5APUA

Sequence iankedkad inserted between gcn4 adaptors - structure a9b black
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
b'HMKQLEDKVEELLSKVYHLENEVARLKKLIANKEDKADMKQLEDKVEELLSKVYHLENEVARLKKLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 28
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apuA00
3NTNA 3HE5B 1FOSE 4GKGA 5AVQB 3O8ZA 5APSA 1GD2E 1NWQA 2WPQA 2P2UA 3KDPB 1S9KE 5CMZA 1CI6A 4B86A 1SLQA 5AVWB 2Q3IA 5AVXB 3L37A 5AW0B 3P32A 2R5DA 3M0AA 1FOSF 1YYCA 2E43A 1H8AA 3LIEA 3MGNA 3UIAA 2W6AA 2Z5IA 1NAFA 1DH3A 5APVA 3VMYA 4M3LA 2QM7A 1SP4A 4C7NB 2VRSA 2P67A 4KHXA 3L35A 3VMZA 3SWFA 3A5TA 2Q5UA 2WTYA 3P7KA 5APUA 5AW2B 2Z5HA 2ZFCA 4RESB 5AW8B 3MD0A 3VMXA 1H88A 2XV5A 2YO3A 5AVSB 2QM8A 5AVVB 3IR9A 3VN0A 3L36A 3TNUB 3HE4A 3NXSA 2Q7CA 3M06A 1OXZA 1G2CB 3V4WA 2WT7B 3HE5A 5AW7B 1MFZA 4AQRD 2JJLA 2R5BA 2WPRA 5AW5B 1T2KC 2P7JA 4JYCA 5AW9B 5AVUB 1A02F 1MV8A 1GTWA 5APQA 3T97A 3M9HA 3VTPC 4JYBA 1S9KD 1CSBA 2E42A 4C46A 5AW4B 3V5BA 2XZRA 3NFQA 1HWTC 5AVRB 2XU6A 5APXA 1HJBA 2W27A 3LIDA 5AW6B 2WWWA 3TK1A 1GK6A 1CZQA 2BASA 2ZXEB 4C7NA 2YNYA 1IO4A 1A02J 2C9NY 4LC1A 1HUCA 1FAVA 1CI6B 3P8MC 3A3YB 2KP8A 4XE5B 4AUWA 1GK4A 1H89A 3M91A 3OAKA 1JUNA 3NMDA 4DZOA 1OWAA 4HYTB 3V4QA 5AVTB 3TNUA 5AVZB 3VYIA 1MUUA 2H7HA 5APTA 4EOTA 1KQLA 5AW1B 2WT7A 3KQGA 1T2KD 3M0DA 5APWA 2IPPA 3B8EB 4AYCA 1GU4A 3M9BA 4I2LC 2R3CA 3A2AA 5APYA 4GT1A 2N9BA 1GU5A 2YO2A 1X8YA 3A7OA 3I5CA 2C9LY 1GZLA 4I6MC 2WPSA 1JNMA 1HBWA 3HE4B 2R32A 5AW3B 3TYYA 3HTKA 5AVYB 1J2JB
chains in the Genus database with same CATH superfamily
3H1JJ 1E5WA 2OYIC 2QJPC 1BE3J 5EFWB 3RL0g 1NTZJ 1YJNP 4OGQC 4H0LB 2R3SA 3MIWA 1LP1A 2E43A 2OQQA 1X0TA 2Z5IA 1KV4A 2Y0CA 3PHLA 4PD4D 2KSEA 2PAJA 1PPJE 1TU3F 4U3FJ 1U7JA 5AVSB 2QSIA 3MP7B 3IN6A 3MHVA 1NU1E 3IFMA 3H1JD 4N78E 1BCCE 2QJPB 2KZIA 1KB9E 1VQKP 2CK3H 1FZBA 1NTZD 1GTWA 3V2QA 3L72G 2YXQB 4PV1C 3V5BA 5DJUB 2WSCJ 1JCDA 4JF7A 3CC2P 2XZRA 2E76C 3Q1MA 1CZQA 1HF9A 1MZ9A 1SFCD 1H89A 3OAKA 4HKZH 1D7MA 2N9YB 5AVZB 1BGYJ 2XNDH 1Q2NA 2W6BA 1ZN5A 1HH0A 5CCHA 2B88A 4I1LA 1T3JA 1YJ9P 2O3JA 1HGVA 3PJSK 3WUVA 1W5CE 3JC22 4LLHA 3IF4A 1RE4A 2RKLA 2AEJA 2E76B 1N2DC 1S9KE 4B86A 1WMKA 1NTKJ 3D70A 4DT0A 3L71E 2A06D 1YYCA 1PP9G 1BGYD 2ZYDA 5KLVJ 4MN4C 3GF7A 1SQQG 4D6TJ 2FFDC 2IZ0A 1SS1A 3L4FA 1YQ4C 3CC7P 3RL0C 1SQXK 3V4WA 2R5BA 2WPRA 1L0NK 2W8ZA 2LR2A 1KILD 1NTKD 5AW4B 3CX5D 2CPBA 4JQ0D 3P8CE 1HWTC 1N7SB 4WBAA 5BU5A 1KFNA 1P84E 5KLVD 4NPDA 5GTIE 1CI6B 4XE5B 4D6TD 1FS0E 2CPSA 1GK4A 5K5GB 1PFIA 3AE2C 4ASWA 4IOIH 1KQLA 5B5EH 3CWBJ 1SQBK 3M0DA 1VQ4P 2ZAEB 1Y9BA 5H2FH 1AQ5A 3SFDC 5C39A 1SQXG 3HD7C 1M7LA 1AVYA 3NTNA 2POHA 3H1HE 1BDCA 2Q3EA 1NWQA 2ZYAA 1SQPJ 5CMZA 2JO1A 3AE6C 1AJYA 4K3AA 4BRYB 2Q3IA 3OJAB 2YKQA 3L74J 1L0NE 3IAOA 1JO5A 1H8AA 2IX7C 4GIFA 4EIJA 4C7NB 2P67A 1L4AC 2VRSA 3VMZA 3CWBD 5APUA 1NGMB 3CMEP 3TGUG 1X22A 1Q7YQ 4Y28J 4TLFA 1NTZK 3E7KA 1Z56A 3C8VA 2B89A 1EQ7A 3FXDA 1SFCA 1USDA 1A02F 1SQBE 3H1LG 1KYOH 5M1BA 1N7LA 3AECC 3L74D 3WUTA 1DX7A 1RF1C 1L2PA 5APXA 4YTPC 1A02J 3KHUA 1N73C 3A3YB 2KP8A 1GL2B 2JWDA 3MUDC 2OYHB 5CCGC 2FXOA 2WSEJ 3EQ2A 2AEMA 4PD4E 1OX3A 3U1AA 2O1KA 2E75B 1NKZB 1QL1A 1X8YA 3Q3DA 1OVUA 4UB6H 2WPSA 3H1JE 3L72J 3LW5J 4WY4B 3BCCG 2IBZI 1RF1B 4GKGA 2E74C 1BE3E 1N7SA 1NTZE 1NO4A 1K8AQ 1FE6A 1FZGA 1CI6A 1EZVI 3M0AA 2O01N 3MGNA 1GMJA 2M8RA 1L0LG 2Q5UA 2IFNA 4U3FE 2XNXA 2W83C 1YJWP 2XKMA 3RK2D 3L75G 1R8EA 1KB9H 2WSEH 1RY3A 3L72D 1ZR2A 1NTKK 1ZRTD 3L70G 1NTMG 1VF5C 2JJLA 1U57A 1GDTA 5AVUB 2QJKB 5KLVK 3JSVC 1LWUC 4BRYA 3CCRP 3LW5H 1M1JC 4W7ZA 1VQMP 1WT6A 4I7ZC 1EC5A 3LIDA 1GK6A 4C7NA 2M3EA 2P58A 1IO4A 2A06E 4GOFA 1BGYE 4DCKA 3VP8A 2ZVOB 2Q1KA 5BVZA 1LTAC 3KQGA 1FBMA 1T2KD 1VF5B 3B4SA 2YMKA 1S5LH 3A2AA 4A7PA 1CW5A 3B5NC 1KC8Q 1RE3C 2FYUG 3CCLP 1GZLA 4I6MC 4YXWH 2ITAA 1M1JB 3RK3D 2ZT9C 4I7ZB 1GD2E 1PP9D 1KILE 1NTKE 1FDIA 1SQQD 3CX5E 1GL2A 1SQVG 3GMAA 2OYHA 5KLVE 3UIAA 2K1AA 4D6TE 3QWOC 4GOEA 3A5TA 3SSUA 1JCCA 3B5NB 5H2FE 1JY2N 1T6AA 5KKZC 1RF0A 5AVVB 3CCMP 3H1HJ 4WY4A 1SQXJ 2RH0A 5KLIC 3D6ZA 2KYVA 5CCHD 1RF1A 3L73G 1L0NJ 2QEXP 5GTIH 2E42A 3VP9A 1U7MA 3PH0A 1AA0A 4W80A 1M90Q 1JM0A 4RO0A 1KN7A 1KYOI 3TGUJ 2D2CD 4HJGH 3CWBE 4OH8B 1YBKA 1IFMA 5KLIB 1W2EA 3H6PA 1ZOYC 1VQ9P 3M9QA 2G3AA 4NPEA 3VMAA 2YO2A 3RGUA 3H1LJ 3Q5RA 4RJTA 3B71A 2K3RA 1FOSE 1SQPE 2WZ7A 3F89A 4H0LD 3L74E 2P10A 1OZHA 1LTGC 3TGUD 1LT9C 1FZCC 1YTZT 1GU5A 4KHXA 5AW2B 3E1IA 2N1TC 5AW8B 2FYNC 4UB6E 1VPCA 1FDOA 1JTHB 3H1LD 1M1JA 2J59M 2GUSA 1IFDA 3N7NA 2Y0DA 1E79H 3CCVP 3A0BH 1J1DB 5AW9B 2BEQD 4WWIA 3M9HA 3HUSC 1KB9I 1LT9B 2HFED 2Q9IA 2W6JH 1EDJA 5DJTB 2KS1B 1L0LJ 2WPVB 2M5AB 1FAVA 3B5NA 1JMBA 2N1TB 4PD4H 1RE3A 2OYIB 2FYNB 1LTBC 4YXDC 3A0HE 3WMM0 1Y8AA 4L75A 4OGQB 2PGDA 2QRXA 1FU1A 3II6A 2GA1A 1EXIA 3BCCD 1Y47A 3L70J 1NTMJ 3AEGC 3L72E 3I5CA 1ZRTE 1SQQK 1ZLLA 3TSIA 2E76D 5AW6B 4H44C 1LTJC 2SPZA 4JPZB 1EDLA 1YI2P 1FZAA 1L0LD 1NYHA 1M56D 2MJZA 4UB8H 1VQOP 2A45I 1LGHB 2C0WA 3L75D 3HRNA 3PLNA 4PV1B 1S5LE 4M3LA 1SP4A 2J58A 3L70D 2LXBA 1NTMD 2K9JA 2FYUJ 5CBOA 4H44B 1LTJB 2IYPA 1JOCA 2WSCH 5CJ0A 1PV3A 1AFOA 1J1EC 4ZKUA 1SQVJ 1UIXA 1PP9E 1N7SD 2HPCA 2RMZA 3NFQA 5AVRB 1SQQE 2KSJA 5CHXA 3H1IG 1KQFB 1K04A 2WVRA 1P84I 2FYUD 4HYTB 2KB7P 3KZIE 2JDIH 3CXHD 1J1EB 3V2PA 2FFDB 1LNQA 1SQVD 5AW3B 2AXCA 3CX5H 1BDDA 3RL0B 3HE5B 2KS1A 4XFJA 2OYIA 2N1TA 1FOSF 2AXTH 3FGAD 1IFJA 3SWFA 3L73D 3G9RA 1H88A 2XV5A 1SQXE 4GDOA 2KNCB 1LTTC 2BEZF 1FZEA 3JCUH 1FDMA 1DD3A 1USEA 2NPSC 1VQ5P 3VTPC 1CSBA 3HTKB 2QA4P 4ZNCA 2UWJE 2I8DA 3HD7B 1KD1Q 1NHLA 1GL2D 2C9NY 4LC1A 3TGUE 4O9BA 2WQYC 3CCQP 5AVTB 1W2BO 1OW8A 4IFMA 2W90A 1JY3O 3A0BE 1LTJA 2O01J 1DIPA 2E75D 5APYA 2NPSB 2J5UA 4PD4I 3H1LE 1L4AB 1JY3P 3CL3D 1L0LK 4WY4D 2C9LY 2JKVA 1HBWA 4C7RA 4IL6H 1LJ2A 2WPQA 2FYZA 3BVHA 1VL2A 1NTMK 2HR3A 3WUUA 4DJGA 1R5SA 1WRGA 1PGOA 2OTLP 1AVOA 5TISE 2YO3A 3VN0A 3PTZA 3BCCE 1N73B 2FFDA 1HJ0A 1NJIQ 3AE9C 2PP6A 3HE5A 3PRJA 4UB8E 2B9BA 2L91A 1N86A 3S1KA 1URQC 2ZXXA 2IBZG 2KZJA 2FYUK 3MTUE 2JR8A 1L0LE 3A0HH 1QGKB 4U3FG 2BASA 3Q2YA 1BCCD 1EDKA 4KT0J 3H1KG 1IK9A 2K88A 1EZVG 2E74B 4H13C 3RK2C 3L75E 1JB0J 2HLOA 3V4QA 2KNCA 1VF5D 3L70E 3OW2O 1SQVK 1NTME 1PP9J 4L74A 3A7OA 1URQB 1SQQJ 2R32A 1DD4A 3HTKA 1M57D 1LTSC 3D71A 1EXJA 3HD7A 4OVNF 1ZR4A 2P2UA 3H1IJ 2YIUC 4H13B 3CPWO 3Q5PA 1VQNP 3AEBC 3P32A 1LWUB 1R5LA 3LIEA 3CX5I 2W6AA 3MZWB 3B5ND 1Q86Q 1EDIA 2FYUE 2NPSA 1QVFO 3R2PA 2ZFCA 2ZVNB 3VMXA 1L4AA 3CXHE 2KLUA 2Y9ZA 2DW3A 3TNUB 3NXSA 3AE7C 3H25A 4W7YA 3USSA 1VQLP 4AQRD 1IZNB 2KUBA 1SQVE 3W67A 1FJKA 3H1ID 3AEEC 2OGUA 2QJYC 4R4LA 2YMYA 4L76A 2AXTE 2L5GB 3EFFK 2ZT9B 3CD6P 5KJ7C 2ZXEB 2BCCG 2WMMA 3KZIH 5KAIE 1M1KQ 3CCJP 1BSHA 4Z1MH 2HG5D 2OYOA 3I56P 2IDBA 3NMDA 4BXLA 1N73A 3VYIA 1MUUA 5APTA 2WITA 5CCHC 3L73E 5AW1B 3MUDA 3JCUE 2E5TA 1GU4A 5CCGA 1PL5A 1IFPA 1P84D 1HTLC 4GT1A 2N9BA 2IFMA 1S2EA 1RE4C 3FX0A 2Z4EA 2QJYB 4DOJA 3BRVB 3HE4B 5KKZB 3TYYA 3EFGA 1SLQA 2D2CC 1NKNA 2K9YA 3WU2H 3VOPA 3S9OA 1PGJA 4PJ0E 3VMYA 3GLMA 2WSSH 4IFDK 1URQA 1FJPA 1OIPA 1JEKA 2K37A 4IL6E 5CJ4A 1YIJP 2PFXA 5AW7B 1NVOA 5B66E 1X79B 5AW5B 2QVAA 4EDFA 1KFMA 2H89C 1LWUA 1VDFA 2JWAA 3BRTB 2W27A 1AQTA 2N1TD 3TK1A 3BCCJ 2YXRB 1OW6A 2M0BA 3CCEP 4OGQD 1S1CX 3AEAC 2B87B 4DZOA 3M0DC 1PGQA 3KYQA 1IK7A 3TNUA 3K5BA 4EOTA 5KAFE 5CBNA 5APWA 3BASA 3G6EP 1FZCB 1SVFA 1PPJG 3FXEA 5GTHH 1N8RQ 3U1CA 2I1KA 1ZXGA 3L75J 1NU1G 4Y99C 3AE5C 1BCCG 3H1KJ 3AEFC 5BU8B 1H0TB 1KZUB 2R5DA 2QE7H 4N3YB 4PV1D 1OVVA 3E1RA 5TISH 3HUSB 4CPGA 1BE3D 2QM7A 3L35A 4RESB 1S5LX 2OARA 2QM8A 2ZYGA 1KTMA 1SFCC 4H44D 1MKMA 3HE4A 2IBZD 1OXZA 1G2CB 3SWYA 3KXDA 3U59A 1MFZA 5KJ7A 3AE4C 4Y99B 1XTCC 1JMMA 4YPCA 2YKOA 5TJHA 1KMIZ 4JBZA 4U3FD 3H1KD 3GG2A 1EZVD 2IZ1A 1LTIC 1VQ6P 1PZQA 3CI9A 2GM4A 3D6YA 2YNYA 3P8MC 1ZV8A 4QMAA 2A45G 2HYNA 4AUWA 4U7JA 3CC4P 4ZKPA 3AE1C 3RK3E 1FC2C 1SFCB 3BATA 3L71G 1G1JA 1T8ZA 3ABVC 1MFTA 1OMIA 1X9VA 2YKPA 3H32B 3RL0D 1N7SC 4WVZA 1HVVA 5AVYB 1JTHA 5AVQB 3H1IE 1ZMEC 2NRGA 2BCCJ 3PP5A 2KIKA 3CCUP 3L73J 5L8RJ 2B87A 1PIXA 3SWKA 2KK7A 1KILC 1QLED 3CXHH 2ZJSE 1LT9A 2JP3A 2P1JA 1KQGB 1FZCA 2Z5HA 1UIIA 2M5AA 3OA7A 2WT7B 1IC2A 2OTJP 3O6QB 4EI2A 2FY8A 2E5YA 3AE3C 3GHGC 2BCCD 1MV8A 3WU2E 1H0TA 5APQA 5KAIH 1RHZB 1KQSO 1LT1A 3HD7D 1KILB 1HJBA 3HUSA 2WWWA 3H1HG 3C1LA 1VQ7P 3W68A 1OWAA 1L0NG 1G2CA 4GODA 1QEXA 2NPSD 1YTZI 3M9BA 1ZP0C 4I2LC 2LKMA 1L4AD 3GHGB 2RN0A 1NH4A 1M8OB 1S72P 1RH5B 1VQPP 2QIWA 1BSNA 2IYOA 3O8ZA 4R4MA 5APSA 1GL2C 2KOGA 3KDPB 4PJ0H 1Q81Q 5E79E 2OYHC 1IJDB 1KYOD 3T97B 3CLQA 1SQBG 3G71P 2FXPA 1DH3A 1NAFA 3ZDMA 2E75C 1RF0C 1SQPD 3MD0A 4WY4C 3IR9A 3H32A 5GTHE 5B66H 1DEEG 5CCGD 4K35A 3GW6A 2Q7CA 1K05A 5KTBA 1NU1J 2KI7B 1BCCJ 3Q5SA 1YQ3C 3S4RA 1FZFA 3H1JG 3V2RA 1PGPA 2E74D 1BE3G 1K73Q 1G1IA 1HUCA 2O01H 2V4HA 1NTZG 2FXMA 5KAFH 1QL2A 3M91A 1JY2O 2H8PD 3KPEA 1PPJD 2H7HA 1OFCX 2WT7A 2IPPA 2QJKC 3B8EB 1JY2P 3O6QA 2H43A 2R3CA 2O1JA 1IFIA 1URQD 4OWFA 1NU1D 2QG4A 1DEBA 2KLVA 4L73A 1T3UA 4N78D 2IBZE 2AEFA 1KB9D 3SFEC 1NOHA 2HODB 1YHQP 1KILA 2R44A 1QVGO 3H1KE 1EZVE 4H13D 3V2NA 4RKUJ 5AVXB 5AW0B 2I1JA 4LGDE 4HB1A 2M3BA 3L71J 5APVA 2FBWC 3P7KA 1HGZA 2FKWB 3GHGA 3AE8C 2PRRA 2A06G 1RQVA 1ZW0A 1OVRA 1JY3N 2MKVA 1YITP 4IFFA 1BGYG 3RK2B 2G8YA 4ZMDA 3AEDC 3M06A 3V6IA 3CXHI 1QX8A 1K9MQ 1T2KC 2P7JA 1XTGB 3G4SP 1GW3A 3T97A 4JYBA 1S9KD 1OW7A 2ZT9D 4BWNA 3RK3C 2C0XA 2Y0EA 3L71D 2JEEA 4XA4A 2A45H 3RBZA 3CCSP 1NTKG 1AV1A 1LP1B 3EWKA 2Q6QA 1JUNA 2YIUB 1RQUA 5KLVG 3TDKA 4D6TG 2NZ2A 3C9IA 2H88C 4TT3H 5B5EE 1GW4A 1JNMA 1IFNA 3I55P 5KJ7D 3RK3B 2WSFJ 2BCCE 2LXCB 1KORA 3F5HA 1S4XA 1VQ8P 1SQPK 3P8CD 3RBXA 5AVWB 1Q90D 3L37A 3TF5A 3CMAP 3G3ZA 2KXPB 4WB4A 3FWLA 2WTYA 1P84H 3QH9A 1Q82Q 3L36A 2V7QJ 4EYYQ 2HODA 3CWBG 3R4YA 4IL6X 4JYCA 3H1HD 1SQXD 1SQBJ 2GUVA 4C46A 3GF3A 2WSFH 2K9JB 1L0ND 2XU6A 1KYOE 4HH2A 1SQPG 2XDJA 4H0LC 1NU1K 2Y9YA 3L74G 4NPFX 2D2CB 1J1DC 3N4XA 4N6JA 2OTKE 1S3JA 4AYCA 4KJMA 2HPCB 2V7QH 3ITKA 4ASVA 3FWNA 1NAYA 5E79H 1SQBD 1J2JB
chains in the Genus database with same CATH topology
1JTHA 1E5WA 2OYIC 5AVQB 1GD2E 2WPQA 3PP5A 2FYZA 3BVHA 3MIWA 1GL2A 1NTMK 2OYHA 2E43A 1KILC 3UIAA 2Z5IA 1LT9A 3A5TA 1JCCA 2P1JA 3B5NB 1FZCA 1JY2N 1WRGA 2Z5HA 2PAJA 1RF0A 2YO3A 5AVSB 5AVVB 3VN0A 1N73B 2FFDA 3OA7A 4WY4A 2PP6A 2KYVA 2WT7B 1IC2A 5CCHD 1RF1A 3HE5A 3IFMA 4N78E 3GHGC 1N86A 1FZBA 1MV8A 1URQC 1GTWA 5APQA 3V2QA 2E42A 3V5BA 3HD7D 3VP9A 1KILB 2FYUK 3MTUE 1JCDA 4JF7A 2XZRA 1HJBA 3HUSA 2WWWA 4W80A 1CZQA 2BASA 1IK9A 1MZ9A 1SFCD 3RK2C 1H89A 3OAKA 1OWAA 2HLOA 3V4QA 5AVZB 4OH8B 1IFMA 1W2EA 1SQVK 1G2CA 3H6PA 2NPSD 2W6BA 1ZN5A 1YTZI 3M9BA 4I2LC 2LKMA 3M9QA 1HH0A 1L4AD 3GHGB 1NH4A 5CCHA 4I1LA 2YO2A 1T3JA 3A7OA 1URQB 1HGVA 2R32A 4LLHA 3HTKA 1RE4A 1FOSE 1LTSC 3O8ZA 1N2DC 5APSA 2WZ7A 1GL2C 2KOGA 3HD7A 1ZR4A 3KDPB 2P2UA 1S9KE 2OYHC 1IJDB 4B86A 3P32A 3CLQA 1LTGC 1LT9C 1YYCA 1LWUB 3LIEA 1FZCC 2W6AA 1DH3A 1NAFA 3B5ND 1RF0C 1YTZT 1GU5A 4KHXA 5AW2B 2FFDC 3E1IA 2NPSA 2N1TC 3R2PA 2ZFCA 5AW8B 3MD0A 4WY4C 3VMXA 3L4FA 1VPCA 1L4AA 3IR9A 1JTHB 3RL0C 3H32A 3TNUB 1M1JA 3NXSA 5CCGD 2Q7CA 2J59M 1SQXK 3V4WA 2GUSA 1IFDA 4W7YA 3N7NA 5KTBA 4AQRD 1J1DB 2R5BA 2WPRA 1L0NK 1FJKA 5AW9B 2YMYA 3M9HA 1KILD 3HUSC 1LT9B 2L5GB 5AW4B 1FZFA 2HFED 2CPBA 3V2RA 2Q9IA 3P8CE 1HWTC 1N7SB 5KJ7C 4WBAA 5BU5A 2ZXEB 1KFNA 1G1IA 1HUCA 2O01H 1FAVA 1CI6B 3B5NA 2N1TB 2OYIB 2FXMA 1RE3A 4XE5B 2HG5D 1LTBC 2CPSA 1GK4A 1QL2A 3M91A 3WMM0 1JY2O 3NMDA 2H8PD 1N73A 3KPEA 1FU1A 1PFIA 3VYIA 1MUUA 2H7HA 3II6A 5APTA 2WITA 5CCHC 1KQLA 5AW1B 3MUDA 2WT7A 1SQBK 3M0DA 2IPPA 3B8EB 1GU4A 1JY2P 5CCGA 2H43A 2R3CA 2O1JA 1IFIA 1HTLC 1URQD 2N9BA 4GT1A 1DEBA 2KLVA 2IFMA 1AQ5A 1T3UA 4N78D 1RE4C 3I5CA 2Z4EA 1SQQK 1ZLLA 4DOJA 3BRVB 3HE4B 3TSIA 1NOHA 2HODB 3HD7C 3TYYA 5AW6B 1M7LA 1KILA 3NTNA 1LTJC 2POHA 3EFGA 1NWQA 3V2NA 1FZAA 5CMZA 2MJZA 1SLQA 2Q3IA 5AVXB 1NKNA 3OJAB 5AW0B 2I1JA 2A45I 2YKQA 1LGHB 4LGDE 3VOPA 1JO5A 1H8AA 2C0WA 2M3BA 3HRNA 2IX7C 5APVA 3VMYA 4GIFA 4M3LA 4EIJA 1SP4A 4C7NB 2P67A 1L4AC 2VRSA 3VMZA 2J58A 3P7KA 5APUA 1HGZA 2FKWB 3GHGA 4IFDK 1URQA 1FJPA 1JY3N 1NTZK 1Z56A 4IFFA 3RK2B 3M06A 5CJ4A 1LTJB 1EQ7A 1JOCA 1SFCA 5AW7B 2WSCH 5CJ0A 1X79B 5AW5B 1T2KC 2P7JA 1AFOA 1J1EC 4ZKUA 1XTGB 1A02F 1KFMA 1GW3A 3T97A 1N7LA 4JYBA 1S9KD 1N7SD 1DX7A 2HPCA 1LWUA 3RK3C 2C0XA 3NFQA 1RF1C 1VDFA 3BRTB 5AVRB 5APXA 2W27A 2N1TD 2KSJA 3TK1A 2JEEA 5CHXA 4XA4A 1A02J 2A45H 1N73C 3A3YB 2KP8A 1GL2B 1JUNA 2OYHB 4DZOA 3M0DC 4HYTB 5CCGC 3KYQA 2KB7P 3TNUA 3EQ2A 4EOTA 3U1AA 5APWA 3BASA 2O1KA 1FZCB 1NKZB 1J1EB 3C9IA 1QL1A 1X8YA 3V2PA 1SVFA 2FFDB 1GW4A 2WPSA 1JNMA 1IFNA 5AW3B 4WY4B 5KJ7D 3U1CA 2I1KA 3RK3B 3RL0B 1RF1B 3HE5B 4GKGA 1N7SA 4Y99C 1NO4A 1FZGA 1SQPK 1CI6A 3P8CD 2OYIA 2N1TA 5AVWB 5BU8B 1KZUB 3L37A 2R5DA 3M0AA 1FOSF 4N3YB 3MGNA 3G3ZA 3HUSB 2M8RA 2QM7A 4WB4A 1IFJA 3L35A 3SWFA 2Q5UA 2WTYA 2IFNA 4RESB 2XNXA 1H88A 2XV5A 2XKMA 2OARA 2QM8A 3RK2D 3L36A 1SFCC 2WSEH 1RY3A 3HE4A 2HODA 1OXZA 1ZR2A 1G2CB 1NTKK 1LTTC 3SWYA 3U59A 1FZEA 1MFZA 4Y99B 5KJ7A 1XTCC 1JMMA 2YKOA 2JJLA 1FDMA 1GDTA 2NPSC 4JYCA 5AVUB 5KLVK 1LWUC 3LW5H 3VTPC 1M1JC 1CSBA 3HTKB 2GUVA 4W7ZA 4C46A 1LTIC 1WT6A 3CI9A 2WSFH 2XU6A 3HD7B 3LIDA 2GM4A 1GK6A 4C7NA 1NHLA 1GL2D 2YNYA 4HH2A 1IO4A 2C9NY 4LC1A 2XDJA 3P8MC 1ZV8A 2A45G 2HYNA 4AUWA 1NU1K 4ZKPA 1SFCB 4O9BA 3BATA 5AVTB 3VP8A 4IFMA 1J1DC 1G1JA 5BVZA 3N4XA 4N6JA 1LTAC 3KQGA 1JY3O 1T8ZA 1FBMA 1T2KD 1LTJA 4AYCA 3A2AA 1CW5A 5APYA 2NPSB 3B5NC 1X9VA 1RE3C 1L4AB 2HPCB 2YKPA 1JY3P 3CL3D 1L0LK 4WY4D 3H32B 1GZLA 4I6MC 2C9LY 1M1JB 1HBWA 3RK3D 3RL0D 1N7SC 1HVVA 5AVYB 1J2JB 4C7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTN A;  3HE5 B;  1FOS E;  4GKG A;  5AVQ B;  3O8Z A;  5APS A;  1GD2 E;  1NWQ A;  2WPQ A;  2P2U A;  3KDP B;  1S9K E;  5CMZ A;  1CI6 A;  4B86 A;  1SLQ A;  5AVW B;  2Q3I A;  5AVX B;  3L37 A;  5AW0 B;  3P32 A;  2R5D A;  3M0A A;  1FOS F;  1YYC A;  2E43 A;  1H8A A;  3LIE A;  3MGN A;  3UIA A;  2W6A A;  2Z5I A;  1NAF A;  1DH3 A;  5APV A;  3VMY A;  4M3L A;  2QM7 A;  1SP4 A;  4C7N B;  2VRS A;  2P67 A;  4KHX A;  3L35 A;  3VMZ A;  3SWF A;  3A5T A;  2Q5U A;  2WTY A;  3P7K A;  5APU A;  5AW2 B;  2Z5H A;  2ZFC A;  4RES B;  5AW8 B;  3MD0 A;  3VMX A;  1H88 A;  2XV5 A;  2YO3 A;  5AVS B;  2QM8 A;  5AVV B;  3IR9 A;  3VN0 A;  3L36 A;  3TNU B;  3HE4 A;  3NXS A;  2Q7C A;  3M06 A;  1OXZ A;  1G2C B;  3V4W A;  2WT7 B;  3HE5 A;  5AW7 B;  1MFZ A;  4AQR D;  2JJL A;  2R5B A;  2WPR A;  5AW5 B;  1T2K C;  2P7J A;  4JYC A;  5AW9 B;  5AVU B;  1A02 F;  1MV8 A;  1GTW A;  5APQ A;  3T97 A;  3M9H A;  3VTP C;  4JYB A;  1S9K D;  1CSB A;  2E42 A;  4C46 A;  5AW4 B;  3V5B A;  2XZR A;  3NFQ A;  1HWT C;  5AVR B;  2XU6 A;  5APX A;  1HJB A;  2W27 A;  3LID A;  5AW6 B;  2WWW A;  3TK1 A;  1GK6 A;  1CZQ A;  2BAS A;  2ZXE B;  4C7N A;  2YNY A;  1IO4 A;  1A02 J;  2C9N Y;  4LC1 A;  1HUC A;  1FAV A;  1CI6 B;  3P8M C;  3A3Y B;  2KP8 A;  4XE5 B;  4AUW A;  1GK4 A;  1H89 A;  3M91 A;  3OAK A;  1JUN A;  3NMD A;  4DZO A;  1OWA A;  4HYT B;  3V4Q A;  5AVT B;  3TNU A;  5AVZ B;  3VYI A;  1MUU A;  2H7H A;  5APT A;  4EOT A;  1KQL A;  5AW1 B;  2WT7 A;  3KQG A;  1T2K D;  3M0D A;  5APW A;  2IPP A;  3B8E B;  4AYC A;  1GU4 A;  3M9B A;  4I2L C;  2R3C A;  3A2A A;  5APY A;  4GT1 A;  2N9B A;  1GU5 A;  2YO2 A;  1X8Y A;  3A7O A;  3I5C A;  2C9L Y;  1GZL A;  4I6M C;  2WPS A;  1JNM A;  1HBW A;  3HE4 B;  2R32 A;  5AW3 B;  3TYY A;  3HTK A;  5AVY B;  1J2J B; 
#chains in the Genus database with same CATH topology
 3H1J J;  1E5W A;  2OYI C;  2QJP C;  1BE3 J;  5EFW B;  3RL0 g;  1NTZ J;  1YJN P;  4OGQ C;  4H0L B;  2R3S A;  3MIW A;  1LP1 A;  2E43 A;  2OQQ A;  1X0T A;  2Z5I A;  1KV4 A;  2Y0C A;  3PHL A;  4PD4 D;  2KSE A;  2PAJ A;  1PPJ E;  1TU3 F;  4U3F J;  1U7J A;  5AVS B;  2QSI A;  3MP7 B;  3IN6 A;  3MHV A;  1NU1 E;  3IFM A;  3H1J D;  4N78 E;  1BCC E;  2QJP B;  2KZI A;  1KB9 E;  1VQK P;  2CK3 H;  1FZB A;  1NTZ D;  1GTW A;  3V2Q A;  3L72 G;  2YXQ B;  4PV1 C;  3V5B A;  5DJU B;  2WSC J;  1JCD A;  4JF7 A;  3CC2 P;  2XZR A;  2E76 C;  3Q1M A;  1CZQ A;  1HF9 A;  1MZ9 A;  1SFC D;  1H89 A;  3OAK A;  4HKZ H;  1D7M A;  2N9Y B;  5AVZ B;  1BGY J;  2XND H;  1Q2N A;  2W6B A;  1ZN5 A;  1HH0 A;  5CCH A;  2B88 A;  4I1L A;  1T3J A;  1YJ9 P;  2O3J A;  1HGV A;  3PJS K;  3WUV A;  1W5C E;  3JC2 2;  4LLH A;  3IF4 A;  1RE4 A;  2RKL A;  2AEJ A;  2E76 B;  1N2D C;  1S9K E;  4B86 A;  1WMK A;  1NTK J;  3D70 A;  4DT0 A;  3L71 E;  2A06 D;  1YYC A;  1PP9 G;  1BGY D;  2ZYD A;  5KLV J;  4MN4 C;  3GF7 A;  1SQQ G;  4D6T J;  2FFD C;  2IZ0 A;  1SS1 A;  3L4F A;  1YQ4 C;  3CC7 P;  3RL0 C;  1SQX K;  3V4W A;  2R5B A;  2WPR A;  1L0N K;  2W8Z A;  2LR2 A;  1KIL D;  1NTK D;  5AW4 B;  3CX5 D;  2CPB A;  4JQ0 D;  3P8C E;  1HWT C;  1N7S B;  4WBA A;  5BU5 A;  1KFN A;  1P84 E;  5KLV D;  4NPD A;  5GTI E;  1CI6 B;  4XE5 B;  4D6T D;  1FS0 E;  2CPS A;  1GK4 A;  5K5G B;  1PFI A;  3AE2 C;  4ASW A;  4IOI H;  1KQL A;  5B5E H;  3CWB J;  1SQB K;  3M0D A;  1VQ4 P;  2ZAE B;  1Y9B A;  5H2F H;  1AQ5 A;  3SFD C;  5C39 A;  1SQX G;  3HD7 C;  1M7L A;  1AVY A;  3NTN A;  2POH A;  3H1H E;  1BDC A;  2Q3E A;  1NWQ A;  2ZYA A;  1SQP J;  5CMZ A;  2JO1 A;  3AE6 C;  1AJY A;  4K3A A;  4BRY B;  2Q3I A;  3OJA B;  2YKQ A;  3L74 J;  1L0N E;  3IAO A;  1JO5 A;  1H8A A;  2IX7 C;  4GIF A;  4EIJ A;  4C7N B;  2P67 A;  1L4A C;  2VRS A;  3VMZ A;  3CWB D;  5APU A;  1NGM B;  3CME P;  3TGU G;  1X22 A;  1Q7Y Q;  4Y28 J;  4TLF A;  1NTZ K;  3E7K A;  1Z56 A;  3C8V A;  2B89 A;  1EQ7 A;  3FXD A;  1SFC A;  1USD A;  1A02 F;  1SQB E;  3H1L G;  1KYO H;  5M1B A;  1N7L A;  3AEC C;  3L74 D;  3WUT A;  1DX7 A;  1RF1 C;  1L2P A;  5APX A;  4YTP C;  1A02 J;  3KHU A;  1N73 C;  3A3Y B;  2KP8 A;  1GL2 B;  2JWD A;  3MUD C;  2OYH B;  5CCG C;  2FXO A;  2WSE J;  3EQ2 A;  2AEM A;  4PD4 E;  1OX3 A;  3U1A A;  2O1K A;  2E75 B;  1NKZ B;  1QL1 A;  1X8Y A;  3Q3D A;  1OVU A;  4UB6 H;  2WPS A;  3H1J E;  3L72 J;  3LW5 J;  4WY4 B;  3BCC G;  2IBZ I;  1RF1 B;  4GKG A;  2E74 C;  1BE3 E;  1N7S A;  1NTZ E;  1NO4 A;  1K8A Q;  1FE6 A;  1FZG A;  1CI6 A;  1EZV I;  3M0A A;  2O01 N;  3MGN A;  1GMJ A;  2M8R A;  1L0L G;  2Q5U A;  2IFN A;  4U3F E;  2XNX A;  2W83 C;  1YJW P;  2XKM A;  3RK2 D;  3L75 G;  1R8E A;  1KB9 H;  2WSE H;  1RY3 A;  3L72 D;  1ZR2 A;  1NTK K;  1ZRT D;  3L70 G;  1NTM G;  1VF5 C;  2JJL A;  1U57 A;  1GDT A;  5AVU B;  2QJK B;  5KLV K;  3JSV C;  1LWU C;  4BRY A;  3CCR P;  3LW5 H;  1M1J C;  4W7Z A;  1VQM P;  1WT6 A;  4I7Z C;  1EC5 A;  3LID A;  1GK6 A;  4C7N A;  2M3E A;  2P58 A;  1IO4 A;  2A06 E;  4GOF A;  1BGY E;  4DCK A;  3VP8 A;  2ZVO B;  2Q1K A;  5BVZ A;  1LTA C;  3KQG A;  1FBM A;  1T2K D;  1VF5 B;  3B4S A;  2YMK A;  1S5L H;  3A2A A;  4A7P A;  1CW5 A;  3B5N C;  1KC8 Q;  1RE3 C;  2FYU G;  3CCL P;  1GZL A;  4I6M C;  4YXW H;  2ITA A;  1M1J B;  3RK3 D;  2ZT9 C;  4I7Z B;  1GD2 E;  1PP9 D;  1KIL E;  1NTK E;  1FDI A;  1SQQ D;  3CX5 E;  1GL2 A;  1SQV G;  3GMA A;  2OYH A;  5KLV E;  3UIA A;  2K1A A;  4D6T E;  3QWO C;  4GOE A;  3A5T A;  3SSU A;  1JCC A;  3B5N B;  5H2F E;  1JY2 N;  1T6A A;  5KKZ C;  1RF0 A;  5AVV B;  3CCM P;  3H1H J;  4WY4 A;  1SQX J;  2RH0 A;  5KLI C;  3D6Z A;  2KYV A;  5CCH D;  1RF1 A;  3L73 G;  1L0N J;  2QEX P;  5GTI H;  2E42 A;  3VP9 A;  1U7M A;  3PH0 A;  1AA0 A;  4W80 A;  1M90 Q;  1JM0 A;  4RO0 A;  1KN7 A;  1KYO I;  3TGU J;  2D2C D;  4HJG H;  3CWB E;  4OH8 B;  1YBK A;  1IFM A;  5KLI B;  1W2E A;  3H6P A;  1ZOY C;  1VQ9 P;  3M9Q A;  2G3A A;  4NPE A;  3VMA A;  2YO2 A;  3RGU A;  3H1L J;  3Q5R A;  4RJT A;  3B71 A;  2K3R A;  1FOS E;  1SQP E;  2WZ7 A;  3F89 A;  4H0L D;  3L74 E;  2P10 A;  1OZH A;  1LTG C;  3TGU D;  1LT9 C;  1FZC C;  1YTZ T;  1GU5 A;  4KHX A;  5AW2 B;  3E1I A;  2N1T C;  5AW8 B;  2FYN C;  4UB6 E;  1VPC A;  1FDO A;  1JTH B;  3H1L D;  1M1J A;  2J59 M;  2GUS A;  1IFD A;  3N7N A;  2Y0D A;  1E79 H;  3CCV P;  3A0B H;  1J1D B;  5AW9 B;  2BEQ D;  4WWI A;  3M9H A;  3HUS C;  1KB9 I;  1LT9 B;  2HFE D;  2Q9I A;  2W6J H;  1EDJ A;  5DJT B;  2KS1 B;  1L0L J;  2WPV B;  2M5A B;  1FAV A;  3B5N A;  1JMB A;  2N1T B;  4PD4 H;  1RE3 A;  2OYI B;  2FYN B;  1LTB C;  4YXD C;  3A0H E;  3WMM 0;  1Y8A A;  4L75 A;  4OGQ B;  2PGD A;  2QRX A;  1FU1 A;  3II6 A;  2GA1 A;  1EXI A;  3BCC D;  1Y47 A;  3L70 J;  1NTM J;  3AEG C;  3L72 E;  3I5C A;  1ZRT E;  1SQQ K;  1ZLL A;  3TSI A;  2E76 D;  5AW6 B;  4H44 C;  1LTJ C;  2SPZ A;  4JPZ B;  1EDL A;  1YI2 P;  1FZA A;  1L0L D;  1NYH A;  1M56 D;  2MJZ A;  4UB8 H;  1VQO P;  2A45 I;  1LGH B;  2C0W A;  3L75 D;  3HRN A;  3PLN A;  4PV1 B;  1S5L E;  4M3L A;  1SP4 A;  2J58 A;  3L70 D;  2LXB A;  1NTM D;  2K9J A;  2FYU J;  5CBO A;  4H44 B;  1LTJ B;  2IYP A;  1JOC A;  2WSC H;  5CJ0 A;  1PV3 A;  1AFO A;  1J1E C;  4ZKU A;  1SQV J;  1UIX A;  1PP9 E;  1N7S D;  2HPC A;  2RMZ A;  3NFQ A;  5AVR B;  1SQQ E;  2KSJ A;  5CHX A;  3H1I G;  1KQF B;  1K04 A;  2WVR A;  1P84 I;  2FYU D;  4HYT B;  2KB7 P;  3KZI E;  2JDI H;  3CXH D;  1J1E B;  3V2P A;  2FFD B;  1LNQ A;  1SQV D;  5AW3 B;  2AXC A;  3CX5 H;  1BDD A;  3RL0 B;  3HE5 B;  2KS1 A;  4XFJ A;  2OYI A;  2N1T A;  1FOS F;  2AXT H;  3FGA D;  1IFJ A;  3SWF A;  3L73 D;  3G9R A;  1H88 A;  2XV5 A;  1SQX E;  4GDO A;  2KNC B;  1LTT C;  2BEZ F;  1FZE A;  3JCU H;  1FDM A;  1DD3 A;  1USE A;  2NPS C;  1VQ5 P;  3VTP C;  1CSB A;  3HTK B;  2QA4 P;  4ZNC A;  2UWJ E;  2I8D A;  3HD7 B;  1KD1 Q;  1NHL A;  1GL2 D;  2C9N Y;  4LC1 A;  3TGU E;  4O9B A;  2WQY C;  3CCQ P;  5AVT B;  1W2B O;  1OW8 A;  4IFM A;  2W90 A;  1JY3 O;  3A0B E;  1LTJ A;  2O01 J;  1DIP A;  2E75 D;  5APY A;  2NPS B;  2J5U A;  4PD4 I;  3H1L E;  1L4A B;  1JY3 P;  3CL3 D;  1L0L K;  4WY4 D;  2C9L Y;  2JKV A;  1HBW A;  4C7R A;  4IL6 H;  1LJ2 A;  2WPQ A;  2FYZ A;  3BVH A;  1VL2 A;  1NTM K;  2HR3 A;  3WUU A;  4DJG A;  1R5S A;  1WRG A;  1PGO A;  2OTL P;  1AVO A;  5TIS E;  2YO3 A;  3VN0 A;  3PTZ A;  3BCC E;  1N73 B;  2FFD A;  1HJ0 A;  1NJI Q;  3AE9 C;  2PP6 A;  3HE5 A;  3PRJ A;  4UB8 E;  2B9B A;  2L91 A;  1N86 A;  3S1K A;  1URQ C;  2ZXX A;  2IBZ G;  2KZJ A;  2FYU K;  3MTU E;  2JR8 A;  1L0L E;  3A0H H;  1QGK B;  4U3F G;  2BAS A;  3Q2Y A;  1BCC D;  1EDK A;  4KT0 J;  3H1K G;  1IK9 A;  2K88 A;  1EZV G;  2E74 B;  4H13 C;  3RK2 C;  3L75 E;  1JB0 J;  2HLO A;  3V4Q A;  2KNC A;  1VF5 D;  3L70 E;  3OW2 O;  1SQV K;  1NTM E;  1PP9 J;  4L74 A;  3A7O A;  1URQ B;  1SQQ J;  2R32 A;  1DD4 A;  3HTK A;  1M57 D;  1LTS C;  3D71 A;  1EXJ A;  3HD7 A;  4OVN F;  1ZR4 A;  2P2U A;  3H1I J;  2YIU C;  4H13 B;  3CPW O;  3Q5P A;  1VQN P;  3AEB C;  3P32 A;  1LWU B;  1R5L A;  3LIE A;  3CX5 I;  2W6A A;  3MZW B;  3B5N D;  1Q86 Q;  1EDI A;  2FYU E;  2NPS A;  1QVF O;  3R2P A;  2ZFC A;  2ZVN B;  3VMX A;  1L4A A;  3CXH E;  2KLU A;  2Y9Z A;  2DW3 A;  3TNU B;  3NXS A;  3AE7 C;  3H25 A;  4W7Y A;  3USS A;  1VQL P;  4AQR D;  1IZN B;  2KUB A;  1SQV E;  3W67 A;  1FJK A;  3H1I D;  3AEE C;  2OGU A;  2QJY C;  4R4L A;  2YMY A;  4L76 A;  2AXT E;  2L5G B;  3EFF K;  2ZT9 B;  3CD6 P;  5KJ7 C;  2ZXE B;  2BCC G;  2WMM A;  3KZI H;  5KAI E;  1M1K Q;  3CCJ P;  1BSH A;  4Z1M H;  2HG5 D;  2OYO A;  3I56 P;  2IDB A;  3NMD A;  4BXL A;  1N73 A;  3VYI A;  1MUU A;  5APT A;  2WIT A;  5CCH C;  3L73 E;  5AW1 B;  3MUD A;  3JCU E;  2E5T A;  1GU4 A;  5CCG A;  1PL5 A;  1IFP A;  1P84 D;  1HTL C;  4GT1 A;  2N9B A;  2IFM A;  1S2E A;  1RE4 C;  3FX0 A;  2Z4E A;  2QJY B;  4DOJ A;  3BRV B;  3HE4 B;  5KKZ B;  3TYY A;  3EFG A;  1SLQ A;  2D2C C;  1NKN A;  2K9Y A;  3WU2 H;  3VOP A;  3S9O A;  1PGJ A;  4PJ0 E;  3VMY A;  3GLM A;  2WSS H;  4IFD K;  1URQ A;  1FJP A;  1OIP A;  1JEK A;  2K37 A;  4IL6 E;  5CJ4 A;  1YIJ P;  2PFX A;  5AW7 B;  1NVO A;  5B66 E;  1X79 B;  5AW5 B;  2QVA A;  4EDF A;  1KFM A;  2H89 C;  1LWU A;  1VDF A;  2JWA A;  3BRT B;  2W27 A;  1AQT A;  2N1T D;  3TK1 A;  3BCC J;  2YXR B;  1OW6 A;  2M0B A;  3CCE P;  4OGQ D;  1S1C X;  3AEA C;  2B87 B;  4DZO A;  3M0D C;  1PGQ A;  3KYQ A;  1IK7 A;  3TNU A;  3K5B A;  4EOT A;  5KAF E;  5CBN A;  5APW A;  3BAS A;  3G6E P;  1FZC B;  1SVF A;  1PPJ G;  3FXE A;  5GTH H;  1N8R Q;  3U1C A;  2I1K A;  1ZXG A;  3L75 J;  1NU1 G;  4Y99 C;  3AE5 C;  1BCC G;  3H1K J;  3AEF C;  5BU8 B;  1H0T B;  1KZU B;  2R5D A;  2QE7 H;  4N3Y B;  4PV1 D;  1OVV A;  3E1R A;  5TIS H;  3HUS B;  4CPG A;  1BE3 D;  2QM7 A;  3L35 A;  4RES B;  1S5L X;  2OAR A;  2QM8 A;  2ZYG A;  1KTM A;  1SFC C;  4H44 D;  1MKM A;  3HE4 A;  2IBZ D;  1OXZ A;  1G2C B;  3SWY A;  3KXD A;  3U59 A;  1MFZ A;  5KJ7 A;  3AE4 C;  4Y99 B;  1XTC C;  1JMM A;  4YPC A;  2YKO A;  5TJH A;  1KMI Z;  4JBZ A;  4U3F D;  3H1K D;  3GG2 A;  1EZV D;  2IZ1 A;  1LTI C;  1VQ6 P;  1PZQ A;  3CI9 A;  2GM4 A;  3D6Y A;  2YNY A;  3P8M C;  1ZV8 A;  4QMA A;  2A45 G;  2HYN A;  4AUW A;  4U7J A;  3CC4 P;  4ZKP A;  3AE1 C;  3RK3 E;  1FC2 C;  1SFC B;  3BAT A;  3L71 G;  1G1J A;  1T8Z A;  3ABV C;  1MFT A;  1OMI A;  1X9V A;  2YKP A;  3H32 B;  3RL0 D;  1N7S C;  4WVZ A;  1HVV A;  5AVY B;  1JTH A;  5AVQ B;  3H1I E;  1ZME C;  2NRG A;  2BCC J;  3PP5 A;  2KIK A;  3CCU P;  3L73 J;  5L8R J;  2B87 A;  1PIX A;  3SWK A;  2KK7 A;  1KIL C;  1QLE D;  3CXH H;  2ZJS E;  1LT9 A;  2JP3 A;  2P1J A;  1KQG B;  1FZC A;  2Z5H A;  1UII A;  2M5A A;  3OA7 A;  2WT7 B;  1IC2 A;  2OTJ P;  3O6Q B;  4EI2 A;  2FY8 A;  2E5Y A;  3AE3 C;  3GHG C;  2BCC D;  1MV8 A;  3WU2 E;  1H0T A;  5APQ A;  5KAI H;  1RHZ B;  1KQS O;  1LT1 A;  3HD7 D;  1KIL B;  1HJB A;  3HUS A;  2WWW A;  3H1H G;  3C1L A;  1VQ7 P;  3W68 A;  1OWA A;  1L0N G;  1G2C A;  4GOD A;  1QEX A;  2NPS D;  1YTZ I;  3M9B A;  1ZP0 C;  4I2L C;  2LKM A;  1L4A D;  3GHG B;  2RN0 A;  1NH4 A;  1M8O B;  1S72 P;  1RH5 B;  1VQP P;  2QIW A;  1BSN A;  2IYO A;  3O8Z A;  4R4M A;  5APS A;  1GL2 C;  2KOG A;  3KDP B;  4PJ0 H;  1Q81 Q;  5E79 E;  2OYH C;  1IJD B;  1KYO D;  3T97 B;  3CLQ A;  1SQB G;  3G71 P;  2FXP A;  1DH3 A;  1NAF A;  3ZDM A;  2E75 C;  1RF0 C;  1SQP D;  3MD0 A;  4WY4 C;  3IR9 A;  3H32 A;  5GTH E;  5B66 H;  1DEE G;  5CCG D;  4K35 A;  3GW6 A;  2Q7C A;  1K05 A;  5KTB A;  1NU1 J;  2KI7 B;  1BCC J;  3Q5S A;  1YQ3 C;  3S4R A;  1FZF A;  3H1J G;  3V2R A;  1PGP A;  2E74 D;  1BE3 G;  1K73 Q;  1G1I A;  1HUC A;  2O01 H;  2V4H A;  1NTZ G;  2FXM A;  5KAF H;  1QL2 A;  3M91 A;  1JY2 O;  2H8P D;  3KPE A;  1PPJ D;  2H7H A;  1OFC X;  2WT7 A;  2IPP A;  2QJK C;  3B8E B;  1JY2 P;  3O6Q A;  2H43 A;  2R3C A;  2O1J A;  1IFI A;  1URQ D;  4OWF A;  1NU1 D;  2QG4 A;  1DEB A;  2KLV A;  4L73 A;  1T3U A;  4N78 D;  2IBZ E;  2AEF A;  1KB9 D;  3SFE C;  1NOH A;  2HOD B;  1YHQ P;  1KIL A;  2R44 A;  1QVG O;  3H1K E;  1EZV E;  4H13 D;  3V2N A;  4RKU J;  5AVX B;  5AW0 B;  2I1J A;  4LGD E;  4HB1 A;  2M3B A;  3L71 J;  5APV A;  2FBW C;  3P7K A;  1HGZ A;  2FKW B;  3GHG A;  3AE8 C;  2PRR A;  2A06 G;  1RQV A;  1ZW0 A;  1OVR A;  1JY3 N;  2MKV A;  1YIT P;  4IFF A;  1BGY G;  3RK2 B;  2G8Y A;  4ZMD A;  3AED C;  3M06 A;  3V6I A;  3CXH I;  1QX8 A;  1K9M Q;  1T2K C;  2P7J A;  1XTG B;  3G4S P;  1GW3 A;  3T97 A;  4JYB A;  1S9K D;  1OW7 A;  2ZT9 D;  4BWN A;  3RK3 C;  2C0X A;  2Y0E A;  3L71 D;  2JEE A;  4XA4 A;  2A45 H;  3RBZ A;  3CCS P;  1NTK G;  1AV1 A;  1LP1 B;  3EWK A;  2Q6Q A;  1JUN A;  2YIU B;  1RQU A;  5KLV G;  3TDK A;  4D6T G;  2NZ2 A;  3C9I A;  2H88 C;  4TT3 H;  5B5E E;  1GW4 A;  1JNM A;  1IFN A;  3I55 P;  5KJ7 D;  3RK3 B;  2WSF J;  2BCC E;  2LXC B;  1KOR A;  3F5H A;  1S4X A;  1VQ8 P;  1SQP K;  3P8C D;  3RBX A;  5AVW B;  1Q90 D;  3L37 A;  3TF5 A;  3CMA P;  3G3Z A;  2KXP B;  4WB4 A;  3FWL A;  2WTY A;  1P84 H;  3QH9 A;  1Q82 Q;  3L36 A;  2V7Q J;  4EYY Q;  2HOD A;  3CWB G;  3R4Y A;  4IL6 X;  4JYC A;  3H1H D;  1SQX D;  1SQB J;  2GUV A;  4C46 A;  3GF3 A;  2WSF H;  2K9J B;  1L0N D;  2XU6 A;  1KYO E;  4HH2 A;  1SQP G;  2XDJ A;  4H0L C;  1NU1 K;  2Y9Y A;  3L74 G;  4NPF X;  2D2C B;  1J1D C;  3N4X A;  4N6J A;  2OTK E;  1S3J A;  4AYC A;  4KJM A;  2HPC B;  2V7Q H;  3ITK A;  4ASV A;  3FWN A;  1NAY A;  5E79 H;  1SQB D;  1J2J B; 
#chains in the Genus database with same CATH homology
 1JTH A;  1E5W A;  2OYI C;  5AVQ B;  1GD2 E;  2WPQ A;  3PP5 A;  2FYZ A;  3BVH A;  3MIW A;  1GL2 A;  1NTM K;  2OYH A;  2E43 A;  1KIL C;  3UIA A;  2Z5I A;  1LT9 A;  3A5T A;  1JCC A;  2P1J A;  3B5N B;  1FZC A;  1JY2 N;  1WRG A;  2Z5H A;  2PAJ A;  1RF0 A;  2YO3 A;  5AVS B;  5AVV B;  3VN0 A;  1N73 B;  2FFD A;  3OA7 A;  4WY4 A;  2PP6 A;  2KYV A;  2WT7 B;  1IC2 A;  5CCH D;  1RF1 A;  3HE5 A;  3IFM A;  4N78 E;  3GHG C;  1N86 A;  1FZB A;  1MV8 A;  1URQ C;  1GTW A;  5APQ A;  3V2Q A;  2E42 A;  3V5B A;  3HD7 D;  3VP9 A;  1KIL B;  2FYU K;  3MTU E;  1JCD A;  4JF7 A;  2XZR A;  1HJB A;  3HUS A;  2WWW A;  4W80 A;  1CZQ A;  2BAS A;  1IK9 A;  1MZ9 A;  1SFC D;  3RK2 C;  1H89 A;  3OAK A;  1OWA A;  2HLO A;  3V4Q A;  5AVZ B;  4OH8 B;  1IFM A;  1W2E A;  1SQV K;  1G2C A;  3H6P A;  2NPS D;  2W6B A;  1ZN5 A;  1YTZ I;  3M9B A;  4I2L C;  2LKM A;  3M9Q A;  1HH0 A;  1L4A D;  3GHG B;  1NH4 A;  5CCH A;  4I1L A;  2YO2 A;  1T3J A;  3A7O A;  1URQ B;  1HGV A;  2R32 A;  4LLH A;  3HTK A;  1RE4 A;  1FOS E;  1LTS C;  3O8Z A;  1N2D C;  5APS A;  2WZ7 A;  1GL2 C;  2KOG A;  3HD7 A;  1ZR4 A;  3KDP B;  2P2U A;  1S9K E;  2OYH C;  1IJD B;  4B86 A;  3P32 A;  3CLQ A;  1LTG C;  1LT9 C;  1YYC A;  1LWU B;  3LIE A;  1FZC C;  2W6A A;  1DH3 A;  1NAF A;  3B5N D;  1RF0 C;  1YTZ T;  1GU5 A;  4KHX A;  5AW2 B;  2FFD C;  3E1I A;  2NPS A;  2N1T C;  3R2P A;  2ZFC A;  5AW8 B;  3MD0 A;  4WY4 C;  3VMX A;  3L4F A;  1VPC A;  1L4A A;  3IR9 A;  1JTH B;  3RL0 C;  3H32 A;  3TNU B;  1M1J A;  3NXS A;  5CCG D;  2Q7C A;  2J59 M;  1SQX K;  3V4W A;  2GUS A;  1IFD A;  4W7Y A;  3N7N A;  5KTB A;  4AQR D;  1J1D B;  2R5B A;  2WPR A;  1L0N K;  1FJK A;  5AW9 B;  2YMY A;  3M9H A;  1KIL D;  3HUS C;  1LT9 B;  2L5G B;  5AW4 B;  1FZF A;  2HFE D;  2CPB A;  3V2R A;  2Q9I A;  3P8C E;  1HWT C;  1N7S B;  5KJ7 C;  4WBA A;  5BU5 A;  2ZXE B;  1KFN A;  1G1I A;  1HUC A;  2O01 H;  1FAV A;  1CI6 B;  3B5N A;  2N1T B;  2OYI B;  2FXM A;  1RE3 A;  4XE5 B;  2HG5 D;  1LTB C;  2CPS A;  1GK4 A;  1QL2 A;  3M91 A;  3WMM 0;  1JY2 O;  3NMD A;  2H8P D;  1N73 A;  3KPE A;  1FU1 A;  1PFI A;  3VYI A;  1MUU A;  2H7H A;  3II6 A;  5APT A;  2WIT A;  5CCH C;  1KQL A;  5AW1 B;  3MUD A;  2WT7 A;  1SQB K;  3M0D A;  2IPP A;  3B8E B;  1GU4 A;  1JY2 P;  5CCG A;  2H43 A;  2R3C A;  2O1J A;  1IFI A;  1HTL C;  1URQ D;  2N9B A;  4GT1 A;  1DEB A;  2KLV A;  2IFM A;  1AQ5 A;  1T3U A;  4N78 D;  1RE4 C;  3I5C A;  2Z4E A;  1SQQ K;  1ZLL A;  4DOJ A;  3BRV B;  3HE4 B;  3TSI A;  1NOH A;  2HOD B;  3HD7 C;  3TYY A;  5AW6 B;  1M7L A;  1KIL A;  3NTN A;  1LTJ C;  2POH A;  3EFG A;  1NWQ A;  3V2N A;  1FZA A;  5CMZ A;  2MJZ A;  1SLQ A;  2Q3I A;  5AVX B;  1NKN A;  3OJA B;  5AW0 B;  2I1J A;  2A45 I;  2YKQ A;  1LGH B;  4LGD E;  3VOP A;  1JO5 A;  1H8A A;  2C0W A;  2M3B A;  3HRN A;  2IX7 C;  5APV A;  3VMY A;  4GIF A;  4M3L A;  4EIJ A;  1SP4 A;  4C7N B;  2P67 A;  1L4A C;  2VRS A;  3VMZ A;  2J58 A;  3P7K A;  5APU A;  1HGZ A;  2FKW B;  3GHG A;  4IFD K;  1URQ A;  1FJP A;  1JY3 N;  1NTZ K;  1Z56 A;  4IFF A;  3RK2 B;  3M06 A;  5CJ4 A;  1LTJ B;  1EQ7 A;  1JOC A;  1SFC A;  5AW7 B;  2WSC H;  5CJ0 A;  1X79 B;  5AW5 B;  1T2K C;  2P7J A;  1AFO A;  1J1E C;  4ZKU A;  1XTG B;  1A02 F;  1KFM A;  1GW3 A;  3T97 A;  1N7L A;  4JYB A;  1S9K D;  1N7S D;  1DX7 A;  2HPC A;  1LWU A;  3RK3 C;  2C0X A;  3NFQ A;  1RF1 C;  1VDF A;  3BRT B;  5AVR B;  5APX A;  2W27 A;  2N1T D;  2KSJ A;  3TK1 A;  2JEE A;  5CHX A;  4XA4 A;  1A02 J;  2A45 H;  1N73 C;  3A3Y B;  2KP8 A;  1GL2 B;  1JUN A;  2OYH B;  4DZO A;  3M0D C;  4HYT B;  5CCG C;  3KYQ A;  2KB7 P;  3TNU A;  3EQ2 A;  4EOT A;  3U1A A;  5APW A;  3BAS A;  2O1K A;  1FZC B;  1NKZ B;  1J1E B;  3C9I A;  1QL1 A;  1X8Y A;  3V2P A;  1SVF A;  2FFD B;  1GW4 A;  2WPS A;  1JNM A;  1IFN A;  5AW3 B;  4WY4 B;  5KJ7 D;  3U1C A;  2I1K A;  3RK3 B;  3RL0 B;  1RF1 B;  3HE5 B;  4GKG A;  1N7S A;  4Y99 C;  1NO4 A;  1FZG A;  1SQP K;  1CI6 A;  3P8C D;  2OYI A;  2N1T A;  5AVW B;  5BU8 B;  1KZU B;  3L37 A;  2R5D A;  3M0A A;  1FOS F;  4N3Y B;  3MGN A;  3G3Z A;  3HUS B;  2M8R A;  2QM7 A;  4WB4 A;  1IFJ A;  3L35 A;  3SWF A;  2Q5U A;  2WTY A;  2IFN A;  4RES B;  2XNX A;  1H88 A;  2XV5 A;  2XKM A;  2OAR A;  2QM8 A;  3RK2 D;  3L36 A;  1SFC C;  2WSE H;  1RY3 A;  3HE4 A;  2HOD A;  1OXZ A;  1ZR2 A;  1G2C B;  1NTK K;  1LTT C;  3SWY A;  3U59 A;  1FZE A;  1MFZ A;  4Y99 B;  5KJ7 A;  1XTC C;  1JMM A;  2YKO A;  2JJL A;  1FDM A;  1GDT A;  2NPS C;  4JYC A;  5AVU B;  5KLV K;  1LWU C;  3LW5 H;  3VTP C;  1M1J C;  1CSB A;  3HTK B;  2GUV A;  4W7Z A;  4C46 A;  1LTI C;  1WT6 A;  3CI9 A;  2WSF H;  2XU6 A;  3HD7 B;  3LID A;  2GM4 A;  1GK6 A;  4C7N A;  1NHL A;  1GL2 D;  2YNY A;  4HH2 A;  1IO4 A;  2C9N Y;  4LC1 A;  2XDJ A;  3P8M C;  1ZV8 A;  2A45 G;  2HYN A;  4AUW A;  1NU1 K;  4ZKP A;  1SFC B;  4O9B A;  3BAT A;  5AVT B;  3VP8 A;  4IFM A;  1J1D C;  1G1J A;  5BVZ A;  3N4X A;  4N6J A;  1LTA C;  3KQG A;  1JY3 O;  1T8Z A;  1FBM A;  1T2K D;  1LTJ A;  4AYC A;  3A2A A;  1CW5 A;  5APY A;  2NPS B;  3B5N C;  1X9V A;  1RE3 C;  1L4A B;  2HPC B;  2YKP A;  1JY3 P;  3CL3 D;  1L0L K;  4WY4 D;  3H32 B;  1GZL A;  4I6M C;  2C9L Y;  1M1J B;  1HBW A;  3RK3 D;  3RL0 D;  1N7S C;  1HVV A;  5AVY B;  1J2J B;  4C7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...