5APVA

Sequence iankedkad inserted between gcn4 adaptors - structure a9b grey
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
70
structure length
70
Chain Sequence
HMKQLEDKVEELLSKVYHLENEVARLKKLIANKEDKADMKQLEDKVEELLSKVYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 28
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apvA00
5AW0B 5AVXB 3TNUB 5AVVB 4M3LA 1S9KE 1YYCA 4I2LC 5AVYB 5APQA 1GZLA 4C7NA 1OXZA 1SLQA 3TNUA 5AVWB 2YO3A 5APSA 4DZOA 2WTYA 1NAFA 1GK4A 2P67A 2XV5A 1MV8A 1HJBA 3M0DA 3NTNA 3A5TA 3A2AA 3M91A 3P8MC 2E42A 4JYBA 4C46A 1CSBA 2WPRA 2WPSA 3HE5B 3MD0A 2WPQA 5AW8B 2KP8A 3VMYA 1SP4A 3SWFA 2JJLA 3L37A 1HWTC 5AVUB 3MGNA 3VTPC 2R5BA 3V4QA 3A3YB 5AVRB 3M9HA 1HBWA 1G2CB 1NWQA 3LIDA 3NFQA 2N9BA 2QM8A 4GKGA 2R3CA 2QM7A 3KDPB 1JNMA 4I6MC 5AVTB 2BASA 4XE5B 4B86A 2WWWA 5CMZA 4HYTB 2R5DA 3NXSA 2XZRA 3VMXA 2H7HA 1JUNA 5AW2B 1T2KC 2ZFCA 4AUWA 3HE4A 1CI6B 3KQGA 5APYA 5AW5B 4LC1A 4GT1A 5AW1B 3M0AA 2C9LY 4EOTA 3UIAA 3HE5A 3TK1A 1FOSE 1FOSF 2VRSA 2Z5IA 3P32A 5AW6B 1HUCA 3T97A 1A02F 2YNYA 1GK6A 5APXA 2W27A 4KHXA 5APWA 5AVSB 1S9KD 1H89A 1GU4A 2E43A 5AVZB 2IPPA 3P7KA 2Q7CA 1OWAA 4JYCA 1J2JB 3M9BA 5AW9B 2Q3IA 3L36A 3TYYA 2WT7B 5APUA 1GU5A 3VYIA 1GTWA 1A02J 5AW3B 1CZQA 1IO4A 4RESB 1H8AA 2R32A 3VN0A 1MUUA 1T2KD 5AVQB 1GD2E 1FAVA 2P2UA 3V4WA 1MFZA 4C7NB 2P7JA 5APVA 1KQLA 5AW4B 3L35A 3O8ZA 3B8EB 3HTKA 2W6AA 3IR9A 3I5CA 2ZXEB 3LIEA 2C9NY 3A7OA 3M06A 5AW7B 3V5BA 2Q5UA 4AYCA 2WT7A 2Z5HA 3VMZA 1H88A 3NMDA 5APTA 1X8YA 3OAKA 4AQRD 2XU6A 1CI6A 1DH3A 2YO2A 3HE4B
chains in the Genus database with same CATH superfamily
2A45I 2FFDA 2E5TA 2K3RA 5AW0B 3VOPA 3Q2YA 5KAIE 5E79H 3RL0D 1JEKA 1PPJG 3SFEC 1NJIQ 3GHGB 2QRXA 2QA4P 1BE3D 4UB6E 3CI9A 1S9KE 1YYCA 4I2LC 1RE3A 4WY4A 1FE6A 4N3YB 5GTIH 1GZLA 5TJHA 4H0LB 4XFJA 3E1RA 3B5ND 4H44D 1EDLA 3TSIA 5APSA 1J1EB 2P1JA 3AE4C 3TF5A 1SQBJ 1GK4A 3A0HH 1MV8A 2POHA 5H2FE 1LT1A 3CXHI 1HJBA 2JWAA 3GLMA 2KYVA 2GM4A 2BEQD 3RK2D 3VP9A 1BSHA 2ZJSE 1VQ8P 4OGQB 3EFGA 4JYBA 1LT9C 4KJMA 3I56P 2JO1A 2FXOA 2K9JB 1TU3F 2E75D 2WPRA 3H1IJ 3HE5B 1JTHA 3IAOA 3RL0g 2WSEH 3VP8A 2WPQA 2K1AA 3E7KA 3HD7A 3CCEP 1Q81Q 1NTMD 3U59A 1JY3O 2JJLA 1JY2O 1BCCG 1FC2C 2WSCJ 1IFIA 1X79B 1GMJA 4H44C 5KLVJ 2JWDA 1KD1Q 2C0WA 2JEEA 2K37A 2Q3EA 3LW5H 5CJ4A 5KAFE 1NTKD 1NWQA 2I1KA 1W2EA 2WPVB 2N9BA 2QM8A 3WU2H 2N1TC 2FYNC 1LWUB 1NTKE 1EXJA 2W8ZA 3A0BH 1G1IA 3FXEA 1VQ7P 3L70E 2HR3A 1KB9I 2BASA 1SQBK 1X0TA 2QJPB 3M9QA 3TGUG 3CX5I 4IFMA 1M1JC 1RF1B 1VQ9P 2R5DA 1SQVK 2QSIA 3NXSA 4WBAA 4U3FE 5H2FH 3VMXA 2H7HA 2FYUE 2M3BA 1H0TA 3IF4A 1PP9J 3RK3E 1BGYG 3II6A 2BCCE 1J1EC 1CI6B 3N4XA 1BE3J 5APYA 1YJNP 1L0LJ 3U1CA 4EOTA 3CXHD 3EFFK 4JPZB 2ZXXA 3SWKA 3GF3A 3AEGC 4HKZH 2E76C 1FZBA 2OARA 2WSCH 1S5LX 2IDBA 1RF0C 3SFDC 3W68A 1FOSF 2N1TD 1NAYA 2K88A 3L73E 1P84I 1PPJD 1QGKB 2ZT9D 2L5GB 4TLFA 5BU5A 1L4AC 4GOFA 1JNMA 3H1HE 4WWIA 1YBKA 5APXA 4KHXA 3H1HD 1OW8A 3T97B 1JMBA 1SQVE 1LTGC 1LTJA 2L91A 5AVSB 2KXPB 1NTZE 1J1DC 4UB8H 5L8RJ 3CCRP 3BASA 1GU4A 1LTAC 2Q1KA 3P7KA 1WRGA 4ASWA 3JSVC 4GOEA 1OVRA 2E74C 1BCCJ 1EZVD 2QJKB 4IFFA 5AW9B 4PD4D 2WT7B 3B71A 4GDOA 1YITP 2KNCB 1N7SA 4N78D 3EQ2A 2OTLP 3CCLP 4O9BA 2ZYDA 1KTMA 3HD7B 1Q90D 4RESB 1H8AA 4BRYA 1IFMA 2IX7C 1QLED 2KSEA 1KYOI 1MUUA 1QL1A 2LXBA 3H1IG 3H1IE 1RE4C 4LGDE 5AVQB 1T2KD 1AA0A 1YQ4C 2OTKE 1OMIA 2HFED 3L74E 3AE3C 2E5YA 3CC7P 1LT9A 1HTLC 1KFMA 4DJGA 5KLVG 4XA4A 1URQC 1R5LA 3RK2C 3HTKA 1GDTA 1S9KD 2IBZI 1QX8A 3IR9A 3ITKA 2QJKC 1RH5B 3RBZA 3LIEA 2IYOA 1BGYJ 4U3FD 1L4AD 4W7YA 4ASVA 5TISH 1DD4A 1JY3N 1SFCA 2WVRA 4L74A 1LWUC 3CWBD 1PGOA 4KT0J 3GMAA 3H1HG 3RBXA 1SQQK 1SQPE 1NTZJ 4AYCA 1AQTA 3CCVP 2YXRB 3L73G 3LW5J 3PRJA 1ZXGA 2BEZF 2P58A 3GHGC 2O01H 1H88A 2QG4A 3BRVB 5APTA 1KYOE 1A02J 1JCCA 1EC5A 1PZQA 1LJ2A 1SQPD 2A45H 4R4LA 2GUSA 1NKNA 1L0NK 1OX3A 1IFNA 1WT6A 1G2CA 2Q9IA 3RK2B 1NVOA 1L0LD 3TK1A 1K73Q 2AXTH 2JP3A 4M3LA 1SQVD 5EFWB 1KC8Q 1RQVA 1FZCB 2J59M 5APQA 2PAJA 3G9RA 1NGMB 4DCKA 3TNUA 2IFMA 4LLHA 3A0HE 2E76D 1SQPK 2R3SA 1JB0J 3L70G 3O6QB 1ZRTE 2BCCJ 3WUVA 4BWNA 2OYHC 1FZCA 1M90Q 2ZAEB 1ZRTD 3CL3D 1NTZG 4N6JA 3Q1MA 3RL0B 1PIXA 1IC2A 3A2AA 3P8MC 1GW4A 4JF7A 2E42A 1S2EA 2YMYA 1NTKJ 1KILB 3MTUE 2QIWA 1L0LG 2M5AA 4YTPC 5AW8B 2FYNB 3VMYA 1FJKA 1NTKG 3CC4P 1N7SD 2D2CB 1RHZB 2PP6A 3L37A 2P10A 4UB6H 5AVUB 3MGNA 1HWTC 2FFDB 2B87B 3PTZA 1AQ5A 3L70D 1PL5A 1PP9D 2J58A 3WU2E 3A3YB 4BXLA 1QVGO 5AVRB 3L75D 2W90A 2FY8A 2KZJA 1VQPP 2K9YA 1GW3A 1RE4A 4OWFA 1M1KQ 2OYHB 1YTZT 2QM7A 3R2PA 1AJYA 1NTZK 2O01N 4I6MC 2CK3H 1KB9H 2NZ2A 3AE5C 4PV1D 3HUSA 1N73A 2JDIH 5CCHC 1VQNP 1AV1A 2PGDA 1IFPA 2PRRA 2WWWA 3H1JE 5CMZA 3CX5H 1M7LA 1URQA 2YKPA 3KYQA 2DW3A 4HYTB 2LKMA 4PJ0E 1DX7A 4H13B 2RMZA 2WITA 1NTKK 3AEBC 2H89C 1N7SB 2D2CD 3C9IA 3CCQP 1IO4A 1HF9A 3L73D 2ZVNB 5AW5B 2FFDC 2WZ7A 3M0AA 2C9LY 2FKWB 1RF0A 1NTMJ 4DOJA 4MN4C 1M1JB 4OGQC 2M5AB 4JQ0D 1GL2B 2HODA 2YKQA 3GHGA 1N2DC 1L4AA 2KOGA 2C0XA 2YXQB 3OJAB 3PLNA 4GODA 2VRSA 1RE3C 3JCUH 3P32A 4L75A 3T97A 1P84H 2YKOA 1PV3A 2A45G 3M0DC 1FS0E 3WUTA 1JCDA 5APWA 1NU1E 3H1LD 3RK3B 1URQD 2M3EA 3CWBJ 1RQUA 2E43A 1KFNA 1K8AQ 1U57A 5AVZB 1SQQE 1PFIA 2YIUB 3AE1C 3C1LA 2I8DA 1WMKA 2M8RA 4DT0A 3H32B 2KIKA 2KZIA 2RN0A 3CX5E 3M9BA 2OYIC 2CPBA 2QEXP 4H0LC 4H13D 1PP9E 5KKZC 1OW7A 1LTIC 2MKVA 3VN0A 2G3AA 2NPSC 1GD2E 4HB1A 1YI2P 3RGUA 4RJTA 2WSSH 2KNCA 3EWKA 4WY4B 1ZN5A 4ZKPA 2AXCA 5B66H 3AE2C 5BU8B 3V2QA 2FXPA 1KN7A 2B87A 2FYUK 3BCCJ 2P7JA 5KJ7C 5APVA 5AW4B 3H1LG 3CC2P 4YPCA 2YIUC 1BCCE 3SWYA 2W6AA 3V2NA 4ZKUA 1N86A 1RY3A 4NPDA 1P84E 3H1KJ 2OQQA 5TISE 4UB8E 1LWUA 2KSJA 3AEEC 2MJZA 4OVNF 2C9NY 3D70A 2ZT9C 2Y0EA 1LGHB 3A0BE 4RKUJ 5B5EH 3H1KD 1FZEA 1FBMA 3H1HJ 1S4XA 1AVYA 1USDA 2SPZA 3L71E 4WY4C 1SFCB 3KPEA 2OGUA 1ZV8A 2I1JA 2IBZD 3BCCE 1VQ6P 1DEBA 2QE7H 1L0LE 2R44A 4WY4D 1N8RQ 2N9YB 3L72E 3QWOC 1OVUA 1IFDA 2Y0DA 1AFOA 1L0NJ 1KILE 2HYNA 5KLVK 1DIPA 3B5NB 1N7LA 1LTBC 2OYOA 3TNUB 4Z1MH 1NO4A 3GW6A 2QVAA 3AE8C 5B66E 3CCUP 1Y47A 1KILD 3WUUA 1R5SA 1NU1J 3H6PA 3L72J 4C7NA 1OXZA 1SLQA 2GA1A 2KLVA 1PPJE 1ZR2A 1VQ4P 2OYHA 5CCGC 1UIIA 5CHXA 3Q5RA 2RKLA 1SQXJ 2IBZG 4JBZA 2WTYA 3L72G 2XV5A 4GIFA 4WB4A 3CLQA 4TT3H 5CJ0A 3BCCG 3M0DA 1NTME 3A5TA 3FWNA 3M91A 3GF7A 4W7ZA 4K3AA 4C46A 1IK7A 1FU1A 1L0NG 3G3ZA 2WPSA 2ITAA 3L75J 1YQ3C 3L74G 3MD0A 4YXWH 1L2PA 4R4MA 2E75C 2KP8A 5KLVD 3CMEP 1SP4A 1ZOYC 4EIJA 1YHQP 2KLUA 2GUVA 3L73J 1Q7YQ 3VTPC 3O8ZA 1T3UA 2R5BA 2ZYAA 3H1JJ 3MHVA 5CCGD 1BDCA 1KORA 2XDJA 2ZVOB 3AEAC 3B5NA 3M9HA 3S1KA 2KS1B 2WQYC 3HUSB 2QJYB 3LIDA 1SQBG 1S5LH 1N73C 2FYUJ 1KB9E 1PGQA 2R3CA 4GKGA 5GTIE 3KDPB 1SQQJ 3D6ZA 2WMMA 3HD7C 4EDFA 3CCJP 2PFXA 1SQVG 1PP9G 5AVTB 4XE5B 4B86A 3R4YA 3L71J 2BCCD 5GTHE 1JMMA 1YJ9P 2V7QH 5C39A 3H25A 1OVVA 2J5UA 1NU1K 3H32A 2W6BA 4RO0A 1JUNA 1GL2C 5AW2B 5CCHD 1T2KC 2ZFCA 3L70J 4H44B 4AUWA 3H1JD 3V6IA 4PV1C 2KB7P 2LR2A 2O1JA 1R8EA 1EZVG 1X22A 1EZVI 3KQGA 5KAIH 4LC1A 1MKMA 3V2RA 1K05A 1DD3A 5KLIC 4EYYQ 1MFTA 4A7PA 3HE5A 4C7RA 1OFCX 3AEFC 4OH8B 1IK9A 1KMIZ 3OW2O 1PGJA 3S4RA 5AW6B 1HUCA 4U3FG 1Q2NA 5CBNA 2YNYA 1VPCA 3FWLA 1N7SC 4D6TG 1HVVA 1VQKP 1AVOA 2WSEJ 3C8VA 4IL6H 1NTZD 1IZNB 1NTMK 2B88A 2YMKA 3FX0A 3TGUD 1S72P 2KS1A 1SQBD 3BATA 3ZDMA 1LP1B 2KI7B 1URQB 1LTSC 4PJ0H 1SQBE 1OWAA 1BGYD 2IFNA 4JYCA 1J2JB 4EI2A 3MUDA 5CCGA 2Q3IA 1QEXA 1SQPG 2E74B 1T8ZA 3L36A 4PD4H 5APUA 1EZVE 3RK3C 3VYIA 5CBOA 2H88C 1LTTC 1CZQA 1M57D 1BE3G 2G8YA 1K04A 1DEEG 3E1IA 1KZUB 5AW3B 2A06D 2IZ1A 2FYUG 2O1KA 3L75G 3IFMA 3L75E 1FAVA 2P2UA 3CX5D 3G71P 1L0ND 1JO5A 1SQPJ 3I55P 4N78E 3U1AA 1L0LK 1IFJA 1L4AB 1SS1A 1M8OB 3TGUJ 3V2PA 1JY3P 3GG2A 5KLVE 1NTMG 3PH0A 1KQSO 1M56D 2XKMA 1VQOP 1J1DB 1SQXG 1SQXE 4ZNCA 1BCCD 3I5CA 2HG5D 2ZXEB 3MIWA 1ZW0A 2IBZE 3AE7C 3HUSC 1N73B 3G6EP 1Y9BA 2E76B 3JC22 5AW7B 4H13C 4HH2A 3G4SP 2H43A 2Q5UA 3CMAP 4H0LD 3QH9A 1FZAA 3VMZA 1Q82Q 3PP5A 3S9OA 5BVZA 1X8YA 3OAKA 1K9MQ 2Z4EA 2E74D 1VDFA 2XU6A 1CI6A 1OW6A 1DH3A 1EDJA 1D7MA 3HE4B 1KQFB 1VQMP 2H8PD 5DJUB 1Q86Q 3D6YA 2KUBA 2OTJP 1EDIA 2M0BA 1T3JA 5KLIB 3SSUA 4IFDK 4NPEA 3FGAD 1KYOD 1EDKA 1GL2A 2HODB 4K35A 5AVXB 5KTBA 5AVVB 3CCMP 3Q5PA 4I7ZC 1G1JA 3L71G 5AVYB 4BRYB 3CWBG 3P8CD 2N1TB 3JCUE 1VF5B 1XTCC 5AVWB 5M1BA 3MP7B 5KAFH 5KJ7D 2YO3A 1YTZI 1LTJB 4HJGH 4DZOA 1NAFA 1FDIA 1LTJC 1X9VA 3HTKB 4ZMDA 1BGYE 2FYZA 2P67A 1XTGB 2B89A 2K9JA 3H1LJ 3CXHH 3AECC 2NPSD 3KZIE 3L35A 4PD4E 1SQQD 3NTNA 1FZGA 2NRGA 5GTHH 3RL0C 1ZP0C 1USEA 1JY2P 5E79E 1FDMA 1CSBA 1PGPA 2O3JA 3KXDA 4D6TE 1S3JA 2JR8A 2XNDH 3AE9C 1U7JA 3L74J 4Y28J 4YXDC 1VQ5P 3SWFA 3OA7A 2HPCB 3MUDC 1ZMEC 3D71A 1LT9B 1T6AA 2XNXA 1FZCC 1L0NE 1HJ0A 2ZYGA 3L74D 3N7NA 2W6JH 3V4QA 2A06E 3W67A 2QJPC 1HBWA 3H1ID 1FZFA 1G2CB 1HH0A 2IYPA 2FBWC 1YJWP 3CPWO 3NFQA 1S1CX 1SQQG 2E75B 3PHLA 1SVFA 3L71D 2B9BA 3IN6A 1KILC 1BSNA 1NU1G 2N1TA 3H1KE 3HRNA 1H0TB 3RK3D 1JY2N 1FDOA 5K5GB 1VQLP 1HGZA 1SQXD 1KQGB 2FYUD 3F5HA 4I7ZB 4IOIH 2XZRA 2D2CC 5B5EE 1LNQA 3F89A 3TDKA 3AEDC 1VF5C 4L76A 3L72D 1MZ9A 1NHLA 3HE4A 1ZR4A 3PJSK 4GT1A 5AW1B 3MZWB 1UIXA 2AXTE 3UIAA 2OYIB 4U7JA 2W83C 1FOSE 5DJTB 3P8CE 2Z5IA 3KHUA 2HPCA 1A02F 1BE3E 2NPSB 1YIJP 1GK6A 4IL6E 4I1LA 1E5WA 1LP1A 2WSFH 3USSA 2W27A 1U7MA 2QJYC 3H1KG 3O6QA 2KK7A 2V4HA 1H89A 1VF5D 2CPSA 4D6TD 2IPPA 1NH4A 1SQXK 2IZ0A 2V7QJ 2Q7CA 1EXIA 3Q3DA 1NU1D 3H1LE 2A06G 4Y99B 3TYYA 1OIPA 1NYHA 1W2BO 3FXDA 4PD4I 1GU5A 3TGUE 2O01J 1SQVJ 2ZT9B 5KKZB 1SFCD 3ABVC 1GTWA 3CD6P 1JTHB 3WMM0 4PV1B 3K5BA 2R32A 1Z56A 1KYOH 2HLOA 1Y8AA 1KV4A 1GL2D 1IJDB 1JM0A 1NOHA 3V4WA 4Y99C 1MFZA 4C7NB 3B4SA 2Q6QA 3BRTB 3VMAA 3CCSP 3H1JG 1FJPA 4WVZA 1VL2A 1ZLLA 1RF1C 4IL6X 3B5NC 1KQLA 4L73A 1QL2A 4QMAA 3L4FA 2OYIA 2AEFA 1M1JA 1NKZB 1OZHA 1P84D 2BCCG 2UWJE 2Y0CA 3B8EB 3HD7D 4W80A 2WSFJ 2RH0A 1QVFO 1BDDA 1S5LE 2NPSA 1JOCA 4D6TJ 3Q5SA 1W5CE 2LXCB 3A7OA 3M06A 2AEJA 4U3FJ 3V5BA 1EQ7A 5CCHA 3BVHA 4NPFX 4CPGA 1KB9D 4OGQD 1E79H 1RF1A 2FXMA 1SFCC 3CWBE 1CW5A 2WT7A 5KJ7A 2Z5HA 3CXHE 2Y9ZA 3KZIH 3AE6C 3NMDA 2JKVA 4AQRD 2AEMA 1KILA 2Y9YA 1HGVA 3BCCD 2YO2A
chains in the Genus database with same CATH topology
2A45I 2FFDA 3VOPA 5AW0B 3RL0D 3GHGB 3CI9A 1S9KE 1YYCA 4I2LC 1RE3A 4WY4A 4N3YB 1GZLA 3B5ND 3TSIA 5APSA 1J1EB 2P1JA 1GK4A 1MV8A 2POHA 1HJBA 2KYVA 2GM4A 3VP9A 3EFGA 4JYBA 1LT9C 1FZCB 2WPRA 3HE5B 1JTHA 2WSEH 3VP8A 2WPQA 3HD7A 3U59A 1JY3O 2JJLA 1JY2O 1IFIA 1X79B 2C0WA 2JEEA 3LW5H 5CJ4A 1NWQA 2I1KA 1W2EA 2N9BA 2QM8A 2N1TC 1LWUB 1G1IA 2BASA 1SQBK 3M9QA 4IFMA 1M1JC 1RF1B 2R5DA 1SQVK 3NXSA 4WBAA 3VMXA 2H7HA 2M3BA 3II6A 1J1EC 1CI6B 3N4XA 5APYA 3U1CA 4EOTA 2WSCH 1FZBA 2OARA 1FOSF 1FJPA 1RF0C 2N1TD 2L5GB 5BU5A 1L4AC 5APXA 4KHXA 3RK2D 5AVSB 1LTGC 1LTJA 1S9KD 1GU4A 1J1DC 3BASA 1LTAC 3P7KA 1WRGA 5AW9B 4IFFA 2WT7B 4N78D 1N7SA 3EQ2A 4O9BA 3HD7B 4RESB 1H8AA 1IFMA 2IX7C 1MUUA 1QL1A 4LGDE 5AVQB 1T2KD 1RE4C 2HFED 1LT9A 1HTLC 1KFMA 4XA4A 1URQC 3RK2C 3HTKA 1GDTA 3IR9A 3LIEA 4W7YA 1L4AD 1JY3N 1SFCA 1LWUC 1SQQK 4AYCA 2FFDB 1H88A 3GHGC 2O01H 3BRVB 5APTA 1JCCA 2A45H 2GUSA 1NKNA 1L0NK 2Q9IA 1IFNA 1WT6A 1G2CA 3RK2B 4M3LA 2J59M 5APQA 2PAJA 3TNUA 2IFMA 4LLHA 1SQPK 2OYHC 1FZCA 3CL3D 4N6JA 3RL0B 1IC2A 3A2AA 3P8MC 1GW4A 4JF7A 2E42A 2YMYA 1KILB 3MTUE 5AW8B 3VMYA 1FJKA 1N7SD 2PP6A 3L37A 1HWTC 5AVUB 3MGNA 1AQ5A 2J58A 3A3YB 5AVRB 2OYHB 1GW3A 1RE4A 1YTZT 2QM7A 3R2PA 1NTZK 1N73A 4I6MC 3HUSA 5CCHC 2WWWA 5CMZA 3KYQA 1M7LA 1URQA 2YKPA 4HYTB 2LKMA 1DX7A 2WITA 1NTKK 1N7SB 3C9IA 5AW5B 2FFDC 2WZ7A 3M0AA 2C9LY 2FKWB 1RF0A 4DOJA 1M1JB 1GL2B 2HODA 2YKQA 3OJAB 3GHGA 1L4AA 1N2DC 2C0XA 2KOGA 3TK1A 2VRSA 1RE3C 3P32A 3T97A 2YKOA 2A45G 3M0DC 1JCDA 5APWA 3RK3B 1URQD 2E43A 1KFNA 5AVZB 1PFIA 2M8RA 3H32B 3M9BA 2OYIC 2CPBA 1LTIC 3VN0A 2NPSC 1GD2E 4WY4B 1ZN5A 4ZKPA 5BU8B 3V2QA 2FYUK 2P7JA 5KJ7C 5APVA 5AW4B 3SWYA 2W6AA 3V2NA 4ZKUA 1N86A 1RY3A 1LWUA 2KSJA 2MJZA 2C9NY 1LGHB 1FZEA 1FBMA 4EIJA 4WY4C 1SFCB 3KPEA 1ZV8A 2I1JA 1DEBA 4WY4D 1AFOA 1IFDA 5KLVK 2HYNA 3B5NB 1N7LA 1LTBC 3TNUB 1NO4A 1KILD 3H6PA 4C7NA 1OXZA 1SLQA 2KLVA 1ZR2A 2OYHA 5CCGC 5CHXA 2WTYA 2XV5A 4GIFA 4WB4A 3CLQA 5CJ0A 3M0DA 3A5TA 3M91A 4W7ZA 4C46A 1FU1A 3G3ZA 2WPSA 3MD0A 2KP8A 1SP4A 2GUVA 3VTPC 1T3UA 2R5BA 5CCGD 2XDJA 3B5NA 3M9HA 3HUSB 1N73C 3LIDA 4GKGA 2R3CA 3KDPB 1JNMA 3HD7C 5AVTB 4XE5B 4B86A 1JMMA 1NU1K 3H32A 2W6BA 1JUNA 1GL2C 5AW2B 5CCHD 1T2KC 2ZFCA 4AUWA 2KB7P 2O1JA 3KQGA 4LC1A 3V2RA 4C7RA 3HE5A 4OH8B 1IK9A 5AW6B 1HUCA 2YNYA 1VPCA 1N7SC 1HVVA 1NTMK 3BATA 1URQB 1LTSC 1OWAA 2IFNA 4JYCA 1J2JB 3MUDA 5CCGA 2Q3IA 3L36A 1T8ZA 5APUA 3RK3C 3VYIA 3E1IA 1LTTC 1CZQA 5AW3B 1A02J 1IO4A 1KZUB 2O1KA 3IFMA 1FAVA 2P2UA 1JO5A 4N78E 3U1AA 1L0LK 1IFJA 1L4AB 3V2PA 1JY3P 2XKMA 1J1DB 3I5CA 2HG5D 2ZXEB 3MIWA 3HUSC 1N73B 5AW7B 4HH2A 2H43A 2Q5UA 1FZAA 3VMZA 3PP5A 5BVZA 2Z4EA 1X8YA 3OAKA 1RF1C 2XU6A 1VDFA 1CI6A 1DH3A 3HE4B 2H8PD 1T3JA 4IFDK 5AVXB 5KTBA 1GL2A 2HODB 5AVVB 1G1JA 5AVYB 3P8CD 2N1TB 1XTCC 5AVWB 5KJ7D 2YO3A 1YTZI 1LTJB 4DZOA 1NAFA 1LTJC 1X9VA 3HTKB 2FYZA 2P67A 1XTGB 2NPSD 3NTNA 1FZGA 3RL0C 1JY2P 1FDMA 1CSBA 3SWFA 3OA7A 2HPCB 1LT9B 2XNXA 1FZCC 3N7NA 3V4QA 1HBWA 1FZFA 1G2CB 1HH0A 3NFQA 1SVFA 1KILC 2N1TA 3HRNA 3RK3D 1JY2N 1HGZA 2XZRA 1MZ9A 1NHLA 3HE4A 1ZR4A 4GT1A 5AW1B 3UIAA 2OYIB 1FOSE 3P8CE 2Z5IA 2HPCA 1A02F 2NPSB 1GK6A 4I1LA 1E5WA 2WSFH 2W27A 1H89A 2CPSA 2IPPA 1NH4A 1SQXK 2Q7CA 4Y99B 3TYYA 1GU5A 1GTWA 1SFCD 1JTHB 3WMM0 2R32A 1Z56A 2HLOA 1GL2D 1IJDB 1NOHA 3V4WA 4Y99C 1MFZA 4C7NB 3BRTB 1ZLLA 3B5NC 1KQLA 1QL2A 3L4FA 2OYIA 3O8ZA 3L35A 1M1JA 1NKZB 3B8EB 3HD7D 4W80A 2NPSA 1JOCA 3BVHA 3A7OA 3M06A 5CCHA 3V5BA 1EQ7A 1RF1A 2FXMA 1SFCC 1CW5A 2WT7A 5KJ7A 2Z5HA 3NMDA 4AQRD 1KILA 1HGVA 2YO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW0 B;  5AVX B;  3TNU B;  5AVV B;  4M3L A;  1S9K E;  1YYC A;  4I2L C;  5AVY B;  5APQ A;  1GZL A;  4C7N A;  1OXZ A;  1SLQ A;  3TNU A;  5AVW B;  2YO3 A;  5APS A;  4DZO A;  2WTY A;  1NAF A;  1GK4 A;  2P67 A;  2XV5 A;  1MV8 A;  1HJB A;  3M0D A;  3NTN A;  3A5T A;  3A2A A;  3M91 A;  3P8M C;  2E42 A;  4JYB A;  4C46 A;  1CSB A;  2WPR A;  2WPS A;  3HE5 B;  3MD0 A;  2WPQ A;  5AW8 B;  2KP8 A;  3VMY A;  1SP4 A;  3SWF A;  2JJL A;  3L37 A;  1HWT C;  5AVU B;  3MGN A;  3VTP C;  2R5B A;  3V4Q A;  3A3Y B;  5AVR B;  3M9H A;  1HBW A;  1G2C B;  1NWQ A;  3LID A;  3NFQ A;  2N9B A;  2QM8 A;  4GKG A;  2R3C A;  2QM7 A;  3KDP B;  1JNM A;  4I6M C;  5AVT B;  2BAS A;  4XE5 B;  4B86 A;  2WWW A;  5CMZ A;  4HYT B;  2R5D A;  3NXS A;  2XZR A;  3VMX A;  2H7H A;  1JUN A;  5AW2 B;  1T2K C;  2ZFC A;  4AUW A;  3HE4 A;  1CI6 B;  3KQG A;  5APY A;  5AW5 B;  4LC1 A;  4GT1 A;  5AW1 B;  3M0A A;  2C9L Y;  4EOT A;  3UIA A;  3HE5 A;  3TK1 A;  1FOS E;  1FOS F;  2VRS A;  2Z5I A;  3P32 A;  5AW6 B;  1HUC A;  3T97 A;  1A02 F;  2YNY A;  1GK6 A;  5APX A;  2W27 A;  4KHX A;  5APW A;  5AVS B;  1S9K D;  1H89 A;  1GU4 A;  2E43 A;  5AVZ B;  2IPP A;  3P7K A;  2Q7C A;  1OWA A;  4JYC A;  1J2J B;  3M9B A;  5AW9 B;  2Q3I A;  3L36 A;  3TYY A;  2WT7 B;  5APU A;  1GU5 A;  3VYI A;  1GTW A;  1A02 J;  5AW3 B;  1CZQ A;  1IO4 A;  4RES B;  1H8A A;  2R32 A;  3VN0 A;  1MUU A;  1T2K D;  5AVQ B;  1GD2 E;  1FAV A;  2P2U A;  3V4W A;  1MFZ A;  4C7N B;  2P7J A;  5APV A;  1KQL A;  5AW4 B;  3L35 A;  3O8Z A;  3B8E B;  3HTK A;  2W6A A;  3IR9 A;  3I5C A;  2ZXE B;  3LIE A;  2C9N Y;  3A7O A;  3M06 A;  5AW7 B;  3V5B A;  2Q5U A;  4AYC A;  2WT7 A;  2Z5H A;  3VMZ A;  1H88 A;  3NMD A;  5APT A;  1X8Y A;  3OAK A;  4AQR D;  2XU6 A;  1CI6 A;  1DH3 A;  2YO2 A;  3HE4 B; 
#chains in the Genus database with same CATH topology
 2A45 I;  2FFD A;  2E5T A;  2K3R A;  5AW0 B;  3VOP A;  3Q2Y A;  5KAI E;  5E79 H;  3RL0 D;  1JEK A;  1PPJ G;  3SFE C;  1NJI Q;  3GHG B;  2QRX A;  2QA4 P;  1BE3 D;  4UB6 E;  3CI9 A;  1S9K E;  1YYC A;  4I2L C;  1RE3 A;  4WY4 A;  1FE6 A;  4N3Y B;  5GTI H;  1GZL A;  5TJH A;  4H0L B;  4XFJ A;  3E1R A;  3B5N D;  4H44 D;  1EDL A;  3TSI A;  5APS A;  1J1E B;  2P1J A;  3AE4 C;  3TF5 A;  1SQB J;  1GK4 A;  3A0H H;  1MV8 A;  2POH A;  5H2F E;  1LT1 A;  3CXH I;  1HJB A;  2JWA A;  3GLM A;  2KYV A;  2GM4 A;  2BEQ D;  3RK2 D;  3VP9 A;  1BSH A;  2ZJS E;  1VQ8 P;  4OGQ B;  3EFG A;  4JYB A;  1LT9 C;  4KJM A;  3I56 P;  2JO1 A;  2FXO A;  2K9J B;  1TU3 F;  2E75 D;  2WPR A;  3H1I J;  3HE5 B;  1JTH A;  3IAO A;  3RL0 g;  2WSE H;  3VP8 A;  2WPQ A;  2K1A A;  3E7K A;  3HD7 A;  3CCE P;  1Q81 Q;  1NTM D;  3U59 A;  1JY3 O;  2JJL A;  1JY2 O;  1BCC G;  1FC2 C;  2WSC J;  1IFI A;  1X79 B;  1GMJ A;  4H44 C;  5KLV J;  2JWD A;  1KD1 Q;  2C0W A;  2JEE A;  2K37 A;  2Q3E A;  3LW5 H;  5CJ4 A;  5KAF E;  1NTK D;  1NWQ A;  2I1K A;  1W2E A;  2WPV B;  2N9B A;  2QM8 A;  3WU2 H;  2N1T C;  2FYN C;  1LWU B;  1NTK E;  1EXJ A;  2W8Z A;  3A0B H;  1G1I A;  3FXE A;  1VQ7 P;  3L70 E;  2HR3 A;  1KB9 I;  2BAS A;  1SQB K;  1X0T A;  2QJP B;  3M9Q A;  3TGU G;  3CX5 I;  4IFM A;  1M1J C;  1RF1 B;  1VQ9 P;  2R5D A;  1SQV K;  2QSI A;  3NXS A;  4WBA A;  4U3F E;  5H2F H;  3VMX A;  2H7H A;  2FYU E;  2M3B A;  1H0T A;  3IF4 A;  1PP9 J;  3RK3 E;  1BGY G;  3II6 A;  2BCC E;  1J1E C;  1CI6 B;  3N4X A;  1BE3 J;  5APY A;  1YJN P;  1L0L J;  3U1C A;  4EOT A;  3CXH D;  3EFF K;  4JPZ B;  2ZXX A;  3SWK A;  3GF3 A;  3AEG C;  4HKZ H;  2E76 C;  1FZB A;  2OAR A;  2WSC H;  1S5L X;  2IDB A;  1RF0 C;  3SFD C;  3W68 A;  1FOS F;  2N1T D;  1NAY A;  2K88 A;  3L73 E;  1P84 I;  1PPJ D;  1QGK B;  2ZT9 D;  2L5G B;  4TLF A;  5BU5 A;  1L4A C;  4GOF A;  1JNM A;  3H1H E;  4WWI A;  1YBK A;  5APX A;  4KHX A;  3H1H D;  1OW8 A;  3T97 B;  1JMB A;  1SQV E;  1LTG C;  1LTJ A;  2L91 A;  5AVS B;  2KXP B;  1NTZ E;  1J1D C;  4UB8 H;  5L8R J;  3CCR P;  3BAS A;  1GU4 A;  1LTA C;  2Q1K A;  3P7K A;  1WRG A;  4ASW A;  3JSV C;  4GOE A;  1OVR A;  2E74 C;  1BCC J;  1EZV D;  2QJK B;  4IFF A;  5AW9 B;  4PD4 D;  2WT7 B;  3B71 A;  4GDO A;  1YIT P;  2KNC B;  1N7S A;  4N78 D;  3EQ2 A;  2OTL P;  3CCL P;  4O9B A;  2ZYD A;  1KTM A;  3HD7 B;  1Q90 D;  4RES B;  1H8A A;  4BRY A;  1IFM A;  2IX7 C;  1QLE D;  2KSE A;  1KYO I;  1MUU A;  1QL1 A;  2LXB A;  3H1I G;  3H1I E;  1RE4 C;  4LGD E;  5AVQ B;  1T2K D;  1AA0 A;  1YQ4 C;  2OTK E;  1OMI A;  2HFE D;  3L74 E;  3AE3 C;  2E5Y A;  3CC7 P;  1LT9 A;  1HTL C;  1KFM A;  4DJG A;  5KLV G;  4XA4 A;  1URQ C;  1R5L A;  3RK2 C;  3HTK A;  1GDT A;  1S9K D;  2IBZ I;  1QX8 A;  3IR9 A;  3ITK A;  2QJK C;  1RH5 B;  3RBZ A;  3LIE A;  2IYO A;  1BGY J;  4U3F D;  1L4A D;  4W7Y A;  4ASV A;  5TIS H;  1DD4 A;  1JY3 N;  1SFC A;  2WVR A;  4L74 A;  1LWU C;  3CWB D;  1PGO A;  4KT0 J;  3GMA A;  3H1H G;  3RBX A;  1SQQ K;  1SQP E;  1NTZ J;  4AYC A;  1AQT A;  3CCV P;  2YXR B;  3L73 G;  3LW5 J;  3PRJ A;  1ZXG A;  2BEZ F;  2P58 A;  3GHG C;  2O01 H;  1H88 A;  2QG4 A;  3BRV B;  5APT A;  1KYO E;  1A02 J;  1JCC A;  1EC5 A;  1PZQ A;  1LJ2 A;  1SQP D;  2A45 H;  4R4L A;  2GUS A;  1NKN A;  1L0N K;  1OX3 A;  1IFN A;  1WT6 A;  1G2C A;  2Q9I A;  3RK2 B;  1NVO A;  1L0L D;  3TK1 A;  1K73 Q;  2AXT H;  2JP3 A;  4M3L A;  1SQV D;  5EFW B;  1KC8 Q;  1RQV A;  1FZC B;  2J59 M;  5APQ A;  2PAJ A;  3G9R A;  1NGM B;  4DCK A;  3TNU A;  2IFM A;  4LLH A;  3A0H E;  2E76 D;  1SQP K;  2R3S A;  1JB0 J;  3L70 G;  3O6Q B;  1ZRT E;  2BCC J;  3WUV A;  4BWN A;  2OYH C;  1FZC A;  1M90 Q;  2ZAE B;  1ZRT D;  3CL3 D;  1NTZ G;  4N6J A;  3Q1M A;  3RL0 B;  1PIX A;  1IC2 A;  3A2A A;  3P8M C;  1GW4 A;  4JF7 A;  2E42 A;  1S2E A;  2YMY A;  1NTK J;  1KIL B;  3MTU E;  2QIW A;  1L0L G;  2M5A A;  4YTP C;  5AW8 B;  2FYN B;  3VMY A;  1FJK A;  1NTK G;  3CC4 P;  1N7S D;  2D2C B;  1RHZ B;  2PP6 A;  3L37 A;  2P10 A;  4UB6 H;  5AVU B;  3MGN A;  1HWT C;  2FFD B;  2B87 B;  3PTZ A;  1AQ5 A;  3L70 D;  1PL5 A;  1PP9 D;  2J58 A;  3WU2 E;  3A3Y B;  4BXL A;  1QVG O;  5AVR B;  3L75 D;  2W90 A;  2FY8 A;  2KZJ A;  1VQP P;  2K9Y A;  1GW3 A;  1RE4 A;  4OWF A;  1M1K Q;  2OYH B;  1YTZ T;  2QM7 A;  3R2P A;  1AJY A;  1NTZ K;  2O01 N;  4I6M C;  2CK3 H;  1KB9 H;  2NZ2 A;  3AE5 C;  4PV1 D;  3HUS A;  1N73 A;  2JDI H;  5CCH C;  1VQN P;  1AV1 A;  2PGD A;  1IFP A;  2PRR A;  2WWW A;  3H1J E;  5CMZ A;  3CX5 H;  1M7L A;  1URQ A;  2YKP A;  3KYQ A;  2DW3 A;  4HYT B;  2LKM A;  4PJ0 E;  1DX7 A;  4H13 B;  2RMZ A;  2WIT A;  1NTK K;  3AEB C;  2H89 C;  1N7S B;  2D2C D;  3C9I A;  3CCQ P;  1IO4 A;  1HF9 A;  3L73 D;  2ZVN B;  5AW5 B;  2FFD C;  2WZ7 A;  3M0A A;  2C9L Y;  2FKW B;  1RF0 A;  1NTM J;  4DOJ A;  4MN4 C;  1M1J B;  4OGQ C;  2M5A B;  4JQ0 D;  1GL2 B;  2HOD A;  2YKQ A;  3GHG A;  1N2D C;  1L4A A;  2KOG A;  2C0X A;  2YXQ B;  3OJA B;  3PLN A;  4GOD A;  2VRS A;  1RE3 C;  3JCU H;  3P32 A;  4L75 A;  3T97 A;  1P84 H;  2YKO A;  1PV3 A;  2A45 G;  3M0D C;  1FS0 E;  3WUT A;  1JCD A;  5APW A;  1NU1 E;  3H1L D;  3RK3 B;  1URQ D;  2M3E A;  3CWB J;  1RQU A;  2E43 A;  1KFN A;  1K8A Q;  1U57 A;  5AVZ B;  1SQQ E;  1PFI A;  2YIU B;  3AE1 C;  3C1L A;  2I8D A;  1WMK A;  2M8R A;  4DT0 A;  3H32 B;  2KIK A;  2KZI A;  2RN0 A;  3CX5 E;  3M9B A;  2OYI C;  2CPB A;  2QEX P;  4H0L C;  4H13 D;  1PP9 E;  5KKZ C;  1OW7 A;  1LTI C;  2MKV A;  3VN0 A;  2G3A A;  2NPS C;  1GD2 E;  4HB1 A;  1YI2 P;  3RGU A;  4RJT A;  2WSS H;  2KNC A;  3EWK A;  4WY4 B;  1ZN5 A;  4ZKP A;  2AXC A;  5B66 H;  3AE2 C;  5BU8 B;  3V2Q A;  2FXP A;  1KN7 A;  2B87 A;  2FYU K;  3BCC J;  2P7J A;  5KJ7 C;  5APV A;  5AW4 B;  3H1L G;  3CC2 P;  4YPC A;  2YIU C;  1BCC E;  3SWY A;  2W6A A;  3V2N A;  4ZKU A;  1N86 A;  1RY3 A;  4NPD A;  1P84 E;  3H1K J;  2OQQ A;  5TIS E;  4UB8 E;  1LWU A;  2KSJ A;  3AEE C;  2MJZ A;  4OVN F;  2C9N Y;  3D70 A;  2ZT9 C;  2Y0E A;  1LGH B;  3A0B E;  4RKU J;  5B5E H;  3H1K D;  1FZE A;  1FBM A;  3H1H J;  1S4X A;  1AVY A;  1USD A;  2SPZ A;  3L71 E;  4WY4 C;  1SFC B;  3KPE A;  2OGU A;  1ZV8 A;  2I1J A;  2IBZ D;  3BCC E;  1VQ6 P;  1DEB A;  2QE7 H;  1L0L E;  2R44 A;  4WY4 D;  1N8R Q;  2N9Y B;  3L72 E;  3QWO C;  1OVU A;  1IFD A;  2Y0D A;  1AFO A;  1L0N J;  1KIL E;  2HYN A;  5KLV K;  1DIP A;  3B5N B;  1N7L A;  1LTB C;  2OYO A;  3TNU B;  4Z1M H;  1NO4 A;  3GW6 A;  2QVA A;  3AE8 C;  5B66 E;  3CCU P;  1Y47 A;  1KIL D;  3WUU A;  1R5S A;  1NU1 J;  3H6P A;  3L72 J;  4C7N A;  1OXZ A;  1SLQ A;  2GA1 A;  2KLV A;  1PPJ E;  1ZR2 A;  1VQ4 P;  2OYH A;  5CCG C;  1UII A;  5CHX A;  3Q5R A;  2RKL A;  1SQX J;  2IBZ G;  4JBZ A;  2WTY A;  3L72 G;  2XV5 A;  4GIF A;  4WB4 A;  3CLQ A;  4TT3 H;  5CJ0 A;  3BCC G;  3M0D A;  1NTM E;  3A5T A;  3FWN A;  3M91 A;  3GF7 A;  4W7Z A;  4K3A A;  4C46 A;  1IK7 A;  1FU1 A;  1L0N G;  3G3Z A;  2WPS A;  2ITA A;  3L75 J;  1YQ3 C;  3L74 G;  3MD0 A;  4YXW H;  1L2P A;  4R4M A;  2E75 C;  2KP8 A;  5KLV D;  3CME P;  1SP4 A;  1ZOY C;  4EIJ A;  1YHQ P;  2KLU A;  2GUV A;  3L73 J;  1Q7Y Q;  3VTP C;  3O8Z A;  1T3U A;  2R5B A;  2ZYA A;  3H1J J;  3MHV A;  5CCG D;  1BDC A;  1KOR A;  2XDJ A;  2ZVO B;  3AEA C;  3B5N A;  3M9H A;  3S1K A;  2KS1 B;  2WQY C;  3HUS B;  2QJY B;  3LID A;  1SQB G;  1S5L H;  1N73 C;  2FYU J;  1KB9 E;  1PGQ A;  2R3C A;  4GKG A;  5GTI E;  3KDP B;  1SQQ J;  3D6Z A;  2WMM A;  3HD7 C;  4EDF A;  3CCJ P;  2PFX A;  1SQV G;  1PP9 G;  5AVT B;  4XE5 B;  4B86 A;  3R4Y A;  3L71 J;  2BCC D;  5GTH E;  1JMM A;  1YJ9 P;  2V7Q H;  5C39 A;  3H25 A;  1OVV A;  2J5U A;  1NU1 K;  3H32 A;  2W6B A;  4RO0 A;  1JUN A;  1GL2 C;  5AW2 B;  5CCH D;  1T2K C;  2ZFC A;  3L70 J;  4H44 B;  4AUW A;  3H1J D;  3V6I A;  4PV1 C;  2KB7 P;  2LR2 A;  2O1J A;  1R8E A;  1EZV G;  1X22 A;  1EZV I;  3KQG A;  5KAI H;  4LC1 A;  1MKM A;  3V2R A;  1K05 A;  1DD3 A;  5KLI C;  4EYY Q;  1MFT A;  4A7P A;  3HE5 A;  4C7R A;  1OFC X;  3AEF C;  4OH8 B;  1IK9 A;  1KMI Z;  3OW2 O;  1PGJ A;  3S4R A;  5AW6 B;  1HUC A;  4U3F G;  1Q2N A;  5CBN A;  2YNY A;  1VPC A;  3FWL A;  1N7S C;  4D6T G;  1HVV A;  1VQK P;  1AVO A;  2WSE J;  3C8V A;  4IL6 H;  1NTZ D;  1IZN B;  1NTM K;  2B88 A;  2YMK A;  3FX0 A;  3TGU D;  1S72 P;  2KS1 A;  1SQB D;  3BAT A;  3ZDM A;  1LP1 B;  2KI7 B;  1URQ B;  1LTS C;  4PJ0 H;  1SQB E;  1OWA A;  1BGY D;  2IFN A;  4JYC A;  1J2J B;  4EI2 A;  3MUD A;  5CCG A;  2Q3I A;  1QEX A;  1SQP G;  2E74 B;  1T8Z A;  3L36 A;  4PD4 H;  5APU A;  1EZV E;  3RK3 C;  3VYI A;  5CBO A;  2H88 C;  1LTT C;  1CZQ A;  1M57 D;  1BE3 G;  2G8Y A;  1K04 A;  1DEE G;  3E1I A;  1KZU B;  5AW3 B;  2A06 D;  2IZ1 A;  2FYU G;  2O1K A;  3L75 G;  3IFM A;  3L75 E;  1FAV A;  2P2U A;  3CX5 D;  3G71 P;  1L0N D;  1JO5 A;  1SQP J;  3I55 P;  4N78 E;  3U1A A;  1L0L K;  1IFJ A;  1L4A B;  1SS1 A;  1M8O B;  3TGU J;  3V2P A;  1JY3 P;  3GG2 A;  5KLV E;  1NTM G;  3PH0 A;  1KQS O;  1M56 D;  2XKM A;  1VQO P;  1J1D B;  1SQX G;  1SQX E;  4ZNC A;  1BCC D;  3I5C A;  2HG5 D;  2ZXE B;  3MIW A;  1ZW0 A;  2IBZ E;  3AE7 C;  3HUS C;  1N73 B;  3G6E P;  1Y9B A;  2E76 B;  3JC2 2;  5AW7 B;  4H13 C;  4HH2 A;  3G4S P;  2H43 A;  2Q5U A;  3CMA P;  4H0L D;  3QH9 A;  1FZA A;  3VMZ A;  1Q82 Q;  3PP5 A;  3S9O A;  5BVZ A;  1X8Y A;  3OAK A;  1K9M Q;  2Z4E A;  2E74 D;  1VDF A;  2XU6 A;  1CI6 A;  1OW6 A;  1DH3 A;  1EDJ A;  1D7M A;  3HE4 B;  1KQF B;  1VQM P;  2H8P D;  5DJU B;  1Q86 Q;  3D6Y A;  2KUB A;  2OTJ P;  1EDI A;  2M0B A;  1T3J A;  5KLI B;  3SSU A;  4IFD K;  4NPE A;  3FGA D;  1KYO D;  1EDK A;  1GL2 A;  2HOD B;  4K35 A;  5AVX B;  5KTB A;  5AVV B;  3CCM P;  3Q5P A;  4I7Z C;  1G1J A;  3L71 G;  5AVY B;  4BRY B;  3CWB G;  3P8C D;  2N1T B;  3JCU E;  1VF5 B;  1XTC C;  5AVW B;  5M1B A;  3MP7 B;  5KAF H;  5KJ7 D;  2YO3 A;  1YTZ I;  1LTJ B;  4HJG H;  4DZO A;  1NAF A;  1FDI A;  1LTJ C;  1X9V A;  3HTK B;  4ZMD A;  1BGY E;  2FYZ A;  2P67 A;  1XTG B;  2B89 A;  2K9J A;  3H1L J;  3CXH H;  3AEC C;  2NPS D;  3KZI E;  3L35 A;  4PD4 E;  1SQQ D;  3NTN A;  1FZG A;  2NRG A;  5GTH H;  3RL0 C;  1ZP0 C;  1USE A;  1JY2 P;  5E79 E;  1FDM A;  1CSB A;  1PGP A;  2O3J A;  3KXD A;  4D6T E;  1S3J A;  2JR8 A;  2XND H;  3AE9 C;  1U7J A;  3L74 J;  4Y28 J;  4YXD C;  1VQ5 P;  3SWF A;  3OA7 A;  2HPC B;  3MUD C;  1ZME C;  3D71 A;  1LT9 B;  1T6A A;  2XNX A;  1FZC C;  1L0N E;  1HJ0 A;  2ZYG A;  3L74 D;  3N7N A;  2W6J H;  3V4Q A;  2A06 E;  3W67 A;  2QJP C;  1HBW A;  3H1I D;  1FZF A;  1G2C B;  1HH0 A;  2IYP A;  2FBW C;  1YJW P;  3CPW O;  3NFQ A;  1S1C X;  1SQQ G;  2E75 B;  3PHL A;  1SVF A;  3L71 D;  2B9B A;  3IN6 A;  1KIL C;  1BSN A;  1NU1 G;  2N1T A;  3H1K E;  3HRN A;  1H0T B;  3RK3 D;  1JY2 N;  1FDO A;  5K5G B;  1VQL P;  1HGZ A;  1SQX D;  1KQG B;  2FYU D;  3F5H A;  4I7Z B;  4IOI H;  2XZR A;  2D2C C;  5B5E E;  1LNQ A;  3F89 A;  3TDK A;  3AED C;  1VF5 C;  4L76 A;  3L72 D;  1MZ9 A;  1NHL A;  3HE4 A;  1ZR4 A;  3PJS K;  4GT1 A;  5AW1 B;  3MZW B;  1UIX A;  2AXT E;  3UIA A;  2OYI B;  4U7J A;  2W83 C;  1FOS E;  5DJT B;  3P8C E;  2Z5I A;  3KHU A;  2HPC A;  1A02 F;  1BE3 E;  2NPS B;  1YIJ P;  1GK6 A;  4IL6 E;  4I1L A;  1E5W A;  1LP1 A;  2WSF H;  3USS A;  2W27 A;  1U7M A;  2QJY C;  3H1K G;  3O6Q A;  2KK7 A;  2V4H A;  1H89 A;  1VF5 D;  2CPS A;  4D6T D;  2IPP A;  1NH4 A;  1SQX K;  2IZ0 A;  2V7Q J;  2Q7C A;  1EXI A;  3Q3D A;  1NU1 D;  3H1L E;  2A06 G;  4Y99 B;  3TYY A;  1OIP A;  1NYH A;  1W2B O;  3FXD A;  4PD4 I;  1GU5 A;  3TGU E;  2O01 J;  1SQV J;  2ZT9 B;  5KKZ B;  1SFC D;  3ABV C;  1GTW A;  3CD6 P;  1JTH B;  3WMM 0;  4PV1 B;  3K5B A;  2R32 A;  1Z56 A;  1KYO H;  2HLO A;  1Y8A A;  1KV4 A;  1GL2 D;  1IJD B;  1JM0 A;  1NOH A;  3V4W A;  4Y99 C;  1MFZ A;  4C7N B;  3B4S A;  2Q6Q A;  3BRT B;  3VMA A;  3CCS P;  3H1J G;  1FJP A;  4WVZ A;  1VL2 A;  1ZLL A;  1RF1 C;  4IL6 X;  3B5N C;  1KQL A;  4L73 A;  1QL2 A;  4QMA A;  3L4F A;  2OYI A;  2AEF A;  1M1J A;  1NKZ B;  1OZH A;  1P84 D;  2BCC G;  2UWJ E;  2Y0C A;  3B8E B;  3HD7 D;  4W80 A;  2WSF J;  2RH0 A;  1QVF O;  1BDD A;  1S5L E;  2NPS A;  1JOC A;  4D6T J;  3Q5S A;  1W5C E;  2LXC B;  3A7O A;  3M06 A;  2AEJ A;  4U3F J;  3V5B A;  1EQ7 A;  5CCH A;  3BVH A;  4NPF X;  4CPG A;  1KB9 D;  4OGQ D;  1E79 H;  1RF1 A;  2FXM A;  1SFC C;  3CWB E;  1CW5 A;  2WT7 A;  5KJ7 A;  2Z5H A;  3CXH E;  2Y9Z A;  3KZI H;  3AE6 C;  3NMD A;  2JKV A;  4AQR D;  2AEM A;  1KIL A;  2Y9Y A;  1HGV A;  3BCC D;  2YO2 A; 
#chains in the Genus database with same CATH homology
 2A45 I;  2FFD A;  3VOP A;  5AW0 B;  3RL0 D;  3GHG B;  3CI9 A;  1S9K E;  1YYC A;  4I2L C;  1RE3 A;  4WY4 A;  4N3Y B;  1GZL A;  3B5N D;  3TSI A;  5APS A;  1J1E B;  2P1J A;  1GK4 A;  1MV8 A;  2POH A;  1HJB A;  2KYV A;  2GM4 A;  3VP9 A;  3EFG A;  4JYB A;  1LT9 C;  1FZC B;  2WPR A;  3HE5 B;  1JTH A;  2WSE H;  3VP8 A;  2WPQ A;  3HD7 A;  3U59 A;  1JY3 O;  2JJL A;  1JY2 O;  1IFI A;  1X79 B;  2C0W A;  2JEE A;  3LW5 H;  5CJ4 A;  1NWQ A;  2I1K A;  1W2E A;  2N9B A;  2QM8 A;  2N1T C;  1LWU B;  1G1I A;  2BAS A;  1SQB K;  3M9Q A;  4IFM A;  1M1J C;  1RF1 B;  2R5D A;  1SQV K;  3NXS A;  4WBA A;  3VMX A;  2H7H A;  2M3B A;  3II6 A;  1J1E C;  1CI6 B;  3N4X A;  5APY A;  3U1C A;  4EOT A;  2WSC H;  1FZB A;  2OAR A;  1FOS F;  1FJP A;  1RF0 C;  2N1T D;  2L5G B;  5BU5 A;  1L4A C;  5APX A;  4KHX A;  3RK2 D;  5AVS B;  1LTG C;  1LTJ A;  1S9K D;  1GU4 A;  1J1D C;  3BAS A;  1LTA C;  3P7K A;  1WRG A;  5AW9 B;  4IFF A;  2WT7 B;  4N78 D;  1N7S A;  3EQ2 A;  4O9B A;  3HD7 B;  4RES B;  1H8A A;  1IFM A;  2IX7 C;  1MUU A;  1QL1 A;  4LGD E;  5AVQ B;  1T2K D;  1RE4 C;  2HFE D;  1LT9 A;  1HTL C;  1KFM A;  4XA4 A;  1URQ C;  3RK2 C;  3HTK A;  1GDT A;  3IR9 A;  3LIE A;  4W7Y A;  1L4A D;  1JY3 N;  1SFC A;  1LWU C;  1SQQ K;  4AYC A;  2FFD B;  1H88 A;  3GHG C;  2O01 H;  3BRV B;  5APT A;  1JCC A;  2A45 H;  2GUS A;  1NKN A;  1L0N K;  2Q9I A;  1IFN A;  1WT6 A;  1G2C A;  3RK2 B;  4M3L A;  2J59 M;  5APQ A;  2PAJ A;  3TNU A;  2IFM A;  4LLH A;  1SQP K;  2OYH C;  1FZC A;  3CL3 D;  4N6J A;  3RL0 B;  1IC2 A;  3A2A A;  3P8M C;  1GW4 A;  4JF7 A;  2E42 A;  2YMY A;  1KIL B;  3MTU E;  5AW8 B;  3VMY A;  1FJK A;  1N7S D;  2PP6 A;  3L37 A;  1HWT C;  5AVU B;  3MGN A;  1AQ5 A;  2J58 A;  3A3Y B;  5AVR B;  2OYH B;  1GW3 A;  1RE4 A;  1YTZ T;  2QM7 A;  3R2P A;  1NTZ K;  1N73 A;  4I6M C;  3HUS A;  5CCH C;  2WWW A;  5CMZ A;  3KYQ A;  1M7L A;  1URQ A;  2YKP A;  4HYT B;  2LKM A;  1DX7 A;  2WIT A;  1NTK K;  1N7S B;  3C9I A;  5AW5 B;  2FFD C;  2WZ7 A;  3M0A A;  2C9L Y;  2FKW B;  1RF0 A;  4DOJ A;  1M1J B;  1GL2 B;  2HOD A;  2YKQ A;  3OJA B;  3GHG A;  1L4A A;  1N2D C;  2C0X A;  2KOG A;  3TK1 A;  2VRS A;  1RE3 C;  3P32 A;  3T97 A;  2YKO A;  2A45 G;  3M0D C;  1JCD A;  5APW A;  3RK3 B;  1URQ D;  2E43 A;  1KFN A;  5AVZ B;  1PFI A;  2M8R A;  3H32 B;  3M9B A;  2OYI C;  2CPB A;  1LTI C;  3VN0 A;  2NPS C;  1GD2 E;  4WY4 B;  1ZN5 A;  4ZKP A;  5BU8 B;  3V2Q A;  2FYU K;  2P7J A;  5KJ7 C;  5APV A;  5AW4 B;  3SWY A;  2W6A A;  3V2N A;  4ZKU A;  1N86 A;  1RY3 A;  1LWU A;  2KSJ A;  2MJZ A;  2C9N Y;  1LGH B;  1FZE A;  1FBM A;  4EIJ A;  4WY4 C;  1SFC B;  3KPE A;  1ZV8 A;  2I1J A;  1DEB A;  4WY4 D;  1AFO A;  1IFD A;  5KLV K;  2HYN A;  3B5N B;  1N7L A;  1LTB C;  3TNU B;  1NO4 A;  1KIL D;  3H6P A;  4C7N A;  1OXZ A;  1SLQ A;  2KLV A;  1ZR2 A;  2OYH A;  5CCG C;  5CHX A;  2WTY A;  2XV5 A;  4GIF A;  4WB4 A;  3CLQ A;  5CJ0 A;  3M0D A;  3A5T A;  3M91 A;  4W7Z A;  4C46 A;  1FU1 A;  3G3Z A;  2WPS A;  3MD0 A;  2KP8 A;  1SP4 A;  2GUV A;  3VTP C;  1T3U A;  2R5B A;  5CCG D;  2XDJ A;  3B5N A;  3M9H A;  3HUS B;  1N73 C;  3LID A;  4GKG A;  2R3C A;  3KDP B;  1JNM A;  3HD7 C;  5AVT B;  4XE5 B;  4B86 A;  1JMM A;  1NU1 K;  3H32 A;  2W6B A;  1JUN A;  1GL2 C;  5AW2 B;  5CCH D;  1T2K C;  2ZFC A;  4AUW A;  2KB7 P;  2O1J A;  3KQG A;  4LC1 A;  3V2R A;  4C7R A;  3HE5 A;  4OH8 B;  1IK9 A;  5AW6 B;  1HUC A;  2YNY A;  1VPC A;  1N7S C;  1HVV A;  1NTM K;  3BAT A;  1URQ B;  1LTS C;  1OWA A;  2IFN A;  4JYC A;  1J2J B;  3MUD A;  5CCG A;  2Q3I A;  3L36 A;  1T8Z A;  5APU A;  3RK3 C;  3VYI A;  3E1I A;  1LTT C;  1CZQ A;  5AW3 B;  1A02 J;  1IO4 A;  1KZU B;  2O1K A;  3IFM A;  1FAV A;  2P2U A;  1JO5 A;  4N78 E;  3U1A A;  1L0L K;  1IFJ A;  1L4A B;  3V2P A;  1JY3 P;  2XKM A;  1J1D B;  3I5C A;  2HG5 D;  2ZXE B;  3MIW A;  3HUS C;  1N73 B;  5AW7 B;  4HH2 A;  2H43 A;  2Q5U A;  1FZA A;  3VMZ A;  3PP5 A;  5BVZ A;  2Z4E A;  1X8Y A;  3OAK A;  1RF1 C;  2XU6 A;  1VDF A;  1CI6 A;  1DH3 A;  3HE4 B;  2H8P D;  1T3J A;  4IFD K;  5AVX B;  5KTB A;  1GL2 A;  2HOD B;  5AVV B;  1G1J A;  5AVY B;  3P8C D;  2N1T B;  1XTC C;  5AVW B;  5KJ7 D;  2YO3 A;  1YTZ I;  1LTJ B;  4DZO A;  1NAF A;  1LTJ C;  1X9V A;  3HTK B;  2FYZ A;  2P67 A;  1XTG B;  2NPS D;  3NTN A;  1FZG A;  3RL0 C;  1JY2 P;  1FDM A;  1CSB A;  3SWF A;  3OA7 A;  2HPC B;  1LT9 B;  2XNX A;  1FZC C;  3N7N A;  3V4Q A;  1HBW A;  1FZF A;  1G2C B;  1HH0 A;  3NFQ A;  1SVF A;  1KIL C;  2N1T A;  3HRN A;  3RK3 D;  1JY2 N;  1HGZ A;  2XZR A;  1MZ9 A;  1NHL A;  3HE4 A;  1ZR4 A;  4GT1 A;  5AW1 B;  3UIA A;  2OYI B;  1FOS E;  3P8C E;  2Z5I A;  2HPC A;  1A02 F;  2NPS B;  1GK6 A;  4I1L A;  1E5W A;  2WSF H;  2W27 A;  1H89 A;  2CPS A;  2IPP A;  1NH4 A;  1SQX K;  2Q7C A;  4Y99 B;  3TYY A;  1GU5 A;  1GTW A;  1SFC D;  1JTH B;  3WMM 0;  2R32 A;  1Z56 A;  2HLO A;  1GL2 D;  1IJD B;  1NOH A;  3V4W A;  4Y99 C;  1MFZ A;  4C7N B;  3BRT B;  1ZLL A;  3B5N C;  1KQL A;  1QL2 A;  3L4F A;  2OYI A;  3O8Z A;  3L35 A;  1M1J A;  1NKZ B;  3B8E B;  3HD7 D;  4W80 A;  2NPS A;  1JOC A;  3BVH A;  3A7O A;  3M06 A;  5CCH A;  3V5B A;  1EQ7 A;  1RF1 A;  2FXM A;  1SFC C;  1CW5 A;  2WT7 A;  5KJ7 A;  2Z5H A;  3NMD A;  4AQR D;  1KIL A;  1HGV A;  2YO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...