5APUA

Sequence iankedkad inserted between gcn4 adaptors - structure a9b black
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
HMKQLEDKVEELLSKVYHLENEVARLKKLIANKEDKADMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 28
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apuA00
5AVYB 1A02J 2XU6A 3HTKA 1NAFA 5AVQB 5AW4B 3M91A 1SLQA 3HE5B 3VYIA 1OXZA 4GKGA 4M3LA 2IPPA 1JUNA 2P2UA 4I2LC 2ZXEB 3P8MC 1S9KD 2E43A 3TK1A 2WPRA 3KDPB 1MV8A 4JYBA 3TYYA 4DZOA 1DH3A 5AW9B 3LIDA 4JYCA 3OAKA 2N9BA 3LIEA 1S9KE 4AUWA 1FAVA 4HYTB 2R3CA 4I6MC 1SP4A 5APSA 5AW6B 5AW8B 1HUCA 3M0AA 5AW7B 3M9HA 1H89A 3P32A 2JJLA 2YO3A 2R5BA 3M9BA 2Q3IA 2WTYA 3HE4A 3KQGA 5AW0B 3T97A 2WT7B 3MD0A 5APWA 2WT7A 3P7KA 3VMYA 4AYCA 2R32A 3HE5A 3NMDA 2XZRA 4RESB 3O8ZA 2ZFCA 5APVA 1T2KD 5APUA 3V5BA 1GU5A 3MGNA 1YYCA 2P7JA 5AVWB 2YNYA 5AVZB 5AVTB 2YO2A 3M0DA 2H7HA 4AQRD 3VTPC 5CMZA 2W27A 1MFZA 1H8AA 1A02F 3L36A 5AVVB 3NXSA 4GT1A 1NWQA 5AW2B 3NTNA 2C9NY 2XV5A 5APQA 1FOSF 2QM8A 1GTWA 1FOSE 1CSBA 3L37A 1MUUA 1GK6A 1HWTC 4C46A 1CI6B 1GD2E 2BASA 2Z5IA 3I5CA 3VMZA 3NFQA 3SWFA 1T2KC 2VRSA 1H88A 5APXA 1OWAA 2R5DA 4LC1A 1KQLA 4C7NB 3TNUB 2P67A 3V4QA 2Z5HA 1CZQA 4C7NA 3TNUA 3UIAA 5APTA 2WPSA 4B86A 3V4WA 3A7OA 2WWWA 4XE5B 3IR9A 3M06A 3A5TA 4EOTA 5AVSB 5APYA 3A2AA 3L35A 5AW5B 5AVXB 1IO4A 2WPQA 2E42A 1GU4A 1J2JB 2Q7CA 2C9LY 1GK4A 1X8YA 5AVRB 1CI6A 4KHXA 2KP8A 5AW3B 3VMXA 2QM7A 5AW1B 1GZLA 2W6AA 3VN0A 1JNMA 1HJBA 3A3YB 3HE4B 1G2CB 5AVUB 1HBWA 2Q5UA 3B8EB
chains in the Genus database with same CATH superfamily
4WY4A 1W2EA 4U3FD 1BCCG 4EI2A 3VYIA 5GTHH 2ZT9B 2GM4A 3RL0C 3CI9A 1LTJC 3LIEA 1Q81Q 2JO1A 1HUCA 1U57A 1YJWP 1RE3A 1KV4A 1YQ3C 5E79E 3M9BA 1R8EA 3EWKA 3CC2P 2N9YB 1KYOE 1LTSC 1LWUB 1FZFA 2O1JA 2WSEH 2YIUC 3VP8A 1NU1D 2YNYA 4Y28J 1QL2A 3GHGB 4IFFA 2KZJA 2HPCA 2ZYAA 4H0LC 1Q90D 1BGYD 3L36A 3NXSA 4JQ0D 5AW2B 1EQ7A 1HF9A 2K9YA 2QJYC 2QM8A 2IFMA 2WZ7A 3L73G 5CCGC 4GODA 3Q2YA 1IFJA 4IL6X 1BE3G 3Q5PA 4BRYB 1R5SA 2YMYA 3KZIH 2D2CD 2YKPA 5AW5B 3WUTA 2ZAEB 3WMM0 3H1LG 3LW5H 2QVAA 1K05A 5CJ0A 2HODB 2AEJA 3EQ2A 2QJKC 1K04A 3L72D 1FJPA 3F5HA 1JNMA 4XA4A 1RE4C 1SQQG 1FZBA 1NHLA 1NTZD 4PD4I 1P84I 1SQXE 5B5EH 1MFTA 5KAIH 1YIJP 1JB0J 2OYHA 1FC2C 1QEXA 3RBZA 2KYVA 3AEFC 1VQLP 1EXJA 4ZNCA 2P10A 3L75D 3BVHA 4L73A 1LTGC 1EZVG 3PHLA 3P8CE 3H25A 4UB6E 1KD1Q 2KI7B 3L74D 3CL3D 1BDCA 3CX5E 1EZVI 1SQBE 2W27A 4GT1A 1FDMA 1VL2A 3D70A 2CPSA 2C9NY 3CXHE 2LXCB 3BCCE 1S2EA 1TU3F 4OVNF 3G4SP 4YXDC 2FYUG 4PJ0H 3L4FA 2GUVA 2M5AB 3H1KG 2Z5HA 4I7ZB 4QMAA 4BRYA 5H2FH 1Y9BA 4GOFA 3H1IE 2OARA 4W7ZA 5BVZA 1FZAA 1FZGA 3IN6A 2W83C 2BCCG 2J59M 2HODA 2YXRB 2ZT9C 1Q82Q 4H0LD 2N1TB 2QSIA 1GZLA 1NTZK 4IFMA 2KS1B 5CCHD 5CCGD 2WSSH 3HE5B 1W2BO 2W6BA 4I1LA 4M3LA 1YQ4C 3HD7D 4L76A 1LWUC 5AW9B 4IL6E 3V2NA 5GTIH 4HYTB 4OGQB 1KFNA 4WY4D 4D6TJ 1G2CA 1SFCC 1OVRA 1N86A 1G1JA 3GHGC 2H8PD 2B87A 2R32A 3WUVA 3AE3C 3OJAB 2GUSA 5AVTB 1T8ZA 2YO2A 5TISH 1LTBC 3VTPC 3TSIA 3OA7A 2JWAA 2ZVNB 1VPCA 1K8AQ 3ITKA 3USSA 3S9OA 1JY3P 4H44B 2M3EA 5CHXA 1NKNA 2OYIB 1PP9E 3AE1C 1M1JC 2M5AA 3CD6P 3UIAA 3A2AA 2IBZE 1OFCX 1N73B 2I8DA 1X8YA 3TGUJ 1U7JA 1CI6A 3AE6C 3V2PA 2N1TA 4BWNA 3HTKA 2KS1A 3H1IJ 3A0BE 2C0XA 1JMMA 2IZ0A 4DZOA 1NOHA 2FFDB 5C39A 3U1AA 3L71E 1KYOD 5AW8B 1FBMA 1VDFA 3P32A 1BSHA 2Q3IA 4PD4E 2WTYA 1P84E 1MZ9A 3P7KA 1SQVG 4BXLA 3GMAA 2ZT9D 1T2KD 2E76B 3SSUA 4AQRD 1FDOA 1L2PA 3PLNA 2E5TA 2V4HA 1JMBA 2JDIH 3V2QA 1ZMEC 3CCEP 1HGVA 3RL0B 4I7ZC 2H43A 3L70G 1IJDB 1EZVE 3SWYA 3SWFA 3Q5SA 1OX3A 2JEEA 4OWFA 5AVSB 2FY8A 3H1JE 1NTKE 1IFIA 1JCCA 1BSNA 4IFDK 4K35A 4H13B 1KTMA 3MUDC 1X0TA 1KB9H 4UB8E 1SVFA 3VN0A 1SQXD 4OGQC 1NAFA 3JCUE 5AW4B 3M91A 1NTMG 1BGYJ 3CWBG 2A45H 1PZQA 4Y99C 3CCLP 4D6TG 3TYYA 1DX7A 3H1HE 1SP4A 3P8CD 2JJLA 4HH2A 1FDIA 5APWA 3CX5D 3FX0A 1RH5B 3EFGA 1SQBD 5AVWB 1BDDA 3L71J 2BEZF 2PP6A 4H44C 3CXHD 2XNDH 3BCCD 1JY2P 2LR2A 1AV1A 2OYIC 1JTHB 1E79H 1LTJA 1NTZJ 2YKQA 1S5LE 3AEAC 3GF3A 2Z5IA 1QL1A 2VRSA 2AXTH 1N73C 3TNUB 3H1ID 3TGUG 1S1CX 5APTA 5KLVE 3MP7B 1JOCA 1L0LE 1FU1A 1SQXK 1FZCC 2E74C 3PRJA 1GL2B 4W7YA 4DJGA 4RKUJ 1JM0A 3L74J 4OH8B 2KNCB 2FFDC 2JR8A 3PP5A 3H1JJ 1NTKJ 1SQPG 3B71A 2RKLA 2A06G 1URQB 4LGDE 1DIPA 4O9BA 1KQSO 1OW6A 1FAVA 3B5NB 3M0AA 2E76C 2N1TD 2I1JA 2YO3A 2WVRA 1N7SB 1SQBK 1AA0A 3V6IA 2XZRA 3EFFK 2R44A 1D7MA 1RE4A 4U3FG 5CBNA 4OGQD 1MFZA 1YHQP 1H8AA 1A02F 1H0TA 1WMKA 2Y0DA 2XV5A 4K3AA 1AQ5A 1GTWA 1LP1A 1GK6A 1JTHA 1GD2E 1PP9D 3CLQA 4ZMDA 2PGDA 2CK3H 1L0NG 1SFCB 4LC1A 2FBWC 3TNUA 4H13C 3AE7C 2IBZD 3CCJP 1NYHA 2YXQB 2GA1A 1N8RQ 1LTTC 2YKOA 1PFIA 1NU1G 1YTZI 3C8VA 1YJ9P 4H44D 1JY3O 2KP8A 1BGYG 5AW3B 2I1KA 1GL2A 2Z4EA 1RY3A 5KLVJ 1PGQA 4LLHA 4IOIH 2FYNB 1L0LJ 3ZDMA 1Q86Q 4ZKUA 5GTHE 1S72P 3L71D 1ZN5A 1M1JB 3CX5H 4PD4D 4TLFA 1VQ9P 1P84D 2IDBA 3QH9A 3Q1MA 2R5BA 3HE4A 4CPGA 3CXHH 3G3ZA 3AE5C 2ZYGA 2JP3A 2K37A 1U7MA 1HVVA 5B66H 3L72G 4N78E 3Q3DA 3KXDA 1IFMA 2IX7C 4PV1B 1GW3A 5KLIB 4YXWH 1K9MQ 3CWBE 3OW2O 2UWJE 5AVVB 2HYNA 3NTNA 5APQA 1EZVD 2FXPA 1EXIA 1LWUA 2QJPB 3SWKA 3L75G 2E76D 1CW5A 2MJZA 3AE4C 1SFCA 1CZQA 3GHGA 3H1JD 1NTKD 3V4WA 1IZNB 1GL2C 1UIXA 5APYA 2V7QJ 3RL0D 1IO4A 3L74G 3VMAA 1FJKA 4KHXA 4JPZB 4L74A 2RMZA 3RBXA 1URQC 2YMKA 3FXEA 1HBWA 3CPWO 3B5NC 5B5EE 5EFWB 5KAIE 1X9VA 3P8MC 3H1HD 2JKVA 1OW8A 1N7SC 1KC8Q 1M1JA 4N6JA 4ASVA 4DCKA 4H13D 3MTUE 1QX8A 1PPJE 2HLOA 3SFEC 3H32B 3CC4P 2E5YA 2P7JA 1LGHB 4L75A 1SQPE 5BU5A 5CMZA 1IFNA 1IK9A 4Y99B 3E1RA 1SQXJ 2IYOA 3GLMA 1GMJA 2E75B 2R3SA 3RK2B 4PJ0E 3AE2C 1NTKK 1BCCE 5KLVD 1ZRTE 2QEXP 2B88A 1KB9I 2A45G 1L0LD 3V4QA 1HGZA 3IR9A 3A0BH 2Q3EA 1VF5C 1JY2O 1HTLC 3TF5A 2KOGA 2FYNC 2A45I 1VQ4P 5BU8B 1SQBJ 2Q5UA 5AVYB 2AEMA 3BCCJ 2QG4A 1L0NE 1JUNA 4KJMA 2NPSB 5GTIE 2WSFJ 1GL2D 3E1IA 3L73E 4PV1C 5KLIC 3JC22 1FZCB 1BE3E 3HE5A 2E74B 4YPCA 1G1IA 3R2PA 1N2DC 3MUDA 3G71P 3V5BA 1PGPA 1YYCA 1OVUA 1URQD 2K3RA 2QJPC 2G3AA 2WPVB 1EDJA 3K5BA 1ZR2A 2XNXA 3H1LE 4WBAA 2PRRA 5KJ7C 1L4AB 1N7SD 3B4SA 5KLVK 1USEA 2BASA 1L0LK 1SQQE 3S1KA 3CCQP 4UB8H 1H88A 1VQNP 2MKVA 2R5DA 2Q9IA 1KQLA 1T3UA 3Q5RA 3HUSC 3BRTB 3D71A 2PFXA 2HG5D 2XDJA 5AVXB 1VQ8P 1LTAC 3AEDC 1BCCJ 5CJ4A 2KXPB 1YTZT 5KAFH 3T97B 2OGUA 2OYIA 1SFCD 4HKZH 2IFNA 1EDIA 2O01J 5M1BA 3TK1A 1QGKB 4ZKPA 1N73A 2QIWA 1PP9J 2R3CA 4I6MC 3SFDC 2FYUE 2XKMA 1VQMP 4N78D 1NVOA 3W68A 3MD0A 2WSCJ 1FZCA 3H1KE 1S5LH 1FZEA 5APVA 3FWLA 3CWBD 2E75C 3RK2C 3CMEP 2FFDA 3L73J 2RN0A 1RF1B 1M8OB 3WU2E 1IFPA 2ZXXA 3O6QB 4RJTA 2OTLP 2BCCE 1BE3J 1KILB 3L37A 4YTPC 2OTJP 1NJIQ 3NFQA 2Y0CA 4PV1D 4EDFA 2KIKA 1YJNP 3H1LJ 4N3YB 3A5TA 3MHVA 2ZJSE 3S4RA 3CCSP 1SQBG 1KFMA 1NKZB 1LT9C 1SQQJ 4GOEA 1KB9E 1YITP 3VMXA 1KILE 3CX5I 1PGJA 1NO4A 2NPSC 4A7PA 3B8EB 1LJ2A 3RK3B 1J1DB 3CXHI 2IPPA 1E5WA 2P2UA 1PL5A 2ZXEB 2P1JA 1EC5A 5CBOA 4GDOA 5DJUB 3GG2A 1Z56A 3H1IG 1LTIC 3MZWB 3PTZA 1M7LA 3G6EP 2WQYC 1PPJD 1IK7A 1YI2P 2Q6QA 5E79H 1USDA 1KYOH 1NTMK 4GIFA 3BATA 2V7QH 2W8ZA 3NMDA 1SQPD 3KPEA 3RK3E 2ZVOB 3MGNA 5AVZB 1L4AC 1XTGB 3M0DA 2B9BA 1K73Q 1KN7A 2QE7H 4DT0A 4NPEA 5KTBA 3C1LA 1NWQA 1ZOYC 1NAYA 3O6QA 1RF0A 1RQUA 5K5GB 1MUUA 3H1KJ 1BCCD 1ZRTD 1DEEG 1Q7YQ 4JBZA 4EIJA 1ZXGA 4DOJA 3PJSK 4JF7A 3H1HJ 5APXA 3R4YA 4C7NB 3GF7A 1GW4A 4B86A 2BCCJ 2WWWA 4HJGH 2OYHB 4HB1A 2E75D 3RK2D 5AVRB 3I56P 2KLUA 3N4XA 3A3YB 1SQVE 2QA4P 1L0ND 3CCUP 1LT1A 2PAJA 1S4XA 2LKMA 5AVQB 1PP9G 1KORA 1OXZA 1PV3A 1VQ6P 2E43A 2POHA 3A0HE 1ZR4A 2WITA 3L73D 4JYCA 2N9BA 1S9KE 2IBZG 1ZP0C 5AW7B 1VF5B 1H89A 3N7NA 2IYPA 3M0DC 1BE3D 1SQPK 2KNCA 3L70E 3QWOC 1RF1C 4UB6H 5CCHC 3AE9C 4AYCA 1JY3N 2IBZI 1RF0C 3AE8C 3HD7C 2QRXA 5APUA 1GU5A 1KILC 2L5GB 2NPSD 1URQA 3H1LD 3II6A 3B5NA 3V2RA 3L71G 4NPDA 4WY4C 2JWDA 2O01N 1M56D 1SQQD 1AFOA 1N7SA 2KUBA 2K88A 2E74D 4RO0A 2WSFH 1NTME 1OVVA 1NTZG 2OTKE 4C7NA 1RE3C 2FYZA 5DJTB 4D6TE 1DD3A 4ASWA 3RK3C 2E42A 1Q2NA 1J1DC 1L4AD 2ZYDA 1SS1A 1L0NK 3WUUA 2OYOA 1N7LA 5AVUB 1G2CB 3PH0A 3GW6A 2XU6A 2B87B 2KK7A 2H89C 3KZIE 1VQKP 1FS0E 1NU1K 4I2LC 1FE6A 2Y9YA 3HUSB 4IL6H 1VQ5P 3H1JG 1NTKG 2FYUD 3IFMA 1DEBA 1SQVJ 4R4LA 3VP9A 2G8YA 3H1KD 3AEGC 3VMYA 5B66E 1GDTA 2AXCA 3O8ZA 3TGUE 2BCCD 5TJHA 2ITAA 1J1EB 3IF4A 1SQQK 3CMAP 3L70J 3H1HG 3KYQA 2IZ1A 2O01H 1CI6B 4C46A 2OYHC 2HR3A 3VMZA 1T2KC 1S3JA 3U59A 1OWAA 3HTKB 1OW7A 2WPSA 1VQ7P 3M06A 2A06E 1DD4A 1HJ0A 3FWNA 1JEKA 1W5CE 2WSEJ 1KB9D 2WSCH 1KILD 1J2JB 2C9LY 1GK4A 3RL0g 1NTMJ 5AW1B 4W80A 2J5UA 3CWBJ 1Y8AA 5KJ7A 1AQTA 2O1KA 1A02J 5H2FE 1WT6A 2FYUK 4U3FE 1UIIA 5KLVG 3TDKA 2WMMA 2WPRA 1MV8A 3CCMP 1L0LG 1ZW0A 3HUSA 1ZV8A 3M9HA 2L91A 1JY2N 4PD4H 1P84H 2DW3A 1JO5A 3RK3D 1EDLA 5KKZB 1LT9B 1QLED 1NH4A 1OMIA 3LW5J 3M9QA 1NU1E 1MKMA 2D2CB 3KHUA 1FOSF 1X79B 1BGYE 4TT3H 4XFJA 1XTCC 1EDKA 1HWTC 3H32A 2KSJA 4Z1MH 3AEEC 5L8RJ 5TISE 3B5ND 1JCDA 1LNQA 3A7OA 4XE5B 1AJYA 4EYYQ 3FGAD 3L35A 2WPQA 2FXOA 2K9JB 1S5LX 2AEFA 3BASA 1SQVD 3AECC 3H6PA 1SQPJ 2QM7A 2W6AA 1HJBA 2OQQA 3L72E 3JCUH 1SLQA 3G9RA 1KYOI 4GKGA 3RGUA 2H88C 1ZLLA 1Y47A 1S9KD 3JSVC 1NTZE 3OAKA 4R4MA 3W67A 2FXMA 4AUWA 4NPFX 5APSA 3L70D 4U7JA 3WU2H 3KQGA 5AW0B 2WT7B 3L75E 1KZUB 1J1EC 1LTJB 1X22A 2B89A 4U3FJ 2SPZA 2K1AA 1LT9A 2C0WA 4RESB 2NZ2A 4MN4C 2NPSA 3F89A 2H7HA 4WWIA 3VOPA 3L74E 2N1TC 1VF5D 1KQGB 1OIPA 1PGOA 2YIUB 2KSEA 1L0NJ 2Y0EA 3IAOA 1FOSE 1HH0A 1CSBA 2LXBA 3HRNA 1NTMD 2RH0A 3I5CA 4H0LB 3CCRP 1SQXG 2P58A 3MIWA 4D6TD 1NU1J 2QJYB 3FXDA 2KB7P 4EOTA 1YBKA 3HD7B 3D6YA 1SQVK 3E7KA 1QVFO 2Q7CA 1L4AA 2K9JA 2KLVA 5KAFE 2W6JH 2HFED 4WY4B 1RQVA 1M90Q 4C7RA 1M57D 2QJKB 1VQPP 3BRVB 4WB4A 1WRGA 3CC7P 3KDPB 1DH3A 4JYBA 5KKZC 3LIDA 1IC2A 1VQOP 3BCCG 5AW6B 1H0TB 4KT0J 2FKWB 3L72J 5KJ7D 3U1CA 3T97A 3CCVP 1LP1B 2Y9ZA 2M3BA 3TGUD 1KQFB 2WT7A 1R5LA 2NRGA 1QVGO 2D2CC 1AVOA 2ZFCA 2CPBA 1AVYA 1PIXA 2HPCB 2M8RA 2BEQD 3L75J 1RHZB 1IFDA 3C9IA 2W90A 1PPJG 3AEBC 2O3JA 2A06D 3ABVC 2P67A 1M1KQ 2FYUJ 2Q1KA 1RF1A 1OZHA 5CCHA 5CCGA 2KZIA 3HD7A 2M0BA 1GU4A 1KILA 1T3JA 3A0HH 1T6AA 4WVZA 3D6ZA 1NGMB 3I55P 2J58A 2AXTE 1KMIZ 3HE4B
chains in the Genus database with same CATH topology
5AVYB 4WY4A 1W2EA 2XU6A 1NAFA 5AW4B 3M91A 3VYIA 1NU1K 1JUNA 4I2LC 2A45H 4Y99C 2GM4A 3RL0C 2NPSB 3TYYA 1DX7A 3CI9A 1LTJC 3HUSB 3LIEA 3IFMA 1SP4A 1DEBA 3P8CD 1HUCA 1GL2D 1RE3A 3E1IA 3VP9A 2JJLA 4HH2A 3M9BA 1LTSC 1LWUB 5APWA 3VMYA 1FZFA 1FZCB 3HE5A 2O1JA 1GDTA 1G1IA 2WSEH 3EFGA 3R2PA 1N2DC 3MUDA 3O8ZA 3VP8A 3V5BA 1YYCA 5AVWB 2YNYA 1URQD 1QL2A 2PP6A 3GHGB 4IFFA 1J1EB 2HPCA 1JY2P 1ZR2A 1SQQK 3L36A 2XNXA 3NXSA 4WBAA 5AW2B 1EQ7A 2OYIC 5KJ7C 3KYQA 2QM8A 1JTHB 2IFMA 1L4AB 1N7SD 2WZ7A 5CCGC 5KLVK 1LTJA 2O01H 4C46A 1CI6B 2YKQA 2BASA 2Z5IA 1QL1A 2OYHC 3VMZA 1L0LK 1T2KC 1IFJA 2VRSA 1H88A 3U59A 1OWAA 2R5DA 1N73C 2Q9IA 1KQLA 1T3UA 3TNUB 3HTKB 3HUSC 3BRTB 5APTA 2WPSA 2YMYA 3M06A 2YKPA 2HG5D 1JOCA 5AW5B 2XDJA 5AVXB 2WSCH 3WMM0 1KILD 1J2JB 3LW5H 1LTAC 1GK4A 2C9LY 1FU1A 5CJ0A 1SQXK 2HODB 3EQ2A 1FZCC 4W7YA 1GL2B 5CJ4A 5AW1B 1YTZT 4W80A 1FJPA 1JNMA 4XA4A 2OYIA 4OH8B 1SFCD 1RE4C 2FFDC 5KJ7A 3PP5A 2O1KA 1A02J 1FZBA 1WT6A 1NHLA 2IFNA 2OYHA 2FYUK 2KYVA 3TK1A 2WPRA 1MV8A 1URQB 4LGDE 4O9BA 4ZKPA 1N73A 1FAVA 3B5NB 2R3CA 3HUSA 4I6MC 1ZV8A 3M0AA 2N1TD 2I1JA 3M9HA 1JY2N 3BVHA 2YO3A 1LTGC 2XKMA 3P8CE 4N78D 1JO5A 1N7SB 3MD0A 3RK3D 1SQBK 1LT9B 1NH4A 2XZRA 1FZCA 1FZEA 5APVA 3CL3D 3RK2C 1RE4A 2FFDA 3M9QA 1RF1B 2W27A 1MFZA 1H8AA 1A02F 4GT1A 1FDMA 2CPSA 2C9NY 2XV5A 1FOSF 1AQ5A 1X79B 1GTWA 1KILB 3L37A 1XTCC 1GK6A 1JTHA 1HWTC 1GD2E 3CLQA 3L4FA 3H32A 2GUVA 2KSJA 3NFQA 1SFCB 4LC1A 3B5ND 2Z5HA 3TNUA 1JCDA 3A7OA 4XE5B 4N3YB 3A5TA 1LTTC 2YKOA 1PFIA 2OARA 3L35A 4W7ZA 1KFMA 5BVZA 1FZAA 2WPQA 1FZGA 1YTZI 1NKZB 1LT9C 3BASA 2J59M 3H6PA 1JY3O 2HODA 2KP8A 2N1TB 5AW3B 3VMXA 2QM7A 2I1KA 1GZLA 2W6AA 1NO4A 1NTZK 1GL2A 1HJBA 2NPSC 2Z4EA 1RY3A 3B8EB 4IFMA 4LLHA 3RK3B 1J1DB 5CCHD 1SLQA 5CCGD 3HE5B 4GKGA 2W6BA 4ZKUA 4I1LA 2IPPA 4M3LA 1ZLLA 1E5WA 3HD7D 2P2UA 1S9KD 2ZXEB 2P1JA 1ZN5A 1M1JB 1LWUC 5AW9B 1Z56A 3OAKA 1LTIC 2FXMA 1M7LA 3V2NA 4AUWA 4HYTB 5APSA 1KFNA 2R5BA 4WY4D 3HE4A 1G2CA 3KQGA 5AW0B 2WT7B 1NTMK 1SFCC 1N86A 1G1JA 3G3ZA 3GHGC 4GIFA 1KZUB 2H8PD 1J1EC 1LTJB 3BATA 1HVVA 2R32A 1LT9A 2C0WA 3NMDA 4RESB 3KPEA 4N78E 3OJAB 1IFMA 2GUSA 2IX7C 3MGNA 5AVZB 1L4AC 5AVTB 1GW3A 1T8ZA 1XTGB 2NPSA 2YO2A 3M0DA 2H7HA 1LTBC 3VTPC 3TSIA 3VOPA 5KTBA 3OA7A 2N1TC 5AVVB 2HYNA 1NWQA 1VPCA 3NTNA 5APQA 1RF0A 1FOSE 1HH0A 1CSBA 1MUUA 1LWUA 1JY3P 3HRNA 4EIJA 3I5CA 5CHXA 4DOJA 4JF7A 1NKNA 1CW5A 2MJZA 2OYIB 3MIWA 5APXA 1M1JC 4C7NB 1SFCA 1CZQA 3GHGA 3UIAA 1GW4A 4B86A 3V4WA 2KB7P 2WWWA 1GL2C 4EOTA 3HD7B 2OYHB 5APYA 1SQVK 3A2AA 3RL0D 1IO4A 1N73B 2Q7CA 1L4AA 1X8YA 3RK2D 5AVRB 1FJKA 1CI6A 4KHXA 2KLVA 3V2PA 2N1TA 3N4XA 1URQC 3A3YB 2HFED 4WY4B 1HBWA 2PAJA 3B5NC 3HTKA 2LKMA 5AVQB 4C7RA 1OXZA 3BRVB 4WB4A 2E43A 1X9VA 3P8MC 2C0XA 1WRGA 1JMMA 3KDPB 4DZOA 4JYBA 1DH3A 1N7SC 2POHA 1NOHA 1ZR4A 2WITA 3LIDA 4JYCA 1M1JA 2FFDB 1IC2A 2N9BA 3U1AA 1S9KE 4N6JA 5AW6B 5AW8B 1FBMA 5AW7B 1VDFA 1H89A 3P32A 2FKWB 3N7NA 3MTUE 3M0DC 2Q3IA 2WTYA 5KJ7D 3U1CA 3T97A 1MZ9A 1SQPK 2M3BA 2WT7A 2HLOA 1RF1C 3P7KA 5CCHC 4AYCA 1JY3N 3H32B 1RF0C 3HD7C 2ZFCA 1T2KD 5APUA 1GU5A 2CPBA 2P7JA 1KILC 2L5GB 1LGHB 2NPSD 1URQA 2HPCB 4AQRD 2M8RA 3II6A 5BU5A 3B5NA 5CMZA 3V2RA 1IFNA 1IK9A 3V2QA 4Y99B 1HGVA 3RL0B 4WY4C 1AFOA 1IFDA 1N7SA 3RK2B 3C9IA 2H43A 1IJDB 3SWYA 3SWFA 1NTKK 2JEEA 2WSFH 2A45G 2P67A 3V4QA 4C7NA 1RE3C 2FYZA 1RF1A 1HGZA 3IR9A 5AVSB 5CCHA 5CCGA 1JY2O 1HTLC 3HD7A 1IFIA 2KOGA 3RK3C 1JCCA 1GU4A 2E42A 1J1DC 1L4AD 1KILA 1T3JA 2A45I 4IFDK 1L0NK 1N7LA 5BU8B 2J58A 1SVFA 3VN0A 3HE4B 1G2CB 5AVUB 2Q5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVY B;  1A02 J;  2XU6 A;  3HTK A;  1NAF A;  5AVQ B;  5AW4 B;  3M91 A;  1SLQ A;  3HE5 B;  3VYI A;  1OXZ A;  4GKG A;  4M3L A;  2IPP A;  1JUN A;  2P2U A;  4I2L C;  2ZXE B;  3P8M C;  1S9K D;  2E43 A;  3TK1 A;  2WPR A;  3KDP B;  1MV8 A;  4JYB A;  3TYY A;  4DZO A;  1DH3 A;  5AW9 B;  3LID A;  4JYC A;  3OAK A;  2N9B A;  3LIE A;  1S9K E;  4AUW A;  1FAV A;  4HYT B;  2R3C A;  4I6M C;  1SP4 A;  5APS A;  5AW6 B;  5AW8 B;  1HUC A;  3M0A A;  5AW7 B;  3M9H A;  1H89 A;  3P32 A;  2JJL A;  2YO3 A;  2R5B A;  3M9B A;  2Q3I A;  2WTY A;  3HE4 A;  3KQG A;  5AW0 B;  3T97 A;  2WT7 B;  3MD0 A;  5APW A;  2WT7 A;  3P7K A;  3VMY A;  4AYC A;  2R32 A;  3HE5 A;  3NMD A;  2XZR A;  4RES B;  3O8Z A;  2ZFC A;  5APV A;  1T2K D;  5APU A;  3V5B A;  1GU5 A;  3MGN A;  1YYC A;  2P7J A;  5AVW B;  2YNY A;  5AVZ B;  5AVT B;  2YO2 A;  3M0D A;  2H7H A;  4AQR D;  3VTP C;  5CMZ A;  2W27 A;  1MFZ A;  1H8A A;  1A02 F;  3L36 A;  5AVV B;  3NXS A;  4GT1 A;  1NWQ A;  5AW2 B;  3NTN A;  2C9N Y;  2XV5 A;  5APQ A;  1FOS F;  2QM8 A;  1GTW A;  1FOS E;  1CSB A;  3L37 A;  1MUU A;  1GK6 A;  1HWT C;  4C46 A;  1CI6 B;  1GD2 E;  2BAS A;  2Z5I A;  3I5C A;  3VMZ A;  3NFQ A;  3SWF A;  1T2K C;  2VRS A;  1H88 A;  5APX A;  1OWA A;  2R5D A;  4LC1 A;  1KQL A;  4C7N B;  3TNU B;  2P67 A;  3V4Q A;  2Z5H A;  1CZQ A;  4C7N A;  3TNU A;  3UIA A;  5APT A;  2WPS A;  4B86 A;  3V4W A;  3A7O A;  2WWW A;  4XE5 B;  3IR9 A;  3M06 A;  3A5T A;  4EOT A;  5AVS B;  5APY A;  3A2A A;  3L35 A;  5AW5 B;  5AVX B;  1IO4 A;  2WPQ A;  2E42 A;  1GU4 A;  1J2J B;  2Q7C A;  2C9L Y;  1GK4 A;  1X8Y A;  5AVR B;  1CI6 A;  4KHX A;  2KP8 A;  5AW3 B;  3VMX A;  2QM7 A;  5AW1 B;  1GZL A;  2W6A A;  3VN0 A;  1JNM A;  1HJB A;  3A3Y B;  3HE4 B;  1G2C B;  5AVU B;  1HBW A;  2Q5U A;  3B8E B; 
#chains in the Genus database with same CATH topology
 4WY4 A;  1W2E A;  4U3F D;  1BCC G;  4EI2 A;  3VYI A;  5GTH H;  2ZT9 B;  2GM4 A;  3RL0 C;  3CI9 A;  1LTJ C;  3LIE A;  1Q81 Q;  2JO1 A;  1HUC A;  1U57 A;  1YJW P;  1RE3 A;  1KV4 A;  1YQ3 C;  5E79 E;  3M9B A;  1R8E A;  3EWK A;  3CC2 P;  2N9Y B;  1KYO E;  1LTS C;  1LWU B;  1FZF A;  2O1J A;  2WSE H;  2YIU C;  3VP8 A;  1NU1 D;  2YNY A;  4Y28 J;  1QL2 A;  3GHG B;  4IFF A;  2KZJ A;  2HPC A;  2ZYA A;  4H0L C;  1Q90 D;  1BGY D;  3L36 A;  3NXS A;  4JQ0 D;  5AW2 B;  1EQ7 A;  1HF9 A;  2K9Y A;  2QJY C;  2QM8 A;  2IFM A;  2WZ7 A;  3L73 G;  5CCG C;  4GOD A;  3Q2Y A;  1IFJ A;  4IL6 X;  1BE3 G;  3Q5P A;  4BRY B;  1R5S A;  2YMY A;  3KZI H;  2D2C D;  2YKP A;  5AW5 B;  3WUT A;  2ZAE B;  3WMM 0;  3H1L G;  3LW5 H;  2QVA A;  1K05 A;  5CJ0 A;  2HOD B;  2AEJ A;  3EQ2 A;  2QJK C;  1K04 A;  3L72 D;  1FJP A;  3F5H A;  1JNM A;  4XA4 A;  1RE4 C;  1SQQ G;  1FZB A;  1NHL A;  1NTZ D;  4PD4 I;  1P84 I;  1SQX E;  5B5E H;  1MFT A;  5KAI H;  1YIJ P;  1JB0 J;  2OYH A;  1FC2 C;  1QEX A;  3RBZ A;  2KYV A;  3AEF C;  1VQL P;  1EXJ A;  4ZNC A;  2P10 A;  3L75 D;  3BVH A;  4L73 A;  1LTG C;  1EZV G;  3PHL A;  3P8C E;  3H25 A;  4UB6 E;  1KD1 Q;  2KI7 B;  3L74 D;  3CL3 D;  1BDC A;  3CX5 E;  1EZV I;  1SQB E;  2W27 A;  4GT1 A;  1FDM A;  1VL2 A;  3D70 A;  2CPS A;  2C9N Y;  3CXH E;  2LXC B;  3BCC E;  1S2E A;  1TU3 F;  4OVN F;  3G4S P;  4YXD C;  2FYU G;  4PJ0 H;  3L4F A;  2GUV A;  2M5A B;  3H1K G;  2Z5H A;  4I7Z B;  4QMA A;  4BRY A;  5H2F H;  1Y9B A;  4GOF A;  3H1I E;  2OAR A;  4W7Z A;  5BVZ A;  1FZA A;  1FZG A;  3IN6 A;  2W83 C;  2BCC G;  2J59 M;  2HOD A;  2YXR B;  2ZT9 C;  1Q82 Q;  4H0L D;  2N1T B;  2QSI A;  1GZL A;  1NTZ K;  4IFM A;  2KS1 B;  5CCH D;  5CCG D;  2WSS H;  3HE5 B;  1W2B O;  2W6B A;  4I1L A;  4M3L A;  1YQ4 C;  3HD7 D;  4L76 A;  1LWU C;  5AW9 B;  4IL6 E;  3V2N A;  5GTI H;  4HYT B;  4OGQ B;  1KFN A;  4WY4 D;  4D6T J;  1G2C A;  1SFC C;  1OVR A;  1N86 A;  1G1J A;  3GHG C;  2H8P D;  2B87 A;  2R32 A;  3WUV A;  3AE3 C;  3OJA B;  2GUS A;  5AVT B;  1T8Z A;  2YO2 A;  5TIS H;  1LTB C;  3VTP C;  3TSI A;  3OA7 A;  2JWA A;  2ZVN B;  1VPC A;  1K8A Q;  3ITK A;  3USS A;  3S9O A;  1JY3 P;  4H44 B;  2M3E A;  5CHX A;  1NKN A;  2OYI B;  1PP9 E;  3AE1 C;  1M1J C;  2M5A A;  3CD6 P;  3UIA A;  3A2A A;  2IBZ E;  1OFC X;  1N73 B;  2I8D A;  1X8Y A;  3TGU J;  1U7J A;  1CI6 A;  3AE6 C;  3V2P A;  2N1T A;  4BWN A;  3HTK A;  2KS1 A;  3H1I J;  3A0B E;  2C0X A;  1JMM A;  2IZ0 A;  4DZO A;  1NOH A;  2FFD B;  5C39 A;  3U1A A;  3L71 E;  1KYO D;  5AW8 B;  1FBM A;  1VDF A;  3P32 A;  1BSH A;  2Q3I A;  4PD4 E;  2WTY A;  1P84 E;  1MZ9 A;  3P7K A;  1SQV G;  4BXL A;  3GMA A;  2ZT9 D;  1T2K D;  2E76 B;  3SSU A;  4AQR D;  1FDO A;  1L2P A;  3PLN A;  2E5T A;  2V4H A;  1JMB A;  2JDI H;  3V2Q A;  1ZME C;  3CCE P;  1HGV A;  3RL0 B;  4I7Z C;  2H43 A;  3L70 G;  1IJD B;  1EZV E;  3SWY A;  3SWF A;  3Q5S A;  1OX3 A;  2JEE A;  4OWF A;  5AVS B;  2FY8 A;  3H1J E;  1NTK E;  1IFI A;  1JCC A;  1BSN A;  4IFD K;  4K35 A;  4H13 B;  1KTM A;  3MUD C;  1X0T A;  1KB9 H;  4UB8 E;  1SVF A;  3VN0 A;  1SQX D;  4OGQ C;  1NAF A;  3JCU E;  5AW4 B;  3M91 A;  1NTM G;  1BGY J;  3CWB G;  2A45 H;  1PZQ A;  4Y99 C;  3CCL P;  4D6T G;  3TYY A;  1DX7 A;  3H1H E;  1SP4 A;  3P8C D;  2JJL A;  4HH2 A;  1FDI A;  5APW A;  3CX5 D;  3FX0 A;  1RH5 B;  3EFG A;  1SQB D;  5AVW B;  1BDD A;  3L71 J;  2BEZ F;  2PP6 A;  4H44 C;  3CXH D;  2XND H;  3BCC D;  1JY2 P;  2LR2 A;  1AV1 A;  2OYI C;  1JTH B;  1E79 H;  1LTJ A;  1NTZ J;  2YKQ A;  1S5L E;  3AEA C;  3GF3 A;  2Z5I A;  1QL1 A;  2VRS A;  2AXT H;  1N73 C;  3TNU B;  3H1I D;  3TGU G;  1S1C X;  5APT A;  5KLV E;  3MP7 B;  1JOC A;  1L0L E;  1FU1 A;  1SQX K;  1FZC C;  2E74 C;  3PRJ A;  1GL2 B;  4W7Y A;  4DJG A;  4RKU J;  1JM0 A;  3L74 J;  4OH8 B;  2KNC B;  2FFD C;  2JR8 A;  3PP5 A;  3H1J J;  1NTK J;  1SQP G;  3B71 A;  2RKL A;  2A06 G;  1URQ B;  4LGD E;  1DIP A;  4O9B A;  1KQS O;  1OW6 A;  1FAV A;  3B5N B;  3M0A A;  2E76 C;  2N1T D;  2I1J A;  2YO3 A;  2WVR A;  1N7S B;  1SQB K;  1AA0 A;  3V6I A;  2XZR A;  3EFF K;  2R44 A;  1D7M A;  1RE4 A;  4U3F G;  5CBN A;  4OGQ D;  1MFZ A;  1YHQ P;  1H8A A;  1A02 F;  1H0T A;  1WMK A;  2Y0D A;  2XV5 A;  4K3A A;  1AQ5 A;  1GTW A;  1LP1 A;  1GK6 A;  1JTH A;  1GD2 E;  1PP9 D;  3CLQ A;  4ZMD A;  2PGD A;  2CK3 H;  1L0N G;  1SFC B;  4LC1 A;  2FBW C;  3TNU A;  4H13 C;  3AE7 C;  2IBZ D;  3CCJ P;  1NYH A;  2YXQ B;  2GA1 A;  1N8R Q;  1LTT C;  2YKO A;  1PFI A;  1NU1 G;  1YTZ I;  3C8V A;  1YJ9 P;  4H44 D;  1JY3 O;  2KP8 A;  1BGY G;  5AW3 B;  2I1K A;  1GL2 A;  2Z4E A;  1RY3 A;  5KLV J;  1PGQ A;  4LLH A;  4IOI H;  2FYN B;  1L0L J;  3ZDM A;  1Q86 Q;  4ZKU A;  5GTH E;  1S72 P;  3L71 D;  1ZN5 A;  1M1J B;  3CX5 H;  4PD4 D;  4TLF A;  1VQ9 P;  1P84 D;  2IDB A;  3QH9 A;  3Q1M A;  2R5B A;  3HE4 A;  4CPG A;  3CXH H;  3G3Z A;  3AE5 C;  2ZYG A;  2JP3 A;  2K37 A;  1U7M A;  1HVV A;  5B66 H;  3L72 G;  4N78 E;  3Q3D A;  3KXD A;  1IFM A;  2IX7 C;  4PV1 B;  1GW3 A;  5KLI B;  4YXW H;  1K9M Q;  3CWB E;  3OW2 O;  2UWJ E;  5AVV B;  2HYN A;  3NTN A;  5APQ A;  1EZV D;  2FXP A;  1EXI A;  1LWU A;  2QJP B;  3SWK A;  3L75 G;  2E76 D;  1CW5 A;  2MJZ A;  3AE4 C;  1SFC A;  1CZQ A;  3GHG A;  3H1J D;  1NTK D;  3V4W A;  1IZN B;  1GL2 C;  1UIX A;  5APY A;  2V7Q J;  3RL0 D;  1IO4 A;  3L74 G;  3VMA A;  1FJK A;  4KHX A;  4JPZ B;  4L74 A;  2RMZ A;  3RBX A;  1URQ C;  2YMK A;  3FXE A;  1HBW A;  3CPW O;  3B5N C;  5B5E E;  5EFW B;  5KAI E;  1X9V A;  3P8M C;  3H1H D;  2JKV A;  1OW8 A;  1N7S C;  1KC8 Q;  1M1J A;  4N6J A;  4ASV A;  4DCK A;  4H13 D;  3MTU E;  1QX8 A;  1PPJ E;  2HLO A;  3SFE C;  3H32 B;  3CC4 P;  2E5Y A;  2P7J A;  1LGH B;  4L75 A;  1SQP E;  5BU5 A;  5CMZ A;  1IFN A;  1IK9 A;  4Y99 B;  3E1R A;  1SQX J;  2IYO A;  3GLM A;  1GMJ A;  2E75 B;  2R3S A;  3RK2 B;  4PJ0 E;  3AE2 C;  1NTK K;  1BCC E;  5KLV D;  1ZRT E;  2QEX P;  2B88 A;  1KB9 I;  2A45 G;  1L0L D;  3V4Q A;  1HGZ A;  3IR9 A;  3A0B H;  2Q3E A;  1VF5 C;  1JY2 O;  1HTL C;  3TF5 A;  2KOG A;  2FYN C;  2A45 I;  1VQ4 P;  5BU8 B;  1SQB J;  2Q5U A;  5AVY B;  2AEM A;  3BCC J;  2QG4 A;  1L0N E;  1JUN A;  4KJM A;  2NPS B;  5GTI E;  2WSF J;  1GL2 D;  3E1I A;  3L73 E;  4PV1 C;  5KLI C;  3JC2 2;  1FZC B;  1BE3 E;  3HE5 A;  2E74 B;  4YPC A;  1G1I A;  3R2P A;  1N2D C;  3MUD A;  3G71 P;  3V5B A;  1PGP A;  1YYC A;  1OVU A;  1URQ D;  2K3R A;  2QJP C;  2G3A A;  2WPV B;  1EDJ A;  3K5B A;  1ZR2 A;  2XNX A;  3H1L E;  4WBA A;  2PRR A;  5KJ7 C;  1L4A B;  1N7S D;  3B4S A;  5KLV K;  1USE A;  2BAS A;  1L0L K;  1SQQ E;  3S1K A;  3CCQ P;  4UB8 H;  1H88 A;  1VQN P;  2MKV A;  2R5D A;  2Q9I A;  1KQL A;  1T3U A;  3Q5R A;  3HUS C;  3BRT B;  3D71 A;  2PFX A;  2HG5 D;  2XDJ A;  5AVX B;  1VQ8 P;  1LTA C;  3AED C;  1BCC J;  5CJ4 A;  2KXP B;  1YTZ T;  5KAF H;  3T97 B;  2OGU A;  2OYI A;  1SFC D;  4HKZ H;  2IFN A;  1EDI A;  2O01 J;  5M1B A;  3TK1 A;  1QGK B;  4ZKP A;  1N73 A;  2QIW A;  1PP9 J;  2R3C A;  4I6M C;  3SFD C;  2FYU E;  2XKM A;  1VQM P;  4N78 D;  1NVO A;  3W68 A;  3MD0 A;  2WSC J;  1FZC A;  3H1K E;  1S5L H;  1FZE A;  5APV A;  3FWL A;  3CWB D;  2E75 C;  3RK2 C;  3CME P;  2FFD A;  3L73 J;  2RN0 A;  1RF1 B;  1M8O B;  3WU2 E;  1IFP A;  2ZXX A;  3O6Q B;  4RJT A;  2OTL P;  2BCC E;  1BE3 J;  1KIL B;  3L37 A;  4YTP C;  2OTJ P;  1NJI Q;  3NFQ A;  2Y0C A;  4PV1 D;  4EDF A;  2KIK A;  1YJN P;  3H1L J;  4N3Y B;  3A5T A;  3MHV A;  2ZJS E;  3S4R A;  3CCS P;  1SQB G;  1KFM A;  1NKZ B;  1LT9 C;  1SQQ J;  4GOE A;  1KB9 E;  1YIT P;  3VMX A;  1KIL E;  3CX5 I;  1PGJ A;  1NO4 A;  2NPS C;  4A7P A;  3B8E B;  1LJ2 A;  3RK3 B;  1J1D B;  3CXH I;  2IPP A;  1E5W A;  2P2U A;  1PL5 A;  2ZXE B;  2P1J A;  1EC5 A;  5CBO A;  4GDO A;  5DJU B;  3GG2 A;  1Z56 A;  3H1I G;  1LTI C;  3MZW B;  3PTZ A;  1M7L A;  3G6E P;  2WQY C;  1PPJ D;  1IK7 A;  1YI2 P;  2Q6Q A;  5E79 H;  1USD A;  1KYO H;  1NTM K;  4GIF A;  3BAT A;  2V7Q H;  2W8Z A;  3NMD A;  1SQP D;  3KPE A;  3RK3 E;  2ZVO B;  3MGN A;  5AVZ B;  1L4A C;  1XTG B;  3M0D A;  2B9B A;  1K73 Q;  1KN7 A;  2QE7 H;  4DT0 A;  4NPE A;  5KTB A;  3C1L A;  1NWQ A;  1ZOY C;  1NAY A;  3O6Q A;  1RF0 A;  1RQU A;  5K5G B;  1MUU A;  3H1K J;  1BCC D;  1ZRT D;  1DEE G;  1Q7Y Q;  4JBZ A;  4EIJ A;  1ZXG A;  4DOJ A;  3PJS K;  4JF7 A;  3H1H J;  5APX A;  3R4Y A;  4C7N B;  3GF7 A;  1GW4 A;  4B86 A;  2BCC J;  2WWW A;  4HJG H;  2OYH B;  4HB1 A;  2E75 D;  3RK2 D;  5AVR B;  3I56 P;  2KLU A;  3N4X A;  3A3Y B;  1SQV E;  2QA4 P;  1L0N D;  3CCU P;  1LT1 A;  2PAJ A;  1S4X A;  2LKM A;  5AVQ B;  1PP9 G;  1KOR A;  1OXZ A;  1PV3 A;  1VQ6 P;  2E43 A;  2POH A;  3A0H E;  1ZR4 A;  2WIT A;  3L73 D;  4JYC A;  2N9B A;  1S9K E;  2IBZ G;  1ZP0 C;  5AW7 B;  1VF5 B;  1H89 A;  3N7N A;  2IYP A;  3M0D C;  1BE3 D;  1SQP K;  2KNC A;  3L70 E;  3QWO C;  1RF1 C;  4UB6 H;  5CCH C;  3AE9 C;  4AYC A;  1JY3 N;  2IBZ I;  1RF0 C;  3AE8 C;  3HD7 C;  2QRX A;  5APU A;  1GU5 A;  1KIL C;  2L5G B;  2NPS D;  1URQ A;  3H1L D;  3II6 A;  3B5N A;  3V2R A;  3L71 G;  4NPD A;  4WY4 C;  2JWD A;  2O01 N;  1M56 D;  1SQQ D;  1AFO A;  1N7S A;  2KUB A;  2K88 A;  2E74 D;  4RO0 A;  2WSF H;  1NTM E;  1OVV A;  1NTZ G;  2OTK E;  4C7N A;  1RE3 C;  2FYZ A;  5DJT B;  4D6T E;  1DD3 A;  4ASW A;  3RK3 C;  2E42 A;  1Q2N A;  1J1D C;  1L4A D;  2ZYD A;  1SS1 A;  1L0N K;  3WUU A;  2OYO A;  1N7L A;  5AVU B;  1G2C B;  3PH0 A;  3GW6 A;  2XU6 A;  2B87 B;  2KK7 A;  2H89 C;  3KZI E;  1VQK P;  1FS0 E;  1NU1 K;  4I2L C;  1FE6 A;  2Y9Y A;  3HUS B;  4IL6 H;  1VQ5 P;  3H1J G;  1NTK G;  2FYU D;  3IFM A;  1DEB A;  1SQV J;  4R4L A;  3VP9 A;  2G8Y A;  3H1K D;  3AEG C;  3VMY A;  5B66 E;  1GDT A;  2AXC A;  3O8Z A;  3TGU E;  2BCC D;  5TJH A;  2ITA A;  1J1E B;  3IF4 A;  1SQQ K;  3CMA P;  3L70 J;  3H1H G;  3KYQ A;  2IZ1 A;  2O01 H;  1CI6 B;  4C46 A;  2OYH C;  2HR3 A;  3VMZ A;  1T2K C;  1S3J A;  3U59 A;  1OWA A;  3HTK B;  1OW7 A;  2WPS A;  1VQ7 P;  3M06 A;  2A06 E;  1DD4 A;  1HJ0 A;  3FWN A;  1JEK A;  1W5C E;  2WSE J;  1KB9 D;  2WSC H;  1KIL D;  1J2J B;  2C9L Y;  1GK4 A;  3RL0 g;  1NTM J;  5AW1 B;  4W80 A;  2J5U A;  3CWB J;  1Y8A A;  5KJ7 A;  1AQT A;  2O1K A;  1A02 J;  5H2F E;  1WT6 A;  2FYU K;  4U3F E;  1UII A;  5KLV G;  3TDK A;  2WMM A;  2WPR A;  1MV8 A;  3CCM P;  1L0L G;  1ZW0 A;  3HUS A;  1ZV8 A;  3M9H A;  2L91 A;  1JY2 N;  4PD4 H;  1P84 H;  2DW3 A;  1JO5 A;  3RK3 D;  1EDL A;  5KKZ B;  1LT9 B;  1QLE D;  1NH4 A;  1OMI A;  3LW5 J;  3M9Q A;  1NU1 E;  1MKM A;  2D2C B;  3KHU A;  1FOS F;  1X79 B;  1BGY E;  4TT3 H;  4XFJ A;  1XTC C;  1EDK A;  1HWT C;  3H32 A;  2KSJ A;  4Z1M H;  3AEE C;  5L8R J;  5TIS E;  3B5N D;  1JCD A;  1LNQ A;  3A7O A;  4XE5 B;  1AJY A;  4EYY Q;  3FGA D;  3L35 A;  2WPQ A;  2FXO A;  2K9J B;  1S5L X;  2AEF A;  3BAS A;  1SQV D;  3AEC C;  3H6P A;  1SQP J;  2QM7 A;  2W6A A;  1HJB A;  2OQQ A;  3L72 E;  3JCU H;  1SLQ A;  3G9R A;  1KYO I;  4GKG A;  3RGU A;  2H88 C;  1ZLL A;  1Y47 A;  1S9K D;  3JSV C;  1NTZ E;  3OAK A;  4R4M A;  3W67 A;  2FXM A;  4AUW A;  4NPF X;  5APS A;  3L70 D;  4U7J A;  3WU2 H;  3KQG A;  5AW0 B;  2WT7 B;  3L75 E;  1KZU B;  1J1E C;  1LTJ B;  1X22 A;  2B89 A;  4U3F J;  2SPZ A;  2K1A A;  1LT9 A;  2C0W A;  4RES B;  2NZ2 A;  4MN4 C;  2NPS A;  3F89 A;  2H7H A;  4WWI A;  3VOP A;  3L74 E;  2N1T C;  1VF5 D;  1KQG B;  1OIP A;  1PGO A;  2YIU B;  2KSE A;  1L0N J;  2Y0E A;  3IAO A;  1FOS E;  1HH0 A;  1CSB A;  2LXB A;  3HRN A;  1NTM D;  2RH0 A;  3I5C A;  4H0L B;  3CCR P;  1SQX G;  2P58 A;  3MIW A;  4D6T D;  1NU1 J;  2QJY B;  3FXD A;  2KB7 P;  4EOT A;  1YBK A;  3HD7 B;  3D6Y A;  1SQV K;  3E7K A;  1QVF O;  2Q7C A;  1L4A A;  2K9J A;  2KLV A;  5KAF E;  2W6J H;  2HFE D;  4WY4 B;  1RQV A;  1M90 Q;  4C7R A;  1M57 D;  2QJK B;  1VQP P;  3BRV B;  4WB4 A;  1WRG A;  3CC7 P;  3KDP B;  1DH3 A;  4JYB A;  5KKZ C;  3LID A;  1IC2 A;  1VQO P;  3BCC G;  5AW6 B;  1H0T B;  4KT0 J;  2FKW B;  3L72 J;  5KJ7 D;  3U1C A;  3T97 A;  3CCV P;  1LP1 B;  2Y9Z A;  2M3B A;  3TGU D;  1KQF B;  2WT7 A;  1R5L A;  2NRG A;  1QVG O;  2D2C C;  1AVO A;  2ZFC A;  2CPB A;  1AVY A;  1PIX A;  2HPC B;  2M8R A;  2BEQ D;  3L75 J;  1RHZ B;  1IFD A;  3C9I A;  2W90 A;  1PPJ G;  3AEB C;  2O3J A;  2A06 D;  3ABV C;  2P67 A;  1M1K Q;  2FYU J;  2Q1K A;  1RF1 A;  1OZH A;  5CCH A;  5CCG A;  2KZI A;  3HD7 A;  2M0B A;  1GU4 A;  1KIL A;  1T3J A;  3A0H H;  1T6A A;  4WVZ A;  3D6Z A;  1NGM B;  3I55 P;  2J58 A;  2AXT E;  1KMI Z;  3HE4 B; 
#chains in the Genus database with same CATH homology
 5AVY B;  4WY4 A;  1W2E A;  2XU6 A;  1NAF A;  5AW4 B;  3M91 A;  3VYI A;  1NU1 K;  1JUN A;  4I2L C;  2A45 H;  4Y99 C;  2GM4 A;  3RL0 C;  2NPS B;  3TYY A;  1DX7 A;  3CI9 A;  1LTJ C;  3HUS B;  3LIE A;  3IFM A;  1SP4 A;  1DEB A;  3P8C D;  1HUC A;  1GL2 D;  1RE3 A;  3E1I A;  3VP9 A;  2JJL A;  4HH2 A;  3M9B A;  1LTS C;  1LWU B;  5APW A;  3VMY A;  1FZF A;  1FZC B;  3HE5 A;  2O1J A;  1GDT A;  1G1I A;  2WSE H;  3EFG A;  3R2P A;  1N2D C;  3MUD A;  3O8Z A;  3VP8 A;  3V5B A;  1YYC A;  5AVW B;  2YNY A;  1URQ D;  1QL2 A;  2PP6 A;  3GHG B;  4IFF A;  1J1E B;  2HPC A;  1JY2 P;  1ZR2 A;  1SQQ K;  3L36 A;  2XNX A;  3NXS A;  4WBA A;  5AW2 B;  1EQ7 A;  2OYI C;  5KJ7 C;  3KYQ A;  2QM8 A;  1JTH B;  2IFM A;  1L4A B;  1N7S D;  2WZ7 A;  5CCG C;  5KLV K;  1LTJ A;  2O01 H;  4C46 A;  1CI6 B;  2YKQ A;  2BAS A;  2Z5I A;  1QL1 A;  2OYH C;  3VMZ A;  1L0L K;  1T2K C;  1IFJ A;  2VRS A;  1H88 A;  3U59 A;  1OWA A;  2R5D A;  1N73 C;  2Q9I A;  1KQL A;  1T3U A;  3TNU B;  3HTK B;  3HUS C;  3BRT B;  5APT A;  2WPS A;  2YMY A;  3M06 A;  2YKP A;  2HG5 D;  1JOC A;  5AW5 B;  2XDJ A;  5AVX B;  2WSC H;  3WMM 0;  1KIL D;  1J2J B;  3LW5 H;  1LTA C;  1GK4 A;  2C9L Y;  1FU1 A;  5CJ0 A;  1SQX K;  2HOD B;  3EQ2 A;  1FZC C;  4W7Y A;  1GL2 B;  5CJ4 A;  5AW1 B;  1YTZ T;  4W80 A;  1FJP A;  1JNM A;  4XA4 A;  2OYI A;  4OH8 B;  1SFC D;  1RE4 C;  2FFD C;  5KJ7 A;  3PP5 A;  2O1K A;  1A02 J;  1FZB A;  1WT6 A;  1NHL A;  2IFN A;  2OYH A;  2FYU K;  2KYV A;  3TK1 A;  2WPR A;  1MV8 A;  1URQ B;  4LGD E;  4O9B A;  4ZKP A;  1N73 A;  1FAV A;  3B5N B;  2R3C A;  3HUS A;  4I6M C;  1ZV8 A;  3M0A A;  2N1T D;  2I1J A;  3M9H A;  1JY2 N;  3BVH A;  2YO3 A;  1LTG C;  2XKM A;  3P8C E;  4N78 D;  1JO5 A;  1N7S B;  3MD0 A;  3RK3 D;  1SQB K;  1LT9 B;  1NH4 A;  2XZR A;  1FZC A;  1FZE A;  5APV A;  3CL3 D;  3RK2 C;  1RE4 A;  2FFD A;  3M9Q A;  1RF1 B;  2W27 A;  1MFZ A;  1H8A A;  1A02 F;  4GT1 A;  1FDM A;  2CPS A;  2C9N Y;  2XV5 A;  1FOS F;  1AQ5 A;  1X79 B;  1GTW A;  1KIL B;  3L37 A;  1XTC C;  1GK6 A;  1JTH A;  1HWT C;  1GD2 E;  3CLQ A;  3L4F A;  3H32 A;  2GUV A;  2KSJ A;  3NFQ A;  1SFC B;  4LC1 A;  3B5N D;  2Z5H A;  3TNU A;  1JCD A;  3A7O A;  4XE5 B;  4N3Y B;  3A5T A;  1LTT C;  2YKO A;  1PFI A;  2OAR A;  3L35 A;  4W7Z A;  1KFM A;  5BVZ A;  1FZA A;  2WPQ A;  1FZG A;  1YTZ I;  1NKZ B;  1LT9 C;  3BAS A;  2J59 M;  3H6P A;  1JY3 O;  2HOD A;  2KP8 A;  2N1T B;  5AW3 B;  3VMX A;  2QM7 A;  2I1K A;  1GZL A;  2W6A A;  1NO4 A;  1NTZ K;  1GL2 A;  1HJB A;  2NPS C;  2Z4E A;  1RY3 A;  3B8E B;  4IFM A;  4LLH A;  3RK3 B;  1J1D B;  5CCH D;  1SLQ A;  5CCG D;  3HE5 B;  4GKG A;  2W6B A;  4ZKU A;  4I1L A;  2IPP A;  4M3L A;  1ZLL A;  1E5W A;  3HD7 D;  2P2U A;  1S9K D;  2ZXE B;  2P1J A;  1ZN5 A;  1M1J B;  1LWU C;  5AW9 B;  1Z56 A;  3OAK A;  1LTI C;  2FXM A;  1M7L A;  3V2N A;  4AUW A;  4HYT B;  5APS A;  1KFN A;  2R5B A;  4WY4 D;  3HE4 A;  1G2C A;  3KQG A;  5AW0 B;  2WT7 B;  1NTM K;  1SFC C;  1N86 A;  1G1J A;  3G3Z A;  3GHG C;  4GIF A;  1KZU B;  2H8P D;  1J1E C;  1LTJ B;  3BAT A;  1HVV A;  2R32 A;  1LT9 A;  2C0W A;  3NMD A;  4RES B;  3KPE A;  4N78 E;  3OJA B;  1IFM A;  2GUS A;  2IX7 C;  3MGN A;  5AVZ B;  1L4A C;  5AVT B;  1GW3 A;  1T8Z A;  1XTG B;  2NPS A;  2YO2 A;  3M0D A;  2H7H A;  1LTB C;  3VTP C;  3TSI A;  3VOP A;  5KTB A;  3OA7 A;  2N1T C;  5AVV B;  2HYN A;  1NWQ A;  1VPC A;  3NTN A;  5APQ A;  1RF0 A;  1FOS E;  1HH0 A;  1CSB A;  1MUU A;  1LWU A;  1JY3 P;  3HRN A;  4EIJ A;  3I5C A;  5CHX A;  4DOJ A;  4JF7 A;  1NKN A;  1CW5 A;  2MJZ A;  2OYI B;  3MIW A;  5APX A;  1M1J C;  4C7N B;  1SFC A;  1CZQ A;  3GHG A;  3UIA A;  1GW4 A;  4B86 A;  3V4W A;  2KB7 P;  2WWW A;  1GL2 C;  4EOT A;  3HD7 B;  2OYH B;  5APY A;  1SQV K;  3A2A A;  3RL0 D;  1IO4 A;  1N73 B;  2Q7C A;  1L4A A;  1X8Y A;  3RK2 D;  5AVR B;  1FJK A;  1CI6 A;  4KHX A;  2KLV A;  3V2P A;  2N1T A;  3N4X A;  1URQ C;  3A3Y B;  2HFE D;  4WY4 B;  1HBW A;  2PAJ A;  3B5N C;  3HTK A;  2LKM A;  5AVQ B;  4C7R A;  1OXZ A;  3BRV B;  4WB4 A;  2E43 A;  1X9V A;  3P8M C;  2C0X A;  1WRG A;  1JMM A;  3KDP B;  4DZO A;  4JYB A;  1DH3 A;  1N7S C;  2POH A;  1NOH A;  1ZR4 A;  2WIT A;  3LID A;  4JYC A;  1M1J A;  2FFD B;  1IC2 A;  2N9B A;  3U1A A;  1S9K E;  4N6J A;  5AW6 B;  5AW8 B;  1FBM A;  5AW7 B;  1VDF A;  1H89 A;  3P32 A;  2FKW B;  3N7N A;  3MTU E;  3M0D C;  2Q3I A;  2WTY A;  5KJ7 D;  3U1C A;  3T97 A;  1MZ9 A;  1SQP K;  2M3B A;  2WT7 A;  2HLO A;  1RF1 C;  3P7K A;  5CCH C;  4AYC A;  1JY3 N;  3H32 B;  1RF0 C;  3HD7 C;  2ZFC A;  1T2K D;  5APU A;  1GU5 A;  2CPB A;  2P7J A;  1KIL C;  2L5G B;  1LGH B;  2NPS D;  1URQ A;  2HPC B;  4AQR D;  2M8R A;  3II6 A;  5BU5 A;  3B5N A;  5CMZ A;  3V2R A;  1IFN A;  1IK9 A;  3V2Q A;  4Y99 B;  1HGV A;  3RL0 B;  4WY4 C;  1AFO A;  1IFD A;  1N7S A;  3RK2 B;  3C9I A;  2H43 A;  1IJD B;  3SWY A;  3SWF A;  1NTK K;  2JEE A;  2WSF H;  2A45 G;  2P67 A;  3V4Q A;  4C7N A;  1RE3 C;  2FYZ A;  1RF1 A;  1HGZ A;  3IR9 A;  5AVS B;  5CCH A;  5CCG A;  1JY2 O;  1HTL C;  3HD7 A;  1IFI A;  2KOG A;  3RK3 C;  1JCC A;  1GU4 A;  2E42 A;  1J1D C;  1L4A D;  1KIL A;  1T3J A;  2A45 I;  4IFD K;  1L0N K;  1N7L A;  5BU8 B;  2J58 A;  1SVF A;  3VN0 A;  3HE4 B;  1G2C B;  5AVU B;  2Q5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...