5APSA

Sequence ienkkad inserted between gcn4 adaptors - structure a7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
EDKVEELLSKVYHLENEVARLKKLIENKKADMKQLEDKVEELLSKVYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apsA00
2P2UA 3A3YB 2YNYA 2IPPA 2YO2A 2Z5HA 1FOSE 3P8MC 1GU4A 3NFQA 2Z5IA 5AVVB 1CZQA 5AW4B 3M9BA 4C7NB 1S9KE 1KQLA 3A5TA 3TK1A 1MFZA 3VN0A 5AVYB 5AW8B 2H7HA 1CI6B 3O8ZA 2R5BA 1HUCA 1YYCA 3V4QA 5APSA 2C9LY 3NXSA 2XU6A 4I2LC 3P7KA 3UIAA 1GK6A 2WTYA 5APQA 1A02J 3LIEA 2XZRA 1H8AA 5AW2B 4C46A 1OWAA 1HWTC 1CSBA 5AVXB 3HTKA 1JUNA 1GZLA 3V4WA 5AW9B 3MGNA 5AVZB 3MD0A 3HE5B 2C9NY 5CMZA 2ZFCA 1CI6A 4JYBA 5AW5B 2R3CA 2WT7A 3NTNA 4XE5B 3M9HA 1SLQA 3IR9A 3L37A 3T97A 3M0AA 5AW6B 1GU5A 1T2KC 3OAKA 2W6AA 3LIDA 3M06A 1T2KD 4AUWA 3HE5A 5APXA 1SP4A 3M91A 5AVSB 3VMXA 2ZXEB 2Q5UA 2R32A 3V5BA 2XV5A 1GTWA 2VRSA 4GT1A 1IO4A 5APVA 2E42A 1NAFA 3L36A 3SWFA 1FAVA 3VMZA 2Q3IA 2WWWA 2Q7CA 1HJBA 4I6MC 4AYCA 4AQRD 1JNMA 1FOSF 3TNUA 2BASA 3B8EB 1OXZA 1HBWA 2W27A 4KHXA 4M3LA 2QM8A 3VTPC 5AVTB 2WT7B 5APTA 4EOTA 1S9KD 5APWA 1GK4A 4GKGA 3A2AA 1A02F 2WPSA 4DZOA 2E43A 3HE4B 1X8YA 5AVRB 3TYYA 1MV8A 3TNUB 5AW3B 2WPRA 3KQGA 3I5CA 1H89A 1NWQA 1GD2E 2N9BA 3VMYA 3A7OA 4B86A 5APYA 3M0DA 2YO3A 3P32A 5AW7B 5AVQB 3HE4A 5AVWB 5APUA 5AW1B 4RESB 2JJLA 1MUUA 3L35A 2R5DA 4JYCA 1DH3A 4HYTB 2QM7A 2P7JA 5AVUB 3VYIA 3NMDA 1H88A 1J2JB 1G2CB 5AW0B 4LC1A 2P67A 2WPQA 3KDPB 2KP8A 4C7NA
chains in the Genus database with same CATH superfamily
4BWNA 4XFJA 3H6PA 1NTKK 3PTZA 5C39A 2AEJA 2K9YA 1GDTA 3CPWO 2E75D 1JY2N 2Z5HA 3KXDA 2K88A 3P8MC 4WY4A 1GU4A 1L0LE 3AEAC 3L73J 1SQPE 5KAIE 3BRTB 2FFDB 2Z5IA 1S72P 1K05A 4EI2A 2BCCD 3M9BA 1FJKA 2Q9IA 1SVFA 1SS1A 5K5GB 1ZR2A 3CCLP 3AEBC 2KIKA 2FBWC 3S9OA 1CI6B 4UB8H 1VDFA 1YJNP 1R5LA 1FU1A 1BE3G 2C0WA 2O3JA 1JY2P 3KPEA 2BCCE 1KQFB 3H1HJ 2PFXA 2IBZI 3E1IA 3CWBJ 2QJKC 1BGYE 2OGUA 3NXSA 3V4QA 1NU1K 3VP8A 1S4XA 1J1EC 2PGDA 2OYOA 3H1JD 3P7KA 4U3FJ 3L74D 3RK3B 1VF5D 1ZW0A 3BCCE 4D6TE 2WTYA 3SFDC 4R4LA 1AQTA 1RE3C 1EZVI 3D70A 1FBMA 2E75C 2FYUD 1H8AA 2HLOA 2Q6QA 4H13C 3LW5J 1EQ7A 3L73D 1RQUA 2G8YA 1CSBA 2XKMA 1LTJC 1NTZE 1OZHA 1L4AD 4JPZB 1YJWP 1OX3A 3V4WA 2B9BA 1VF5C 1SQQJ 2N1TA 3D6ZA 2PAJA 2AEMA 5AW9B 3KYQA 3MGNA 5AVZB 4NPDA 1JCCA 1AA0A 1PPJG 1YTZI 2YKPA 2OYHB 2WQYC 1XTGB 1YTZT 2ZT9D 3M9QA 4I7ZB 4K35A 2WT7A 3NTNA 4IFFA 3GF3A 1JMBA 1R5SA 3G4SP 1K8AQ 3AECC 1URQD 2Y9ZA 1JM0A 2YIUC 3T97A 3M0AA 4U3FE 1WMKA 5DJTB 1K73Q 1NO4A 3I55P 1T2KC 1T2KD 3M06A 3E7KA 3CWBE 1U7JA 3HE5A 3CXHI 1QVFO 1N73C 2YXRB 3B5NC 1EDJA 1QEXA 3M91A 1LWUB 3BRVB 1KYOD 2ZXEB 1JTHB 3TGUG 3H1ID 1GTWA 2HYNA 3L72D 4UB6H 4GT1A 2XDJA 4GIFA 1IO4A 1SQQD 1NTMD 4ZMDA 1GL2C 3CCUP 2D2CD 2J59M 3PP5A 3BVHA 3PJSK 3FXEA 4GOEA 1LTGC 3B5NB 3V2NA 3G3ZA 2Q3IA 2QEXP 2WWWA 1SQVJ 3L73G 2Q7CA 4AQRD 1VQ8P 2J5UA 3TNUA 3AEGC 3WU2H 1LWUA 1VQ4P 2IBZG 4M3LA 3W67A 1EDKA 1ZMEC 2E76C 1IK9A 2FXMA 2KZJA 2FYNB 2YIUB 3F5HA 1DEBA 3RL0B 4WY4D 2JEEA 2QG4A 1VQ7P 4K3AA 5KLVD 3D6YA 1OVVA 1HGVA 3PH0A 1N7SD 5AVRB 1EDLA 1RF0A 1NU1J 3Q2YA 1PL5A 2ZVNB 1BGYD 1L2PA 1LTTC 2KOGA 3KQGA 4PV1D 1FZGA 2YKOA 2WITA 2Y9YA 1S2EA 1URQB 5B66E 3CI9A 1H89A 1AVYA 1W2BO 1LP1B 4UB8E 2B87B 3FX0A 5APYA 1USDA 3SSUA 4DJGA 1Q81Q 2QJPB 2H89C 2NPSA 2XNDH 3A0HE 5KLIB 5AW7B 1PP9G 2E5TA 1VQKP 3HE4A 1WRGA 4OWFA 5AVWB 3L70D 1FDMA 1BSNA 5APUA 1JUNA 2JJLA 1NKNA 4GOFA 4UB6E 4Z1MH 2E75B 4Y99B 5CJ4A 1SQXK 4HYTB 1BCCG 1L4AB 1NTKJ 2P7JA 3L71J 3F89A 3H1LJ 3ABVC 3RK3C 3CX5E 1Y8AA 3EWKA 3NMDA 4IL6H 5KJ7C 1KYOH 5AW0B 1FZCC 1JY3N 3MZWB 5E79H 2KP8A 1NU1D 1KFNA 3H1KD 4C7NA 2HR3A 1NTZD 1BGYJ 2ZYAA 4DT0A 1OW6A 3CMAP 1KD1Q 2QVAA 5CJ0A 1J1DB 1T3JA 4DOJA 5GTHH 2ZXXA 1NTMK 2E74D 3OJAB 4H0LB 3A3YB 3WUTA 1N8RQ 2YNYA 2IYPA 3AEFC 2JP3A 1JTHA 4ZNCA 2A45H 1OVUA 4H13D 4N3YB 1FOSE 2A06E 2A06G 1NVOA 3M0DC 1JY3P 5AVVB 3B71A 3JCUE 3RBXA 1QGKB 1DEEG 2J58A 4L73A 1SQPJ 4C7NB 4CPGA 1VQMP 1LNQA 1QLED 2K37A 1MKMA 3TK1A 1HVVA 3H1IJ 4OGQC 4H0LC 5AW8B 3VMAA 5CCGA 2H7HA 1X9VA 2KLUA 3O8ZA 2FFDA 1FZAA 2POHA 3B4SA 2M8RA 1YYCA 1HJ0A 2A45G 2AEFA 2OARA 1EZVD 2N1TD 3K5BA 3WUUA 5KLVG 1DX7A 2C9LY 1LTAC 3KZIH 3HD7D 4I2LC 5KLVK 2PRRA 1NTME 2WT7B 2O1KA 5BU8B 1G1JA 2IBZD 3OA7A 2WSFJ 1ZXGA 2ITAA 4OGQD 5TISE 5KKZB 1A02J 2XZRA 3CC2P 1JY3O 2H8PD 1URQA 3LW5H 1SFCC 2WMMA 3WU2E 4C46A 4GODA 4L75A 3Q5SA 2N1TC 2K3RA 3CD6P 2B87A 5EFWB 3MUDA 3VOPA 3ZDMA 1Q2NA 2Z4EA 1D7MA 1FE6A 2KSEA 1LTJA 2N9YB 1SQBG 2G3AA 3EQ2A 3GHGC 2WSSH 3O6QA 1Z56A 4LLHA 3JC22 3TGUD 3MD0A 3HE5B 3R2PA 5KAFH 5CMZA 4YTPC 3Q5RA 1LT9B 2ZAEB 1EDIA 1N7SA 5CCGC 1CI6A 3BASA 2K1AA 4JYBA 4WVZA 2FYNC 2W6BA 2R3CA 3QH9A 3I56P 2YMYA 3N7NA 4ASVA 4XE5B 4U3FD 1VQOP 1G2CA 5AW6B 1W5CE 5H2FH 1GU5A 3V2RA 2WSCJ 2AXTH 2FYUJ 3AE7C 1YI2P 1IFPA 5APXA 1S5LH 1AFOA 1SP4A 1FZBA 1PPJE 2IFNA 3C8VA 2RN0A 4R4MA 2WSEJ 3EFFK 3H1LD 3HUSB 5AVSB 1FDIA 2KK7A 3VMXA 2SPZA 1DD4A 1K04A 2R32A 3V5BA 1ZOYC 4C7RA 2QA4P 1GL2D 2ZJSE 3HD7B 2E42A 1IFNA 3L36A 4QMAA 3TGUJ 1KB9D 4W80A 1GL2A 2V4HA 3S1KA 2QRXA 2MKVA 3VMZA 2KI7B 3TGUE 5E79E 4O9BA 1GW3A 3A0BH 3CXHE 1NGMB 1LTBC 3B8EB 1E5WA 1L0ND 2W27A 3CWBG 1L0NK 2YMKA 2GUSA 2QM8A 3GF7A 3HUSA 1ZRTE 5APTA 5AVTB 2NPSD 1PGJA 3H1JG 2W83C 3H1JE 5B66H 4EOTA 1VPCA 4RESB 2E76D 1L0NG 2YKQA 2C0XA 2NPSB 5KAFE 1T8ZA 1A02F 1BDDA 1LT9C 3VP9A 1OW8A 2OYIA 1X8YA 2JKVA 2DW3A 1YIJP 2ZT9B 4KJMA 3TYYA 1NKZB 3H1LE 1MV8A 2L5GB 2V7QH 3AE3C 1VL2A 4IOIH 4Y99C 1RF1C 1CW5A 2HPCB 1L0LK 1UIXA 1SQBJ 3CWBD 2OYIC 2N9BA 1USEA 5TJHA 5H2FE 4B86A 2IFMA 2FY8A 2M3BA 3IF4A 5CCHC 3CX5H 2QJPC 1NTZG 4IL6E 1S5LE 3GLMA 3TSIA 1VQPP 1LTJB 3ITKA 1KB9I 1NAYA 1H0TA 1M1JC 4BRYA 5AW1B 3KZIE 3B5ND 2K9JA 2R5DA 5DJUB 5M1BA 1BCCD 3P8CE 3RL0C 4ZKPA 3L72G 4ZKUA 1KQSO 2D2CB 1MFTA 2XNXA 3L4FA 4EYYQ 5KJ7D 2RMZA 3RK3D 1KILE 4PD4H 3T97B 1H88A 2RH0A 2KUBA 4EIJA 3SWFA 2JWAA 1M57D 3USSA 5KJ7A 2LXBA 3A0BE 2WPVB 2P2UA 2FFDC 3Q5PA 1KB9H 3U1AA 3CLQA 2Y0CA 1JOCA 4JBZA 4NPEA 1KILD 1JO5A 1FS0E 2V7QJ 1NJIQ 2IPPA 2YO2A 1T3UA 2WSFH 3IN6A 3CCQP 1M90Q 3G9RA 1YQ4C 2PP6A 2M5AA 1L0LG 3HD7A 3NFQA 3WMM0 5CCHA 3G71P 3HRNA 3CCEP 5AW4B 3W68A 2MJZA 3O6QB 3S4RA 1N73B 1BCCJ 1KQLA 1NTKG 2LXCB 2R44A 3L71G 5BU5A 1S9KE 5AVYB 3CC7P 1RH5B 1X22A 2R5BA 1J1DC 1JMMA 1ZLLA 2Y0DA 3MTUE 1KN7A 1L4AA 3QWOC 1EZVG 3GG2A 2O01H 2B88A 4TLFA 1P84H 2FYUG 1SQXJ 2D2CC 2H88C 5APSA 1E79H 4L74A 1BDCA 2NRGA 2KS1B 1OIPA 3UIAA 1ZRTD 2FYZA 2IBZE 1N73A 1GK6A 2JWDA 4HKZH 5APQA 1PIXA 2OYHC 4OH8B 3LIEA 1ZR4A 1PP9E 5AW2B 1L0LD 1M1JB 3CX5I 2KB7P 1SQPG 4JF7A 1PP9J 5KTBA 1HWTC 2OTJP 5AVXB 3GHGA 4WB4A 1URQC 1ZP0C 5B5EE 4U7JA 2M0BA 1KC8Q 3BCCJ 4H13B 4D6TJ 1SQQE 3KHUA 4XA4A 4N78D 4PV1C 2ZFCA 1Q7YQ 3H1KG 1JEKA 3AE9C 1OFCX 2KNCB 2JR8A 1SQVG 1SQXD 5CHXA 1PZQA 4Y28J 1NU1E 2GA1A 2QE7H 2Y0EA 1SLQA 3M9HA 1IFDA 1SQVK 1BCCE 1Y9BA 3P8CD 2KLVA 4GDOA 4H44D 4LGDE 2OYHA 3LIDA 1IFJA 2I1JA 4H44B 2P10A 1SQXE 3AE6C 1VQNP 2FXOA 2E74C 1L0LJ 2BCCJ 3L73E 1PP9D 2FYUK 4PD4D 1P84E 3CXHH 2KNCA 2XV5A 1WT6A 2P1JA 1PV3A 5APVA 3H1KJ 2ZYGA 1SQPK 1NH4A 3RL0g 1LWUC 1FC2C 2O1JA 1DIPA 1S5LX 3L70G 3N4XA 4N78E 1HJBA 1KILB 3Q1MA 4I6MC 4PJ0E 1JNMA 1FDOA 3HUSC 3II6A 3V2QA 2IZ1A 3L75G 2JO1A 3V6IA 1BE3D 1N7SB 1HH0A 1LTSC 2BASA 2L91A 3AE2C 3IFMA 4KT0J 1HBWA 3VTPC 2GM4A 1S9KD 1P84I 1QX8A 5APWA 3RL0D 1GK4A 1BGYG 3PRJA 3RBZA 4GKGA 4I7ZC 3CCVP 2BCCG 1U57A 2FKWB 1NTZK 2E43A 1KTMA 2JDIH 3CL3D 3JSVC 4YXWH 1QL2A 1SQQK 3PHLA 1VQLP 1U7MA 1P84D 2QJYC 2WPRA 3TNUB 1PGQA 5GTIH 1SQBE 3I5CA 4WBAA 3RGUA 3CCJP 5BVZA 1GD2E 2O01N 1SQQG 1IC2A 3VMYA 2IX7C 1N86A 3A7OA 3HTKB 3MHVA 3SWKA 1BSHA 3M0DA 2HODA 1KV4A 3OW2O 2YO3A 1RQVA 3P32A 1QVGO 2N1TB 5AVQB 1SFCB 3TDKA 5KKZC 1BE3J 5L8RJ 2IZ0A 1HTLC 1LT9A 1ZN5A 3BCCG 1NTMG 1DD3A 3L35A 1KB9E 2NPSC 4JYCA 2HPCA 1M56D 2M3EA 4U3FG 1LJ2A 1KYOI 2E76B 5AVUB 2QIWA 3BCCD 3CMEP 5KLVE 1R8EA 3TF5A 1PFIA 1IK7A 1G2CB 3CXHD 2QSIA 3L75J 2KS1A 2P67A 1X79B 4PJ0H 1HF9A 1PPJD 3IAOA 4TT3H 5B5EH 1HGZA 1Y47A 1IZNB 1X0TA 3H32A 3H1JJ 1XTCC 2K9JB 1LTIC 1SFCD 1SQBD 3L74J 3U59A 2KYVA 1M1JA 1KILC 1RHZB 1M7LA 2W6JH 3EFGA 2WVRA 4W7ZA 1JB0J 1KYOE 3AE4C 3AEDC 3CCMP 2Q1KA 1YITP 1GL2B 1LGHB 1CZQA 2A45I 1RE3A 2GUVA 1JY2O 3HD7C 1M1KQ 1IFIA 1NOHA 3C1LA 5GTHE 3A5TA 3WUVA 4BRYB 2OTLP 1MFZA 3H32B 3VN0A 5KLVJ 4EDFA 5TISH 3CX5D 1HUCA 3AEEC 1FZFA 1KZUB 3CC4P 1FZCB 3L75D 1IFMA 3SFEC 3D71A 4WWIA 2YXQB 2E5YA 2Q3EA 1L4AC 3PLNA 3AE5C 1TU3F 1AVOA 1BE3E 2CK3H 2HG5D 3JCUH 2XU6A 1PGPA 3L74G 4WY4C 1S1CX 3FWNA 1VQ9P 3L72E 4PV1B 1L0NJ 3AE8C 2OTKE 1Q82Q 1VQ5P 1EXJA 2FXPA 1W2EA 4NPFX 5KLIC 4IFMA 2LKMA 2A06D 1EC5A 3RK2B 1T6AA 4HH2A 1OWAA 4PD4I 1UIIA 5CCGD 2R3SA 2H43A 1YHQP 1NHLA 1PGOA 3HTKA 3RK2C 1GZLA 2AXCA 1RF1A 2QJYB 2ZVOB 1NTMJ 3B5NA 2LR2A 2O01J 4RJTA 1GMJA 1H0TB 1OW7A 1SFCA 2AXTE 4YXDC 1AV1A 2IYOA 2KSJA 3MIWA 2C9NY 3FXDA 3H1LG 1RF1B 1AJYA 1SQVD 1SQXG 5AW5B 1S3JA 2BEZF 2CPSA 1JCDA 4HB1A 1KFMA 4L76A 5GTIE 1L0NE 2CPBA 2WSEH 3IR9A 3L37A 1G1IA 4A7PA 1N7SC 1SQBK 2KXPB 1YJ9P 3U1CA 1RY3A 4BXLA 2KZIA 3AE1C 2W90A 2W6AA 3H1HG 3OAKA 4AUWA 4JQ0D 3GMAA 3CCSP 3H1KE 1OMIA 3FWLA 1SQPD 3FGAD 3H25A 1N7LA 2Q5UA 3MP7B 1LP1A 2VRSA 2WSCH 3GW6A 3H1IE 1Q90D 3L70E 4D6TD 2M5AB 4IFDK 1NAFA 3MUDC 4I1LA 1FAVA 4W7YA 4IL6X 2E74B 3SWYA 4AYCA 1FOSF 2I8DA 2RKLA 2WZ7A 3E1RA 4N6JA 1MZ9A 3L70J 1IJDB 2OQQA 4RO0A 1OXZA 2NZ2A 4KHXA 4H44C 1AQ5A 2IDBA 3L74E 1KORA 1YQ3C 3G6EP 1KQGB 1Q86Q 1NTKD 3L71D 2FYUE 3A2AA 5CBOA 2WPSA 4DZOA 1EXIA 1EZVE 1KMIZ 1FJPA 3RK3E 4RKUJ 3HE4B 3L75E 1FZEA 1M8OB 5KAIH 3CCRP 1LT1A 2HFED 1VQ6P 1NTZJ 4YPCA 2B89A 1VF5B 5AW3B 1K9MQ 1GW4A 1NTKE 3L71E 3Q3DA 1ZV8A 5CBNA 4DCKA 1NWQA 4ASWA 3R4YA 1NYHA 4OVNF 3V2PA 3GHGB 3RK2D 3H1IG 1N2DC 4PD4E 2I1KA 2OYIB 1YBKA 1KILA 2W8ZA 2ZYDA 1J1EB 1MUUA 2BEQD 1RE4A 3BATA 3H1HE 4D6TG 2ZT9C 1QL1A 1DH3A 1RF0C 2P58A 2QM7A 1FZCA 4H0LD 5CCHD 3C9IA 4WY4B 1NU1G 2UWJE 4MN4C 3A0HH 3VYIA 2HODB 1J2JB 1OVRA 2QJKB 3L72J 4HJGH 1SQVE 1RE4C 4LC1A 2WPQA 3KDPB 3H1HD 4OGQB
chains in the Genus database with same CATH topology
3H6PA 1NTKK 1GDTA 1JY2N 2Z5HA 3P8MC 4WY4A 1GU4A 3BRTB 2Z5IA 3M9BA 1FJKA 2Q9IA 1SVFA 1ZR2A 1CI6B 1VDFA 1FU1A 2C0WA 1JY2P 3KPEA 3V4QA 3E1IA 3VP8A 3NXSA 1NU1K 1J1EC 3P7KA 3RK3B 2WTYA 1RE3C 1FBMA 1H8AA 2HLOA 1EQ7A 1CSBA 2XKMA 1LTJC 1L4AD 3V4WA 2N1TA 2PAJA 5AW9B 3KYQA 3MGNA 5AVZB 1JCCA 1YTZI 2YKPA 2OYHB 1XTGB 1YTZT 3M9QA 2WT7A 3NTNA 4IFFA 1URQD 3T97A 3M0AA 1NO4A 1T2KC 1T2KD 3M06A 3HE5A 1N73C 3B5NC 3M91A 1LWUB 3BRVB 2ZXEB 1JTHB 1GTWA 2HYNA 4GT1A 2XDJA 4GIFA 1IO4A 3BVHA 1GL2C 2J59M 3PP5A 1LTGC 3B5NB 3V2NA 3G3ZA 2Q3IA 2WWWA 2Q7CA 4AQRD 3TNUA 1LWUA 4M3LA 1IK9A 2FXMA 1DEBA 3RL0B 4WY4D 2JEEA 1HGVA 1N7SD 5AVRB 1RF0A 1LTTC 2KOGA 3KQGA 1FZGA 2YKOA 2WITA 1H89A 1URQB 3CI9A 5APYA 2NPSA 5AW7B 3HE4A 1WRGA 5AVWB 1FDMA 5APUA 2JJLA 1NKNA 4Y99B 5CJ4A 1SQXK 4HYTB 1L4AB 2P7JA 3RK3C 1FZCC 3NMDA 5KJ7C 5AW0B 1JY3N 2KP8A 1KFNA 4C7NA 5CJ0A 1J1DB 1T3JA 4DOJA 1NTMK 3OJAB 3A3YB 2YNYA 1JTHA 2A45H 4N3YB 1FOSE 3M0DC 1JY3P 5AVVB 2J58A 4C7NB 3TK1A 2H7HA 1HVVA 5AW8B 5CCGA 1X9VA 3O8ZA 2FFDA 1FZAA 2POHA 2M8RA 1YYCA 2A45G 2OARA 2N1TD 1DX7A 2C9LY 1LTAC 3HD7D 4I2LC 5KLVK 2O1KA 5BU8B 1G1JA 3OA7A 1A02J 2XZRA 1JY3O 2H8PD 1URQA 3LW5H 1SFCC 4C46A 2N1TC 3MUDA 3VOPA 2Z4EA 1JUNA 3EQ2A 1LTJA 3GHGC 1Z56A 4LLHA 3MD0A 3HE5B 3R2PA 5CMZA 1LT9B 1N7SA 5CCGC 1CI6A 3BASA 4JYBA 2W6BA 2R3CA 2YMYA 3N7NA 4XE5B 1G2CA 5AW6B 1GU5A 3V2RA 5APXA 1AFOA 1SP4A 1FZBA 2IFNA 5AVSB 1RF1A 3VMXA 3HUSB 2R32A 3V5BA 4C7RA 1GL2D 3HD7B 2E42A 1IFNA 3L36A 4W80A 1GL2A 3VMZA 4O9BA 1GW3A 3B8EB 1LTBC 1E5WA 3HUSA 2W27A 2FFDB 1L0NK 2GUSA 2QM8A 5AVTB 2WT7B 5APTA 4EOTA 2NPSD 1VPCA 2YKQA 2C0XA 2NPSB 1A02F 1T8ZA 1LT9C 3VP9A 2OYIA 1X8YA 3TYYA 1NKZB 4Y99C 1MV8A 2L5GB 1PFIA 1RF1C 1CW5A 2HPCB 1L0LK 2OYIC 2N9BA 4B86A 2IFMA 2M3BA 5CCHC 3TSIA 1LTJB 1M1JC 5AW1B 3B5ND 4ZKUA 2R5DA 3RL0C 3P8CE 4ZKPA 2XNXA 3L4FA 5KJ7D 3RK3D 1H88A 4EIJA 3SWFA 5KJ7A 2P2UA 2FFDC 3U1AA 3CLQA 1JOCA 1JO5A 1KILD 2IPPA 2YO2A 1T3UA 2WSFH 3HD7A 2PP6A 3NFQA 3WMM0 5CCHA 3HRNA 5AW4B 2MJZA 1N73B 1S9KE 1KQLA 5BU5A 5AVYB 2R5BA 1J1DC 1JMMA 1ZLLA 3MTUE 1L4AA 2O01H 5APSA 3UIAA 2FYZA 1N73A 1GK6A 5APQA 2OYHC 4OH8B 3LIEA 1ZR4A 5AW2B 1M1JB 4JF7A 2KB7P 5KTBA 1HWTC 5AVXB 3GHGA 4WB4A 1URQC 4XA4A 4N78D 2ZFCA 5CHXA 3M9HA 1SLQA 1IFDA 1SQVK 3P8CD 2KLVA 4LGDE 3LIDA 1IFJA 2I1JA 2FYUK 2XV5A 1WT6A 2P1JA 5APVA 1SQPK 1NH4A 1LWUC 2O1JA 3N4XA 4N78E 1HJBA 1KILB 4I6MC 1JNMA 3HUSC 3II6A 3V2QA 1N7SB 2BASA 1HH0A 1LTSC 3IFMA 1HBWA 3VTPC 2GM4A 1S9KD 3RL0D 5APWA 1GK4A 4GKGA 2FKWB 1NTZK 2E43A 3CL3D 1QL2A 1SQQK 3TNUB 2WPRA 3I5CA 4WBAA 5BVZA 1GD2E 1IC2A 3VMYA 2IX7C 1N86A 3A7OA 3HTKB 3M0DA 2HODA 2YO3A 3P32A 2N1TB 5AVQB 1SFCB 4RESB 1HTLC 1LT9A 1ZN5A 3L35A 2NPSC 4JYCA 2HPCA 5AVUB 1G2CB 2P67A 1X79B 1HGZA 3H32A 1XTCC 3U59A 1LTIC 1SFCD 2KYVA 1M1JA 1KILC 1M7LA 3EFGA 4W7ZA 1GL2B 1LGHB 1CZQA 2A45I 1RE3A 2GUVA 1JY2O 3HD7C 1IFIA 1NOHA 3A5TA 1MFZA 3H32B 3VN0A 1HUCA 1FZFA 1KZUB 1FZCB 1IFMA 1L4AC 2HG5D 2XU6A 4WY4C 1W2EA 4IFMA 2LKMA 3RK2B 2OYHA 4HH2A 5CCGD 1OWAA 2H43A 1NHLA 3HTKA 3RK2C 1GZLA 3B5NA 1SFCA 2KSJA 3MIWA 2C9NY 1RF1B 5AW5B 2CPSA 1JCDA 1KFMA 2CPBA 2WSEH 3IR9A 3L37A 1G1IA 1N7SC 1SQBK 3U1CA 1RY3A 3OAKA 2W6AA 4AUWA 1N7LA 2Q5UA 2VRSA 2WSCH 4IFDK 1NAFA 4I1LA 1FAVA 4W7YA 3SWYA 4AYCA 1FOSF 2WZ7A 4N6JA 1MZ9A 1IJDB 1OXZA 4KHXA 1AQ5A 3A2AA 2WPSA 4DZOA 1FJPA 3HE4B 1FZEA 2HFED 5AW3B 1GW4A 1ZV8A 1NWQA 3V2PA 3GHGB 3RK2D 1N2DC 2I1KA 2OYIB 1KILA 1J1EB 1MUUA 1RE4A 3BATA 1QL1A 1DH3A 1RF0C 2QM7A 1FZCA 5CCHD 3C9IA 4WY4B 3VYIA 2HODB 1J2JB 1RE4C 4LC1A 2WPQA 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P2U A;  3A3Y B;  2YNY A;  2IPP A;  2YO2 A;  2Z5H A;  1FOS E;  3P8M C;  1GU4 A;  3NFQ A;  2Z5I A;  5AVV B;  1CZQ A;  5AW4 B;  3M9B A;  4C7N B;  1S9K E;  1KQL A;  3A5T A;  3TK1 A;  1MFZ A;  3VN0 A;  5AVY B;  5AW8 B;  2H7H A;  1CI6 B;  3O8Z A;  2R5B A;  1HUC A;  1YYC A;  3V4Q A;  5APS A;  2C9L Y;  3NXS A;  2XU6 A;  4I2L C;  3P7K A;  3UIA A;  1GK6 A;  2WTY A;  5APQ A;  1A02 J;  3LIE A;  2XZR A;  1H8A A;  5AW2 B;  4C46 A;  1OWA A;  1HWT C;  1CSB A;  5AVX B;  3HTK A;  1JUN A;  1GZL A;  3V4W A;  5AW9 B;  3MGN A;  5AVZ B;  3MD0 A;  3HE5 B;  2C9N Y;  5CMZ A;  2ZFC A;  1CI6 A;  4JYB A;  5AW5 B;  2R3C A;  2WT7 A;  3NTN A;  4XE5 B;  3M9H A;  1SLQ A;  3IR9 A;  3L37 A;  3T97 A;  3M0A A;  5AW6 B;  1GU5 A;  1T2K C;  3OAK A;  2W6A A;  3LID A;  3M06 A;  1T2K D;  4AUW A;  3HE5 A;  5APX A;  1SP4 A;  3M91 A;  5AVS B;  3VMX A;  2ZXE B;  2Q5U A;  2R32 A;  3V5B A;  2XV5 A;  1GTW A;  2VRS A;  4GT1 A;  1IO4 A;  5APV A;  2E42 A;  1NAF A;  3L36 A;  3SWF A;  1FAV A;  3VMZ A;  2Q3I A;  2WWW A;  2Q7C A;  1HJB A;  4I6M C;  4AYC A;  4AQR D;  1JNM A;  1FOS F;  3TNU A;  2BAS A;  3B8E B;  1OXZ A;  1HBW A;  2W27 A;  4KHX A;  4M3L A;  2QM8 A;  3VTP C;  5AVT B;  2WT7 B;  5APT A;  4EOT A;  1S9K D;  5APW A;  1GK4 A;  4GKG A;  3A2A A;  1A02 F;  2WPS A;  4DZO A;  2E43 A;  3HE4 B;  1X8Y A;  5AVR B;  3TYY A;  1MV8 A;  3TNU B;  5AW3 B;  2WPR A;  3KQG A;  3I5C A;  1H89 A;  1NWQ A;  1GD2 E;  2N9B A;  3VMY A;  3A7O A;  4B86 A;  5APY A;  3M0D A;  2YO3 A;  3P32 A;  5AW7 B;  5AVQ B;  3HE4 A;  5AVW B;  5APU A;  5AW1 B;  4RES B;  2JJL A;  1MUU A;  3L35 A;  2R5D A;  4JYC A;  1DH3 A;  4HYT B;  2QM7 A;  2P7J A;  5AVU B;  3VYI A;  3NMD A;  1H88 A;  1J2J B;  1G2C B;  5AW0 B;  4LC1 A;  2P67 A;  2WPQ A;  3KDP B;  2KP8 A;  4C7N A; 
#chains in the Genus database with same CATH topology
 4BWN A;  4XFJ A;  3H6P A;  1NTK K;  3PTZ A;  5C39 A;  2AEJ A;  2K9Y A;  1GDT A;  3CPW O;  2E75 D;  1JY2 N;  2Z5H A;  3KXD A;  2K88 A;  3P8M C;  4WY4 A;  1GU4 A;  1L0L E;  3AEA C;  3L73 J;  1SQP E;  5KAI E;  3BRT B;  2FFD B;  2Z5I A;  1S72 P;  1K05 A;  4EI2 A;  2BCC D;  3M9B A;  1FJK A;  2Q9I A;  1SVF A;  1SS1 A;  5K5G B;  1ZR2 A;  3CCL P;  3AEB C;  2KIK A;  2FBW C;  3S9O A;  1CI6 B;  4UB8 H;  1VDF A;  1YJN P;  1R5L A;  1FU1 A;  1BE3 G;  2C0W A;  2O3J A;  1JY2 P;  3KPE A;  2BCC E;  1KQF B;  3H1H J;  2PFX A;  2IBZ I;  3E1I A;  3CWB J;  2QJK C;  1BGY E;  2OGU A;  3NXS A;  3V4Q A;  1NU1 K;  3VP8 A;  1S4X A;  1J1E C;  2PGD A;  2OYO A;  3H1J D;  3P7K A;  4U3F J;  3L74 D;  3RK3 B;  1VF5 D;  1ZW0 A;  3BCC E;  4D6T E;  2WTY A;  3SFD C;  4R4L A;  1AQT A;  1RE3 C;  1EZV I;  3D70 A;  1FBM A;  2E75 C;  2FYU D;  1H8A A;  2HLO A;  2Q6Q A;  4H13 C;  3LW5 J;  1EQ7 A;  3L73 D;  1RQU A;  2G8Y A;  1CSB A;  2XKM A;  1LTJ C;  1NTZ E;  1OZH A;  1L4A D;  4JPZ B;  1YJW P;  1OX3 A;  3V4W A;  2B9B A;  1VF5 C;  1SQQ J;  2N1T A;  3D6Z A;  2PAJ A;  2AEM A;  5AW9 B;  3KYQ A;  3MGN A;  5AVZ B;  4NPD A;  1JCC A;  1AA0 A;  1PPJ G;  1YTZ I;  2YKP A;  2OYH B;  2WQY C;  1XTG B;  1YTZ T;  2ZT9 D;  3M9Q A;  4I7Z B;  4K35 A;  2WT7 A;  3NTN A;  4IFF A;  3GF3 A;  1JMB A;  1R5S A;  3G4S P;  1K8A Q;  3AEC C;  1URQ D;  2Y9Z A;  1JM0 A;  2YIU C;  3T97 A;  3M0A A;  4U3F E;  1WMK A;  5DJT B;  1K73 Q;  1NO4 A;  3I55 P;  1T2K C;  1T2K D;  3M06 A;  3E7K A;  3CWB E;  1U7J A;  3HE5 A;  3CXH I;  1QVF O;  1N73 C;  2YXR B;  3B5N C;  1EDJ A;  1QEX A;  3M91 A;  1LWU B;  3BRV B;  1KYO D;  2ZXE B;  1JTH B;  3TGU G;  3H1I D;  1GTW A;  2HYN A;  3L72 D;  4UB6 H;  4GT1 A;  2XDJ A;  4GIF A;  1IO4 A;  1SQQ D;  1NTM D;  4ZMD A;  1GL2 C;  3CCU P;  2D2C D;  2J59 M;  3PP5 A;  3BVH A;  3PJS K;  3FXE A;  4GOE A;  1LTG C;  3B5N B;  3V2N A;  3G3Z A;  2Q3I A;  2QEX P;  2WWW A;  1SQV J;  3L73 G;  2Q7C A;  4AQR D;  1VQ8 P;  2J5U A;  3TNU A;  3AEG C;  3WU2 H;  1LWU A;  1VQ4 P;  2IBZ G;  4M3L A;  3W67 A;  1EDK A;  1ZME C;  2E76 C;  1IK9 A;  2FXM A;  2KZJ A;  2FYN B;  2YIU B;  3F5H A;  1DEB A;  3RL0 B;  4WY4 D;  2JEE A;  2QG4 A;  1VQ7 P;  4K3A A;  5KLV D;  3D6Y A;  1OVV A;  1HGV A;  3PH0 A;  1N7S D;  5AVR B;  1EDL A;  1RF0 A;  1NU1 J;  3Q2Y A;  1PL5 A;  2ZVN B;  1BGY D;  1L2P A;  1LTT C;  2KOG A;  3KQG A;  4PV1 D;  1FZG A;  2YKO A;  2WIT A;  2Y9Y A;  1S2E A;  1URQ B;  5B66 E;  3CI9 A;  1H89 A;  1AVY A;  1W2B O;  1LP1 B;  4UB8 E;  2B87 B;  3FX0 A;  5APY A;  1USD A;  3SSU A;  4DJG A;  1Q81 Q;  2QJP B;  2H89 C;  2NPS A;  2XND H;  3A0H E;  5KLI B;  5AW7 B;  1PP9 G;  2E5T A;  1VQK P;  3HE4 A;  1WRG A;  4OWF A;  5AVW B;  3L70 D;  1FDM A;  1BSN A;  5APU A;  1JUN A;  2JJL A;  1NKN A;  4GOF A;  4UB6 E;  4Z1M H;  2E75 B;  4Y99 B;  5CJ4 A;  1SQX K;  4HYT B;  1BCC G;  1L4A B;  1NTK J;  2P7J A;  3L71 J;  3F89 A;  3H1L J;  3ABV C;  3RK3 C;  3CX5 E;  1Y8A A;  3EWK A;  3NMD A;  4IL6 H;  5KJ7 C;  1KYO H;  5AW0 B;  1FZC C;  1JY3 N;  3MZW B;  5E79 H;  2KP8 A;  1NU1 D;  1KFN A;  3H1K D;  4C7N A;  2HR3 A;  1NTZ D;  1BGY J;  2ZYA A;  4DT0 A;  1OW6 A;  3CMA P;  1KD1 Q;  2QVA A;  5CJ0 A;  1J1D B;  1T3J A;  4DOJ A;  5GTH H;  2ZXX A;  1NTM K;  2E74 D;  3OJA B;  4H0L B;  3A3Y B;  3WUT A;  1N8R Q;  2YNY A;  2IYP A;  3AEF C;  2JP3 A;  1JTH A;  4ZNC A;  2A45 H;  1OVU A;  4H13 D;  4N3Y B;  1FOS E;  2A06 E;  2A06 G;  1NVO A;  3M0D C;  1JY3 P;  5AVV B;  3B71 A;  3JCU E;  3RBX A;  1QGK B;  1DEE G;  2J58 A;  4L73 A;  1SQP J;  4C7N B;  4CPG A;  1VQM P;  1LNQ A;  1QLE D;  2K37 A;  1MKM A;  3TK1 A;  1HVV A;  3H1I J;  4OGQ C;  4H0L C;  5AW8 B;  3VMA A;  5CCG A;  2H7H A;  1X9V A;  2KLU A;  3O8Z A;  2FFD A;  1FZA A;  2POH A;  3B4S A;  2M8R A;  1YYC A;  1HJ0 A;  2A45 G;  2AEF A;  2OAR A;  1EZV D;  2N1T D;  3K5B A;  3WUU A;  5KLV G;  1DX7 A;  2C9L Y;  1LTA C;  3KZI H;  3HD7 D;  4I2L C;  5KLV K;  2PRR A;  1NTM E;  2WT7 B;  2O1K A;  5BU8 B;  1G1J A;  2IBZ D;  3OA7 A;  2WSF J;  1ZXG A;  2ITA A;  4OGQ D;  5TIS E;  5KKZ B;  1A02 J;  2XZR A;  3CC2 P;  1JY3 O;  2H8P D;  1URQ A;  3LW5 H;  1SFC C;  2WMM A;  3WU2 E;  4C46 A;  4GOD A;  4L75 A;  3Q5S A;  2N1T C;  2K3R A;  3CD6 P;  2B87 A;  5EFW B;  3MUD A;  3VOP A;  3ZDM A;  1Q2N A;  2Z4E A;  1D7M A;  1FE6 A;  2KSE A;  1LTJ A;  2N9Y B;  1SQB G;  2G3A A;  3EQ2 A;  3GHG C;  2WSS H;  3O6Q A;  1Z56 A;  4LLH A;  3JC2 2;  3TGU D;  3MD0 A;  3HE5 B;  3R2P A;  5KAF H;  5CMZ A;  4YTP C;  3Q5R A;  1LT9 B;  2ZAE B;  1EDI A;  1N7S A;  5CCG C;  1CI6 A;  3BAS A;  2K1A A;  4JYB A;  4WVZ A;  2FYN C;  2W6B A;  2R3C A;  3QH9 A;  3I56 P;  2YMY A;  3N7N A;  4ASV A;  4XE5 B;  4U3F D;  1VQO P;  1G2C A;  5AW6 B;  1W5C E;  5H2F H;  1GU5 A;  3V2R A;  2WSC J;  2AXT H;  2FYU J;  3AE7 C;  1YI2 P;  1IFP A;  5APX A;  1S5L H;  1AFO A;  1SP4 A;  1FZB A;  1PPJ E;  2IFN A;  3C8V A;  2RN0 A;  4R4M A;  2WSE J;  3EFF K;  3H1L D;  3HUS B;  5AVS B;  1FDI A;  2KK7 A;  3VMX A;  2SPZ A;  1DD4 A;  1K04 A;  2R32 A;  3V5B A;  1ZOY C;  4C7R A;  2QA4 P;  1GL2 D;  2ZJS E;  3HD7 B;  2E42 A;  1IFN A;  3L36 A;  4QMA A;  3TGU J;  1KB9 D;  4W80 A;  1GL2 A;  2V4H A;  3S1K A;  2QRX A;  2MKV A;  3VMZ A;  2KI7 B;  3TGU E;  5E79 E;  4O9B A;  1GW3 A;  3A0B H;  3CXH E;  1NGM B;  1LTB C;  3B8E B;  1E5W A;  1L0N D;  2W27 A;  3CWB G;  1L0N K;  2YMK A;  2GUS A;  2QM8 A;  3GF7 A;  3HUS A;  1ZRT E;  5APT A;  5AVT B;  2NPS D;  1PGJ A;  3H1J G;  2W83 C;  3H1J E;  5B66 H;  4EOT A;  1VPC A;  4RES B;  2E76 D;  1L0N G;  2YKQ A;  2C0X A;  2NPS B;  5KAF E;  1T8Z A;  1A02 F;  1BDD A;  1LT9 C;  3VP9 A;  1OW8 A;  2OYI A;  1X8Y A;  2JKV A;  2DW3 A;  1YIJ P;  2ZT9 B;  4KJM A;  3TYY A;  1NKZ B;  3H1L E;  1MV8 A;  2L5G B;  2V7Q H;  3AE3 C;  1VL2 A;  4IOI H;  4Y99 C;  1RF1 C;  1CW5 A;  2HPC B;  1L0L K;  1UIX A;  1SQB J;  3CWB D;  2OYI C;  2N9B A;  1USE A;  5TJH A;  5H2F E;  4B86 A;  2IFM A;  2FY8 A;  2M3B A;  3IF4 A;  5CCH C;  3CX5 H;  2QJP C;  1NTZ G;  4IL6 E;  1S5L E;  3GLM A;  3TSI A;  1VQP P;  1LTJ B;  3ITK A;  1KB9 I;  1NAY A;  1H0T A;  1M1J C;  4BRY A;  5AW1 B;  3KZI E;  3B5N D;  2K9J A;  2R5D A;  5DJU B;  5M1B A;  1BCC D;  3P8C E;  3RL0 C;  4ZKP A;  3L72 G;  4ZKU A;  1KQS O;  2D2C B;  1MFT A;  2XNX A;  3L4F A;  4EYY Q;  5KJ7 D;  2RMZ A;  3RK3 D;  1KIL E;  4PD4 H;  3T97 B;  1H88 A;  2RH0 A;  2KUB A;  4EIJ A;  3SWF A;  2JWA A;  1M57 D;  3USS A;  5KJ7 A;  2LXB A;  3A0B E;  2WPV B;  2P2U A;  2FFD C;  3Q5P A;  1KB9 H;  3U1A A;  3CLQ A;  2Y0C A;  1JOC A;  4JBZ A;  4NPE A;  1KIL D;  1JO5 A;  1FS0 E;  2V7Q J;  1NJI Q;  2IPP A;  2YO2 A;  1T3U A;  2WSF H;  3IN6 A;  3CCQ P;  1M90 Q;  3G9R A;  1YQ4 C;  2PP6 A;  2M5A A;  1L0L G;  3HD7 A;  3NFQ A;  3WMM 0;  5CCH A;  3G71 P;  3HRN A;  3CCE P;  5AW4 B;  3W68 A;  2MJZ A;  3O6Q B;  3S4R A;  1N73 B;  1BCC J;  1KQL A;  1NTK G;  2LXC B;  2R44 A;  3L71 G;  5BU5 A;  1S9K E;  5AVY B;  3CC7 P;  1RH5 B;  1X22 A;  2R5B A;  1J1D C;  1JMM A;  1ZLL A;  2Y0D A;  3MTU E;  1KN7 A;  1L4A A;  3QWO C;  1EZV G;  3GG2 A;  2O01 H;  2B88 A;  4TLF A;  1P84 H;  2FYU G;  1SQX J;  2D2C C;  2H88 C;  5APS A;  1E79 H;  4L74 A;  1BDC A;  2NRG A;  2KS1 B;  1OIP A;  3UIA A;  1ZRT D;  2FYZ A;  2IBZ E;  1N73 A;  1GK6 A;  2JWD A;  4HKZ H;  5APQ A;  1PIX A;  2OYH C;  4OH8 B;  3LIE A;  1ZR4 A;  1PP9 E;  5AW2 B;  1L0L D;  1M1J B;  3CX5 I;  2KB7 P;  1SQP G;  4JF7 A;  1PP9 J;  5KTB A;  1HWT C;  2OTJ P;  5AVX B;  3GHG A;  4WB4 A;  1URQ C;  1ZP0 C;  5B5E E;  4U7J A;  2M0B A;  1KC8 Q;  3BCC J;  4H13 B;  4D6T J;  1SQQ E;  3KHU A;  4XA4 A;  4N78 D;  4PV1 C;  2ZFC A;  1Q7Y Q;  3H1K G;  1JEK A;  3AE9 C;  1OFC X;  2KNC B;  2JR8 A;  1SQV G;  1SQX D;  5CHX A;  1PZQ A;  4Y28 J;  1NU1 E;  2GA1 A;  2QE7 H;  2Y0E A;  1SLQ A;  3M9H A;  1IFD A;  1SQV K;  1BCC E;  1Y9B A;  3P8C D;  2KLV A;  4GDO A;  4H44 D;  4LGD E;  2OYH A;  3LID A;  1IFJ A;  2I1J A;  4H44 B;  2P10 A;  1SQX E;  3AE6 C;  1VQN P;  2FXO A;  2E74 C;  1L0L J;  2BCC J;  3L73 E;  1PP9 D;  2FYU K;  4PD4 D;  1P84 E;  3CXH H;  2KNC A;  2XV5 A;  1WT6 A;  2P1J A;  1PV3 A;  5APV A;  3H1K J;  2ZYG A;  1SQP K;  1NH4 A;  3RL0 g;  1LWU C;  1FC2 C;  2O1J A;  1DIP A;  1S5L X;  3L70 G;  3N4X A;  4N78 E;  1HJB A;  1KIL B;  3Q1M A;  4I6M C;  4PJ0 E;  1JNM A;  1FDO A;  3HUS C;  3II6 A;  3V2Q A;  2IZ1 A;  3L75 G;  2JO1 A;  3V6I A;  1BE3 D;  1N7S B;  1HH0 A;  1LTS C;  2BAS A;  2L91 A;  3AE2 C;  3IFM A;  4KT0 J;  1HBW A;  3VTP C;  2GM4 A;  1S9K D;  1P84 I;  1QX8 A;  5APW A;  3RL0 D;  1GK4 A;  1BGY G;  3PRJ A;  3RBZ A;  4GKG A;  4I7Z C;  3CCV P;  2BCC G;  1U57 A;  2FKW B;  1NTZ K;  2E43 A;  1KTM A;  2JDI H;  3CL3 D;  3JSV C;  4YXW H;  1QL2 A;  1SQQ K;  3PHL A;  1VQL P;  1U7M A;  1P84 D;  2QJY C;  2WPR A;  3TNU B;  1PGQ A;  5GTI H;  1SQB E;  3I5C A;  4WBA A;  3RGU A;  3CCJ P;  5BVZ A;  1GD2 E;  2O01 N;  1SQQ G;  1IC2 A;  3VMY A;  2IX7 C;  1N86 A;  3A7O A;  3HTK B;  3MHV A;  3SWK A;  1BSH A;  3M0D A;  2HOD A;  1KV4 A;  3OW2 O;  2YO3 A;  1RQV A;  3P32 A;  1QVG O;  2N1T B;  5AVQ B;  1SFC B;  3TDK A;  5KKZ C;  1BE3 J;  5L8R J;  2IZ0 A;  1HTL C;  1LT9 A;  1ZN5 A;  3BCC G;  1NTM G;  1DD3 A;  3L35 A;  1KB9 E;  2NPS C;  4JYC A;  2HPC A;  1M56 D;  2M3E A;  4U3F G;  1LJ2 A;  1KYO I;  2E76 B;  5AVU B;  2QIW A;  3BCC D;  3CME P;  5KLV E;  1R8E A;  3TF5 A;  1PFI A;  1IK7 A;  1G2C B;  3CXH D;  2QSI A;  3L75 J;  2KS1 A;  2P67 A;  1X79 B;  4PJ0 H;  1HF9 A;  1PPJ D;  3IAO A;  4TT3 H;  5B5E H;  1HGZ A;  1Y47 A;  1IZN B;  1X0T A;  3H32 A;  3H1J J;  1XTC C;  2K9J B;  1LTI C;  1SFC D;  1SQB D;  3L74 J;  3U59 A;  2KYV A;  1M1J A;  1KIL C;  1RHZ B;  1M7L A;  2W6J H;  3EFG A;  2WVR A;  4W7Z A;  1JB0 J;  1KYO E;  3AE4 C;  3AED C;  3CCM P;  2Q1K A;  1YIT P;  1GL2 B;  1LGH B;  1CZQ A;  2A45 I;  1RE3 A;  2GUV A;  1JY2 O;  3HD7 C;  1M1K Q;  1IFI A;  1NOH A;  3C1L A;  5GTH E;  3A5T A;  3WUV A;  4BRY B;  2OTL P;  1MFZ A;  3H32 B;  3VN0 A;  5KLV J;  4EDF A;  5TIS H;  3CX5 D;  1HUC A;  3AEE C;  1FZF A;  1KZU B;  3CC4 P;  1FZC B;  3L75 D;  1IFM A;  3SFE C;  3D71 A;  4WWI A;  2YXQ B;  2E5Y A;  2Q3E A;  1L4A C;  3PLN A;  3AE5 C;  1TU3 F;  1AVO A;  1BE3 E;  2CK3 H;  2HG5 D;  3JCU H;  2XU6 A;  1PGP A;  3L74 G;  4WY4 C;  1S1C X;  3FWN A;  1VQ9 P;  3L72 E;  4PV1 B;  1L0N J;  3AE8 C;  2OTK E;  1Q82 Q;  1VQ5 P;  1EXJ A;  2FXP A;  1W2E A;  4NPF X;  5KLI C;  4IFM A;  2LKM A;  2A06 D;  1EC5 A;  3RK2 B;  1T6A A;  4HH2 A;  1OWA A;  4PD4 I;  1UII A;  5CCG D;  2R3S A;  2H43 A;  1YHQ P;  1NHL A;  1PGO A;  3HTK A;  3RK2 C;  1GZL A;  2AXC A;  1RF1 A;  2QJY B;  2ZVO B;  1NTM J;  3B5N A;  2LR2 A;  2O01 J;  4RJT A;  1GMJ A;  1H0T B;  1OW7 A;  1SFC A;  2AXT E;  4YXD C;  1AV1 A;  2IYO A;  2KSJ A;  3MIW A;  2C9N Y;  3FXD A;  3H1L G;  1RF1 B;  1AJY A;  1SQV D;  1SQX G;  5AW5 B;  1S3J A;  2BEZ F;  2CPS A;  1JCD A;  4HB1 A;  1KFM A;  4L76 A;  5GTI E;  1L0N E;  2CPB A;  2WSE H;  3IR9 A;  3L37 A;  1G1I A;  4A7P A;  1N7S C;  1SQB K;  2KXP B;  1YJ9 P;  3U1C A;  1RY3 A;  4BXL A;  2KZI A;  3AE1 C;  2W90 A;  2W6A A;  3H1H G;  3OAK A;  4AUW A;  4JQ0 D;  3GMA A;  3CCS P;  3H1K E;  1OMI A;  3FWL A;  1SQP D;  3FGA D;  3H25 A;  1N7L A;  2Q5U A;  3MP7 B;  1LP1 A;  2VRS A;  2WSC H;  3GW6 A;  3H1I E;  1Q90 D;  3L70 E;  4D6T D;  2M5A B;  4IFD K;  1NAF A;  3MUD C;  4I1L A;  1FAV A;  4W7Y A;  4IL6 X;  2E74 B;  3SWY A;  4AYC A;  1FOS F;  2I8D A;  2RKL A;  2WZ7 A;  3E1R A;  4N6J A;  1MZ9 A;  3L70 J;  1IJD B;  2OQQ A;  4RO0 A;  1OXZ A;  2NZ2 A;  4KHX A;  4H44 C;  1AQ5 A;  2IDB A;  3L74 E;  1KOR A;  1YQ3 C;  3G6E P;  1KQG B;  1Q86 Q;  1NTK D;  3L71 D;  2FYU E;  3A2A A;  5CBO A;  2WPS A;  4DZO A;  1EXI A;  1EZV E;  1KMI Z;  1FJP A;  3RK3 E;  4RKU J;  3HE4 B;  3L75 E;  1FZE A;  1M8O B;  5KAI H;  3CCR P;  1LT1 A;  2HFE D;  1VQ6 P;  1NTZ J;  4YPC A;  2B89 A;  1VF5 B;  5AW3 B;  1K9M Q;  1GW4 A;  1NTK E;  3L71 E;  3Q3D A;  1ZV8 A;  5CBN A;  4DCK A;  1NWQ A;  4ASW A;  3R4Y A;  1NYH A;  4OVN F;  3V2P A;  3GHG B;  3RK2 D;  3H1I G;  1N2D C;  4PD4 E;  2I1K A;  2OYI B;  1YBK A;  1KIL A;  2W8Z A;  2ZYD A;  1J1E B;  1MUU A;  2BEQ D;  1RE4 A;  3BAT A;  3H1H E;  4D6T G;  2ZT9 C;  1QL1 A;  1DH3 A;  1RF0 C;  2P58 A;  2QM7 A;  1FZC A;  4H0L D;  5CCH D;  3C9I A;  4WY4 B;  1NU1 G;  2UWJ E;  4MN4 C;  3A0H H;  3VYI A;  2HOD B;  1J2J B;  1OVR A;  2QJK B;  3L72 J;  4HJG H;  1SQV E;  1RE4 C;  4LC1 A;  2WPQ A;  3KDP B;  3H1H D;  4OGQ B; 
#chains in the Genus database with same CATH homology
 3H6P A;  1NTK K;  1GDT A;  1JY2 N;  2Z5H A;  3P8M C;  4WY4 A;  1GU4 A;  3BRT B;  2Z5I A;  3M9B A;  1FJK A;  2Q9I A;  1SVF A;  1ZR2 A;  1CI6 B;  1VDF A;  1FU1 A;  2C0W A;  1JY2 P;  3KPE A;  3V4Q A;  3E1I A;  3VP8 A;  3NXS A;  1NU1 K;  1J1E C;  3P7K A;  3RK3 B;  2WTY A;  1RE3 C;  1FBM A;  1H8A A;  2HLO A;  1EQ7 A;  1CSB A;  2XKM A;  1LTJ C;  1L4A D;  3V4W A;  2N1T A;  2PAJ A;  5AW9 B;  3KYQ A;  3MGN A;  5AVZ B;  1JCC A;  1YTZ I;  2YKP A;  2OYH B;  1XTG B;  1YTZ T;  3M9Q A;  2WT7 A;  3NTN A;  4IFF A;  1URQ D;  3T97 A;  3M0A A;  1NO4 A;  1T2K C;  1T2K D;  3M06 A;  3HE5 A;  1N73 C;  3B5N C;  3M91 A;  1LWU B;  3BRV B;  2ZXE B;  1JTH B;  1GTW A;  2HYN A;  4GT1 A;  2XDJ A;  4GIF A;  1IO4 A;  3BVH A;  1GL2 C;  2J59 M;  3PP5 A;  1LTG C;  3B5N B;  3V2N A;  3G3Z A;  2Q3I A;  2WWW A;  2Q7C A;  4AQR D;  3TNU A;  1LWU A;  4M3L A;  1IK9 A;  2FXM A;  1DEB A;  3RL0 B;  4WY4 D;  2JEE A;  1HGV A;  1N7S D;  5AVR B;  1RF0 A;  1LTT C;  2KOG A;  3KQG A;  1FZG A;  2YKO A;  2WIT A;  1H89 A;  1URQ B;  3CI9 A;  5APY A;  2NPS A;  5AW7 B;  3HE4 A;  1WRG A;  5AVW B;  1FDM A;  5APU A;  2JJL A;  1NKN A;  4Y99 B;  5CJ4 A;  1SQX K;  4HYT B;  1L4A B;  2P7J A;  3RK3 C;  1FZC C;  3NMD A;  5KJ7 C;  5AW0 B;  1JY3 N;  2KP8 A;  1KFN A;  4C7N A;  5CJ0 A;  1J1D B;  1T3J A;  4DOJ A;  1NTM K;  3OJA B;  3A3Y B;  2YNY A;  1JTH A;  2A45 H;  4N3Y B;  1FOS E;  3M0D C;  1JY3 P;  5AVV B;  2J58 A;  4C7N B;  3TK1 A;  2H7H A;  1HVV A;  5AW8 B;  5CCG A;  1X9V A;  3O8Z A;  2FFD A;  1FZA A;  2POH A;  2M8R A;  1YYC A;  2A45 G;  2OAR A;  2N1T D;  1DX7 A;  2C9L Y;  1LTA C;  3HD7 D;  4I2L C;  5KLV K;  2O1K A;  5BU8 B;  1G1J A;  3OA7 A;  1A02 J;  2XZR A;  1JY3 O;  2H8P D;  1URQ A;  3LW5 H;  1SFC C;  4C46 A;  2N1T C;  3MUD A;  3VOP A;  2Z4E A;  1JUN A;  3EQ2 A;  1LTJ A;  3GHG C;  1Z56 A;  4LLH A;  3MD0 A;  3HE5 B;  3R2P A;  5CMZ A;  1LT9 B;  1N7S A;  5CCG C;  1CI6 A;  3BAS A;  4JYB A;  2W6B A;  2R3C A;  2YMY A;  3N7N A;  4XE5 B;  1G2C A;  5AW6 B;  1GU5 A;  3V2R A;  5APX A;  1AFO A;  1SP4 A;  1FZB A;  2IFN A;  5AVS B;  1RF1 A;  3VMX A;  3HUS B;  2R32 A;  3V5B A;  4C7R A;  1GL2 D;  3HD7 B;  2E42 A;  1IFN A;  3L36 A;  4W80 A;  1GL2 A;  3VMZ A;  4O9B A;  1GW3 A;  3B8E B;  1LTB C;  1E5W A;  3HUS A;  2W27 A;  2FFD B;  1L0N K;  2GUS A;  2QM8 A;  5AVT B;  2WT7 B;  5APT A;  4EOT A;  2NPS D;  1VPC A;  2YKQ A;  2C0X A;  2NPS B;  1A02 F;  1T8Z A;  1LT9 C;  3VP9 A;  2OYI A;  1X8Y A;  3TYY A;  1NKZ B;  4Y99 C;  1MV8 A;  2L5G B;  1PFI A;  1RF1 C;  1CW5 A;  2HPC B;  1L0L K;  2OYI C;  2N9B A;  4B86 A;  2IFM A;  2M3B A;  5CCH C;  3TSI A;  1LTJ B;  1M1J C;  5AW1 B;  3B5N D;  4ZKU A;  2R5D A;  3RL0 C;  3P8C E;  4ZKP A;  2XNX A;  3L4F A;  5KJ7 D;  3RK3 D;  1H88 A;  4EIJ A;  3SWF A;  5KJ7 A;  2P2U A;  2FFD C;  3U1A A;  3CLQ A;  1JOC A;  1JO5 A;  1KIL D;  2IPP A;  2YO2 A;  1T3U A;  2WSF H;  3HD7 A;  2PP6 A;  3NFQ A;  3WMM 0;  5CCH A;  3HRN A;  5AW4 B;  2MJZ A;  1N73 B;  1S9K E;  1KQL A;  5BU5 A;  5AVY B;  2R5B A;  1J1D C;  1JMM A;  1ZLL A;  3MTU E;  1L4A A;  2O01 H;  5APS A;  3UIA A;  2FYZ A;  1N73 A;  1GK6 A;  5APQ A;  2OYH C;  4OH8 B;  3LIE A;  1ZR4 A;  5AW2 B;  1M1J B;  4JF7 A;  2KB7 P;  5KTB A;  1HWT C;  5AVX B;  3GHG A;  4WB4 A;  1URQ C;  4XA4 A;  4N78 D;  2ZFC A;  5CHX A;  3M9H A;  1SLQ A;  1IFD A;  1SQV K;  3P8C D;  2KLV A;  4LGD E;  3LID A;  1IFJ A;  2I1J A;  2FYU K;  2XV5 A;  1WT6 A;  2P1J A;  5APV A;  1SQP K;  1NH4 A;  1LWU C;  2O1J A;  3N4X A;  4N78 E;  1HJB A;  1KIL B;  4I6M C;  1JNM A;  3HUS C;  3II6 A;  3V2Q A;  1N7S B;  2BAS A;  1HH0 A;  1LTS C;  3IFM A;  1HBW A;  3VTP C;  2GM4 A;  1S9K D;  3RL0 D;  5APW A;  1GK4 A;  4GKG A;  2FKW B;  1NTZ K;  2E43 A;  3CL3 D;  1QL2 A;  1SQQ K;  3TNU B;  2WPR A;  3I5C A;  4WBA A;  5BVZ A;  1GD2 E;  1IC2 A;  3VMY A;  2IX7 C;  1N86 A;  3A7O A;  3HTK B;  3M0D A;  2HOD A;  2YO3 A;  3P32 A;  2N1T B;  5AVQ B;  1SFC B;  4RES B;  1HTL C;  1LT9 A;  1ZN5 A;  3L35 A;  2NPS C;  4JYC A;  2HPC A;  5AVU B;  1G2C B;  2P67 A;  1X79 B;  1HGZ A;  3H32 A;  1XTC C;  3U59 A;  1LTI C;  1SFC D;  2KYV A;  1M1J A;  1KIL C;  1M7L A;  3EFG A;  4W7Z A;  1GL2 B;  1LGH B;  1CZQ A;  2A45 I;  1RE3 A;  2GUV A;  1JY2 O;  3HD7 C;  1IFI A;  1NOH A;  3A5T A;  1MFZ A;  3H32 B;  3VN0 A;  1HUC A;  1FZF A;  1KZU B;  1FZC B;  1IFM A;  1L4A C;  2HG5 D;  2XU6 A;  4WY4 C;  1W2E A;  4IFM A;  2LKM A;  3RK2 B;  2OYH A;  4HH2 A;  5CCG D;  1OWA A;  2H43 A;  1NHL A;  3HTK A;  3RK2 C;  1GZL A;  3B5N A;  1SFC A;  2KSJ A;  3MIW A;  2C9N Y;  1RF1 B;  5AW5 B;  2CPS A;  1JCD A;  1KFM A;  2CPB A;  2WSE H;  3IR9 A;  3L37 A;  1G1I A;  1N7S C;  1SQB K;  3U1C A;  1RY3 A;  3OAK A;  2W6A A;  4AUW A;  1N7L A;  2Q5U A;  2VRS A;  2WSC H;  4IFD K;  1NAF A;  4I1L A;  1FAV A;  4W7Y A;  3SWY A;  4AYC A;  1FOS F;  2WZ7 A;  4N6J A;  1MZ9 A;  1IJD B;  1OXZ A;  4KHX A;  1AQ5 A;  3A2A A;  2WPS A;  4DZO A;  1FJP A;  3HE4 B;  1FZE A;  2HFE D;  5AW3 B;  1GW4 A;  1ZV8 A;  1NWQ A;  3V2P A;  3GHG B;  3RK2 D;  1N2D C;  2I1K A;  2OYI B;  1KIL A;  1J1E B;  1MUU A;  1RE4 A;  3BAT A;  1QL1 A;  1DH3 A;  1RF0 C;  2QM7 A;  1FZC A;  5CCH D;  3C9I A;  4WY4 B;  3VYI A;  2HOD B;  1J2J B;  1RE4 C;  4LC1 A;  2WPQ A;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...