1N2DC 4XA4A 1OWAA 2IPPA 2W6AA 2XV5A 1H88A 3EFGA 1KILB 2OARA 2PP6A 1IFMA 2FYUK 1LTJA 2C9NY 1XTGB 1FDMA 2H8PD 1JTHA 1GL2D 1N7SC 5BVZA 1GD2E 1MV8A 5AVQB 3N4XA 5AW2B 4WY4B 1URQA 5AVWB 3V2NA 1RF1C 4Y99B 5AW8B 2IFNA 3TNUB 2A45H 2GUVA 2BASA 3V2RA 4RESB 1JY2P 1NU1K 1T3UA 1ZV8A 3HD7B 3HUSB 3RL0B 3GHGA 1GL2C 1NTMK 3P8CE 1YTZI 1LTBC 2P1JA 2FYZA 1W2EA 2XU6A 1LGHB 5AW7B 5CCGC 3V2QA 3M0DA 1H8AA 1FZEA 5APXA 2YO2A 1G2CB 1L4AB 1KILA 1GK6A 1HGZA 4GKGA 3BRTB 1VPCA 2J59M 1LWUA 2YKPA 4IFMA 2GUSA 1SFCC 3BRVB 5CCHC 1HTLC 4IFFA 2XZRA 2YMYA 3CI9A 4DZOA 2H43A 2WITA 2YKOA 1EQ7A 2M3BA 1YTZT 1ZR2A 2N1TB 1FZGA 3TNUA 4KHXA 2OYIC 2M8RA 2O1JA 2E43A 2HYNA 3L4FA 5AW5B 3HUSA 1ZR4A 1LT9C 2A45G 3KDPB 4EOTA 2IX7C 3H32B 4ZKPA 5AW3B 4N3YB 1RE3A 1HH0A 3M06A 1VDFA 5AVXB 2FFDB 2YO3A 1RF0C 4WBAA 1GDTA 2HFED 3MIWA 1N73C 5AVUB 1JY3N 3N7NA 2P67A 4XE5B 2HPCB 1G2CA 1L4AA 3RK3D 3M0AA 3P8MC 1J1DB 3VMXA 1SP4A 1PFIA 3G3ZA 2JEEA 1JUNA 3B5NC 1NHLA 2Q5UA 3HTKA 3VYIA 1N7LA 1T8ZA 2KLVA 1GTWA 2C0XA 1IFDA 3MUDA 1JCDA 1IFNA 2N1TA 3VP9A 2Q3IA 1JO5A 3RK2B 3C9IA 2R3CA 1N7SD 5AVSB 4DOJA 2NPSB 3TSIA 1LTJC 2WTYA 5AVVB 3WMM0 1FZFA 2LKMA 3H32A 5APTA 1G1IA 3I5CA 4HH2A 5APSA 3EQ2A 2FFDA 2QM7A 1MFZA 1URQC 1OXZA 2L5GB 1FZCA 2HPCA 1JY3P 3OAKA 1RF1B 1FZAA 2H7HA 4N78D 1IJDB 1NTKK 3A3YB 1KFMA 2WT7B 2OYHA 5AW0B 1MUUA 4EIJA 1IK9A 1NKZB 3GHGC 5AVTB 2I1KA 2ZFCA 1GL2B 5CCGD 1JMMA 1CZQA 5AVZB 5CMZA 1M7LA 3TK1A 3IR9A 4I1LA 3SWYA 3BASA 1LTAC 4W80A 5AW4B 4GT1A 5APUA 1CW5A 1KILC 1SFCD 3HE4B 2Q7CA 2KYVA 5CCHD 2NPSA 2KSJA 1LWUC 4LC1A 3VP8A 1HWTC 1HUCA 1Z56A 1LTTC 2Z5IA 1ZLLA 1L0LK 2Z4EA 4AQRD 1JY2O 2OYIB 2WPQA 1FOSF 3OJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M C;  3L37 A;  3T97 A;  4JYC A;  5AVU B;  3UIA A;  1GU5 A;  2P67 A;  4XE5 B;  1OWA A;  2IPP A;  2W6A A;  2XV5 A;  3HE5 B;  1GZL A;  3M0A A;  3P8M C;  4C46 A;  3VMX A;  1SP4 A;  3VMY A;  5AW1 B;  1IO4 A;  2WWW A;  1CI6 B;  1HBW A;  3LID A;  1SLQ A;  1H88 A;  1JUN A;  4HYT B;  1HJB A;  3A7O A;  2C9L Y;  1JNM A;  2Q5U A;  1S9K E;  2VRS A;  3HTK A;  5APY A;  3VYI A;  1T2K C;  1GTW A;  3NMD A;  1A02 F;  2C9N Y;  3L36 A;  4AUW A;  1FOS E;  2YNY A;  2WT7 A;  1NWQ A;  4C7N B;  1GD2 E;  2ZXE B;  1MV8 A;  2Q3I A;  3O8Z A;  5AVQ B;  2P2U A;  2R3C A;  4M3L A;  5AW2 B;  5AVS B;  5AW6 B;  2JJL A;  5AVW B;  1DH3 A;  5APV A;  3LIE A;  2QM8 A;  1GU4 A;  2WTY A;  3TYY A;  5AW8 B;  5AVV B;  3VN0 A;  5AVY B;  3TNU B;  5APT A;  3I5C A;  3V4Q A;  1H89 A;  2BAS A;  5APS A;  4RES B;  1S9K D;  1J2J B;  1X8Y A;  3VTP C;  2QM7 A;  1MFZ A;  3HE4 A;  1OXZ A;  3NFQ A;  4JYB A;  3HE5 A;  3OAK A;  4AYC A;  2H7H A;  3KQG A;  1FAV A;  3A3Y B;  2WT7 B;  1YYC A;  5AW0 B;  2XU6 A;  1MUU A;  2W27 A;  5AW7 B;  1CI6 A;  2N9B A;  3M0D A;  3MGN A;  1H8A A;  5APX A;  1A02 J;  2YO2 A;  5AVR B;  1G2C B;  5AVT B;  1GK6 A;  2ZFC A;  4GKG A;  5AW9 B;  3M9H A;  3VMZ A;  1NAF A;  1CZQ A;  5AVZ B;  2R5D A;  5APQ A;  1GK4 A;  5CMZ A;  3TK1 A;  3IR9 A;  2R32 A;  4C7N A;  2R5B A;  3V5B A;  2XZR A;  5AW4 B;  4GT1 A;  5APU A;  4B86 A;  4DZO A;  3HE4 B;  3MD0 A;  2Q7C A;  3B8E B;  3P32 A;  1KQL A;  3P7K A;  4LC1 A;  2KP8 A;  3TNU A;  3M9B A;  4KHX A;  2WPR A;  3A5T A;  2P7J A;  5APW A;  1HWT C;  2E43 A;  4I2L C;  1CSB A;  3M91 A;  5AW5 B;  1HUC A;  3NTN A;  2Z5I A;  3V4W A;  2WPS A;  3KDP B;  4EOT A;  3A2A A;  3NXS A;  4AQR D;  5AW3 B;  3L35 A;  2E42 A;  3M06 A;  3SWF A;  5AVX B;  2Z5H A;  2YO3 A;  2WPQ A;  1FOS F;  1T2K D; 
#chains in the Genus database with same CATH topology
 4WY4 A;  2OGU A;  1LT9 B;  2QJP B;  1W2B O;  1NU1 G;  3H25 A;  1PIX A;  1KB9 H;  1IO4 A;  1NTK J;  1HVV A;  3V2P A;  1UIX A;  1LNQ A;  3QH9 A;  1VQP P;  2YXR B;  3AE8 C;  4D6T G;  1NWQ A;  5CJ4 A;  1SQQ G;  2O01 N;  1NTK E;  1GW3 A;  2ZT9 C;  2Q3E A;  1NTM J;  1FJP A;  4PD4 D;  3MUD C;  3TYY A;  3VN0 A;  2CPB A;  1U7M A;  2XNX A;  1FZB A;  2E5Y A;  4I7Z C;  3WUV A;  1LTS C;  2QSI A;  2LR2 A;  2FFD C;  4NPE A;  1RF0 A;  1RE4 A;  5AVR B;  1AQ5 A;  1G1J A;  3BVH A;  3M9H A;  4ASV A;  1BDC A;  1S2E A;  2L91 A;  1E5W A;  4C7N A;  3AEE C;  3MD0 A;  3B71 A;  1T3J A;  4HKZ H;  2JDI H;  4U7J A;  1KIL D;  2KP8 A;  3A5T A;  2XKM A;  1T6A A;  4WWI A;  2Y0C A;  1VQO P;  2XDJ A;  1ZRT D;  1YQ4 C;  2QA4 P;  2WPS A;  3FWL A;  2NPS C;  3PP5 A;  1K73 Q;  1BGY D;  2WSE H;  4DT0 A;  1S4X A;  5BU5 A;  2ZYA A;  2OQQ A;  2D2C D;  3T97 A;  1BDD A;  1GZL A;  1KYO H;  4C46 A;  3HD7 D;  3RL0 D;  4PD4 E;  3LID A;  1RQU A;  2FYN B;  3G6E P;  1JNM A;  2JR8 A;  1T2K C;  2C0W A;  1D7M A;  1NTK G;  1L4A D;  4H13 C;  3CX5 D;  2ZXE B;  5K5G B;  2JWD A;  2QM8 A;  1NOH A;  2IBZ I;  1NTM G;  1PP9 D;  4HB1 A;  5CCG A;  1N73 B;  2K9J A;  3CXH D;  1J1E B;  2H89 C;  4AYC A;  3E1I A;  1NKN A;  2RN0 A;  3PTZ A;  3KQG A;  4IL6 H;  1KIL E;  5B66 H;  4HJG H;  3B5N B;  4O9B A;  2HLO A;  2KXP B;  2I1J A;  2QJP C;  2E75 B;  1KB9 D;  3AED C;  1ZRT E;  2NRG A;  1MZ9 A;  4BRY B;  3L70 J;  5M1B A;  4OH8 B;  2WSS H;  1LTJ B;  3AE3 C;  1FJK A;  1L0L J;  1Q7Y Q;  2KZI A;  4EDF A;  1PGJ A;  2E74 D;  2M5A A;  3SFD C;  3NXS A;  2WZ7 A;  3II6 A;  2NPS D;  3L37 A;  3GHG B;  3R2P A;  4ZMD A;  5KJ7 C;  3CX5 E;  1GU5 A;  1PP9 J;  2IPP A;  2B87 A;  3Q5P A;  1NGM B;  1PP9 E;  3ABV C;  2FYU K;  3CXH E;  2C9N Y;  1OZH A;  1JTH A;  5BVZ A;  3SSU A;  4EI2 A;  1M8O B;  2RMZ A;  1URQ A;  4WY4 B;  1VQ5 P;  1RF1 C;  4Y99 B;  2A45 H;  1KB9 E;  3HUS B;  4R4L A;  2BEQ D;  4TT3 H;  1LTB C;  2P1J A;  2FYZ A;  2RH0 A;  1H8A A;  3V2Q A;  2YO2 A;  2K37 A;  3CCL P;  1KTM A;  1GK6 A;  4GKG A;  1VPC A;  1KOR A;  2YKP A;  2GUS A;  4L75 A;  2FYN C;  3F5H A;  1P84 I;  2N1T B;  3L70 G;  1LT1 A;  2M8R A;  2XND H;  2B89 A;  1VQK P;  1L0L G;  2J5U A;  3KDP B;  4ZKP A;  1NAY A;  1KMI Z;  1HH0 A;  2HFE D;  4OVN F;  2AEM A;  1N73 C;  1K04 A;  5AVU B;  3ITK A;  2K9Y A;  1SP4 A;  1PFI A;  2WSE J;  1KB9 I;  3AEC C;  1PP9 G;  2DW3 A;  1RQV A;  4L73 A;  3B5N C;  2Q5U A;  3O6Q B;  1T8Z A;  2CK3 H;  1OVU A;  2Q3I A;  1JO5 A;  1JB0 J;  5AVS B;  3TSI A;  1LTJ C;  5AVV B;  2QIW A;  3I5C A;  2JO1 A;  5KAF H;  3EQ2 A;  4WVZ A;  1MFZ A;  1QEX A;  5KAI H;  1FZC A;  3RBZ A;  1Q2N A;  3RBX A;  2H7H A;  1IJD B;  1VQ4 P;  2JKV A;  1KFM A;  2OYH A;  3PH0 A;  2YMK A;  1AV1 A;  3GHG C;  3L73 D;  1VQ6 P;  1GL2 B;  3KZI H;  1JMM A;  3FXE A;  5AVZ B;  5CMZ A;  2Y0D A;  3SWY A;  3G9R A;  1FE6 A;  3D6Y A;  1FDI A;  2K9J B;  3GG2 A;  3H1I D;  5GTI H;  1NVO A;  1HWT C;  5B66 E;  1VF5 B;  1LTT C;  2Z5I A;  3Q3D A;  2Z4E A;  1JY2 O;  4K35 A;  2SPZ A;  2WPQ A;  4I6M C;  3HUS C;  3H1K G;  1KYO I;  1WT6 A;  3VMY A;  2W8Z A;  2NZ2 A;  3A0B E;  1PGQ A;  3D6Z A;  2FXM A;  1EC5 A;  1IZN B;  4UB6 E;  1QL1 A;  3B5N D;  1Q82 Q;  3AEB C;  3CL3 D;  2E75 D;  1L0N G;  1HGV A;  4XFJ A;  3LIE A;  3FWN A;  3L73 E;  2N1T C;  4OWF A;  1LTG C;  1OW6 A;  2WPV B;  3H1I J;  2IFM A;  2WSF H;  2O01 J;  1NO4 A;  1SQX G;  1JTH B;  1SQB K;  1CI6 A;  1OMI A;  3H1I E;  2V7Q J;  1GK4 A;  1N7S B;  1KFN A;  2R5B A;  3KYQ A;  4B86 A;  1M1J A;  3CC7 P;  4W7Y A;  2HOD A;  1SS1 A;  2FXO A;  1KQL A;  2BCC D;  3S4R A;  2P7J A;  5APW A;  3CD6 P;  4CPG A;  4WB4 A;  4RJT A;  2GM4 A;  1OW7 A;  1NJI Q;  2JP3 A;  3H6P A;  3CME P;  4WY4 D;  4YXD C;  3SWF A;  3M0D C;  1VQM P;  2HG5 D;  1BE3 J;  2ZAE B;  1SFC B;  2PGD A;  5KKZ B;  2WWW A;  1VQ8 P;  1SLQ A;  1HJB A;  2WSC J;  2KB7 P;  3LW5 J;  2IBZ D;  1PZQ A;  2WQY C;  4EYY Q;  3HD7 C;  3RL0 C;  1XTC C;  1OVR A;  1SQQ K;  2IDB A;  2YKQ A;  2A45 I;  1H89 A;  2KNC B;  1J2J B;  2Q6Q A;  1L4A C;  2PAJ A;  2N1T D;  3KPE A;  3HE4 A;  1JCC A;  2FXP A;  3MHV A;  4JYB A;  3HE5 A;  2W83 C;  5CJ0 A;  1DEB A;  3H1I G;  3G71 P;  1YYC A;  2BCC E;  2W27 A;  4GOE A;  2N9B A;  3B4S A;  5AW9 B;  2JWA A;  2AXT H;  3Q2Y A;  1FZC B;  1Y47 A;  2Q9I A;  3CCQ P;  4L76 A;  2WPR A;  2OYH B;  3CCE P;  1S72 P;  4RKU J;  1CSB A;  3IFM A;  3NTN A;  1KQS O;  4JF7 A;  2IBZ E;  5B5E E;  1EDI A;  1N2D C;  4BXL A;  2QRX A;  1S3J A;  2E74 C;  3AE9 C;  2BEZ F;  3S1K A;  1H88 A;  5GTI E;  1BE3 G;  2FYU D;  1AJY A;  1U57 A;  1EZV D;  1XTG B;  1OW8 A;  1N7S C;  1GL2 D;  3H1H D;  3TGU D;  3E1R A;  3V2N A;  1M56 D;  3PLN A;  4PV1 B;  3D70 A;  1K05 A;  4RES B;  1FDO A;  1T3U A;  1H0T B;  1NTM K;  3FX0 A;  2QJY B;  2KK7 A;  1Q90 D;  1OFC X;  2K1A A;  1VF5 D;  2XU6 A;  1LGH B;  3M0D A;  1FZE A;  5EFW B;  1G2C B;  1P84 D;  1KIL A;  3BCC D;  1N8R Q;  1LWU A;  1SFC C;  5KKZ C;  1UII A;  5CCH C;  1R8E A;  1HTL C;  2H43 A;  2WMM A;  2WIT A;  2QE7 H;  2M3B A;  3SFE C;  1FZG A;  3TNU A;  1BGY J;  2OYI C;  3CC4 P;  2E43 A;  2HYN A;  3H1H J;  1LT9 C;  5GTH E;  2FYU E;  4GOD A;  1EZV E;  1ZP0 C;  1BGY E;  3MIW A;  1YIJ P;  1FC2 C;  5E79 H;  3H1H E;  1JY3 N;  1L4A A;  3TGU E;  1J1D B;  3G3Z A;  1OVV A;  4R4M A;  3CCM P;  3VYI A;  1WMK A;  2PRR A;  3MUD A;  3BCC J;  1Y8A A;  3C9I A;  2ZJS E;  2R3C A;  1N7S D;  4NPF X;  1DEE G;  2M3E A;  3L75 D;  3WMM 0;  1P84 E;  3H32 A;  3BCC E;  2FFD A;  1L2P A;  3A0H H;  2HPC A;  1JY3 P;  1S5L H;  3R4Y A;  1BSH A;  4N78 D;  3A3Y B;  2ZXX A;  4EIJ A;  1IK9 A;  1IK7 A;  1TU3 F;  1EZV I;  1BCC D;  4I1L A;  1LTA C;  1CW5 A;  3L72 D;  1SFC D;  3HE4 B;  1X0T A;  1USD A;  5CCH D;  2NPS A;  1MFT A;  4ASW A;  4LC1 A;  1KYO D;  1YJN P;  1HUC A;  3VMA A;  1BGY G;  1S1C X;  1L0L K;  4AQR D;  3IAO A;  4PV1 C;  2QEX P;  3H1H G;  1IFP A;  2AXT E;  3OJA B;  3GF7 A;  1EXI A;  4Z1M H;  5CHX A;  3ZDM A;  3M9Q A;  2ZVN B;  1RE3 C;  5AW1 B;  2E76 B;  3L75 E;  1EDJ A;  3A7O A;  2KUB A;  1A02 F;  1FOS E;  4C7N B;  1LP1 A;  4N78 E;  1SQP K;  2P2U A;  1J1E C;  5AW6 B;  5TJH A;  1VL2 A;  3H1L D;  3AEA C;  1GU4 A;  3BCC G;  2W6J H;  2RKL A;  1S9K D;  3RK3 B;  1ZOY C;  1BCC E;  2E75 C;  1LT9 A;  3L72 E;  2WVR A;  4ZKU A;  1SQB D;  2K3R A;  2V4H A;  3AEF C;  2Y9Y A;  3T97 B;  3CCS P;  1KYO E;  1J1D C;  3MP7 B;  3CPW O;  1JY2 N;  3IN6 A;  2QVA A;  3AE2 C;  2KSE A;  3WUU A;  1JM0 A;  3RL0 g;  3OA7 A;  3M9B A;  1SQV K;  5KJ7 A;  3V4W A;  3C1L A;  3U59 A;  1OIP A;  3WU2 H;  1LWU B;  3Q5S A;  2E42 A;  4KJM A;  2IYP A;  2Z5H A;  1IFJ A;  2AEF A;  1YQ3 C;  3W68 A;  4JYC A;  4PV1 D;  1NTZ K;  4GIF A;  1K8A Q;  4C7R A;  1YJ9 P;  2O1K A;  1RY3 A;  4IL6 E;  5BU8 B;  2G3A A;  2M0B A;  1SQB J;  1NH4 A;  4WY4 C;  4QMA A;  3L71 D;  2ZYG A;  1S9K E;  5APY A;  4Y99 C;  1RF1 A;  2YIU B;  4YXW H;  2YNY A;  2WT7 A;  3O8Z A;  3U1A A;  1WRG A;  1DX7 A;  1SQQ D;  2W90 A;  1SQB E;  3F89 A;  5KLV K;  3GLM A;  3C8V A;  1X9V A;  5APV A;  1L0N K;  2AEJ A;  1AFO A;  1LTI C;  2M5A B;  1X8Y A;  3VTP C;  1E79 H;  2ZT9 B;  3L73 J;  4PD4 H;  1A02 J;  1SQX K;  4RO0 A;  1NAF A;  2B87 B;  3HRN A;  2HR3 A;  2R32 A;  3P8C D;  1Q86 Q;  1RE4 C;  2KLU A;  2POH A;  1PL5 A;  3B8E B;  3A0H E;  3P32 A;  3L71 J;  1S5L E;  3P7K A;  1QX8 A;  3GW6 A;  5KTB A;  3AEG C;  2J58 A;  4I2L C;  1URQ B;  1N73 A;  1SQQ J;  1VQ9 P;  4GOF A;  3L71 E;  1SVF A;  3CC2 P;  3RK3 C;  4IL6 X;  3B5N A;  2A06 D;  1OWA A;  1SQQ E;  2W6A A;  2KZJ A;  3JC2 2;  2E5T A;  2OAR A;  3EFF K;  1IFM A;  3JCU H;  1LTJ A;  4DJG A;  1SQB G;  1AA0 A;  1GD2 E;  3IF4 A;  1AQT A;  1MV8 A;  2K88 A;  5AVQ B;  3N4X A;  1Y9B A;  5CBO A;  2FY8 A;  2P10 A;  2IFN A;  3L74 D;  2GUV A;  3V2R A;  4H13 B;  1USE A;  1NU1 K;  1NTM D;  3I55 P;  1ZV8 A;  3GHG A;  1GL2 C;  3CX5 H;  3P8C E;  3Q1M A;  2R44 A;  5CBN A;  2Q1K A;  1W2E A;  5CCG C;  3L73 G;  4IOI H;  3USS A;  1HGZ A;  3BRT B;  2J59 M;  1EDL A;  4IFM A;  2BCC J;  1K9M Q;  4IFF A;  1GMJ A;  2YMY A;  1VF5 C;  2E76 D;  1KN7 A;  2YKO A;  2YIU C;  2A06 E;  4U3F D;  1W5C E;  4KHX A;  1PPJ D;  2O1J A;  4KT0 J;  4YTP C;  5AW5 B;  3HUS A;  3L71 G;  2A45 G;  4TLF A;  2IX7 C;  4EOT A;  5AW3 B;  4N3Y B;  3M06 A;  1KD1 Q;  5KAF E;  4WBA A;  3L74 J;  3RGU A;  1Q81 Q;  1KC8 Q;  2P67 A;  4XE5 B;  5KAI E;  3RK3 D;  4UB8 H;  3M0A A;  3P8M C;  2H88 C;  3L74 E;  3HTK A;  2QJK B;  1N7L A;  1NTM E;  3KZI E;  5C39 A;  3OW2 O;  1GTW A;  1IFD A;  3WU2 E;  2N1T A;  3RK2 B;  1YHQ P;  1DD4 A;  4BWN A;  4PJ0 H;  1QVF O;  3G4S P;  1YBK A;  2WTY A;  5TIS H;  2PFX A;  3GMA A;  1FZF A;  5APT A;  1G1I A;  1YJW P;  1QLE D;  3JSV C;  1HF9 A;  5APS A;  4U3F J;  1FS0 E;  1URQ C;  3OAK A;  2G8Y A;  1RF1 B;  1FZA A;  1NTK K;  3WUT A;  2WT7 B;  5AW0 B;  3GF3 A;  3FGA D;  4U3F E;  1NKZ B;  3KXD A;  1VQ7 P;  1PPJ E;  2I1K A;  2ZFC A;  5CCG D;  3O6Q A;  1CZQ A;  1PGO A;  3TK1 A;  1YI2 P;  4W80 A;  5AW4 B;  5APU A;  3CCU P;  2A06 G;  2KYV A;  1PGP A;  2BCC G;  2KSJ A;  3RK3 E;  3L70 D;  1L0L D;  2WSF J;  3W67 A;  1FOS F;  3UIA A;  3SWK A;  2FYU J;  1GL2 A;  1KZU B;  2ZT9 D;  3L74 G;  1EXJ A;  1M57 D;  1CI6 B;  3HD7 A;  2P58 A;  2IBZ G;  3TGU J;  3NMD A;  5KLI B;  4H44 B;  3QWO C;  1M1K Q;  4AUW A;  1SQP D;  1M1J B;  2Y0E A;  4M3L A;  1U7J A;  2HOD B;  1FU1 A;  1GW4 A;  2IYO A;  5AVY B;  2LXB A;  4IFD K;  4W7Z A;  3V4Q A;  4Y28 J;  3BAT A;  3PHL A;  4H0L B;  2OTL P;  3NFQ A;  1NYH A;  2B9B A;  3JCU E;  1PV3 A;  3TF5 A;  1URQ D;  1EDK A;  4U3F G;  1HJ0 A;  3A0B H;  1FAV A;  3MTU E;  4PD4 I;  1PPJ G;  3PRJ A;  4A7P A;  2W6B A;  1FZC C;  3L70 E;  1QL2 A;  4UB6 H;  2KOG A;  2R5D A;  2OTJ P;  5APQ A;  1L0L E;  2OYH C;  1AVY A;  1R5L A;  3TDK A;  2QJK C;  1JOC A;  1KV4 A;  1SQV D;  2OYO A;  1N86 A;  1ZW0 A;  2KIK A;  4LLH A;  1X79 B;  3RK2 C;  4K3A A;  3PJS K;  3M91 A;  1SQP J;  3A2A A;  1T2K D;  1NTZ D;  1BSN A;  3FXD A;  1JY3 O;  1SQP E;  4H13 D;  1RHZ B;  3CLQ A;  3HE5 B;  2B88 A;  3H1K D;  4OGQ B;  2O01 H;  2KS1 A;  1DD3 A;  1N7S A;  1ZN5 A;  1HBW A;  2FYU G;  4HYT B;  2C9L Y;  1EZV G;  2YXQ B;  2VRS A;  5H2F H;  2V7Q H;  1AVO A;  3L36 A;  3L75 J;  3MZW B;  5KLV D;  1IFI A;  3TGU G;  1L0N D;  2JJL A;  2QJY C;  1DH3 A;  1ZME C;  4UB8 E;  3VOP A;  4JPZ B;  2ITA A;  1SQV J;  3CWB D;  1X22 A;  1IC2 A;  5DJU B;  4LGD E;  3CX5 I;  3HTK B;  2FKW B;  1QGK B;  4YPC A;  1KQG B;  2OTK E;  1SQX D;  1SFC A;  2IZ0 A;  1BCC J;  2MKV A;  5CCH A;  1SQV E;  3MGN A;  3S9O A;  1FBM A;  1NTZ J;  3L72 J;  3VMZ A;  4PJ0 E;  4N6J A;  3CXH I;  5TIS E;  3H1K J;  2OYI A;  3V5B A;  2CPS A;  3AE4 C;  2WSC H;  3LW5 H;  3AE6 C;  1NTZ E;  4JBZ A;  2ZYD A;  5KLI C;  3CCR P;  4H44 C;  3H1J D;  2ZVO B;  5KJ7 D;  2O3J A;  3H1K E;  2KNC A;  2MJZ A;  3AE1 C;  1M1J C;  5KLV J;  3RK2 D;  3D71 A;  1L0N J;  2FBW C;  3L35 A;  3EWK A;  3U1C A;  1SQP G;  4H0L C;  2I8D A;  5KLV E;  3CWB J;  4XA4 A;  2XV5 A;  3CMA P;  1L0N E;  1KQF B;  3EFG A;  1KIL B;  1MKM A;  1SQX J;  2PP6 A;  3CWB E;  3H1L J;  1FDM A;  3K5B A;  2H8P D;  1ZXG A;  5AW2 B;  1SQX E;  5AVW B;  3L75 G;  5AW8 B;  3H1L E;  2D2C B;  3TNU B;  1NU1 D;  2BAS A;  1JY2 P;  3H1J J;  5B5E H;  1R5S A;  4JQ0 D;  3I56 P;  3HD7 B;  3RL0 B;  2UWJ E;  4NPD A;  1YTZ I;  4GDO A;  1SQV G;  4D6T D;  3H1J E;  5AW7 B;  5APX A;  5E79 E;  3CCJ P;  1L4A B;  4OGQ C;  5L8R J;  1BCC G;  3BRV B;  1NTZ G;  2XZR A;  3L72 G;  3CI9 A;  4DZO A;  1RH5 B;  3AE7 C;  1EQ7 A;  1YTZ T;  1ZR2 A;  2GA1 A;  1OX3 A;  4H44 D;  2IZ1 A;  3L4F A;  1JEK A;  1H0T A;  4I7Z B;  1ZR4 A;  1DIP A;  3KHU A;  3CCV P;  3H32 B;  2Y9Z A;  2E76 C;  1RE3 A;  1VDF A;  5AVX B;  2FFD B;  2YO3 A;  1RF0 C;  5KLV G;  1GDT A;  1NU1 J;  4MN4 C;  3N7N A;  2HPC B;  1G2C A;  2KI7 B;  2N9Y B;  4H0L D;  1VQN P;  3VMX A;  1M90 Q;  2JEE A;  4ZNC A;  3CWB G;  4D6T J;  1JUN A;  1NU1 E;  1LJ2 A;  1NHL A;  1BE3 D;  2KLV A;  2C0X A;  4L74 A;  2AXC A;  1JCD A;  2E74 B;  2LXC B;  1IFN A;  3VP9 A;  4D6T E;  2R3S A;  3H1L G;  4DOJ A;  2NPS B;  5GTH H;  2KS1 B;  2LKM A;  4HH2 A;  4BRY A;  5DJT B;  2QM7 A;  1OXZ A;  2L5G B;  4DCK A;  5H2F E;  1NTK D;  3H1J G;  1MUU A;  5AVT B;  1YIT P;  3AE5 C;  1VQL P;  1M7L A;  3IR9 A;  4OGQ D;  3BAS A;  3V6I A;  4GT1 A;  3Q5R A;  1KIL C;  2Q7C A;  1LWU C;  1P84 H;  1JMB A;  3VP8 A;  1LP1 B;  1Z56 A;  1QVG O;  3CXH H;  1ZLL A;  3E7K A;  1BE3 E;  2D2C C;  1S5L X;  2QG4 A;  2OYI B; 
#chains in the Genus database with same CATH homology
 4I6M C;  3HUS C;  4WY4 A;  3UIA A;  1GL2 A;  5CHX A;  1LT9 B;  3M9Q A;  1KZU B;  1WT6 A;  1RE3 C;  3VMY A;  5AW1 B;  1IO4 A;  1CI6 B;  1HVV A;  3V2P A;  3HD7 A;  3A7O A;  2FXM A;  1A02 F;  3NMD A;  1QL1 A;  3B5N D;  4AUW A;  1FOS E;  1NWQ A;  4C7N B;  5CJ4 A;  1GW3 A;  3CL3 D;  4N78 E;  1M1J B;  1SQP K;  1HGV A;  2P2U A;  4M3L A;  1J1E C;  5AW6 B;  2HOD B;  1FU1 A;  1FJP A;  3LIE A;  1GU4 A;  1GW4 A;  3TYY A;  3VN0 A;  5AVY B;  4IFD K;  4W7Z A;  2N1T C;  3V4Q A;  1LTG C;  1S9K D;  2CPB A;  3BAT A;  3RK3 B;  2IFM A;  2XNX A;  1FZB A;  3NFQ A;  2WSF H;  1LTS C;  1LT9 A;  4ZKU A;  1URQ D;  1NO4 A;  1FAV A;  1JTH B;  2FFD C;  3MTU E;  1SQB K;  1CI6 A;  1RF0 A;  1RE4 A;  5AVR B;  2W6B A;  1FZC C;  1G1J A;  1AQ5 A;  3BVH A;  1QL2 A;  3M9H A;  2KOG A;  2R5D A;  1J1D C;  5APQ A;  1E5W A;  1GK4 A;  1N7S B;  2OYH C;  1JY2 N;  1KFN A;  4C7N A;  2R5B A;  3KYQ A;  4B86 A;  1M1J A;  4W7Y A;  3MD0 A;  2HOD A;  1T3J A;  1JOC A;  1KQL A;  1KIL D;  3OA7 A;  2KP8 A;  3M9B A;  1N86 A;  1SQV K;  4LLH A;  1X79 B;  3A5T A;  2P7J A;  5APW A;  3RK2 C;  2XKM A;  4WB4 A;  3M91 A;  2GM4 A;  5KJ7 A;  2XDJ A;  3V4W A;  2WPS A;  2NPS C;  3PP5 A;  3U59 A;  3H6P A;  3A2A A;  1LWU B;  2WSE H;  4WY4 D;  2E42 A;  3SWF A;  3M0D C;  2Z5H A;  1IFJ A;  5BU5 A;  1T2K D;  3T97 A;  4JYC A;  1JY3 O;  1NTZ K;  4GIF A;  3CLQ A;  4C7R A;  3HE5 B;  2HG5 D;  1GZL A;  4C46 A;  2O01 H;  3HD7 D;  3RL0 D;  2O1K A;  1RY3 A;  1SFC B;  1N7S A;  1ZN5 A;  2WWW A;  5BU8 B;  1HBW A;  3LID A;  1SLQ A;  4HYT B;  1HJB A;  1NH4 A;  2KB7 P;  4WY4 C;  2C9L Y;  1JNM A;  1S9K E;  2VRS A;  5APY A;  1T2K C;  4Y99 C;  1RF1 A;  2C0W A;  3L36 A;  1L4A D;  2YNY A;  2WT7 A;  2ZXE B;  1IFI A;  3O8Z A;  3U1A A;  1WRG A;  3HD7 C;  1DX7 A;  3RL0 C;  5KLV K;  1XTC C;  1SQQ K;  2JJL A;  1X9V A;  1DH3 A;  5APV A;  1L0N K;  2QM8 A;  1NOH A;  3VOP A;  2YKQ A;  2A45 I;  1H89 A;  1AFO A;  1J2J B;  1LTI C;  1X8Y A;  3VTP C;  1IC2 A;  5CCG A;  1N73 B;  1L4A C;  2PAJ A;  2N1T D;  3KPE A;  4LGD E;  3HE4 A;  1J1E B;  3HTK B;  2FKW B;  1JCC A;  4JYB A;  3HE5 A;  4AYC A;  3E1I A;  1NKN A;  5CJ0 A;  1DEB A;  3KQG A;  1SFC A;  1YYC A;  2W27 A;  5CCH A;  2N9B A;  3MGN A;  1A02 J;  1SQX K;  3B5N B;  4O9B A;  2HLO A;  5AW9 B;  1FBM A;  3VMZ A;  2I1J A;  1NAF A;  4N6J A;  3HRN A;  1MZ9 A;  2R32 A;  3P8C D;  2OYI A;  3V5B A;  2CPS A;  1RE4 C;  2POH A;  2WSC H;  3LW5 H;  3B8E B;  4OH8 B;  1FZC B;  1LTJ B;  3P32 A;  1FJK A;  2Q9I A;  3P7K A;  5KJ7 D;  2WPR A;  2OYH B;  5KTB A;  2MJZ A;  2J58 A;  1M1J C;  4I2L C;  1CSB A;  1URQ B;  3IFM A;  1N73 A;  3NTN A;  3RK2 D;  4JF7 A;  1SVF A;  3NXS A;  2WZ7 A;  3L35 A;  3II6 A;  2NPS D;  3U1C A;  3RK3 C;  3L37 A;  3GHG B;  3R2P A;  5KJ7 C;  3B5N A;  1GU5 A;  1N2D C;  4XA4 A;  1OWA A;  2IPP A;  2W6A A;  2XV5 A;  1H88 A;  3EFG A;  1KIL B;  2OAR A;  2PP6 A;  1IFM A;  2FYU K;  1LTJ A;  2C9N Y;  1XTG B;  1FDM A;  2H8P D;  1JTH A;  1GL2 D;  1N7S C;  5BVZ A;  1GD2 E;  1MV8 A;  5AVQ B;  3N4X A;  5AW2 B;  4WY4 B;  1URQ A;  5AVW B;  3V2N A;  1RF1 C;  4Y99 B;  5AW8 B;  2IFN A;  3TNU B;  2A45 H;  2GUV A;  2BAS A;  3V2R A;  4RES B;  1JY2 P;  1NU1 K;  1T3U A;  1ZV8 A;  3HD7 B;  3HUS B;  3RL0 B;  3GHG A;  1GL2 C;  1NTM K;  3P8C E;  1YTZ I;  1LTB C;  2P1J A;  2FYZ A;  1W2E A;  2XU6 A;  1LGH B;  5AW7 B;  5CCG C;  3V2Q A;  3M0D A;  1H8A A;  1FZE A;  5APX A;  2YO2 A;  1G2C B;  1L4A B;  1KIL A;  1GK6 A;  1HGZ A;  4GKG A;  3BRT B;  1VPC A;  2J59 M;  1LWU A;  2YKP A;  4IFM A;  2GUS A;  1SFC C;  3BRV B;  5CCH C;  1HTL C;  4IFF A;  2XZR A;  2YMY A;  3CI9 A;  4DZO A;  2H43 A;  2WIT A;  2YKO A;  1EQ7 A;  2M3B A;  1YTZ T;  1ZR2 A;  2N1T B;  1FZG A;  3TNU A;  4KHX A;  2OYI C;  2M8R A;  2O1J A;  2E43 A;  2HYN A;  3L4F A;  5AW5 B;  3HUS A;  1ZR4 A;  1LT9 C;  2A45 G;  3KDP B;  4EOT A;  2IX7 C;  3H32 B;  4ZKP A;  5AW3 B;  4N3Y B;  1RE3 A;  1HH0 A;  3M06 A;  1VDF A;  5AVX B;  2FFD B;  2YO3 A;  1RF0 C;  4WBA A;  1GDT A;  2HFE D;  3MIW A;  1N73 C;  5AVU B;  1JY3 N;  3N7N A;  2P67 A;  4XE5 B;  2HPC B;  1G2C A;  1L4A A;  3RK3 D;  3M0A A;  3P8M C;  1J1D B;  3VMX A;  1SP4 A;  1PFI A;  3G3Z A;  2JEE A;  1JUN A;  3B5N C;  1NHL A;  2Q5U A;  3HTK A;  3VYI A;  1N7L A;  1T8Z A;  2KLV A;  1GTW A;  2C0X A;  1IFD A;  3MUD A;  1JCD A;  1IFN A;  2N1T A;  3VP9 A;  2Q3I A;  1JO5 A;  3RK2 B;  3C9I A;  2R3C A;  1N7S D;  5AVS B;  4DOJ A;  2NPS B;  3TSI A;  1LTJ C;  2WTY A;  5AVV B;  3WMM 0;  1FZF A;  2LKM A;  3H32 A;  5APT A;  1G1I A;  3I5C A;  4HH2 A;  5APS A;  3EQ2 A;  2FFD A;  2QM7 A;  1MFZ A;  1URQ C;  1OXZ A;  2L5G B;  1FZC A;  2HPC A;  1JY3 P;  3OAK A;  1RF1 B;  1FZA A;  2H7H A;  4N78 D;  1IJD B;  1NTK K;  3A3Y B;  1KFM A;  2WT7 B;  2OYH A;  5AW0 B;  1MUU A;  4EIJ A;  1IK9 A;  1NKZ B;  3GHG C;  5AVT B;  2I1K A;  2ZFC A;  1GL2 B;  5CCG D;  1JMM A;  1CZQ A;  5AVZ B;  5CMZ A;  1M7L A;  3TK1 A;  3IR9 A;  4I1L A;  3SWY A;  3BAS A;  1LTA C;  4W80 A;  5AW4 B;  4GT1 A;  5APU A;  1CW5 A;  1KIL C;  1SFC D;  3HE4 B;  2Q7C A;  2KYV A;  5CCH D;  2NPS A;  2KSJ A;  1LWU C;  4LC1 A;  3VP8 A;  1HWT C;  1HUC A;  1Z56 A;  1LTT C;  2Z5I A;  1ZLL A;  1L0L K;  2Z4E A;  4AQR D;  1JY2 O;  2OYI B;  2WPQ A;  1FOS F;  3OJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...