5APUA

Sequence iankedkad inserted between gcn4 adaptors - structure a9b black
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
b'HMKQLEDKVEELLSKVYHLENEVARLKKLIANKEDKADMKQLEDKVEELLSKVYHLENEVARLKKLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 28
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apuA00
3LIEA 3VMXA 1SP4A 5AVWB 2R5DA 5AW5B 2P67A 5CMZA 1JNMA 1GTWA 3I5CA 3VTPC 3TK1A 4LC1A 4I6MC 1GU4A 5AW3B 3P7KA 3L35A 1A02J 2XZRA 3B8EB 1OXZA 1MV8A 1H8AA 1FOSF 2YNYA 3M06A 3M9BA 2E43A 1NAFA 3VN0A 1S9KD 1MFZA 3M91A 5AVZB 2KP8A 5APQA 3M0DA 4C7NA 4AYCA 3NTNA 3HE5A 3LIDA 2QM8A 2Q3IA 3A7OA 5APTA 5AW2B 2Z5HA 3V5BA 3TNUB 3VYIA 3P8MC 2Z5IA 4GKGA 3VMYA 4HYTB 4KHXA 2WT7A 1GD2E 5AVVB 4JYCA 1SLQA 2Q7CA 5AW0B 3OAKA 1KQLA 3NFQA 2WTYA 3A2AA 5AW9B 4JYBA 1GK6A 3V4QA 3A3YB 5AW4B 2IPPA 1H88A 4EOTA 5AVRB 1HBWA 2WWWA 2VRSA 3MD0A 2XV5A 2WPSA 3M0AA 4B86A 3O8ZA 2P7JA 2C9NY 2YO3A 5AW6B 1A02F 2R3CA 1CI6A 3KQGA 4DZOA 1J2JB 4M3LA 1S9KE 5AVYB 3HE4A 2C9LY 1YYCA 5AW1B 5APSA 3TYYA 1T2KD 3L36A 5AVSB 2QM7A 2E42A 1OWAA 1G2CB 5APYA 1GU5A 2JJLA 3SWFA 5AW7B 4C7NB 2YO2A 5APWA 2H7HA 1GZLA 3M9HA 3HE5B 1CSBA 2Q5UA 5AVXB 1JUNA 3NMDA 1CZQA 4AUWA 2WT7B 2N9BA 2W6AA 3V4WA 5AW8B 5AVTB 2R32A 5AVQB 4RESB 1FAVA 1FOSE 1T2KC 5APVA 4C46A 1X8YA 4AQRD 2WPQA 3NXSA 4I2LC 5APXA 1HUCA 1DH3A 2XU6A 3TNUA 3L37A 1HJBA 4XE5B 5AVUB 2W27A 3P32A 1IO4A 2WPRA 3A5TA 5APUA 1H89A 4GT1A 1GK4A 3IR9A 3HTKA 1MUUA 2ZXEB 3UIAA 1NWQA 1HWTC 2R5BA 1CI6B 3T97A 2P2UA 3MGNA 3KDPB 3VMZA 3HE4B 2BASA 2ZFCA
chains in the Genus database with same CATH superfamily
1ZR2A 3N4XA 3H32B 4RO0A 2XNXA 5AW5B 3H6PA 2QJKC 4Y28J 1GTWA 3RK3B 3CX5D 2G8YA 3L75J 2FYUE 3CMEP 1EDKA 3L73J 2FYZA 1VQMP 1EDJA 2WZ7A 2WSFH 3Q1MA 2MKVA 3NTNA 3HE5A 5KLVK 2QM8A 2K1AA 2WT7A 1IZNB 3L75G 4JYCA 2E5TA 5TISH 1M56D 3R4YA 3AEDC 3OAKA 1J1DB 1IFDA 4EOTA 3CCMP 3CCSP 1N2DC 4IFDK 4UB8E 2OYHA 1U7MA 4R4LA 4PD4E 2YXRB 4YXDC 3G4SP 4CPGA 3PH0A 3V2NA 2YO2A 3S4RA 2Q5UA 2I8DA 3W68A 1NTMJ 1R8EA 1T2KC 1OX3A 2FXPA 4RJTA 2YIUB 1VQKP 5AVUB 4BWNA 2W27A 3TGUD 1KILE 3RGUA 1H89A 3UIAA 3Q5RA 1L0LD 1BE3D 1NTMG 1RH5B 1KB9H 3L70E 5AVWB 1KD1Q 3P7KA 3B8EB 2Q9IA 1YBKA 3CD6P 2ZVOB 1RE3C 1MFTA 2CK3H 2IFMA 3RL0C 4QMAA 3AE7C 1QGKB 2H43A 2O1JA 2POHA 4XFJA 1FDMA 1L4AB 2OYIA 1PGPA 2ZVNB 2P1JA 4NPFX 4ASVA 1HBWA 2I1JA 3FWLA 1OFCX 3PP5A 3O8ZA 1VQPP 2V7QJ 5AW6B 2FYNB 2GUSA 3K5BA 2ZXXA 1RE4A 2IFNA 1YJWP 1KQFB 1H0TB 3WUUA 4IOIH 2E42A 1L4AD 2JJLA 4W80A 3FWNA 3H1JE 3KZIH 1L0NE 2M0BA 3G3ZA 4IFMA 2B9BA 2N9BA 3CCQP 4UB6H 4RESB 1GW3A 2G3AA 3G6EP 1HUCA 2IZ1A 3H1KG 2GM4A 3B5NC 2WPRA 1LWUA 2M5AA 4WY4C 2HYNA 3GF7A 1JY2N 2XDJA 2BASA 2ZFCA 1AJYA 2W6BA 1N73A 4HKZH 5CMZA 3N7NA 4N78E 2JDIH 2OTKE 3HRNA 4I6MC 3MHVA 3L35A 1W2BO 2QJPB 1SQVK 3GHGB 3PRJA 3LW5J 4ASWA 1FOSF 4DOJA 3M06A 2IYPA 3L74G 1FZCA 2HODA 3CCEP 4H0LB 1JO5A 2KP8A 5APQA 2PRRA 2FFDC 2WMMA 2A45H 3BCCE 1HTLC 3USSA 1W2EA 2E74B 4GKGA 3V2RA 2QSIA 1LTJB 2YKOA 2J58A 2Y0DA 2KXPB 1NTMD 3D6YA 2VRSA 2XV5A 1S3JA 4IL6H 4H0LD 1JY3N 1A02F 2B87B 2WSFJ 2O3JA 1S9KE 1M1JA 2NRGA 3L4FA 2M8RA 1N7SA 1OMIA 1VQ6P 1L2PA 1SQXK 4I7ZB 1FU1A 4GIFA 5CCGC 4KJMA 1Q86Q 4AQRD 1T3UA 1OVUA 2BCCE 1HJ0A 1NOHA 3H1LE 1GL2B 3H25A 1RF0C 3HTKA 4TLFA 1RF1A 2O01J 1SQQG 2P67A 5CHXA 1IJDB 1NO4A 3CCLP 2KLVA 3A0HH 5H2FH 1MV8A 3G71P 1LT9C 1Q81Q 1SQPE 3IAOA 4XA4A 1UIXA 3H1KD 1VDFA 1HH0A 2K9JB 2AEJA 1L0LK 1S1CX 3CX5E 3Q5SA 1NTZK 2QJYC 1U7JA 1YTZT 1JEKA 5KKZB 1PFIA 1BSNA 4N3YB 1JCCA 1M57D 3KQGA 4IL6X 3CX5I 3HE4A 1NTKJ 1NJIQ 1DD3A 3AEFC 2E75D 3L74D 5GTHE 1EDIA 4L75A 4OGQB 3TDKA 1ZRTD 4C7RA 5CCHA 1G1IA 3HD7C 3V4WA 1BGYJ 1IFNA 1EDLA 1FS0E 1KILA 1NHLA 1QEXA 5EFWB 1PP9G 1AA0A 5E79E 3VOPA 2HFED 3CXHD 2NPSB 1HF9A 3H1HJ 3CI9A 5KTBA 1IK9A 1S2EA 3VMZA 2M3BA 1BGYG 1TU3F 3HD7B 1J1EB 4OGQD 3CC7P 5KLIB 1FJKA 3RL0g 3JCUE 2YKPA 3H1HG 4H44C 1MFZA 3FX0A 3TGUE 1R5LA 1X0TA 2AXTH 2Z5HA 1FZAA 4PV1C 2IBZI 2RN0A 4KHXA 1L0LE 1BE3E 5AVVB 1KC8Q 5AW9B 1GDTA 2KZJA 2A45I 2OYHC 2R3SA 2AEMA 1SQQD 3PJSK 2V7QH 3M0AA 4PV1B 3CWBJ 2KK7A 3RK2D 4IL6E 5B66H 4K3AA 5APYA 1G2CB 3IF4A 2IBZG 5AW7B 4ZKUA 2R44A 2HPCA 3GG2A 2R32A 2A45G 1FJPA 5KAFH 1OZHA 2W8ZA 1VQ5P 5DJUB 3H1IJ 2PAJA 3BASA 1LNQA 1NTMK 1SFCB 1DD4A 3P32A 1AVYA 2WVRA 1OW8A 2Q3EA 3P8CD 1KB9D 4BRYB 3SWYA 4NPEA 1RQVA 2PFXA 3MUDA 2W90A 2SPZA 4N6JA 1N86A 1PZQA 1SFCD 5L8RJ 5C39A 1URQB 1YQ4C 3WU2E 2RKLA 1ZXGA 3O6QA 3A7OA 3TNUB 2N1TB 2OYIC 2Y9YA 1PP9D 1IFJA 4D6TJ 4ZKPA 4IFFA 4H13D 1IC2A 3FGAD 1GK6A 1RY3A 1BGYD 1OW6A 2ZT9B 3SFDC 2WWWA 1RE4C 3MD0A 3Q3DA 2YO3A 3SWKA 2QJKB 4D6TG 2QG4A 3H1HD 3RK3D 3L73G 1N8RQ 2B88A 2H7HA 2BEQD 1JUNA 3V6IA 2ZT9D 1NTME 1SQBJ 1S4XA 1LWUC 2OTLP 2O01H 3II6A 1N73C 4A7PA 3E7KA 1NU1J 1SQBG 3B4SA 4YTPC 1JTHB 3WMM0 2JEEA 3S9OA 1KZUB 3V2QA 1L0NK 1P84D 5BVZA 1VQLP 2IBZD 5KAIE 2RH0A 1YQ3C 1FZCC 4WWIA 1N73B 1KFNA 1NU1G 3AE3C 2WSCH 3M91A 2ZAEB 3M0DA 1NAYA 4L74A 3A0BE 2LXBA 3MZWB 3C1LA 2HODB 1JY2O 3T97B 2IPPA 3AE2C 4TT3H 3WUTA 3EWKA 1M1JC 5CJ0A 1WT6A 1N7SC 2KYVA 3GLMA 3H32A 4LGDE 1YYCA 5APSA 1T2KD 4RKUJ 2JWAA 3H1KE 2LKMA 2KUBA 4C7NB 3W67A 1E79H 4WBAA 1IFIA 3RL0B 1D7MA 2WPQA 3BRTB 4ZNCA 1QX8A 1RF1C 4DCKA 1YTZI 5KLVJ 2OTJP 1SQQK 2OYOA 3AE5C 2KOGA 2HR3A 2JWDA 1JY3O 3L74E 4D6TD 3L75D 1LTIC 3RL0D 1GMJA 1QLED 3L73D 5AW3B 1ZRTE 5KLVG 1R5SA 2Z4EA 2PP6A 2J5UA 4YXWH 4WB4A 1KTMA 3CXHE 1M7LA 3U59A 3AECC 2Q3IA 2KZIA 3Q2YA 1LTSC 2P10A 2KS1B 2Q7CA 1PV3A 2LXCB 3CXHI 1P84H 4HB1A 1KQLA 1NVOA 2QE7H 3B5NB 3H1JJ 3ITKA 4WY4B 1SQBD 1IK7A 1PPJG 2Y0CA 3D71A 1SQPK 3PHLA 1EXIA 1X22A 1NU1D 5TISE 1AFOA 5CCHC 3B5ND 1ZW0A 1S5LH 4WY4D 1CZQA 3F89A 1KILC 2FFDB 1AV1A 3VP8A 3L72J 1M8OB 1SQQE 3R2PA 2A06G 2I1KA 3TSIA 1T8ZA 2E74D 1U57A 4XE5B 1LP1A 2E76C 1IFPA 1L4AA 1MUUA 1CI6B 4DJGA 3L72G 3BCCJ 1KILB 1Q82Q 1SP4A 1HGZA 1NYHA 5DJTB 1SS1A 1NH4A 2KSJA 4U3FJ 1FE6A 1KYOD 3B71A 4PJ0H 1H0TA 2L5GB 1NGMB 2E43A 3BCCG 2D2CC 2HG5D 1Y9BA 3CC4P 3FXEA 2KNCA 3VMYA 1WRGA 3P8CE 1KB9E 3CPWO 4U3FG 2FXOA 3PTZA 1N7LA 3OJAB 3NFQA 1ZV8A 1KB9I 1ZR4A 1Y47A 2D2CB 1GL2D 1JB0J 2WPSA 1KQGB 2WSCJ 1Q7YQ 2R3CA 1J2JB 4M3LA 5KLVD 2E75C 5CCGD 2C0WA 3SSUA 3TYYA 1MZ9A 3SFEC 1SVFA 1PP9E 5GTIH 1LT9B 1EZVG 3GHGA 3OW2O 3D6ZA 1BCCJ 3CCVP 4OVNF 1SQVJ 5AVQB 1BGYE 2ZYGA 1QVFO 2ZYAA 1JOCA 1DH3A 2HPCB 1LTJA 1PPJD 1X79B 3QH9A 3IR9A 1DX7A 3H1HE 2QJYB 1NWQA 2R5BA 1BCCG 3MGNA 3RK3E 1SQVG 3KZIE 3VMXA 3MUDC 1ZOYC 1NTKG 4UB6E 3TK1A 1YJNP 2B87A 1A02J 2FBWC 1OIPA 4UB8H 3ZDMA 1PGQA 1OW7A 1FDIA 1EC5A 1LTBC 2JP3A 2A06D 1VF5C 1EQ7A 3GF3A 4PD4H 1SQXJ 3AEAC 2Z5IA 3P8MC 1QVGO 1K8AQ 2HLOA 3BVHA 1PGOA 4L76A 2H8PD 1P84E 1USDA 3L72D 2IBZE 5AVRB 1RHZB 4ZMDA 1XTCC 3RK2C 1KYOH 1JMMA 1FZGA 2NPSD 1GL2A 5TJHA 1NKZB 1SQXG 1NKNA 1P84I 2C9LY 1ZMEC 3HD7D 1PGJA 2ITAA 4DT0A 5AVSB 1T3JA 2QIWA 1QL1A 1JM0A 2OARA 3HE5B 4H44B 3U1CA 1KN7A 2GA1A 2WT7B 4U3FD 1ZP0C 5APXA 5BU8B 1LTGC 2YMYA 3L71J 2KIKA 4GT1A 2OYHB 4YPCA 2K9JA 5KJ7D 4H44D 1BDCA 3LIEA 2OQQA 3CWBG 1FZEA 1L0LJ 1BE3J 2NZ2A 1NTZJ 1NU1K 4PV1D 1GU4A 3L71G 2JKVA 1EZVD 3M0DC 3AE8C 2M3EA 2K88A 1USEA 4Y99C 1LJ2A 1NTZG 4H13C 4HYTB 3CLQA 3H1IG 4D6TE 3L75E 1S72P 1BCCD 3L73E 1SQVD 2O1KA 2XNDH 3BATA 3A0HE 5H2FE 1LGHB 2H88C 2NPSA 4Y99B 3KPEA 1NTKD 4DZOA 2YMKA 3RK3C 3JC22 4Z1MH 5CBOA 2CPSA 5AW1B 2KI7B 3L36A 1YITP 2Q6QA 4GOFA 1GZLA 1K04A 3U1AA 1KMIZ 2Y0EA 2YKQA 2OGUA 1URQD 2IDBA 2W6AA 1SQBE 2H89C 2OYIB 1X8YA 3NXSA 1Q90D 2N1TD 3Q5PA 1K05A 2FXMA 1IO4A 1J1DC 2ZXEB 1SQXD 2P2UA 2UWJE 1NU1E 1MKMA 5KJ7A 3GMAA 3HUSA 4NPDA 3VTPC 2FYUJ 2DW3A 2XZRA 2GUVA 1H8AA 1G2CA 1YIJP 1K73Q 4AYCA 1FZFA 4LLHA 5AW2B 3M9QA 4HJGH 3V5BA 1LWUB 2M5AB 3EFFK 2FYUG 2YIUC 5AW0B 3I56P 3A2AA 4JYBA 3CC2P 1SFCA 1VQ4P 3CWBD 4PD4I 1KQSO 2AEFA 1YI2P 2IYOA 1KYOE 3MP7B 3L71D 3RBXA 5B5EH 2AXTE 1PIXA 4BRYA 1W5CE 2QM7A 1FZCB 1KYOI 3CMAP 4EIJA 1NTZD 2PGDA 3H1ID 5AW8B 1URQA 1L4AC 3TNUA 2N1TA 1HJBA 5KLVE 5B66E 2B89A 1GK4A 3I55P 4OWFA 1M1JB 2FYNC 3L70J 3KHUA 1BDDA 1N7SB 2N9YB 1LP1B 3I5CA 3KXDA 3CX5H 5KAFE 1NAFA 5AVZB 3L70G 3F5HA 1PPJE 2FKWB 2BEZF 4JQ0D 1AVOA 1N7SD 5GTHH 3AEEC 3HTKB 1RF1B 3H1KJ 5AW4B 4K35A 2LR2A 4WVZA 2KNCB 4HH2A 4MN4C 4B86A 1VQ9P 2C9NY 5E79H 3CCRP 2A06E 1JTHA 2QJPC 1OWAA 1YHQP 3GHGC 1UIIA 2IX7C 1L0NJ 2CPBA 4H0LC 3L74J 3JSVC 1FC2C 3QWOC 3L72E 3WUVA 2FYUD 5AVTB 2E74C 1FAVA 3JCUH 3CCUP 1LTJC 3C9IA 2XKMA 3H1JG 1L0NG 2FY8A 1VQNP 3T97A 1NTKK 3HE4B 2WSEH 1JNMA 1OVRA 1X9VA 2E5YA 1YJ9P 2MJZA 4U3FE 4I7ZC 1GW4A 3VMAA 3VN0A 2P58A 4EYYQ 4C7NA 1XTGB 4PD4D 1KV4A 5APTA 3VP9A 2YXQB 1JCDA 1HGVA 1RE3A 2K37A 3CCJP 2WPVB 4U7JA 2WTYA 2E76B 1GL2C 3A3YB 2C0XA 1H88A 3MTUE 1KORA 1EZVE 5CCHD 2P7JA 3IN6A 4GDOA 1SQQJ 5CJ4A 2IZ0A 3V2PA 3EFGA 1DEEG 2KSEA 1KILD 2QRXA 3MIWA 3FXDA 3TF5A 1EZVI 5B5EE 2JR8A 1GU5A 1WMKA 4EI2A 3L70D 1JY2P 2E76D 3KYQA 1BCCE 5CBNA 1SQVE 4JBZA 1FOSE 5APVA 3D70A 4I2LC 2BCCJ 1VQ7P 5M1BA 2W83C 1K9MQ 1NTKE 2KS1A 1JMBA 5APUA 3H1LJ 3WU2H 3BRVB 3B5NA 3KDPB 5KKZC 4WY4A 1S5LX 2R5DA 2D2CD 2BCCG 1Q2NA 3RBZA 2E75B 4LC1A 2J59M 3H1LG 1BSHA 2YNYA 1FDOA 1SQPJ 4I1LA 5BU5A 4OGQC 4R4MA 3AEGC 3LIDA 1JY3P 3VYIA 1SQXE 1HVVA 1PL5A 4EDFA 2FFDA 1FZBA 3H1JD 1SLQA 4W7ZA 1L0ND 1KFMA 1PP9J 3E1RA 1SQPG 2NPSC 4L73A 2KB7P 4GODA 1G1JA 3AE1C 3EQ2A 1J1EC 3CL3D 3ABVC 1CI6A 3AE9C 3OA7A 5AVYB 5K5GB 5KLIC 2JO1A 2QEXP 2RMZA 1RQUA 3SWFA 2Q1KA 3O6QB 5APWA 3M9HA 1CSBA 4N78D 1M1KQ 3NMDA 1OVVA 1Y8AA 1VF5B 5KAIH 2Y9ZA 4C46A 3CWBE 2WQYC 3AE4C 5CCGA 4JF7A 2XU6A 3L37A 1AQTA 2KLUA 1VPCA 3AEBC 2QA4P 3L71E 5KJ7C 3BCCD 3GW6A 3HUSC 3A0BH 3RK2B 3C8VA 1LTTC 1VL2A 1IFMA 1RF0A 2ZJSE 1S5LE 2O01N 2K9YA 1ZN5A 1VF5D 2WSSH 1NTZE 1T6AA 1DEBA 1AQ5A 3H1IE 3PLNA 1SQBK 1OXZA 2AXCA 3HUSB 3M9BA 2V4HA 1S9KD 1M90Q 2FYUK 3TGUJ 3G9RA 1LT9A 2QVAA 4OH8B 1GD2E 2WSEJ 4O9BA 2ZYDA 1SFCC 1FBMA 1E5WA 3V4QA 1EXJA 1QL2A 3TGUG 1LT1A 1Z56A 4PJ0E 2BCCD 2WITA 1L0LG 3IFMA 1BE3G 1DIPA 3S1KA 3H1LD 4W7YA 3E1IA 1CW5A 1VQOP 1VQ8P 1URQC 4JPZB 5AVXB 3AE6C 4GOEA 4BXLA 4AUWA 2N1TC 1ZLLA 2K3RA 4H13B 4KT0J 2L91A 3LW5H 3HD7A 1SQPD 1LTAC 3A5TA 3CXHH 2ZT9C 1HWTC 2W6JH 5GTIE
chains in the Genus database with same CATH topology
1ZR2A 3N4XA 3H32B 1J1EB 3HD7B 1SP4A 1HGZA 1N7SB 2XNXA 5AW5B 3H6PA 1GTWA 3I5CA 3RK3B 1FJKA 1NH4A 2KSJA 2YKPA 2FYZA 2L5GB 2WZ7A 2E43A 1NAFA 1MFZA 5AVZB 2WSFH 2HG5D 3NTNA 3HE5A 2FKWB 2QM8A 5KLVK 2Z5HA 1FZAA 3VMYA 4KHXA 2WT7A 1WRGA 3P8CE 5AVVB 1N7SD 4JYCA 1N7LA 3HTKB 1RF1B 3OAKA 3OJAB 3NFQA 5AW9B 1GDTA 1J1DB 1IFDA 1ZV8A 5AW4B 2A45I 4EOTA 2OYHC 1N2DC 1ZR4A 4IFDK 4HH2A 1GL2D 2WPSA 3M0AA 4B86A 2C9NY 2OYHA 2R3CA 3RK2D 1J2JB 4M3LA 5CCGD 2C0WA 1JTHA 3TYYA 1OWAA 1G2CB 1MZ9A 3GHGC 5APYA 5AW7B 1SVFA 3V2NA 2IX7C 4ZKUA 2YO2A 1LT9B 2CPBA 2Q5UA 3GHGA 2HPCA 5AVTB 2R32A 5AVQB 2A45G 1FAVA 1T2KC 1FJPA 1LTJC 1JOCA 2PAJA 3BASA 1DH3A 3C9IA 2XKMA 1NTMK 1SFCB 5AVUB 2W27A 3P32A 2HPCB 1H89A 1LTJA 1X79B 3IR9A 3UIAA 1DX7A 1NWQA 2R5BA 3T97A 3MGNA 1NTKK 3P8CD 3HE4B 3VMXA 5AVWB 2WSEH 3SWYA 1JNMA 1X9VA 3TK1A 3MUDA 3P7KA 2MJZA 1A02J 4N6JA 3B8EB 2Q9IA 1N86A 1SFCD 1GW4A 3VN0A 1URQB 1RE3C 1LTBC 2IFMA 3RL0C 4C7NA 1XTGB 5APTA 3VP9A 1EQ7A 3A7OA 2H43A 1JCDA 3TNUB 2N1TB 2OYIC 1HGVA 2O1JA 3P8MC 2Z5IA 1RE3A 2POHA 1IFJA 2HLOA 1FDMA 1L4AB 3BVHA 4ZKPA 4IFFA 2OYIA 1IC2A 2WTYA 2H8PD 1GK6A 1RY3A 1GL2C 2P1JA 2C0XA 3A3YB 1H88A 3MTUE 5AVRB 1XTCC 1HBWA 2I1JA 2WWWA 3RK2C 1RE4C 1JMMA 3MD0A 3PP5A 1FZGA 2NPSD 1GL2A 3O8ZA 5CCHD 2P7JA 1NKZB 2YO3A 5AW6B 2GUSA 1NKNA 5CJ4A 3V2PA 3EFGA 1RE4A 2IFNA 1KILD 2C9LY 3HD7D 3MIWA 5AVSB 1T3JA 2E42A 3RK3D 1L4AD 2JJLA 1GU5A 4W80A 1QL1A 2OARA 2H7HA 3HE5B 1JY2P 3G3ZA 3U1CA 1JUNA 3KYQA 2WT7B 4IFMA 2N9BA 4RESB 1GW3A 1FOSE 5APVA 1LWUC 4I2LC 5APXA 5BU8B 1HUCA 1LTGC 2YMYA 2GM4A 3B5NC 2WPRA 1LWUA 5APUA 4WY4C 4GT1A 2HYNA 2O01H 1JY2N 3II6A 1N73C 2OYHB 2XDJA 3BRVB 3B5NA 3KDPB 5KJ7D 2BASA 2ZFCA 4WY4A 3LIEA 2W6BA 1N73A 1JTHB 1FZEA 2R5DA 3WMM0 2JEEA 5CMZA 1KZUB 3N7NA 4N78E 3V2QA 1L0NK 1NU1K 5BVZA 3HRNA 4LC1A 4I6MC 1GU4A 3L35A 2J59M 1FZCC 1SQVK 3GHGB 3M0DC 1FOSF 4DOJA 2YNYA 1N73B 1KFNA 3M06A 1FZCA 2HODA 2WSCH 4I1LA 5BU5A 1JO5A 3M91A 2KP8A 5APQA 3M0DA 2FFDC 2A45H 4Y99C 1HTLC 3LIDA 1W2EA 1JY3P 3VYIA 4GKGA 4HYTB 1HVVA 3CLQA 3V2RA 2FFDA 1FZBA 1LTJB 2YKOA 1SLQA 4W7ZA 2J58A 1KFMA 2HODB 1JY2O 2IPPA 2NPSC 3BATA 2O1KA 2KB7P 2VRSA 1LGHB 1M1JC 2XV5A 5CJ0A 1G1JA 1WT6A 2NPSA 3EQ2A 4Y99B 1J1EC 3CL3D 1JY3N 3KPEA 1A02F 1N7SC 1CI6A 4DZOA 1S9KE 3OA7A 5AVYB 3RK3C 1M1JA 2KYVA 2CPSA 3H32A 3L4FA 4LGDE 1YYCA 2M8RA 1N7SA 5APSA 5AW1B 1T2KD 3L36A 3SWFA 2LKMA 1SQXK 4C7NB 5APWA 1GZLA 3M9HA 3U1AA 1CSBA 4N78D 4WBAA 1IFIA 1FU1A 2YKQA 3NMDA 3RL0B 4GIFA 1URQD 2W6AA 5CCGC 2OYIB 4C46A 1X8YA 4AQRD 1T3UA 2WPQA 3BRTB 3NXSA 5CCGA 2N1TD 4JF7A 2XU6A 3L37A 1RF1C 1VPCA 1YTZI 1NOHA 2FXMA 1IO4A 1SQQK 1J1DC 5KJ7C 1GL2B 1RF0C 3HTKA 2KOGA 2ZXEB 1RF1A 3HUSC 1JY3O 3RK2B 2P2UA 1LTTC 5KJ7A 1IFMA 1RF0A 3HUSA 1LTIC 2P67A 3RL0D 5CHXA 1IJDB 1ZN5A 1NO4A 3VTPC 1DEBA 1AQ5A 5AW3B 2KLVA 2XZRA 1SQBK 1OXZA 2GUVA 1MV8A 2Z4EA 2PP6A 1H8AA 1LT9C 3HUSB 3M9BA 1G2CA 1S9KD 2FYUK 4WB4A 4XA4A 1M7LA 4AYCA 3U59A 1FZFA 4LLHA 5AW2B 1LT9A 2Q3IA 3M9QA 3V5BA 4OH8B 1LTSC 1GD2E 1LWUB 1VDFA 4O9BA 2Q7CA 1SFCC 5AW0B 1FBMA 1KQLA 3A2AA 1E5WA 3B5NB 4JYBA 1HH0A 3V4QA 1L0LK 4WY4B 1NTZK 1SFCA 1QL2A 1YTZT 1Z56A 1PFIA 4N3YB 2WITA 1JCCA 3IFMA 3KQGA 3HE4A 1SQPK 4W7YA 3E1IA 1CW5A 2QM7A 1FZCB 1AFOA 5CCHC 1URQC 4EIJA 3B5ND 5AVXB 4WY4D 1CZQA 4AUWA 1KILC 2FFDB 3VP8A 4C7RA 1G1IA 3V4WA 3HD7C 5AW8B 5CCHA 1URQA 2N1TC 1IFNA 1ZLLA 3R2PA 2I1KA 1KILA 1NHLA 1L4AC 3TSIA 1T8ZA 3LW5H 3HD7A 3TNUA 2N1TA 1HJBA 3VOPA 4XE5B 1LTAC 2HFED 3A5TA 1L4AA 2NPSB 1GK4A 3CI9A 1MUUA 1HWTC 5KTBA 1IK9A 1CI6B 3VMZA 1M1JB 1KILB 2M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  3VMX A;  1SP4 A;  5AVW B;  2R5D A;  5AW5 B;  2P67 A;  5CMZ A;  1JNM A;  1GTW A;  3I5C A;  3VTP C;  3TK1 A;  4LC1 A;  4I6M C;  1GU4 A;  5AW3 B;  3P7K A;  3L35 A;  1A02 J;  2XZR A;  3B8E B;  1OXZ A;  1MV8 A;  1H8A A;  1FOS F;  2YNY A;  3M06 A;  3M9B A;  2E43 A;  1NAF A;  3VN0 A;  1S9K D;  1MFZ A;  3M91 A;  5AVZ B;  2KP8 A;  5APQ A;  3M0D A;  4C7N A;  4AYC A;  3NTN A;  3HE5 A;  3LID A;  2QM8 A;  2Q3I A;  3A7O A;  5APT A;  5AW2 B;  2Z5H A;  3V5B A;  3TNU B;  3VYI A;  3P8M C;  2Z5I A;  4GKG A;  3VMY A;  4HYT B;  4KHX A;  2WT7 A;  1GD2 E;  5AVV B;  4JYC A;  1SLQ A;  2Q7C A;  5AW0 B;  3OAK A;  1KQL A;  3NFQ A;  2WTY A;  3A2A A;  5AW9 B;  4JYB A;  1GK6 A;  3V4Q A;  3A3Y B;  5AW4 B;  2IPP A;  1H88 A;  4EOT A;  5AVR B;  1HBW A;  2WWW A;  2VRS A;  3MD0 A;  2XV5 A;  2WPS A;  3M0A A;  4B86 A;  3O8Z A;  2P7J A;  2C9N Y;  2YO3 A;  5AW6 B;  1A02 F;  2R3C A;  1CI6 A;  3KQG A;  4DZO A;  1J2J B;  4M3L A;  1S9K E;  5AVY B;  3HE4 A;  2C9L Y;  1YYC A;  5AW1 B;  5APS A;  3TYY A;  1T2K D;  3L36 A;  5AVS B;  2QM7 A;  2E42 A;  1OWA A;  1G2C B;  5APY A;  1GU5 A;  2JJL A;  3SWF A;  5AW7 B;  4C7N B;  2YO2 A;  5APW A;  2H7H A;  1GZL A;  3M9H A;  3HE5 B;  1CSB A;  2Q5U A;  5AVX B;  1JUN A;  3NMD A;  1CZQ A;  4AUW A;  2WT7 B;  2N9B A;  2W6A A;  3V4W A;  5AW8 B;  5AVT B;  2R32 A;  5AVQ B;  4RES B;  1FAV A;  1FOS E;  1T2K C;  5APV A;  4C46 A;  1X8Y A;  4AQR D;  2WPQ A;  3NXS A;  4I2L C;  5APX A;  1HUC A;  1DH3 A;  2XU6 A;  3TNU A;  3L37 A;  1HJB A;  4XE5 B;  5AVU B;  2W27 A;  3P32 A;  1IO4 A;  2WPR A;  3A5T A;  5APU A;  1H89 A;  4GT1 A;  1GK4 A;  3IR9 A;  3HTK A;  1MUU A;  2ZXE B;  3UIA A;  1NWQ A;  1HWT C;  2R5B A;  1CI6 B;  3T97 A;  2P2U A;  3MGN A;  3KDP B;  3VMZ A;  3HE4 B;  2BAS A;  2ZFC A; 
#chains in the Genus database with same CATH topology
 1ZR2 A;  3N4X A;  3H32 B;  4RO0 A;  2XNX A;  5AW5 B;  3H6P A;  2QJK C;  4Y28 J;  1GTW A;  3RK3 B;  3CX5 D;  2G8Y A;  3L75 J;  2FYU E;  3CME P;  1EDK A;  3L73 J;  2FYZ A;  1VQM P;  1EDJ A;  2WZ7 A;  2WSF H;  3Q1M A;  2MKV A;  3NTN A;  3HE5 A;  5KLV K;  2QM8 A;  2K1A A;  2WT7 A;  1IZN B;  3L75 G;  4JYC A;  2E5T A;  5TIS H;  1M56 D;  3R4Y A;  3AED C;  3OAK A;  1J1D B;  1IFD A;  4EOT A;  3CCM P;  3CCS P;  1N2D C;  4IFD K;  4UB8 E;  2OYH A;  1U7M A;  4R4L A;  4PD4 E;  2YXR B;  4YXD C;  3G4S P;  4CPG A;  3PH0 A;  3V2N A;  2YO2 A;  3S4R A;  2Q5U A;  2I8D A;  3W68 A;  1NTM J;  1R8E A;  1T2K C;  1OX3 A;  2FXP A;  4RJT A;  2YIU B;  1VQK P;  5AVU B;  4BWN A;  2W27 A;  3TGU D;  1KIL E;  3RGU A;  1H89 A;  3UIA A;  3Q5R A;  1L0L D;  1BE3 D;  1NTM G;  1RH5 B;  1KB9 H;  3L70 E;  5AVW B;  1KD1 Q;  3P7K A;  3B8E B;  2Q9I A;  1YBK A;  3CD6 P;  2ZVO B;  1RE3 C;  1MFT A;  2CK3 H;  2IFM A;  3RL0 C;  4QMA A;  3AE7 C;  1QGK B;  2H43 A;  2O1J A;  2POH A;  4XFJ A;  1FDM A;  1L4A B;  2OYI A;  1PGP A;  2ZVN B;  2P1J A;  4NPF X;  4ASV A;  1HBW A;  2I1J A;  3FWL A;  1OFC X;  3PP5 A;  3O8Z A;  1VQP P;  2V7Q J;  5AW6 B;  2FYN B;  2GUS A;  3K5B A;  2ZXX A;  1RE4 A;  2IFN A;  1YJW P;  1KQF B;  1H0T B;  3WUU A;  4IOI H;  2E42 A;  1L4A D;  2JJL A;  4W80 A;  3FWN A;  3H1J E;  3KZI H;  1L0N E;  2M0B A;  3G3Z A;  4IFM A;  2B9B A;  2N9B A;  3CCQ P;  4UB6 H;  4RES B;  1GW3 A;  2G3A A;  3G6E P;  1HUC A;  2IZ1 A;  3H1K G;  2GM4 A;  3B5N C;  2WPR A;  1LWU A;  2M5A A;  4WY4 C;  2HYN A;  3GF7 A;  1JY2 N;  2XDJ A;  2BAS A;  2ZFC A;  1AJY A;  2W6B A;  1N73 A;  4HKZ H;  5CMZ A;  3N7N A;  4N78 E;  2JDI H;  2OTK E;  3HRN A;  4I6M C;  3MHV A;  3L35 A;  1W2B O;  2QJP B;  1SQV K;  3GHG B;  3PRJ A;  3LW5 J;  4ASW A;  1FOS F;  4DOJ A;  3M06 A;  2IYP A;  3L74 G;  1FZC A;  2HOD A;  3CCE P;  4H0L B;  1JO5 A;  2KP8 A;  5APQ A;  2PRR A;  2FFD C;  2WMM A;  2A45 H;  3BCC E;  1HTL C;  3USS A;  1W2E A;  2E74 B;  4GKG A;  3V2R A;  2QSI A;  1LTJ B;  2YKO A;  2J58 A;  2Y0D A;  2KXP B;  1NTM D;  3D6Y A;  2VRS A;  2XV5 A;  1S3J A;  4IL6 H;  4H0L D;  1JY3 N;  1A02 F;  2B87 B;  2WSF J;  2O3J A;  1S9K E;  1M1J A;  2NRG A;  3L4F A;  2M8R A;  1N7S A;  1OMI A;  1VQ6 P;  1L2P A;  1SQX K;  4I7Z B;  1FU1 A;  4GIF A;  5CCG C;  4KJM A;  1Q86 Q;  4AQR D;  1T3U A;  1OVU A;  2BCC E;  1HJ0 A;  1NOH A;  3H1L E;  1GL2 B;  3H25 A;  1RF0 C;  3HTK A;  4TLF A;  1RF1 A;  2O01 J;  1SQQ G;  2P67 A;  5CHX A;  1IJD B;  1NO4 A;  3CCL P;  2KLV A;  3A0H H;  5H2F H;  1MV8 A;  3G71 P;  1LT9 C;  1Q81 Q;  1SQP E;  3IAO A;  4XA4 A;  1UIX A;  3H1K D;  1VDF A;  1HH0 A;  2K9J B;  2AEJ A;  1L0L K;  1S1C X;  3CX5 E;  3Q5S A;  1NTZ K;  2QJY C;  1U7J A;  1YTZ T;  1JEK A;  5KKZ B;  1PFI A;  1BSN A;  4N3Y B;  1JCC A;  1M57 D;  3KQG A;  4IL6 X;  3CX5 I;  3HE4 A;  1NTK J;  1NJI Q;  1DD3 A;  3AEF C;  2E75 D;  3L74 D;  5GTH E;  1EDI A;  4L75 A;  4OGQ B;  3TDK A;  1ZRT D;  4C7R A;  5CCH A;  1G1I A;  3HD7 C;  3V4W A;  1BGY J;  1IFN A;  1EDL A;  1FS0 E;  1KIL A;  1NHL A;  1QEX A;  5EFW B;  1PP9 G;  1AA0 A;  5E79 E;  3VOP A;  2HFE D;  3CXH D;  2NPS B;  1HF9 A;  3H1H J;  3CI9 A;  5KTB A;  1IK9 A;  1S2E A;  3VMZ A;  2M3B A;  1BGY G;  1TU3 F;  3HD7 B;  1J1E B;  4OGQ D;  3CC7 P;  5KLI B;  1FJK A;  3RL0 g;  3JCU E;  2YKP A;  3H1H G;  4H44 C;  1MFZ A;  3FX0 A;  3TGU E;  1R5L A;  1X0T A;  2AXT H;  2Z5H A;  1FZA A;  4PV1 C;  2IBZ I;  2RN0 A;  4KHX A;  1L0L E;  1BE3 E;  5AVV B;  1KC8 Q;  5AW9 B;  1GDT A;  2KZJ A;  2A45 I;  2OYH C;  2R3S A;  2AEM A;  1SQQ D;  3PJS K;  2V7Q H;  3M0A A;  4PV1 B;  3CWB J;  2KK7 A;  3RK2 D;  4IL6 E;  5B66 H;  4K3A A;  5APY A;  1G2C B;  3IF4 A;  2IBZ G;  5AW7 B;  4ZKU A;  2R44 A;  2HPC A;  3GG2 A;  2R32 A;  2A45 G;  1FJP A;  5KAF H;  1OZH A;  2W8Z A;  1VQ5 P;  5DJU B;  3H1I J;  2PAJ A;  3BAS A;  1LNQ A;  1NTM K;  1SFC B;  1DD4 A;  3P32 A;  1AVY A;  2WVR A;  1OW8 A;  2Q3E A;  3P8C D;  1KB9 D;  4BRY B;  3SWY A;  4NPE A;  1RQV A;  2PFX A;  3MUD A;  2W90 A;  2SPZ A;  4N6J A;  1N86 A;  1PZQ A;  1SFC D;  5L8R J;  5C39 A;  1URQ B;  1YQ4 C;  3WU2 E;  2RKL A;  1ZXG A;  3O6Q A;  3A7O A;  3TNU B;  2N1T B;  2OYI C;  2Y9Y A;  1PP9 D;  1IFJ A;  4D6T J;  4ZKP A;  4IFF A;  4H13 D;  1IC2 A;  3FGA D;  1GK6 A;  1RY3 A;  1BGY D;  1OW6 A;  2ZT9 B;  3SFD C;  2WWW A;  1RE4 C;  3MD0 A;  3Q3D A;  2YO3 A;  3SWK A;  2QJK B;  4D6T G;  2QG4 A;  3H1H D;  3RK3 D;  3L73 G;  1N8R Q;  2B88 A;  2H7H A;  2BEQ D;  1JUN A;  3V6I A;  2ZT9 D;  1NTM E;  1SQB J;  1S4X A;  1LWU C;  2OTL P;  2O01 H;  3II6 A;  1N73 C;  4A7P A;  3E7K A;  1NU1 J;  1SQB G;  3B4S A;  4YTP C;  1JTH B;  3WMM 0;  2JEE A;  3S9O A;  1KZU B;  3V2Q A;  1L0N K;  1P84 D;  5BVZ A;  1VQL P;  2IBZ D;  5KAI E;  2RH0 A;  1YQ3 C;  1FZC C;  4WWI A;  1N73 B;  1KFN A;  1NU1 G;  3AE3 C;  2WSC H;  3M91 A;  2ZAE B;  3M0D A;  1NAY A;  4L74 A;  3A0B E;  2LXB A;  3MZW B;  3C1L A;  2HOD B;  1JY2 O;  3T97 B;  2IPP A;  3AE2 C;  4TT3 H;  3WUT A;  3EWK A;  1M1J C;  5CJ0 A;  1WT6 A;  1N7S C;  2KYV A;  3GLM A;  3H32 A;  4LGD E;  1YYC A;  5APS A;  1T2K D;  4RKU J;  2JWA A;  3H1K E;  2LKM A;  2KUB A;  4C7N B;  3W67 A;  1E79 H;  4WBA A;  1IFI A;  3RL0 B;  1D7M A;  2WPQ A;  3BRT B;  4ZNC A;  1QX8 A;  1RF1 C;  4DCK A;  1YTZ I;  5KLV J;  2OTJ P;  1SQQ K;  2OYO A;  3AE5 C;  2KOG A;  2HR3 A;  2JWD A;  1JY3 O;  3L74 E;  4D6T D;  3L75 D;  1LTI C;  3RL0 D;  1GMJ A;  1QLE D;  3L73 D;  5AW3 B;  1ZRT E;  5KLV G;  1R5S A;  2Z4E A;  2PP6 A;  2J5U A;  4YXW H;  4WB4 A;  1KTM A;  3CXH E;  1M7L A;  3U59 A;  3AEC C;  2Q3I A;  2KZI A;  3Q2Y A;  1LTS C;  2P10 A;  2KS1 B;  2Q7C A;  1PV3 A;  2LXC B;  3CXH I;  1P84 H;  4HB1 A;  1KQL A;  1NVO A;  2QE7 H;  3B5N B;  3H1J J;  3ITK A;  4WY4 B;  1SQB D;  1IK7 A;  1PPJ G;  2Y0C A;  3D71 A;  1SQP K;  3PHL A;  1EXI A;  1X22 A;  1NU1 D;  5TIS E;  1AFO A;  5CCH C;  3B5N D;  1ZW0 A;  1S5L H;  4WY4 D;  1CZQ A;  3F89 A;  1KIL C;  2FFD B;  1AV1 A;  3VP8 A;  3L72 J;  1M8O B;  1SQQ E;  3R2P A;  2A06 G;  2I1K A;  3TSI A;  1T8Z A;  2E74 D;  1U57 A;  4XE5 B;  1LP1 A;  2E76 C;  1IFP A;  1L4A A;  1MUU A;  1CI6 B;  4DJG A;  3L72 G;  3BCC J;  1KIL B;  1Q82 Q;  1SP4 A;  1HGZ A;  1NYH A;  5DJT B;  1SS1 A;  1NH4 A;  2KSJ A;  4U3F J;  1FE6 A;  1KYO D;  3B71 A;  4PJ0 H;  1H0T A;  2L5G B;  1NGM B;  2E43 A;  3BCC G;  2D2C C;  2HG5 D;  1Y9B A;  3CC4 P;  3FXE A;  2KNC A;  3VMY A;  1WRG A;  3P8C E;  1KB9 E;  3CPW O;  4U3F G;  2FXO A;  3PTZ A;  1N7L A;  3OJA B;  3NFQ A;  1ZV8 A;  1KB9 I;  1ZR4 A;  1Y47 A;  2D2C B;  1GL2 D;  1JB0 J;  2WPS A;  1KQG B;  2WSC J;  1Q7Y Q;  2R3C A;  1J2J B;  4M3L A;  5KLV D;  2E75 C;  5CCG D;  2C0W A;  3SSU A;  3TYY A;  1MZ9 A;  3SFE C;  1SVF A;  1PP9 E;  5GTI H;  1LT9 B;  1EZV G;  3GHG A;  3OW2 O;  3D6Z A;  1BCC J;  3CCV P;  4OVN F;  1SQV J;  5AVQ B;  1BGY E;  2ZYG A;  1QVF O;  2ZYA A;  1JOC A;  1DH3 A;  2HPC B;  1LTJ A;  1PPJ D;  1X79 B;  3QH9 A;  3IR9 A;  1DX7 A;  3H1H E;  2QJY B;  1NWQ A;  2R5B A;  1BCC G;  3MGN A;  3RK3 E;  1SQV G;  3KZI E;  3VMX A;  3MUD C;  1ZOY C;  1NTK G;  4UB6 E;  3TK1 A;  1YJN P;  2B87 A;  1A02 J;  2FBW C;  1OIP A;  4UB8 H;  3ZDM A;  1PGQ A;  1OW7 A;  1FDI A;  1EC5 A;  1LTB C;  2JP3 A;  2A06 D;  1VF5 C;  1EQ7 A;  3GF3 A;  4PD4 H;  1SQX J;  3AEA C;  2Z5I A;  3P8M C;  1QVG O;  1K8A Q;  2HLO A;  3BVH A;  1PGO A;  4L76 A;  2H8P D;  1P84 E;  1USD A;  3L72 D;  2IBZ E;  5AVR B;  1RHZ B;  4ZMD A;  1XTC C;  3RK2 C;  1KYO H;  1JMM A;  1FZG A;  2NPS D;  1GL2 A;  5TJH A;  1NKZ B;  1SQX G;  1NKN A;  1P84 I;  2C9L Y;  1ZME C;  3HD7 D;  1PGJ A;  2ITA A;  4DT0 A;  5AVS B;  1T3J A;  2QIW A;  1QL1 A;  1JM0 A;  2OAR A;  3HE5 B;  4H44 B;  3U1C A;  1KN7 A;  2GA1 A;  2WT7 B;  4U3F D;  1ZP0 C;  5APX A;  5BU8 B;  1LTG C;  2YMY A;  3L71 J;  2KIK A;  4GT1 A;  2OYH B;  4YPC A;  2K9J A;  5KJ7 D;  4H44 D;  1BDC A;  3LIE A;  2OQQ A;  3CWB G;  1FZE A;  1L0L J;  1BE3 J;  2NZ2 A;  1NTZ J;  1NU1 K;  4PV1 D;  1GU4 A;  3L71 G;  2JKV A;  1EZV D;  3M0D C;  3AE8 C;  2M3E A;  2K88 A;  1USE A;  4Y99 C;  1LJ2 A;  1NTZ G;  4H13 C;  4HYT B;  3CLQ A;  3H1I G;  4D6T E;  3L75 E;  1S72 P;  1BCC D;  3L73 E;  1SQV D;  2O1K A;  2XND H;  3BAT A;  3A0H E;  5H2F E;  1LGH B;  2H88 C;  2NPS A;  4Y99 B;  3KPE A;  1NTK D;  4DZO A;  2YMK A;  3RK3 C;  3JC2 2;  4Z1M H;  5CBO A;  2CPS A;  5AW1 B;  2KI7 B;  3L36 A;  1YIT P;  2Q6Q A;  4GOF A;  1GZL A;  1K04 A;  3U1A A;  1KMI Z;  2Y0E A;  2YKQ A;  2OGU A;  1URQ D;  2IDB A;  2W6A A;  1SQB E;  2H89 C;  2OYI B;  1X8Y A;  3NXS A;  1Q90 D;  2N1T D;  3Q5P A;  1K05 A;  2FXM A;  1IO4 A;  1J1D C;  2ZXE B;  1SQX D;  2P2U A;  2UWJ E;  1NU1 E;  1MKM A;  5KJ7 A;  3GMA A;  3HUS A;  4NPD A;  3VTP C;  2FYU J;  2DW3 A;  2XZR A;  2GUV A;  1H8A A;  1G2C A;  1YIJ P;  1K73 Q;  4AYC A;  1FZF A;  4LLH A;  5AW2 B;  3M9Q A;  4HJG H;  3V5B A;  1LWU B;  2M5A B;  3EFF K;  2FYU G;  2YIU C;  5AW0 B;  3I56 P;  3A2A A;  4JYB A;  3CC2 P;  1SFC A;  1VQ4 P;  3CWB D;  4PD4 I;  1KQS O;  2AEF A;  1YI2 P;  2IYO A;  1KYO E;  3MP7 B;  3L71 D;  3RBX A;  5B5E H;  2AXT E;  1PIX A;  4BRY A;  1W5C E;  2QM7 A;  1FZC B;  1KYO I;  3CMA P;  4EIJ A;  1NTZ D;  2PGD A;  3H1I D;  5AW8 B;  1URQ A;  1L4A C;  3TNU A;  2N1T A;  1HJB A;  5KLV E;  5B66 E;  2B89 A;  1GK4 A;  3I55 P;  4OWF A;  1M1J B;  2FYN C;  3L70 J;  3KHU A;  1BDD A;  1N7S B;  2N9Y B;  1LP1 B;  3I5C A;  3KXD A;  3CX5 H;  5KAF E;  1NAF A;  5AVZ B;  3L70 G;  3F5H A;  1PPJ E;  2FKW B;  2BEZ F;  4JQ0 D;  1AVO A;  1N7S D;  5GTH H;  3AEE C;  3HTK B;  1RF1 B;  3H1K J;  5AW4 B;  4K35 A;  2LR2 A;  4WVZ A;  2KNC B;  4HH2 A;  4MN4 C;  4B86 A;  1VQ9 P;  2C9N Y;  5E79 H;  3CCR P;  2A06 E;  1JTH A;  2QJP C;  1OWA A;  1YHQ P;  3GHG C;  1UII A;  2IX7 C;  1L0N J;  2CPB A;  4H0L C;  3L74 J;  3JSV C;  1FC2 C;  3QWO C;  3L72 E;  3WUV A;  2FYU D;  5AVT B;  2E74 C;  1FAV A;  3JCU H;  3CCU P;  1LTJ C;  3C9I A;  2XKM A;  3H1J G;  1L0N G;  2FY8 A;  1VQN P;  3T97 A;  1NTK K;  3HE4 B;  2WSE H;  1JNM A;  1OVR A;  1X9V A;  2E5Y A;  1YJ9 P;  2MJZ A;  4U3F E;  4I7Z C;  1GW4 A;  3VMA A;  3VN0 A;  2P58 A;  4EYY Q;  4C7N A;  1XTG B;  4PD4 D;  1KV4 A;  5APT A;  3VP9 A;  2YXQ B;  1JCD A;  1HGV A;  1RE3 A;  2K37 A;  3CCJ P;  2WPV B;  4U7J A;  2WTY A;  2E76 B;  1GL2 C;  3A3Y B;  2C0X A;  1H88 A;  3MTU E;  1KOR A;  1EZV E;  5CCH D;  2P7J A;  3IN6 A;  4GDO A;  1SQQ J;  5CJ4 A;  2IZ0 A;  3V2P A;  3EFG A;  1DEE G;  2KSE A;  1KIL D;  2QRX A;  3MIW A;  3FXD A;  3TF5 A;  1EZV I;  5B5E E;  2JR8 A;  1GU5 A;  1WMK A;  4EI2 A;  3L70 D;  1JY2 P;  2E76 D;  3KYQ A;  1BCC E;  5CBN A;  1SQV E;  4JBZ A;  1FOS E;  5APV A;  3D70 A;  4I2L C;  2BCC J;  1VQ7 P;  5M1B A;  2W83 C;  1K9M Q;  1NTK E;  2KS1 A;  1JMB A;  5APU A;  3H1L J;  3WU2 H;  3BRV B;  3B5N A;  3KDP B;  5KKZ C;  4WY4 A;  1S5L X;  2R5D A;  2D2C D;  2BCC G;  1Q2N A;  3RBZ A;  2E75 B;  4LC1 A;  2J59 M;  3H1L G;  1BSH A;  2YNY A;  1FDO A;  1SQP J;  4I1L A;  5BU5 A;  4OGQ C;  4R4M A;  3AEG C;  3LID A;  1JY3 P;  3VYI A;  1SQX E;  1HVV A;  1PL5 A;  4EDF A;  2FFD A;  1FZB A;  3H1J D;  1SLQ A;  4W7Z A;  1L0N D;  1KFM A;  1PP9 J;  3E1R A;  1SQP G;  2NPS C;  4L73 A;  2KB7 P;  4GOD A;  1G1J A;  3AE1 C;  3EQ2 A;  1J1E C;  3CL3 D;  3ABV C;  1CI6 A;  3AE9 C;  3OA7 A;  5AVY B;  5K5G B;  5KLI C;  2JO1 A;  2QEX P;  2RMZ A;  1RQU A;  3SWF A;  2Q1K A;  3O6Q B;  5APW A;  3M9H A;  1CSB A;  4N78 D;  1M1K Q;  3NMD A;  1OVV A;  1Y8A A;  1VF5 B;  5KAI H;  2Y9Z A;  4C46 A;  3CWB E;  2WQY C;  3AE4 C;  5CCG A;  4JF7 A;  2XU6 A;  3L37 A;  1AQT A;  2KLU A;  1VPC A;  3AEB C;  2QA4 P;  3L71 E;  5KJ7 C;  3BCC D;  3GW6 A;  3HUS C;  3A0B H;  3RK2 B;  3C8V A;  1LTT C;  1VL2 A;  1IFM A;  1RF0 A;  2ZJS E;  1S5L E;  2O01 N;  2K9Y A;  1ZN5 A;  1VF5 D;  2WSS H;  1NTZ E;  1T6A A;  1DEB A;  1AQ5 A;  3H1I E;  3PLN A;  1SQB K;  1OXZ A;  2AXC A;  3HUS B;  3M9B A;  2V4H A;  1S9K D;  1M90 Q;  2FYU K;  3TGU J;  3G9R A;  1LT9 A;  2QVA A;  4OH8 B;  1GD2 E;  2WSE J;  4O9B A;  2ZYD A;  1SFC C;  1FBM A;  1E5W A;  3V4Q A;  1EXJ A;  1QL2 A;  3TGU G;  1LT1 A;  1Z56 A;  4PJ0 E;  2BCC D;  2WIT A;  1L0L G;  3IFM A;  1BE3 G;  1DIP A;  3S1K A;  3H1L D;  4W7Y A;  3E1I A;  1CW5 A;  1VQO P;  1VQ8 P;  1URQ C;  4JPZ B;  5AVX B;  3AE6 C;  4GOE A;  4BXL A;  4AUW A;  2N1T C;  1ZLL A;  2K3R A;  4H13 B;  4KT0 J;  2L91 A;  3LW5 H;  3HD7 A;  1SQP D;  1LTA C;  3A5T A;  3CXH H;  2ZT9 C;  1HWT C;  2W6J H;  5GTI E; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  3N4X A;  3H32 B;  1J1E B;  3HD7 B;  1SP4 A;  1HGZ A;  1N7S B;  2XNX A;  5AW5 B;  3H6P A;  1GTW A;  3I5C A;  3RK3 B;  1FJK A;  1NH4 A;  2KSJ A;  2YKP A;  2FYZ A;  2L5G B;  2WZ7 A;  2E43 A;  1NAF A;  1MFZ A;  5AVZ B;  2WSF H;  2HG5 D;  3NTN A;  3HE5 A;  2FKW B;  2QM8 A;  5KLV K;  2Z5H A;  1FZA A;  3VMY A;  4KHX A;  2WT7 A;  1WRG A;  3P8C E;  5AVV B;  1N7S D;  4JYC A;  1N7L A;  3HTK B;  1RF1 B;  3OAK A;  3OJA B;  3NFQ A;  5AW9 B;  1GDT A;  1J1D B;  1IFD A;  1ZV8 A;  5AW4 B;  2A45 I;  4EOT A;  2OYH C;  1N2D C;  1ZR4 A;  4IFD K;  4HH2 A;  1GL2 D;  2WPS A;  3M0A A;  4B86 A;  2C9N Y;  2OYH A;  2R3C A;  3RK2 D;  1J2J B;  4M3L A;  5CCG D;  2C0W A;  1JTH A;  3TYY A;  1OWA A;  1G2C B;  1MZ9 A;  3GHG C;  5APY A;  5AW7 B;  1SVF A;  3V2N A;  2IX7 C;  4ZKU A;  2YO2 A;  1LT9 B;  2CPB A;  2Q5U A;  3GHG A;  2HPC A;  5AVT B;  2R32 A;  5AVQ B;  2A45 G;  1FAV A;  1T2K C;  1FJP A;  1LTJ C;  1JOC A;  2PAJ A;  3BAS A;  1DH3 A;  3C9I A;  2XKM A;  1NTM K;  1SFC B;  5AVU B;  2W27 A;  3P32 A;  2HPC B;  1H89 A;  1LTJ A;  1X79 B;  3IR9 A;  3UIA A;  1DX7 A;  1NWQ A;  2R5B A;  3T97 A;  3MGN A;  1NTK K;  3P8C D;  3HE4 B;  3VMX A;  5AVW B;  2WSE H;  3SWY A;  1JNM A;  1X9V A;  3TK1 A;  3MUD A;  3P7K A;  2MJZ A;  1A02 J;  4N6J A;  3B8E B;  2Q9I A;  1N86 A;  1SFC D;  1GW4 A;  3VN0 A;  1URQ B;  1RE3 C;  1LTB C;  2IFM A;  3RL0 C;  4C7N A;  1XTG B;  5APT A;  3VP9 A;  1EQ7 A;  3A7O A;  2H43 A;  1JCD A;  3TNU B;  2N1T B;  2OYI C;  1HGV A;  2O1J A;  3P8M C;  2Z5I A;  1RE3 A;  2POH A;  1IFJ A;  2HLO A;  1FDM A;  1L4A B;  3BVH A;  4ZKP A;  4IFF A;  2OYI A;  1IC2 A;  2WTY A;  2H8P D;  1GK6 A;  1RY3 A;  1GL2 C;  2P1J A;  2C0X A;  3A3Y B;  1H88 A;  3MTU E;  5AVR B;  1XTC C;  1HBW A;  2I1J A;  2WWW A;  3RK2 C;  1RE4 C;  1JMM A;  3MD0 A;  3PP5 A;  1FZG A;  2NPS D;  1GL2 A;  3O8Z A;  5CCH D;  2P7J A;  1NKZ B;  2YO3 A;  5AW6 B;  2GUS A;  1NKN A;  5CJ4 A;  3V2P A;  3EFG A;  1RE4 A;  2IFN A;  1KIL D;  2C9L Y;  3HD7 D;  3MIW A;  5AVS B;  1T3J A;  2E42 A;  3RK3 D;  1L4A D;  2JJL A;  1GU5 A;  4W80 A;  1QL1 A;  2OAR A;  2H7H A;  3HE5 B;  1JY2 P;  3G3Z A;  3U1C A;  1JUN A;  3KYQ A;  2WT7 B;  4IFM A;  2N9B A;  4RES B;  1GW3 A;  1FOS E;  5APV A;  1LWU C;  4I2L C;  5APX A;  5BU8 B;  1HUC A;  1LTG C;  2YMY A;  2GM4 A;  3B5N C;  2WPR A;  1LWU A;  5APU A;  4WY4 C;  4GT1 A;  2HYN A;  2O01 H;  1JY2 N;  3II6 A;  1N73 C;  2OYH B;  2XDJ A;  3BRV B;  3B5N A;  3KDP B;  5KJ7 D;  2BAS A;  2ZFC A;  4WY4 A;  3LIE A;  2W6B A;  1N73 A;  1JTH B;  1FZE A;  2R5D A;  3WMM 0;  2JEE A;  5CMZ A;  1KZU B;  3N7N A;  4N78 E;  3V2Q A;  1L0N K;  1NU1 K;  5BVZ A;  3HRN A;  4LC1 A;  4I6M C;  1GU4 A;  3L35 A;  2J59 M;  1FZC C;  1SQV K;  3GHG B;  3M0D C;  1FOS F;  4DOJ A;  2YNY A;  1N73 B;  1KFN A;  3M06 A;  1FZC A;  2HOD A;  2WSC H;  4I1L A;  5BU5 A;  1JO5 A;  3M91 A;  2KP8 A;  5APQ A;  3M0D A;  2FFD C;  2A45 H;  4Y99 C;  1HTL C;  3LID A;  1W2E A;  1JY3 P;  3VYI A;  4GKG A;  4HYT B;  1HVV A;  3CLQ A;  3V2R A;  2FFD A;  1FZB A;  1LTJ B;  2YKO A;  1SLQ A;  4W7Z A;  2J58 A;  1KFM A;  2HOD B;  1JY2 O;  2IPP A;  2NPS C;  3BAT A;  2O1K A;  2KB7 P;  2VRS A;  1LGH B;  1M1J C;  2XV5 A;  5CJ0 A;  1G1J A;  1WT6 A;  2NPS A;  3EQ2 A;  4Y99 B;  1J1E C;  3CL3 D;  1JY3 N;  3KPE A;  1A02 F;  1N7S C;  1CI6 A;  4DZO A;  1S9K E;  3OA7 A;  5AVY B;  3RK3 C;  1M1J A;  2KYV A;  2CPS A;  3H32 A;  3L4F A;  4LGD E;  1YYC A;  2M8R A;  1N7S A;  5APS A;  5AW1 B;  1T2K D;  3L36 A;  3SWF A;  2LKM A;  1SQX K;  4C7N B;  5APW A;  1GZL A;  3M9H A;  3U1A A;  1CSB A;  4N78 D;  4WBA A;  1IFI A;  1FU1 A;  2YKQ A;  3NMD A;  3RL0 B;  4GIF A;  1URQ D;  2W6A A;  5CCG C;  2OYI B;  4C46 A;  1X8Y A;  4AQR D;  1T3U A;  2WPQ A;  3BRT B;  3NXS A;  5CCG A;  2N1T D;  4JF7 A;  2XU6 A;  3L37 A;  1RF1 C;  1VPC A;  1YTZ I;  1NOH A;  2FXM A;  1IO4 A;  1SQQ K;  1J1D C;  5KJ7 C;  1GL2 B;  1RF0 C;  3HTK A;  2KOG A;  2ZXE B;  1RF1 A;  3HUS C;  1JY3 O;  3RK2 B;  2P2U A;  1LTT C;  5KJ7 A;  1IFM A;  1RF0 A;  3HUS A;  1LTI C;  2P67 A;  3RL0 D;  5CHX A;  1IJD B;  1ZN5 A;  1NO4 A;  3VTP C;  1DEB A;  1AQ5 A;  5AW3 B;  2KLV A;  2XZR A;  1SQB K;  1OXZ A;  2GUV A;  1MV8 A;  2Z4E A;  2PP6 A;  1H8A A;  1LT9 C;  3HUS B;  3M9B A;  1G2C A;  1S9K D;  2FYU K;  4WB4 A;  4XA4 A;  1M7L A;  4AYC A;  3U59 A;  1FZF A;  4LLH A;  5AW2 B;  1LT9 A;  2Q3I A;  3M9Q A;  3V5B A;  4OH8 B;  1LTS C;  1GD2 E;  1LWU B;  1VDF A;  4O9B A;  2Q7C A;  1SFC C;  5AW0 B;  1FBM A;  1KQL A;  3A2A A;  1E5W A;  3B5N B;  4JYB A;  1HH0 A;  3V4Q A;  1L0L K;  4WY4 B;  1NTZ K;  1SFC A;  1QL2 A;  1YTZ T;  1Z56 A;  1PFI A;  4N3Y B;  2WIT A;  1JCC A;  3IFM A;  3KQG A;  3HE4 A;  1SQP K;  4W7Y A;  3E1I A;  1CW5 A;  2QM7 A;  1FZC B;  1AFO A;  5CCH C;  1URQ C;  4EIJ A;  3B5N D;  5AVX B;  4WY4 D;  1CZQ A;  4AUW A;  1KIL C;  2FFD B;  3VP8 A;  4C7R A;  1G1I A;  3V4W A;  3HD7 C;  5AW8 B;  5CCH A;  1URQ A;  2N1T C;  1IFN A;  1ZLL A;  3R2P A;  2I1K A;  1KIL A;  1NHL A;  1L4A C;  3TSI A;  1T8Z A;  3LW5 H;  3HD7 A;  3TNU A;  2N1T A;  1HJB A;  3VOP A;  4XE5 B;  1LTA C;  2HFE D;  3A5T A;  1L4A A;  2NPS B;  1GK4 A;  3CI9 A;  1MUU A;  1HWT C;  5KTB A;  1IK9 A;  1CI6 B;  3VMZ A;  1M1J B;  1KIL B;  2M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...