5APVA

Sequence iankedkad inserted between gcn4 adaptors - structure a9b grey
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
70
structure length
70
Chain Sequence
HMKQLEDKVEELLSKVYHLENEVARLKKLIANKEDKADMKQLEDKVEELLSKVYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 28
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apvA00
1T2KC 2W6AA 3TYYA 4RESB 1J2JB 5AVXB 2QM7A 2BASA 5APQA 3VMZA 1NAFA 4XE5B 2Q7CA 3KDPB 1GTWA 5AVTB 1DH3A 1GZLA 2R3CA 3M91A 4KHXA 5AW6B 4C7NA 2XV5A 3OAKA 1SP4A 2ZXEB 5AVQB 5AW1B 3NMDA 1H8AA 1KQLA 5AW2B 2C9NY 3KQGA 4I6MC 2YNYA 5AVYB 2WPRA 5AW0B 4AYCA 2WTYA 4M3LA 3TNUA 2KP8A 4LC1A 1MUUA 4C7NB 2WPQA 3P7KA 3L35A 3M0DA 1MV8A 3V4QA 3M9BA 3V4WA 3SWFA 2E43A 1GD2E 2JJLA 1S9KE 1H89A 1YYCA 2WWWA 3NTNA 4JYCA 2ZFCA 3A3YB 3MGNA 3TNUB 1CSBA 3A5TA 3LIDA 3O8ZA 4GT1A 2Z5HA 5AW7B 3IR9A 2WPSA 2XU6A 4B86A 3VYIA 2VRSA 2P67A 4AUWA 1MFZA 3A2AA 3L37A 4I2LC 1JNMA 5APWA 3UIAA 2R5DA 2Q3IA 3P32A 1GK4A 1A02F 5AVUB 3MD0A 5AVZB 5AVVB 3L36A 3VMXA 1HBWA 1HWTC 2Q5UA 2Z5IA 5APVA 5AW8B 3NFQA 3M0AA 1OWAA 5APTA 2WT7A 2E42A 5APSA 3T97A 3VN0A 1GU4A 1A02J 2IPPA 3B8EB 4C46A 3A7OA 1S9KD 3NXSA 3HE5A 2W27A 5AW4B 3V5BA 1G2CB 1HJBA 2YO3A 1CZQA 3I5CA 1GU5A 1FAVA 2WT7B 3TK1A 2R5BA 5AVRB 1NWQA 1T2KD 1H88A 1X8YA 2N9BA 2P7JA 3LIEA 3M06A 2YO2A 3HE4A 3VTPC 5APXA 1JUNA 5CMZA 3HE5B 5AW3B 1CI6A 5APYA 4AQRD 3P8MC 1SLQA 5AVSB 3M9HA 2H7HA 5APUA 4DZOA 1FOSF 5AW5B 1FOSE 2C9LY 5AVWB 4GKGA 2XZRA 4EOTA 1OXZA 4JYBA 5AW9B 1IO4A 3VMYA 2P2UA 3HE4B 4HYTB 2R32A 2QM8A 1HUCA 1GK6A 1CI6B 3HTKA
chains in the Genus database with same CATH superfamily
1T2KC 2QM7A 5KJ7A 3VMZA 4HB1A 1M1JC 2J5UA 3KDPB 2E76D 4KHXA 4C7NA 5CHXA 5AVQB 3K5BA 2FFDB 1NTKD 1SQQJ 1VPCA 1LP1B 3GHGC 1LTTC 2FY8A 1FJPA 5CJ0A 2AXTH 2R3SA 3AEAC 2WWWA 1VQKP 4D6TJ 3O8ZA 1OMIA 1SQVD 1MFZA 1YHQP 1LTJC 1TU3F 1GK4A 2FYNB 1N73B 1GDTA 2BCCJ 1SQBJ 1M1JA 1YBKA 3CXHD 2G8YA 3RK3E 1KFNA 2YIUB 2W27A 3G3ZA 3MZWB 1HJBA 4W7ZA 3I5CA 1Q82Q 3GHGA 4TLFA 2KSJA 2M8RA 2P7JA 3CD6P 2KS1B 1JUNA 5CBOA 1QL1A 4AQRD 1KYOI 3S1KA 1S72P 1N86A 1FOSE 2C0WA 1KMIZ 4O9BA 1KFMA 4EOTA 1NTKJ 1BGYE 1NTZD 3RL0D 1D7MA 3G6EP 4N6JA 3TF5A 3RL0g 2KK7A 1GZLA 3CCVP 3RL0B 2XV5A 4EI2A 3L75D 1G1JA 2O3JA 4N78E 1SQVJ 1BGYG 1RY3A 3PP5A 3OJAB 4PJ0E 1NJIQ 1VQ5P 3IAOA 2QJPB 3O6QB 3A3YB 4U3FE 2YKPA 1Q7YQ 4YTPC 1ZR2A 3FX0A 1WRGA 2M3EA 1NU1K 4H0LD 2WSCJ 3VMXA 5CCHD 4A7PA 2WT7A 4IFMA 1QL2A 1N7SD 4L73A 3PRJA 4C46A 1VQMP 2AEJA 3H1HE 1KYOE 4QMAA 3V5BA 2FXOA 2ZVNB 1FAVA 1AVYA 3KHUA 3CI9A 1VL2A 5B5EH 1M56D 5KLVG 3M0DC 1UIIA 3KXDA 3P8MC 1ZXGA 2HG5D 1NU1E 4I7ZC 2ZT9D 1JOCA 3HUSC 2WMMA 3L75J 3H1JE 3I56P 2QM8A 3Q5SA 3CMEP 3ZDMA 4ZNCA 1J1DC 1PPJG 5KAFE 1NKZB 1SP4A 2JKVA 3L74D 1EZVD 3H1LD 3KQGA 2WPRA 5AW0B 3H1JG 3HRNA 1VF5D 3GW6A 4Y99C 1GW4A 4OGQB 1NKNA 3BATA 1FBMA 3M0DA 3CWBG 3SWFA 1HF9A 1P84H 2JJLA 2P1JA 1VQPP 1L0ND 3AE5C 1CW5A 1VF5B 2OTLP 1YI2P 3MGNA 1X0TA 3HUSA 1IJDB 2M3BA 3CCQP 2IBZD 4OWFA 3A2AA 1NTME 1R5SA 4WVZA 1BCCE 2FFDC 3Q1MA 3L72E 1A02F 3VP8A 3L71D 2Z5IA 1WT6A 3AEEC 3D6ZA 3C1LA 1ZV8A 4ZMDA 5EFWB 3AE3C 3G71P 1T3UA 1T2KD 1NYHA 4YXDC 1BCCG 1PGPA 2IYPA 2D2CB 3GG2A 2Y0EA 2YKQA 2FYNC 1FOSF 3L70E 1N73C 5GTHH 3H1LJ 1S5LH 2RH0A 3B5NB 4RESB 4DOJA 2YIUC 2FFDA 3D6YA 3WUTA 1LP1A 1M7LA 1L0NJ 1JMBA 3OAKA 1EDIA 5GTIE 1RQVA 3NMDA 1EXIA 3MIWA 2A06D 1LTIC 1SQVG 1FDOA 1FJKA 1VDFA 3V2PA 3CCLP 2OYIC 3CXHH 3JCUE 2CPSA 3NTNA 3MUDC 2ZFCA 3GLMA 1N73A 1LTJB 2E74B 1KN7A 1FZEA 2ZVOB 2L91A 2JWDA 2WSCH 5DJUB 3E1RA 1JCCA 2P58A 2HFED 2A45I 2JO1A 1VQ8P 3C9IA 2WSEJ 3NXSA 2KS1A 2V7QH 2QJPC 1NTZG 1RF1B 1KZUB 1PGOA 1ZOYC 1LTAC 3RGUA 1H88A 1X8YA 2N9BA 5KAIH 5L8RJ 2O01J 1OVRA 3RK3B 3VTPC 4GDOA 4HKZH 3MUDA 2OYOA 2YMYA 3M9QA 3H1KE 3TGUD 1OXZA 4JYBA 4WWIA 1VQOP 1DD3A 3FWNA 2BASA 2M0BA 5APQA 2FYUD 4UB8H 5AVTB 5AW6B 1YJWP 2ZAEB 4RJTA 2XNXA 1SQXK 1FU1A 5AW1B 1LGHB 2NPSB 2YNYA 3O6QA 2I1JA 2WTYA 4LC1A 5BU8B 4N78D 1GL2B 1WMKA 1YQ3C 2RN0A 4PD4D 1SFCB 2ZJSE 2I1KA 1SQPK 1IC2A 3BCCE 3AECC 1SQXE 4GODA 3VYIA 2B87B 2VRSA 3L37A 1NAYA 4GOFA 4OGQC 5H2FH 2QA4P 2A45G 3TGUJ 5TISE 1KILE 3OW2O 1SQPE 2Q6QA 2QEXP 5AVRB 3T97B 1BE3E 4NPDA 2FBWC 1FZGA 1GW3A 2O01N 2JDIH 1SLQA 3M9HA 3L74G 4BXLA 3H1LG 4HJGH 3CPWO 3RBXA 2SPZA 2IFMA 3L73E 2R32A 1KILC 2ITAA 1BE3G 1HVVA 1EXJA 1HGZA 1RE4C 1KV4A 1LTBC 1SQBD 2Q7CA 2B9BA 1GTWA 3CLQA 1DIPA 2ZXEB 1H8AA 2I8DA 1XTCC 3PH0A 2IBZG 1RE3C 4U3FJ 1JMMA 1ZN5A 3L71G 2IZ0A 1QLED 3B5NC 2AXTE 2KZJA 2H43A 3H1HJ 1JEKA 2QJKB 1NTMD 3CX5D 3L72D 2WSEH 3NFQA 2YXQB 1GU4A 3VN0A 1KC8Q 2O1JA 1YIJP 1JCDA 1URQB 1OW6A 3CCJP 2E75B 2O01H 1RE3A 2WZ7A 2E74C 3PTZA 1Z56A 3AE1C 2WITA 3F5HA 3B5NA 2A06G 1IFDA 1T6AA 5AW5B 2PRRA 3L70D 2C0XA 3VMYA 5M1BA 1NH4A 1RF1C 3USSA 1NAFA 3AE4C 3P8CE 4ASWA 3RK3C 3B71A 2OYIB 4I6MC 1NGMB 2POHA 1E79H 1FZFA 4IOIH 1KTMA 3AEFC 1OW7A 1LTJA 3L35A 4PV1C 1MV8A 3A0HH 1NTMJ 3AE2C 4L76A 2E43A 3L72J 3TDKA 2WSFJ 3A0BE 2QG4A 5KLVK 3FWLA 1JY2O 2K3RA 2NPSC 3P32A 1P84I 2XDJA 1RF1A 1HWTC 4IL6E 3M0AA 1L0LK 1Q90D 3TGUG 5KTBA 2PAJA 3WMM0 1IFMA 1GL2C 3N7NA 1G2CB 1ZRTE 3L70J 1SFCC 3WU2E 1QVFO 2FYUG 5KLVE 3FXDA 1OIPA 1BSNA 1EDJA 4R4MA 1SQQK 1LT9C 3SFDC 4H13C 3G9RA 1DEBA 2M5AB 2XZRA 4RKUJ 4WY4B 3SFEC 2NRGA 1CI6B 2YKOA 2W6AA 1PZQA 2NPSA 4PD4H 4YPCA 4XE5B 2LXBA 1PP9D 1PPJE 4L75A 2BEZF 1DH3A 2PGDA 1H0TB 4LGDE 1SQQE 1GL2A 4L74A 1L0LG 5AW2B 3RBZA 2L5GB 5AVYB 1SFCA 1S4XA 1KB9D 2GUVA 4M3LA 3S4RA 3CWBE 3Q5PA 4D6TE 2B87A 3EFFK 1P84E 4OGQD 2HLOA 3CC2P 3A5TA 1VQNP 1SQQG 3V2QA 2J59M 1JY3O 3CXHI 3H1ID 2BCCE 3C8VA 3W68A 1NTKK 4D6TG 3R2PA 1X9VA 3AE8C 4UB6H 3T97A 1S9KD 3H1KJ 2Q9IA 2LXCB 1KILD 1DEEG 2BCCG 1SQBG 1PP9J 2QJKC 5AVSB 1SQVK 1KILB 1Y47A 1NTKE 5AVWB 5GTHE 2XKMA 1N8RQ 1S5LE 1X22A 2D2CD 1FE6A 1AFOA 1URQC 1GK6A 2KB7P 1L2PA 3TYYA 3L73D 2G3AA 1EDKA 5K5GB 2E75C 1JY2P 3KYQA 2FXMA 4JBZA 3U59A 3B5ND 5CCGC 1NTKG 1SQVE 1HJ0A 1M90Q 3BCCJ 3CX5H 1K73Q 2IDBA 3VP9A 1MUUA 3H1IJ 3P7KA 2E5TA 1AVOA 3CXHE 4WBAA 1NTZK 2QRXA 2KYVA 4JYCA 3VMAA 1IK9A 1FZBA 4GT1A 2P67A 1URQA 2H8PD 2DW3A 5B66H 2K9JB 3KZIH 4I2LC 4HH2A 3UIAA 1BDDA 1SQPJ 1YTZI 2JWAA 1IZNB 4BRYB 2E74D 1Q81Q 3EQ2A 1QGKB 5CCGA 1DX7A 1NTZE 5AW4B 1CZQA 1JO5A 1AQTA 3L73J 3HE5B 3AEGC 2Y9YA 4RO0A 5GTIH 3RK3D 1VQ4P 5DJTB 1IFNA 3H25A 3PHLA 1YJ9P 4ASVA 2KLUA 2QSIA 2JR8A 1FZCB 2YXRB 5AVXB 2OYIA 3S9OA 1JY3P 3JCUH 4PV1D 3HD7B 4UB8E 1KQFB 1EC5A 1KD1Q 3HTKB 3L75G 1S3JA 3P8CD 1KQLA 2H88C 3JSVC 1Y9BA 4PV1B 5KKZB 5E79H 4XFJA 3RK2C 3AEDC 4EYYQ 1BGYD 4WY4C 2FYZA 2NPSD 3SSUA 5CJ4A 4Z1MH 4ZKUA 1Y8AA 2IBZI 3MTUE 2W83C 3H32B 2KLVA 2IX7C 1M57D 1GL2D 3I55P 2Z5HA 3IF4A 2LR2A 1JB0J 1SFCD 1OW8A 2Q3IA 5BU5A 1G2CA 3L36A 4IFFA 5APVA 3WUVA 2E42A 1A02J 3B8EB 3R4YA 3E7KA 1L4AB 1FDMA 1L0NK 4U3FD 1KQSO 1LT9B 2PP6A 2M5AA 1AJYA 2OTKE 3LIEA 4H13B 4WY4A 3FXEA 1CI6A 2K88A 1SS1A 5APYA 3L74E 2HYNA 3H1LE 3CCUP 2N1TB 1K9MQ 1KB9H 3II6A 1IO4A 2P2UA 3ABVC 3H1HD 1H0TA 4N3YB 1KYOD 4ZKPA 4W80A 2UWJE 2O1KA 1ZR4A 1BGYJ 3LW5J 1EZVG 2HODB 1BDCA 1JY2N 3TSIA 5BVZA 1NU1D 2V4HA 3Q5RA 2IBZE 2C9NY 3H1IG 3H1JD 3N4XA 1GMJA 2Q1KA 2KP8A 3L71E 2WPQA 5KJ7C 2AEFA 2QVAA 3W67A 1FC2C 3BVHA 2IZ1A 1L0NG 3E1IA 1GD2E 1M1KQ 1T8ZA 1H89A 4KJMA 1E5WA 3CC4P 3TNUB 1LWUB 1RF0C 2XU6A 2W6JH 4NPFX 1K04A 3MHVA 4AUWA 1XTGB 2WVRA 3AEBC 1ZMEC 2ZYDA 1AA0A 3MD0A 5AVZB 5AVVB 1JM0A 5KLVJ 1FDIA 1RQUA 4DJGA 2K1AA 2PFXA 1PL5A 4W7YA 3KPEA 1KILA 2OYHB 1URQD 4H44C 4EIJA 2CK3H 1BCCD 1RE4A 2E75D 2A06E 1PGJA 1NU1J 5CCGD 1RF0A 4OVNF 1IFPA 2KNCB 1OVUA 2ZYGA 2E76B 4GIFA 1HGVA 3H1JJ 5KLIB 1ZLLA 2QE7H 3BRTB 4IL6X 1S2EA 2ZYAA 3BASA 3CWBJ 1OVVA 2R3CA 3M91A 1JY3N 3AE6C 3Q2YA 2JEEA 3F89A 4PD4I 4JF7A 4AYCA 1JTHB 3V2RA 3V4QA 3A0HE 3GF7A 3V2NA 2K9JA 1PFIA 1FZCC 2W90A 4BRYA 2GUSA 2KUBA 3HD7C 1USEA 2OQQA 4TT3H 2FYUK 4B86A 1JNMA 5APWA 2HPCB 1VQLP 1AQ5A 4NPEA 5KKZC 2Q5UA 2KIKA 1BCCJ 3TGUE 1BSHA 2QJYB 2Y9ZA 3HE5A 1M8OB 2FYUE 1U7JA 1Q2NA 2Y0DA 4XA4A 1FZCA 3EWKA 2NZ2A 4C7RA 2HR3A 2KI7B 3HD7A 5AW9B 3HTKA 1QX8A 3RK2D 1J2JB 1U7MA 4PD4E 5B5EE 1X79B 3LW5H 4K3AA 1L4AC 4DT0A 3EFGA 3PJSK 4WY4D 3A0BH 2B88A 4EDFA 4WB4A 3RK2B 1J1EB 1L0LE 3IFMA 3H1KD 3H32A 4JQ0D 1MFTA 2N1TC 1K05A 4OH8B 4PJ0H 4IL6H 3V4WA 2Y0CA 2GM4A 2OARA 1UIXA 1NHLA 2KZIA 2IYOA 3BRVB 1EQ7A 4H0LB 1S5LX 3CX5I 3WU2H 1W5CE 5AW7B 4U3FG 1SQBK 1N7SB 1NTZJ 2V7QJ 3D71A 4LLHA 2R5DA 1EDLA 3CC7P 2P10A 5AVUB 2KSEA 1L4AA 2K37A 1FZAA 1LT9A 1NOHA 4UB6E 3A7OA 1KYOH 4MN4C 3H1HG 4DCKA 3CMAP 2YO3A 3L4FA 2N1TA 3BCCD 1SQXD 1NWQA 1LWUC 2ZT9B 1SQBE 3ITKA 3SWYA 1YQ4C 2N9YB 3JC22 1NU1G 4CPGA 4GKGA 2KOGA 1NTMK 3HE4B 4U7JA 2HODA 1T3JA 1VQ6P 1SQPD 4K35A 5KJ7D 1BE3D 5KAFH 2AEMA 2OYHC 5C39A 2Z4EA 1YJNP 5TJHA 3H6PA 3TNUA 3CX5E 4GOEA 1LWUA 4C7NB 2W6BA 2RKLA 3AE9C 3M9BA 2E76C 5KLIC 1YYCA 3OA7A 2WPVB 1N7LA 2WPSA 1QEXA 5B66E 1NTMG 1SQXJ 3KZIE 3L72G 4H44D 2ZXXA 1R5LA 2WSFH 2MJZA 1HBWA 1OFCX 1OWAA 5APTA 3WUUA 2OYHA 1S1CX 3L74J 4YXWH 4H44B 1HTLC 3G4SP 1M1JB 2R5BA 1RHZB 3IN6A 3M06A 2KNCA 2MKVA 2YO2A 2Q3EA 5CBNA 1BE3J 1NVOA 1IK7A 2FKWB 1PGQA 3L70G 3GHGB 3AE7C 2WQYC 2QJYC 1G1IA 2YMKA 5APUA 4DZOA 2BEQD 2RMZA 5KAIE 3L71J 1JTHA 1KB9I 4Y28J 3L75E 1FS0E 2GA1A 1VQ7P 3HD7D 3RL0C 3VOPA 2OGUA 4R4LA 5E79E 2JP3A 1EZVI 3CCEP 2KXPB 2AXCA 1IFIA 2HPCA 2WSSH 4IFDK 1CSBA 3CL3D 1ZW0A 1LTGC 3SWKA 1R8EA 2IFNA 3IR9A 2LKMA 1LNQA 3GF3A 3GMAA 1J1EC 2W8ZA 1W2BO 3QH9A 3CCMP 2H89C 1LT1A 3V6IA 3D70A 1OX3A 3B4SA 2WT7B 1USDA 3TK1A 1U57A 1RH5B 3MP7B 4JPZB 1PP9E 4H0LC 5CCHC 5APXA 1N7SC 5CMZA 1L4AD 2FXPA 1LJ2A 5AW3B 1W2EA 5H2FE 1N2DC 1QVGO 3H1KG 4H13D 1HH0A 1KB9E 2QIWA 4HYTB 1MZ9A 1HUCA 2K9YA 1ZRTD 1LTSC 2N1TD 1PP9G 2CPBA 5KLVD 2ZT9C 1NO4A 1EZVE 2J58A 3H1IE 1L0LD 4BWNA 1K8AQ 1OZHA 1YTZT 1AV1A 5CCHA 1L0NE 1N7SA 1S9KE 1IFJA 1PPJD 2A45H 3FGAD 2OTJP 3CCRP 3LIDA 3Q3DA 1VF5C 3BCCG 1SQQD 1SQXG 4I1LA 1KQGB 1DD4A 1ZP0C 4I7ZB 1KORA 2B89A 2FYUJ 2XNDH 3HUSB 5AW8B 3CWBD 5APSA 2IPPA 3PLNA 4D6TD 1P84D 5TISH 1J1DB 3U1AA 1Q86Q 1GU5A 1PIXA 1MKMA 1SQPG 3CCSP 1PV3A 1SVFA 1VQ9P 3HE4A 2BCCD 2E5YA 3U1CA 2H7HA 4Y99B 2R44A 2C9LY 2D2CC 1YITP 3QWOC 3L73G 1L0LJ 4KT0J
chains in the Genus database with same CATH topology
1T2KC 3TYYA 3RK2D 1J2JB 2QM7A 1X79B 3LW5H 5KJ7A 2BASA 5APQA 1L4AC 3VMZA 1JY2P 3EFGA 4WY4D 1M1JC 3KDPB 5AVTB 3KYQA 2FXMA 5AW6B 4KHXA 3U59A 3B5ND 4C7NA 2XNXA 5CHXA 1SQXK 4WB4A 1FU1A 5AVQB 5AW1B 3RK2B 1J1EB 5CCGC 1LGHB 2NPSB 2FFDB 2YNYA 3IFMA 3H32A 1VPCA 2N1TC 2I1JA 2WTYA 3VP9A 3GHGC 4LC1A 5BU8B 1MUUA 1LTTC 3P7KA 4N78D 4OH8B 1FJPA 5CJ0A 1GL2B 3V4WA 2GM4A 2OARA 4WBAA 1NHLA 1SFCB 1NTZK 2WWWA 2KYVA 4JYCA 1IK9A 2I1KA 3BRVB 1EQ7A 1FZBA 1SQPK 1IC2A 3O8ZA 4GT1A 5AW7B 1SQBK 3VYIA 1N7SB 2P67A 2VRSA 1URQA 2H8PD 1MFZA 3L37A 4I2LC 4HH2A 1LTJC 4LLHA 2R5DA 3UIAA 1GK4A 1YTZI 5AVUB 1L4AA 1N73B 1GDTA 3EQ2A 1M1JA 1FZAA 1LT9A 1NOHA 3A7OA 1KFNA 2A45G 5CCGA 1DX7A 2W27A 3G3ZA 5AW4B 1HJBA 4W7ZA 2YO3A 1CZQA 3I5CA 1JO5A 3L4FA 2N1TA 5AVRB 1NWQA 1LWUC 3GHGA 2KSJA 2M8RA 2P7JA 3SWYA 1JUNA 3HE5B 1FZGA 1GW3A 1QL1A 4AQRD 1SLQA 3M9HA 1N86A 1FOSE 4GKGA 2C0WA 2KOGA 1NTMK 2IFMA 4O9BA 4EOTA 1KFMA 3RK3D 1IFNA 3HE4B 2R32A 1KILC 3RL0D 2HODA 1T3JA 1FZCB 5AVXB 1HVVA 2OYIA 1JY3P 5KJ7D 4N6JA 1HGZA 1RE4C 1LTBC 3HD7B 2Q7CA 1GTWA 2OYHC 1GZLA 2Z4EA 3CLQA 3RL0B 2XV5A 3HTKB 2ZXEB 3P8CD 1H8AA 1XTCC 1KQLA 1G1JA 1GK6A 1RE3C 3RK2C 4N78E 3H6PA 1RY3A 3TNUA 1LWUA 3PP5A 3OJAB 1JMMA 4C7NB 1ZN5A 2W6BA 2FYZA 2NPSD 4WY4C 5CJ4A 3M9BA 4ZKUA 3B5NC 1YYCA 3H32B 3MTUE 2H43A 2KLVA 2IX7C 3OA7A 3A3YB 1N7LA 1GL2D 2Z5HA 2WPSA 2YKPA 1SFCD 1ZR2A 2Q3IA 5BU5A 1WRGA 1G2CA 2WSFH 1NU1K 2MJZA 3L36A 3VMXA 4IFFA 5CCHD 1HBWA 2WT7A 2WSEH 4IFMA 3NFQA 1QL2A 1OWAA 5APTA 5APVA 2E42A 1N7SD 2OYHA 1GU4A 3VN0A 1A02J 2O1JA 1JCDA 3B8EB 1URQB 4C46A 3V5BA 1L4AB 1FDMA 2O01H 1HTLC 1FAVA 1RE3A 1L0NK 1M1JB 2WZ7A 2R5BA 3CI9A 1LT9B 2PP6A 3LIEA 3M06A 3M0DC 4WY4A 1Z56A 2YO2A 2WITA 1CI6A 5APYA 3B5NA 3P8MC 2HG5D 2HYNA 1IFDA 2FKWB 2N1TB 5AW5B 3GHGB 3HUSC 1JOCA 2C0XA 3II6A 3VMYA 1IO4A 2P2UA 1G1IA 2QM8A 4N3YB 5APUA 4DZOA 4W80A 4ZKPA 1ZR4A 2O1KA 1NH4A 1J1DC 1RF1C 1NAFA 1JTHA 1NKZB 3P8CE 1SP4A 2HODB 1JY2N 3RK3C 3TSIA 5BVZA 2C9NY 2OYIB 3KQGA 4I6MC 2POHA 3HD7D 2WPRA 5AW0B 3RL0C 3HRNA 3VOPA 4Y99C 1GW4A 1FZFA 3N4XA 1NKNA 3BATA 1FBMA 2KP8A 2WPQA 5KJ7C 1LTJA 3L35A 3M0DA 1MV8A 3SWFA 3BVHA 2E43A 3E1IA 1GD2E 1T8ZA 2JJLA 2P1JA 1H89A 1CW5A 1E5WA 1IFIA 2HPCA 3MGNA 4IFDK 3TNUB 1CSBA 3CL3D 1LWUB 3HUSA 1LTGC 1IJDB 1RF0C 2M3BA 2IFNA 3IR9A 2XU6A 2LKMA 5KLVK 1JY2O 4AUWA 1XTGB 3A2AA 1J1EC 2NPSC 2FFDC 3P32A 2XDJA 1A02F 3MD0A 5AVZB 1RF1A 5AVVB 3VP8A 1HWTC 2Z5IA 1WT6A 3M0AA 1L0LK 5KTBA 2PAJA 3WMM0 1IFMA 1ZV8A 1GL2C 3N7NA 1G2CB 1SFCC 4W7YA 3KPEA 2WT7B 1KILA 1T3UA 3TK1A 2OYHB 1URQD 1T2KD 4EIJA 5CCHC 5APXA 1N7SC 5CMZA 1RE4A 1L4AD 5AW3B 1SQQK 1LT9C 1W2EA 1N2DC 2YKQA 1DEBA 1FOSF 1N73C 1HH0A 2XZRA 5CCGD 1RF0A 4WY4B 4HYTB 1MZ9A 1HUCA 4GIFA 1CI6B 1HGVA 2YKOA 2W6AA 3B5NB 1LTSC 4RESB 4DOJA 1ZLLA 2N1TD 2NPSA 2FFDA 3BRTB 2CPBA 4XE5B 3BASA 1DH3A 2R3CA 1M7LA 3M91A 1NO4A 2J58A 3OAKA 4LGDE 1JY3N 3NMDA 1GL2A 3MIWA 1LTIC 5AW2B 2JEEA 2L5GB 5AVYB 1SFCA 1FJKA 4JF7A 1VDFA 4AYCA 2GUVA 3V2PA 1JTHB 4M3LA 1YTZT 2OYIC 3V2RA 5CCHA 3V4QA 3V2NA 1N7SA 2CPSA 1S9KE 1PFIA 1FZCC 2HLOA 1IFJA 2A45H 3NTNA 2ZFCA 2GUSA 1N73A 3A5TA 3LIDA 3HD7C 3V2QA 1LTJB 1FZEA 2J59M 2FYUK 4I1LA 4B86A 1JY3O 2WSCH 1JNMA 5APWA 1JCCA 2HPCB 1AQ5A 2HFED 2A45I 2Q5UA 3HUSB 5AW8B 1NTKK 3R2PA 1X9VA 5APSA 3T97A 2IPPA 3C9IA 1S9KD 3NXSA 3HE5A 1J1DB 1RF1B 3U1AA 1KZUB 2Q9IA 1GU5A 1LTAC 1KILD 1H88A 1SVFA 1X8YA 2N9BA 3HE4A 3RK3B 3VTPC 3U1CA 4XA4A 5AVSB 1FZCA 1SQVK 2H7HA 1KILB 3MUDA 4Y99B 3M9QA 2YMYA 4C7RA 2C9LY 5AVWB 3HD7A 2XKMA 1OXZA 4JYBA 5AW9B 1AFOA 1URQC 2KB7P 3HTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K C;  2W6A A;  3TYY A;  4RES B;  1J2J B;  5AVX B;  2QM7 A;  2BAS A;  5APQ A;  3VMZ A;  1NAF A;  4XE5 B;  2Q7C A;  3KDP B;  1GTW A;  5AVT B;  1DH3 A;  1GZL A;  2R3C A;  3M91 A;  4KHX A;  5AW6 B;  4C7N A;  2XV5 A;  3OAK A;  1SP4 A;  2ZXE B;  5AVQ B;  5AW1 B;  3NMD A;  1H8A A;  1KQL A;  5AW2 B;  2C9N Y;  3KQG A;  4I6M C;  2YNY A;  5AVY B;  2WPR A;  5AW0 B;  4AYC A;  2WTY A;  4M3L A;  3TNU A;  2KP8 A;  4LC1 A;  1MUU A;  4C7N B;  2WPQ A;  3P7K A;  3L35 A;  3M0D A;  1MV8 A;  3V4Q A;  3M9B A;  3V4W A;  3SWF A;  2E43 A;  1GD2 E;  2JJL A;  1S9K E;  1H89 A;  1YYC A;  2WWW A;  3NTN A;  4JYC A;  2ZFC A;  3A3Y B;  3MGN A;  3TNU B;  1CSB A;  3A5T A;  3LID A;  3O8Z A;  4GT1 A;  2Z5H A;  5AW7 B;  3IR9 A;  2WPS A;  2XU6 A;  4B86 A;  3VYI A;  2VRS A;  2P67 A;  4AUW A;  1MFZ A;  3A2A A;  3L37 A;  4I2L C;  1JNM A;  5APW A;  3UIA A;  2R5D A;  2Q3I A;  3P32 A;  1GK4 A;  1A02 F;  5AVU B;  3MD0 A;  5AVZ B;  5AVV B;  3L36 A;  3VMX A;  1HBW A;  1HWT C;  2Q5U A;  2Z5I A;  5APV A;  5AW8 B;  3NFQ A;  3M0A A;  1OWA A;  5APT A;  2WT7 A;  2E42 A;  5APS A;  3T97 A;  3VN0 A;  1GU4 A;  1A02 J;  2IPP A;  3B8E B;  4C46 A;  3A7O A;  1S9K D;  3NXS A;  3HE5 A;  2W27 A;  5AW4 B;  3V5B A;  1G2C B;  1HJB A;  2YO3 A;  1CZQ A;  3I5C A;  1GU5 A;  1FAV A;  2WT7 B;  3TK1 A;  2R5B A;  5AVR B;  1NWQ A;  1T2K D;  1H88 A;  1X8Y A;  2N9B A;  2P7J A;  3LIE A;  3M06 A;  2YO2 A;  3HE4 A;  3VTP C;  5APX A;  1JUN A;  5CMZ A;  3HE5 B;  5AW3 B;  1CI6 A;  5APY A;  4AQR D;  3P8M C;  1SLQ A;  5AVS B;  3M9H A;  2H7H A;  5APU A;  4DZO A;  1FOS F;  5AW5 B;  1FOS E;  2C9L Y;  5AVW B;  4GKG A;  2XZR A;  4EOT A;  1OXZ A;  4JYB A;  5AW9 B;  1IO4 A;  3VMY A;  2P2U A;  3HE4 B;  4HYT B;  2R32 A;  2QM8 A;  1HUC A;  1GK6 A;  1CI6 B;  3HTK A; 
#chains in the Genus database with same CATH topology
 1T2K C;  2QM7 A;  5KJ7 A;  3VMZ A;  4HB1 A;  1M1J C;  2J5U A;  3KDP B;  2E76 D;  4KHX A;  4C7N A;  5CHX A;  5AVQ B;  3K5B A;  2FFD B;  1NTK D;  1SQQ J;  1VPC A;  1LP1 B;  3GHG C;  1LTT C;  2FY8 A;  1FJP A;  5CJ0 A;  2AXT H;  2R3S A;  3AEA C;  2WWW A;  1VQK P;  4D6T J;  3O8Z A;  1OMI A;  1SQV D;  1MFZ A;  1YHQ P;  1LTJ C;  1TU3 F;  1GK4 A;  2FYN B;  1N73 B;  1GDT A;  2BCC J;  1SQB J;  1M1J A;  1YBK A;  3CXH D;  2G8Y A;  3RK3 E;  1KFN A;  2YIU B;  2W27 A;  3G3Z A;  3MZW B;  1HJB A;  4W7Z A;  3I5C A;  1Q82 Q;  3GHG A;  4TLF A;  2KSJ A;  2M8R A;  2P7J A;  3CD6 P;  2KS1 B;  1JUN A;  5CBO A;  1QL1 A;  4AQR D;  1KYO I;  3S1K A;  1S72 P;  1N86 A;  1FOS E;  2C0W A;  1KMI Z;  4O9B A;  1KFM A;  4EOT A;  1NTK J;  1BGY E;  1NTZ D;  3RL0 D;  1D7M A;  3G6E P;  4N6J A;  3TF5 A;  3RL0 g;  2KK7 A;  1GZL A;  3CCV P;  3RL0 B;  2XV5 A;  4EI2 A;  3L75 D;  1G1J A;  2O3J A;  4N78 E;  1SQV J;  1BGY G;  1RY3 A;  3PP5 A;  3OJA B;  4PJ0 E;  1NJI Q;  1VQ5 P;  3IAO A;  2QJP B;  3O6Q B;  3A3Y B;  4U3F E;  2YKP A;  1Q7Y Q;  4YTP C;  1ZR2 A;  3FX0 A;  1WRG A;  2M3E A;  1NU1 K;  4H0L D;  2WSC J;  3VMX A;  5CCH D;  4A7P A;  2WT7 A;  4IFM A;  1QL2 A;  1N7S D;  4L73 A;  3PRJ A;  4C46 A;  1VQM P;  2AEJ A;  3H1H E;  1KYO E;  4QMA A;  3V5B A;  2FXO A;  2ZVN B;  1FAV A;  1AVY A;  3KHU A;  3CI9 A;  1VL2 A;  5B5E H;  1M56 D;  5KLV G;  3M0D C;  1UII A;  3KXD A;  3P8M C;  1ZXG A;  2HG5 D;  1NU1 E;  4I7Z C;  2ZT9 D;  1JOC A;  3HUS C;  2WMM A;  3L75 J;  3H1J E;  3I56 P;  2QM8 A;  3Q5S A;  3CME P;  3ZDM A;  4ZNC A;  1J1D C;  1PPJ G;  5KAF E;  1NKZ B;  1SP4 A;  2JKV A;  3L74 D;  1EZV D;  3H1L D;  3KQG A;  2WPR A;  5AW0 B;  3H1J G;  3HRN A;  1VF5 D;  3GW6 A;  4Y99 C;  1GW4 A;  4OGQ B;  1NKN A;  3BAT A;  1FBM A;  3M0D A;  3CWB G;  3SWF A;  1HF9 A;  1P84 H;  2JJL A;  2P1J A;  1VQP P;  1L0N D;  3AE5 C;  1CW5 A;  1VF5 B;  2OTL P;  1YI2 P;  3MGN A;  1X0T A;  3HUS A;  1IJD B;  2M3B A;  3CCQ P;  2IBZ D;  4OWF A;  3A2A A;  1NTM E;  1R5S A;  4WVZ A;  1BCC E;  2FFD C;  3Q1M A;  3L72 E;  1A02 F;  3VP8 A;  3L71 D;  2Z5I A;  1WT6 A;  3AEE C;  3D6Z A;  3C1L A;  1ZV8 A;  4ZMD A;  5EFW B;  3AE3 C;  3G71 P;  1T3U A;  1T2K D;  1NYH A;  4YXD C;  1BCC G;  1PGP A;  2IYP A;  2D2C B;  3GG2 A;  2Y0E A;  2YKQ A;  2FYN C;  1FOS F;  3L70 E;  1N73 C;  5GTH H;  3H1L J;  1S5L H;  2RH0 A;  3B5N B;  4RES B;  4DOJ A;  2YIU C;  2FFD A;  3D6Y A;  3WUT A;  1LP1 A;  1M7L A;  1L0N J;  1JMB A;  3OAK A;  1EDI A;  5GTI E;  1RQV A;  3NMD A;  1EXI A;  3MIW A;  2A06 D;  1LTI C;  1SQV G;  1FDO A;  1FJK A;  1VDF A;  3V2P A;  3CCL P;  2OYI C;  3CXH H;  3JCU E;  2CPS A;  3NTN A;  3MUD C;  2ZFC A;  3GLM A;  1N73 A;  1LTJ B;  2E74 B;  1KN7 A;  1FZE A;  2ZVO B;  2L91 A;  2JWD A;  2WSC H;  5DJU B;  3E1R A;  1JCC A;  2P58 A;  2HFE D;  2A45 I;  2JO1 A;  1VQ8 P;  3C9I A;  2WSE J;  3NXS A;  2KS1 A;  2V7Q H;  2QJP C;  1NTZ G;  1RF1 B;  1KZU B;  1PGO A;  1ZOY C;  1LTA C;  3RGU A;  1H88 A;  1X8Y A;  2N9B A;  5KAI H;  5L8R J;  2O01 J;  1OVR A;  3RK3 B;  3VTP C;  4GDO A;  4HKZ H;  3MUD A;  2OYO A;  2YMY A;  3M9Q A;  3H1K E;  3TGU D;  1OXZ A;  4JYB A;  4WWI A;  1VQO P;  1DD3 A;  3FWN A;  2BAS A;  2M0B A;  5APQ A;  2FYU D;  4UB8 H;  5AVT B;  5AW6 B;  1YJW P;  2ZAE B;  4RJT A;  2XNX A;  1SQX K;  1FU1 A;  5AW1 B;  1LGH B;  2NPS B;  2YNY A;  3O6Q A;  2I1J A;  2WTY A;  4LC1 A;  5BU8 B;  4N78 D;  1GL2 B;  1WMK A;  1YQ3 C;  2RN0 A;  4PD4 D;  1SFC B;  2ZJS E;  2I1K A;  1SQP K;  1IC2 A;  3BCC E;  3AEC C;  1SQX E;  4GOD A;  3VYI A;  2B87 B;  2VRS A;  3L37 A;  1NAY A;  4GOF A;  4OGQ C;  5H2F H;  2QA4 P;  2A45 G;  3TGU J;  5TIS E;  1KIL E;  3OW2 O;  1SQP E;  2Q6Q A;  2QEX P;  5AVR B;  3T97 B;  1BE3 E;  4NPD A;  2FBW C;  1FZG A;  1GW3 A;  2O01 N;  2JDI H;  1SLQ A;  3M9H A;  3L74 G;  4BXL A;  3H1L G;  4HJG H;  3CPW O;  3RBX A;  2SPZ A;  2IFM A;  3L73 E;  2R32 A;  1KIL C;  2ITA A;  1BE3 G;  1HVV A;  1EXJ A;  1HGZ A;  1RE4 C;  1KV4 A;  1LTB C;  1SQB D;  2Q7C A;  2B9B A;  1GTW A;  3CLQ A;  1DIP A;  2ZXE B;  1H8A A;  2I8D A;  1XTC C;  3PH0 A;  2IBZ G;  1RE3 C;  4U3F J;  1JMM A;  1ZN5 A;  3L71 G;  2IZ0 A;  1QLE D;  3B5N C;  2AXT E;  2KZJ A;  2H43 A;  3H1H J;  1JEK A;  2QJK B;  1NTM D;  3CX5 D;  3L72 D;  2WSE H;  3NFQ A;  2YXQ B;  1GU4 A;  3VN0 A;  1KC8 Q;  2O1J A;  1YIJ P;  1JCD A;  1URQ B;  1OW6 A;  3CCJ P;  2E75 B;  2O01 H;  1RE3 A;  2WZ7 A;  2E74 C;  3PTZ A;  1Z56 A;  3AE1 C;  2WIT A;  3F5H A;  3B5N A;  2A06 G;  1IFD A;  1T6A A;  5AW5 B;  2PRR A;  3L70 D;  2C0X A;  3VMY A;  5M1B A;  1NH4 A;  1RF1 C;  3USS A;  1NAF A;  3AE4 C;  3P8C E;  4ASW A;  3RK3 C;  3B71 A;  2OYI B;  4I6M C;  1NGM B;  2POH A;  1E79 H;  1FZF A;  4IOI H;  1KTM A;  3AEF C;  1OW7 A;  1LTJ A;  3L35 A;  4PV1 C;  1MV8 A;  3A0H H;  1NTM J;  3AE2 C;  4L76 A;  2E43 A;  3L72 J;  3TDK A;  2WSF J;  3A0B E;  2QG4 A;  5KLV K;  3FWL A;  1JY2 O;  2K3R A;  2NPS C;  3P32 A;  1P84 I;  2XDJ A;  1RF1 A;  1HWT C;  4IL6 E;  3M0A A;  1L0L K;  1Q90 D;  3TGU G;  5KTB A;  2PAJ A;  3WMM 0;  1IFM A;  1GL2 C;  3N7N A;  1G2C B;  1ZRT E;  3L70 J;  1SFC C;  3WU2 E;  1QVF O;  2FYU G;  5KLV E;  3FXD A;  1OIP A;  1BSN A;  1EDJ A;  4R4M A;  1SQQ K;  1LT9 C;  3SFD C;  4H13 C;  3G9R A;  1DEB A;  2M5A B;  2XZR A;  4RKU J;  4WY4 B;  3SFE C;  2NRG A;  1CI6 B;  2YKO A;  2W6A A;  1PZQ A;  2NPS A;  4PD4 H;  4YPC A;  4XE5 B;  2LXB A;  1PP9 D;  1PPJ E;  4L75 A;  2BEZ F;  1DH3 A;  2PGD A;  1H0T B;  4LGD E;  1SQQ E;  1GL2 A;  4L74 A;  1L0L G;  5AW2 B;  3RBZ A;  2L5G B;  5AVY B;  1SFC A;  1S4X A;  1KB9 D;  2GUV A;  4M3L A;  3S4R A;  3CWB E;  3Q5P A;  4D6T E;  2B87 A;  3EFF K;  1P84 E;  4OGQ D;  2HLO A;  3CC2 P;  3A5T A;  1VQN P;  1SQQ G;  3V2Q A;  2J59 M;  1JY3 O;  3CXH I;  3H1I D;  2BCC E;  3C8V A;  3W68 A;  1NTK K;  4D6T G;  3R2P A;  1X9V A;  3AE8 C;  4UB6 H;  3T97 A;  1S9K D;  3H1K J;  2Q9I A;  2LXC B;  1KIL D;  1DEE G;  2BCC G;  1SQB G;  1PP9 J;  2QJK C;  5AVS B;  1SQV K;  1KIL B;  1Y47 A;  1NTK E;  5AVW B;  5GTH E;  2XKM A;  1N8R Q;  1S5L E;  1X22 A;  2D2C D;  1FE6 A;  1AFO A;  1URQ C;  1GK6 A;  2KB7 P;  1L2P A;  3TYY A;  3L73 D;  2G3A A;  1EDK A;  5K5G B;  2E75 C;  1JY2 P;  3KYQ A;  2FXM A;  4JBZ A;  3U59 A;  3B5N D;  5CCG C;  1NTK G;  1SQV E;  1HJ0 A;  1M90 Q;  3BCC J;  3CX5 H;  1K73 Q;  2IDB A;  3VP9 A;  1MUU A;  3H1I J;  3P7K A;  2E5T A;  1AVO A;  3CXH E;  4WBA A;  1NTZ K;  2QRX A;  2KYV A;  4JYC A;  3VMA A;  1IK9 A;  1FZB A;  4GT1 A;  2P67 A;  1URQ A;  2H8P D;  2DW3 A;  5B66 H;  2K9J B;  3KZI H;  4I2L C;  4HH2 A;  3UIA A;  1BDD A;  1SQP J;  1YTZ I;  2JWA A;  1IZN B;  4BRY B;  2E74 D;  1Q81 Q;  3EQ2 A;  1QGK B;  5CCG A;  1DX7 A;  1NTZ E;  5AW4 B;  1CZQ A;  1JO5 A;  1AQT A;  3L73 J;  3HE5 B;  3AEG C;  2Y9Y A;  4RO0 A;  5GTI H;  3RK3 D;  1VQ4 P;  5DJT B;  1IFN A;  3H25 A;  3PHL A;  1YJ9 P;  4ASV A;  2KLU A;  2QSI A;  2JR8 A;  1FZC B;  2YXR B;  5AVX B;  2OYI A;  3S9O A;  1JY3 P;  3JCU H;  4PV1 D;  3HD7 B;  4UB8 E;  1KQF B;  1EC5 A;  1KD1 Q;  3HTK B;  3L75 G;  1S3J A;  3P8C D;  1KQL A;  2H88 C;  3JSV C;  1Y9B A;  4PV1 B;  5KKZ B;  5E79 H;  4XFJ A;  3RK2 C;  3AED C;  4EYY Q;  1BGY D;  4WY4 C;  2FYZ A;  2NPS D;  3SSU A;  5CJ4 A;  4Z1M H;  4ZKU A;  1Y8A A;  2IBZ I;  3MTU E;  2W83 C;  3H32 B;  2KLV A;  2IX7 C;  1M57 D;  1GL2 D;  3I55 P;  2Z5H A;  3IF4 A;  2LR2 A;  1JB0 J;  1SFC D;  1OW8 A;  2Q3I A;  5BU5 A;  1G2C A;  3L36 A;  4IFF A;  5APV A;  3WUV A;  2E42 A;  1A02 J;  3B8E B;  3R4Y A;  3E7K A;  1L4A B;  1FDM A;  1L0N K;  4U3F D;  1KQS O;  1LT9 B;  2PP6 A;  2M5A A;  1AJY A;  2OTK E;  3LIE A;  4H13 B;  4WY4 A;  3FXE A;  1CI6 A;  2K88 A;  1SS1 A;  5APY A;  3L74 E;  2HYN A;  3H1L E;  3CCU P;  2N1T B;  1K9M Q;  1KB9 H;  3II6 A;  1IO4 A;  2P2U A;  3ABV C;  3H1H D;  1H0T A;  4N3Y B;  1KYO D;  4ZKP A;  4W80 A;  2UWJ E;  2O1K A;  1ZR4 A;  1BGY J;  3LW5 J;  1EZV G;  2HOD B;  1BDC A;  1JY2 N;  3TSI A;  5BVZ A;  1NU1 D;  2V4H A;  3Q5R A;  2IBZ E;  2C9N Y;  3H1I G;  3H1J D;  3N4X A;  1GMJ A;  2Q1K A;  2KP8 A;  3L71 E;  2WPQ A;  5KJ7 C;  2AEF A;  2QVA A;  3W67 A;  1FC2 C;  3BVH A;  2IZ1 A;  1L0N G;  3E1I A;  1GD2 E;  1M1K Q;  1T8Z A;  1H89 A;  4KJM A;  1E5W A;  3CC4 P;  3TNU B;  1LWU B;  1RF0 C;  2XU6 A;  2W6J H;  4NPF X;  1K04 A;  3MHV A;  4AUW A;  1XTG B;  2WVR A;  3AEB C;  1ZME C;  2ZYD A;  1AA0 A;  3MD0 A;  5AVZ B;  5AVV B;  1JM0 A;  5KLV J;  1FDI A;  1RQU A;  4DJG A;  2K1A A;  2PFX A;  1PL5 A;  4W7Y A;  3KPE A;  1KIL A;  2OYH B;  1URQ D;  4H44 C;  4EIJ A;  2CK3 H;  1BCC D;  1RE4 A;  2E75 D;  2A06 E;  1PGJ A;  1NU1 J;  5CCG D;  1RF0 A;  4OVN F;  1IFP A;  2KNC B;  1OVU A;  2ZYG A;  2E76 B;  4GIF A;  1HGV A;  3H1J J;  5KLI B;  1ZLL A;  2QE7 H;  3BRT B;  4IL6 X;  1S2E A;  2ZYA A;  3BAS A;  3CWB J;  1OVV A;  2R3C A;  3M91 A;  1JY3 N;  3AE6 C;  3Q2Y A;  2JEE A;  3F89 A;  4PD4 I;  4JF7 A;  4AYC A;  1JTH B;  3V2R A;  3V4Q A;  3A0H E;  3GF7 A;  3V2N A;  2K9J A;  1PFI A;  1FZC C;  2W90 A;  4BRY A;  2GUS A;  2KUB A;  3HD7 C;  1USE A;  2OQQ A;  4TT3 H;  2FYU K;  4B86 A;  1JNM A;  5APW A;  2HPC B;  1VQL P;  1AQ5 A;  4NPE A;  5KKZ C;  2Q5U A;  2KIK A;  1BCC J;  3TGU E;  1BSH A;  2QJY B;  2Y9Z A;  3HE5 A;  1M8O B;  2FYU E;  1U7J A;  1Q2N A;  2Y0D A;  4XA4 A;  1FZC A;  3EWK A;  2NZ2 A;  4C7R A;  2HR3 A;  2KI7 B;  3HD7 A;  5AW9 B;  3HTK A;  1QX8 A;  3RK2 D;  1J2J B;  1U7M A;  4PD4 E;  5B5E E;  1X79 B;  3LW5 H;  4K3A A;  1L4A C;  4DT0 A;  3EFG A;  3PJS K;  4WY4 D;  3A0B H;  2B88 A;  4EDF A;  4WB4 A;  3RK2 B;  1J1E B;  1L0L E;  3IFM A;  3H1K D;  3H32 A;  4JQ0 D;  1MFT A;  2N1T C;  1K05 A;  4OH8 B;  4PJ0 H;  4IL6 H;  3V4W A;  2Y0C A;  2GM4 A;  2OAR A;  1UIX A;  1NHL A;  2KZI A;  2IYO A;  3BRV B;  1EQ7 A;  4H0L B;  1S5L X;  3CX5 I;  3WU2 H;  1W5C E;  5AW7 B;  4U3F G;  1SQB K;  1N7S B;  1NTZ J;  2V7Q J;  3D71 A;  4LLH A;  2R5D A;  1EDL A;  3CC7 P;  2P10 A;  5AVU B;  2KSE A;  1L4A A;  2K37 A;  1FZA A;  1LT9 A;  1NOH A;  4UB6 E;  3A7O A;  1KYO H;  4MN4 C;  3H1H G;  4DCK A;  3CMA P;  2YO3 A;  3L4F A;  2N1T A;  3BCC D;  1SQX D;  1NWQ A;  1LWU C;  2ZT9 B;  1SQB E;  3ITK A;  3SWY A;  1YQ4 C;  2N9Y B;  3JC2 2;  1NU1 G;  4CPG A;  4GKG A;  2KOG A;  1NTM K;  3HE4 B;  4U7J A;  2HOD A;  1T3J A;  1VQ6 P;  1SQP D;  4K35 A;  5KJ7 D;  1BE3 D;  5KAF H;  2AEM A;  2OYH C;  5C39 A;  2Z4E A;  1YJN P;  5TJH A;  3H6P A;  3TNU A;  3CX5 E;  4GOE A;  1LWU A;  4C7N B;  2W6B A;  2RKL A;  3AE9 C;  3M9B A;  2E76 C;  5KLI C;  1YYC A;  3OA7 A;  2WPV B;  1N7L A;  2WPS A;  1QEX A;  5B66 E;  1NTM G;  1SQX J;  3KZI E;  3L72 G;  4H44 D;  2ZXX A;  1R5L A;  2WSF H;  2MJZ A;  1HBW A;  1OFC X;  1OWA A;  5APT A;  3WUU A;  2OYH A;  1S1C X;  3L74 J;  4YXW H;  4H44 B;  1HTL C;  3G4S P;  1M1J B;  2R5B A;  1RHZ B;  3IN6 A;  3M06 A;  2KNC A;  2MKV A;  2YO2 A;  2Q3E A;  5CBN A;  1BE3 J;  1NVO A;  1IK7 A;  2FKW B;  1PGQ A;  3L70 G;  3GHG B;  3AE7 C;  2WQY C;  2QJY C;  1G1I A;  2YMK A;  5APU A;  4DZO A;  2BEQ D;  2RMZ A;  5KAI E;  3L71 J;  1JTH A;  1KB9 I;  4Y28 J;  3L75 E;  1FS0 E;  2GA1 A;  1VQ7 P;  3HD7 D;  3RL0 C;  3VOP A;  2OGU A;  4R4L A;  5E79 E;  2JP3 A;  1EZV I;  3CCE P;  2KXP B;  2AXC A;  1IFI A;  2HPC A;  2WSS H;  4IFD K;  1CSB A;  3CL3 D;  1ZW0 A;  1LTG C;  3SWK A;  1R8E A;  2IFN A;  3IR9 A;  2LKM A;  1LNQ A;  3GF3 A;  3GMA A;  1J1E C;  2W8Z A;  1W2B O;  3QH9 A;  3CCM P;  2H89 C;  1LT1 A;  3V6I A;  3D70 A;  1OX3 A;  3B4S A;  2WT7 B;  1USD A;  3TK1 A;  1U57 A;  1RH5 B;  3MP7 B;  4JPZ B;  1PP9 E;  4H0L C;  5CCH C;  5APX A;  1N7S C;  5CMZ A;  1L4A D;  2FXP A;  1LJ2 A;  5AW3 B;  1W2E A;  5H2F E;  1N2D C;  1QVG O;  3H1K G;  4H13 D;  1HH0 A;  1KB9 E;  2QIW A;  4HYT B;  1MZ9 A;  1HUC A;  2K9Y A;  1ZRT D;  1LTS C;  2N1T D;  1PP9 G;  2CPB A;  5KLV D;  2ZT9 C;  1NO4 A;  1EZV E;  2J58 A;  3H1I E;  1L0L D;  4BWN A;  1K8A Q;  1OZH A;  1YTZ T;  1AV1 A;  5CCH A;  1L0N E;  1N7S A;  1S9K E;  1IFJ A;  1PPJ D;  2A45 H;  3FGA D;  2OTJ P;  3CCR P;  3LID A;  3Q3D A;  1VF5 C;  3BCC G;  1SQQ D;  1SQX G;  4I1L A;  1KQG B;  1DD4 A;  1ZP0 C;  4I7Z B;  1KOR A;  2B89 A;  2FYU J;  2XND H;  3HUS B;  5AW8 B;  3CWB D;  5APS A;  2IPP A;  3PLN A;  4D6T D;  1P84 D;  5TIS H;  1J1D B;  3U1A A;  1Q86 Q;  1GU5 A;  1PIX A;  1MKM A;  1SQP G;  3CCS P;  1PV3 A;  1SVF A;  1VQ9 P;  3HE4 A;  2BCC D;  2E5Y A;  3U1C A;  2H7H A;  4Y99 B;  2R44 A;  2C9L Y;  2D2C C;  1YIT P;  3QWO C;  3L73 G;  1L0L J;  4KT0 J; 
#chains in the Genus database with same CATH homology
 1T2K C;  3TYY A;  3RK2 D;  1J2J B;  2QM7 A;  1X79 B;  3LW5 H;  5KJ7 A;  2BAS A;  5APQ A;  1L4A C;  3VMZ A;  1JY2 P;  3EFG A;  4WY4 D;  1M1J C;  3KDP B;  5AVT B;  3KYQ A;  2FXM A;  5AW6 B;  4KHX A;  3U59 A;  3B5N D;  4C7N A;  2XNX A;  5CHX A;  1SQX K;  4WB4 A;  1FU1 A;  5AVQ B;  5AW1 B;  3RK2 B;  1J1E B;  5CCG C;  1LGH B;  2NPS B;  2FFD B;  2YNY A;  3IFM A;  3H32 A;  1VPC A;  2N1T C;  2I1J A;  2WTY A;  3VP9 A;  3GHG C;  4LC1 A;  5BU8 B;  1MUU A;  1LTT C;  3P7K A;  4N78 D;  4OH8 B;  1FJP A;  5CJ0 A;  1GL2 B;  3V4W A;  2GM4 A;  2OAR A;  4WBA A;  1NHL A;  1SFC B;  1NTZ K;  2WWW A;  2KYV A;  4JYC A;  1IK9 A;  2I1K A;  3BRV B;  1EQ7 A;  1FZB A;  1SQP K;  1IC2 A;  3O8Z A;  4GT1 A;  5AW7 B;  1SQB K;  3VYI A;  1N7S B;  2P67 A;  2VRS A;  1URQ A;  2H8P D;  1MFZ A;  3L37 A;  4I2L C;  4HH2 A;  1LTJ C;  4LLH A;  2R5D A;  3UIA A;  1GK4 A;  1YTZ I;  5AVU B;  1L4A A;  1N73 B;  1GDT A;  3EQ2 A;  1M1J A;  1FZA A;  1LT9 A;  1NOH A;  3A7O A;  1KFN A;  2A45 G;  5CCG A;  1DX7 A;  2W27 A;  3G3Z A;  5AW4 B;  1HJB A;  4W7Z A;  2YO3 A;  1CZQ A;  3I5C A;  1JO5 A;  3L4F A;  2N1T A;  5AVR B;  1NWQ A;  1LWU C;  3GHG A;  2KSJ A;  2M8R A;  2P7J A;  3SWY A;  1JUN A;  3HE5 B;  1FZG A;  1GW3 A;  1QL1 A;  4AQR D;  1SLQ A;  3M9H A;  1N86 A;  1FOS E;  4GKG A;  2C0W A;  2KOG A;  1NTM K;  2IFM A;  4O9B A;  4EOT A;  1KFM A;  3RK3 D;  1IFN A;  3HE4 B;  2R32 A;  1KIL C;  3RL0 D;  2HOD A;  1T3J A;  1FZC B;  5AVX B;  1HVV A;  2OYI A;  1JY3 P;  5KJ7 D;  4N6J A;  1HGZ A;  1RE4 C;  1LTB C;  3HD7 B;  2Q7C A;  1GTW A;  2OYH C;  1GZL A;  2Z4E A;  3CLQ A;  3RL0 B;  2XV5 A;  3HTK B;  2ZXE B;  3P8C D;  1H8A A;  1XTC C;  1KQL A;  1G1J A;  1GK6 A;  1RE3 C;  3RK2 C;  4N78 E;  3H6P A;  1RY3 A;  3TNU A;  1LWU A;  3PP5 A;  3OJA B;  1JMM A;  4C7N B;  1ZN5 A;  2W6B A;  2FYZ A;  2NPS D;  4WY4 C;  5CJ4 A;  3M9B A;  4ZKU A;  3B5N C;  1YYC A;  3H32 B;  3MTU E;  2H43 A;  2KLV A;  2IX7 C;  3OA7 A;  3A3Y B;  1N7L A;  1GL2 D;  2Z5H A;  2WPS A;  2YKP A;  1SFC D;  1ZR2 A;  2Q3I A;  5BU5 A;  1WRG A;  1G2C A;  2WSF H;  1NU1 K;  2MJZ A;  3L36 A;  3VMX A;  4IFF A;  5CCH D;  1HBW A;  2WT7 A;  2WSE H;  4IFM A;  3NFQ A;  1QL2 A;  1OWA A;  5APT A;  5APV A;  2E42 A;  1N7S D;  2OYH A;  1GU4 A;  3VN0 A;  1A02 J;  2O1J A;  1JCD A;  3B8E B;  1URQ B;  4C46 A;  3V5B A;  1L4A B;  1FDM A;  2O01 H;  1HTL C;  1FAV A;  1RE3 A;  1L0N K;  1M1J B;  2WZ7 A;  2R5B A;  3CI9 A;  1LT9 B;  2PP6 A;  3LIE A;  3M06 A;  3M0D C;  4WY4 A;  1Z56 A;  2YO2 A;  2WIT A;  1CI6 A;  5APY A;  3B5N A;  3P8M C;  2HG5 D;  2HYN A;  1IFD A;  2FKW B;  2N1T B;  5AW5 B;  3GHG B;  3HUS C;  1JOC A;  2C0X A;  3II6 A;  3VMY A;  1IO4 A;  2P2U A;  1G1I A;  2QM8 A;  4N3Y B;  5APU A;  4DZO A;  4W80 A;  4ZKP A;  1ZR4 A;  2O1K A;  1NH4 A;  1J1D C;  1RF1 C;  1NAF A;  1JTH A;  1NKZ B;  3P8C E;  1SP4 A;  2HOD B;  1JY2 N;  3RK3 C;  3TSI A;  5BVZ A;  2C9N Y;  2OYI B;  3KQG A;  4I6M C;  2POH A;  3HD7 D;  2WPR A;  5AW0 B;  3RL0 C;  3HRN A;  3VOP A;  4Y99 C;  1GW4 A;  1FZF A;  3N4X A;  1NKN A;  3BAT A;  1FBM A;  2KP8 A;  2WPQ A;  5KJ7 C;  1LTJ A;  3L35 A;  3M0D A;  1MV8 A;  3SWF A;  3BVH A;  2E43 A;  3E1I A;  1GD2 E;  1T8Z A;  2JJL A;  2P1J A;  1H89 A;  1CW5 A;  1E5W A;  1IFI A;  2HPC A;  3MGN A;  4IFD K;  3TNU B;  1CSB A;  3CL3 D;  1LWU B;  3HUS A;  1LTG C;  1IJD B;  1RF0 C;  2M3B A;  2IFN A;  3IR9 A;  2XU6 A;  2LKM A;  5KLV K;  1JY2 O;  4AUW A;  1XTG B;  3A2A A;  1J1E C;  2NPS C;  2FFD C;  3P32 A;  2XDJ A;  1A02 F;  3MD0 A;  5AVZ B;  1RF1 A;  5AVV B;  3VP8 A;  1HWT C;  2Z5I A;  1WT6 A;  3M0A A;  1L0L K;  5KTB A;  2PAJ A;  3WMM 0;  1IFM A;  1ZV8 A;  1GL2 C;  3N7N A;  1G2C B;  1SFC C;  4W7Y A;  3KPE A;  2WT7 B;  1KIL A;  1T3U A;  3TK1 A;  2OYH B;  1URQ D;  1T2K D;  4EIJ A;  5CCH C;  5APX A;  1N7S C;  5CMZ A;  1RE4 A;  1L4A D;  5AW3 B;  1SQQ K;  1LT9 C;  1W2E A;  1N2D C;  2YKQ A;  1DEB A;  1FOS F;  1N73 C;  1HH0 A;  2XZR A;  5CCG D;  1RF0 A;  4WY4 B;  4HYT B;  1MZ9 A;  1HUC A;  4GIF A;  1CI6 B;  1HGV A;  2YKO A;  2W6A A;  3B5N B;  1LTS C;  4RES B;  4DOJ A;  1ZLL A;  2N1T D;  2NPS A;  2FFD A;  3BRT B;  2CPB A;  4XE5 B;  3BAS A;  1DH3 A;  2R3C A;  1M7L A;  3M91 A;  1NO4 A;  2J58 A;  3OAK A;  4LGD E;  1JY3 N;  3NMD A;  1GL2 A;  3MIW A;  1LTI C;  5AW2 B;  2JEE A;  2L5G B;  5AVY B;  1SFC A;  1FJK A;  4JF7 A;  1VDF A;  4AYC A;  2GUV A;  3V2P A;  1JTH B;  4M3L A;  1YTZ T;  2OYI C;  3V2R A;  5CCH A;  3V4Q A;  3V2N A;  1N7S A;  2CPS A;  1S9K E;  1PFI A;  1FZC C;  2HLO A;  1IFJ A;  2A45 H;  3NTN A;  2ZFC A;  2GUS A;  1N73 A;  3A5T A;  3LID A;  3HD7 C;  3V2Q A;  1LTJ B;  1FZE A;  2J59 M;  2FYU K;  4I1L A;  4B86 A;  1JY3 O;  2WSC H;  1JNM A;  5APW A;  1JCC A;  2HPC B;  1AQ5 A;  2HFE D;  2A45 I;  2Q5U A;  3HUS B;  5AW8 B;  1NTK K;  3R2P A;  1X9V A;  5APS A;  3T97 A;  2IPP A;  3C9I A;  1S9K D;  3NXS A;  3HE5 A;  1J1D B;  1RF1 B;  3U1A A;  1KZU B;  2Q9I A;  1GU5 A;  1LTA C;  1KIL D;  1H88 A;  1SVF A;  1X8Y A;  2N9B A;  3HE4 A;  3RK3 B;  3VTP C;  3U1C A;  4XA4 A;  5AVS B;  1FZC A;  1SQV K;  2H7H A;  1KIL B;  3MUD A;  4Y99 B;  3M9Q A;  2YMY A;  4C7R A;  2C9L Y;  5AVW B;  3HD7 A;  2XKM A;  1OXZ A;  4JYB A;  5AW9 B;  1AFO A;  1URQ C;  2KB7 P;  3HTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...