5APVA

Sequence iankedkad inserted between gcn4 adaptors - structure a9b grey
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
70
structure length
70
Chain Sequence
b'HMKQLEDKVEELLSKVYHLENEVARLKKLIANKEDKADMKQLEDKVEELLSKVYHLENEVARLKKLVGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 28
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apvA00
3HE4B 3MD0A 3VMZA 1GU4A 1A02J 3SWFA 2E43A 3P7KA 4XE5B 3V4QA 2ZFCA 3KQGA 2WT7B 5AW2B 4HYTB 4GKGA 5CMZA 2WTYA 4I6MC 1OWAA 5APXA 5AVWB 2KP8A 5AW5B 1FOSF 4JYCA 4EOTA 2ZXEB 1H8AA 3NMDA 4B86A 3TNUB 5AVUB 2WT7A 3A2AA 2Q7CA 2P67A 3OAKA 3T97A 1S9KE 2JJLA 1SP4A 3M9HA 1GK4A 2C9NY 1GU5A 1CZQA 3A5TA 2R5BA 1HBWA 1S9KD 5AW1B 3TK1A 2XV5A 5AW9B 2WPRA 4GT1A 4KHXA 5AW8B 3TYYA 2QM7A 5AVZB 3L35A 3L36A 4M3LA 2Q5UA 2W6AA 1NWQA 3HE4A 3M06A 5AVRB 3NXSA 1GTWA 2C9LY 5AVYB 2XZRA 1T2KD 3LIEA 3HE5B 2BASA 1FOSE 2Z5HA 5AVXB 1YYCA 3I5CA 1A02F 2P7JA 1JNMA 2QM8A 1KQLA 1G2CB 5APTA 1JUNA 5APUA 2E42A 3M9BA 5AW4B 1H88A 3M0AA 5AW7B 4C7NB 3TNUA 1SLQA 1CI6B 3A3YB 5AVQB 2VRSA 2WPQA 2H7HA 1X8YA 2W27A 2R3CA 5AW6B 3B8EB 4JYBA 3MGNA 5APQA 2Z5IA 4I2LC 1CSBA 3P32A 1DH3A 1NAFA 3M91A 4AQRD 5AW0B 3VN0A 2WPSA 1H89A 2P2UA 1FAVA 3LIDA 3O8ZA 2R32A 3HTKA 4LC1A 5AVTB 3VMYA 2YNYA 2WWWA 4AYCA 1MV8A 5APWA 5AVVB 1MUUA 2IPPA 2YO3A 1GK6A 3VTPC 4C46A 3VYIA 5APSA 4DZOA 3HE5A 3M0DA 1GZLA 3VMXA 2YO2A 2XU6A 5APVA 1HUCA 1OXZA 2N9BA 4RESB 3NTNA 2Q3IA 1T2KC 1HWTC 4AUWA 3P8MC 3KDPB 1HJBA 3V4WA 4C7NA 3V5BA 1CI6A 2R5DA 3UIAA 5AW3B 3NFQA 1GD2E 1MFZA 5APYA 3IR9A 1IO4A 5AVSB 1J2JB 3L37A 3A7OA
chains in the Genus database with same CATH superfamily
3U59A 3L73J 1JY3N 1JY3O 1NTKG 3L75D 2E5YA 2W83C 3KQGA 2H8PD 4OGQC 3H1JD 3HD7B 4HKZH 2K9JA 1SQXK 3FWLA 4NPFX 3OJAB 1T6AA 1SFCC 3D6ZA 1YQ3C 3RBZA 2KNCB 5AVUB 1WT6A 3R4YA 2P67A 3OA7A 2Q9IA 2RN0A 1NTKK 1NTZJ 2KS1A 1R5LA 2JKVA 5CCGC 1EDKA 1EQ7A 2IBZG 3AE3C 1AA0A 1GL2B 2V7QJ 3L75G 1FZCA 1ZRTE 1QVGO 2P7JA 5BVZA 3CPWO 2DW3A 2O1JA 5TISE 4L75A 2K37A 2UWJE 2WSEJ 2E74B 4OH8B 3P32A 4GIFA 1EDIA 1IFJA 1VQKP 5KLVD 3I55P 1Q82Q 1EZVE 3VTPC 2LR2A 1OMIA 3RL0D 2NPSC 4PV1D 3H1HE 1KMIZ 2NZ2A 4O9BA 3AE8C 3S4RA 3V5BA 2R5DA 1S2EA 3NFQA 3RK3C 1GD2E 4PD4I 2AXTH 1GU4A 3SWFA 1VQ4P 4HYTB 5KLVG 2FXMA 5H2FH 1YBKA 1W5CE 3VP8A 2LXBA 5GTIE 2IYPA 1BGYD 2ZXEB 4DJGA 1H8AA 1LT9B 4WWIA 3CWBJ 3FGAD 3AEGC 3L72E 1ZN5A 1PP9G 2R5BA 4H0LD 5KLVK 1S9KD 2K88A 2B9BA 3VP9A 1W2BO 1YJNP 1K73Q 1NYHA 5AVRB 3Q5PA 1XTCC 2M5AB 2B87B 1KQGB 1N73B 1WMKA 2QM8A 1BGYG 1JMBA 4ASWA 1AV1A 2OYHA 1S4XA 4C7NB 2IDBA 3E1RA 1NAYA 1GW3A 2QIWA 1FDOA 1URQC 2N9YB 3H1LE 3Q1MA 2YKPA 3VMXA 3G3ZA 3GF3A 3WUTA 1IFPA 5KAIE 1OVUA 2R3SA 5AW3B 4UB6E 2K9JB 5B66H 2HR3A 1JMMA 4EIJA 3AEEC 5AW2B 4GKGA 1ZW0A 4I1LA 4PD4E 1IJDB 1JTHB 3TNUB 2L91A 1Q90D 2BCCD 2Q1KA 3GF7A 3ZDMA 1FZCC 1RF1B 5K5GB 1YITP 1HBWA 2ZXXA 1SQQD 3G6EP 5B5EH 5AW8B 5CBOA 3WMM0 1VQ8P 1SQPD 2Q5UA 4N3YB 5CJ0A 3U1CA 2SPZA 1ZR4A 2OYIC 1ZR2A 1M57D 2H7HA 3H1LD 2FY8A 1Q7YQ 1SQQG 1FAVA 3TDKA 1RE4A 3JCUE 2FYZA 3HD7D 1N2DC 1GZLA 4GDOA 3TGUD 3P8CD 1SQQK 1L0NG 3HUSA 4IFDK 1ZLLA 2FBWC 1SQPK 4RO0A 1KB9H 1CW5A 1JEKA 2YIUC 3A0HH 3P7KA 1P84H 4XE5B 2ZFCA 3LW5H 3E7KA 3CC4P 3PP5A 4H44B 1GL2D 4U3FG 2HG5D 2JWAA 1OX3A 3L74E 4D6TD 2YMKA 1DIPA 3M9HA 1GK4A 2OYOA 3GHGA 3CCJP 1S5LX 2N1TB 2OYHC 3RL0C 2IYOA 1Z56A 2E74D 3L36A 1L0LG 4PV1C 1E5WA 3A0BH 1BDCA 1U57A 2PFXA 3HD7A 2E5TA 1KFMA 1KQLA 4RJTA 1S5LE 1N7SB 2KNCA 1M1JB 4D6TG 2FYUG 1X8YA 2ZAEB 2ZYDA 2R3CA 4JYBA 3AEFC 3H1IG 1NAFA 3L71J 2D2CB 3BATA 3L70J 3L74J 3H1KE 4H0LC 1YIJP 1GL2A 1IZNB 5APSA 1VDFA 1DEBA 3FX0A 3PHLA 5KAFE 1BCCE 2XU6A 5APVA 2Q3IA 2OGUA 2KZJA 1IK9A 2HLOA 4Y99B 4HH2A 3FXEA 2JEEA 1SQBE 1NJIQ 3G9RA 2OARA 1PPJE 1Q86Q 2K3RA 3AEAC 5KLIB 1N8RQ 1TU3F 3H1KJ 2IZ1A 4JBZA 1S3JA 1VQMP 5KTBA 3S9OA 3OW2O 2KZIA 4MN4C 4M3LA 2O01J 2KLVA 4A7PA 1A02F 4OWFA 1YI2P 4XFJA 2QJYB 1LP1B 3CX5D 1H88A 1RE4C 5AW7B 2AXCA 3FWNA 1LT9A 1SLQA 2YKQA 3A3YB 5AVQB 2J59M 2W27A 1NTME 3MGNA 2ITAA 1SQBJ 1QVFO 1BE3G 2IBZE 3VMYA 3HUSC 3KZIH 4IFMA 2FYNB 4K3AA 2A06E 2QE7H 2B88A 1LTTC 1J1EC 1SQVE 1SQXD 3Q2YA 5KJ7D 2B87A 1N73A 1NU1G 1ZXGA 3CCRP 2QG4A 4RESB 2ZJSE 2G8YA 1PIXA 4C7NA 4GOFA 4YXWH 3MHVA 5CHXA 1LTJA 4LLHA 1NTZE 1HTLC 3D70A 1PZQA 4GOEA 1YQ4C 3GHGC 3JSVC 1OWAA 1KILE 1Q2NA 1UIIA 2K1AA 1SQXG 1AQTA 3TSIA 3AEDC 2WT7A 4UB8E 2AXTE 3AE6C 3HD7C 5AW1B 3TK1A 1JY2N 5AW9B 5H2FE 1JY2O 1SQVJ 2YXRB 5E79H 3EQ2A 2KUBA 3KPEA 1K8AQ 4ASVA 5KJ7A 1LT1A 3AE7C 5AW4B 1NGMB 3BRVB 1JTHA 3L73D 5GTHH 3TNUA 2KSJA 1YHQP 2H88C 1GL2C 4NPDA 1PP9E 4N78D 1ZV8A 1RF1A 4I2LC 4PJ0H 1CSBA 3M91A 3H1JG 3MIWA 1UIXA 2WWWA 4AYCA 2CPBA 2GUSA 1KYOD 4H44D 1OW8A 2E74C 2FXPA 2W6BA 1Y8AA 2I8DA 3KYQA 3R2PA 3CWBE 2AEMA 1NTMK 2QJPB 5APYA 1HGVA 5AVSB 1LTBC 1VF5B 3HE4B 3CCVP 2R44A 3VMZA 3CMEP 1LWUC 2N1TD 4BRYB 3G71P 1RY3A 2PAJA 2WMMA 2WPVB 1PP9J 4IL6H 4JYCA 4K35A 1SQVK 3B4SA 3SFDC 5B66E 4IFFA 4EI2A 2E76B 1N7SD 2H89C 2GA1A 3QH9A 2Y9ZA 1DD3A 2XV5A 1QX8A 1RE3A 1MKMA 1LT9C 1LTAC 1NTZK 1BDDA 2D2CD 2C9LY 3B71A 1OZHA 3GLMA 1FZBA 1ZRTD 2E75B 1VQ7P 1J1DB 2JDIH 1LNQA 2VRSA 3N4XA 3V2QA 3BCCE 3SSUA 2Y0CA 1DD4A 1YTZT 1QL2A 1N73C 1Y47A 4AQRD 1VQ6P 3O8ZA 3LIDA 2N1TA 2FFDB 3CI9A 1AQ5A 1FZEA 3RL0g 1EZVD 2O01N 3WU2H 3CCMP 2WQYC 1LTJB 1N7SA 2BEQD 3UIAA 1M1JA 3H1HD 3W68A 2YXQB 2OTLP 2WSFH 2WT7B 3RK2B 3W67A 3GG2A 3BCCJ 2KP8A 5AW5B 1FJPA 2HYNA 4B86A 1NVOA 2QA4P 1D7MA 3USSA 1KB9E 4EDFA 1L0NE 2Y9YA 1RQUA 3TF5A 1GW4A 1ZMEC 1VQLP 3A0HE 1GU5A 3F5HA 1P84E 1S1CX 5KJ7C 3L72D 1FDMA 3H1HG 3II6A 3L35A 3M06A 1VQ9P 4U3FE 1YYCA 3AE9C 1RF1C 1VQOP 2Q6QA 2JO1A 4W80A 1AVYA 5CCHD 1IFIA 3B8EB 3A0BE 3C1LA 3L4FA 2HFED 3L72G 2LXCB 1L0LE 3EWKA 1L0NJ 2QJKB 3CCEP 4WY4B 3RGUA 3VMAA 1U7MA 2BCCG 3M0DA 2QVAA 3LW5J 3U1AA 1LP1A 2FYUE 1SS1A 3H1IE 4U3FJ 1IO4A 2Z4EA 3Q5SA 1SQPG 2HPCB 2E43A 1KORA 4WVZA 2AEJA 1GDTA 2A45I 1KN7A 3M9QA 2IZ0A 4I6MC 1YTZI 5APXA 4PD4D 2XNDH 3CXHI 3H1LG 1JCDA 1L0LJ 2M8RA 1CZQA 4YTPC 5CCHA 2WVRA 4H44C 1XTGB 2PGDA 2WZ7A 2FXOA 3L71E 3RK3E 2FYUJ 4D6TJ 3L70E 2Z5HA 1M8OB 1JNMA 1KILB 4BWNA 3TGUG 4JQ0D 3H1IJ 4YPCA 3V2PA 1G1JA 2N1TC 1Y9BA 1CI6B 2KIKA 1VPCA 4Z1MH 2M3EA 2J58A 2GUVA 4CPGA 1L4AB 1VF5D 1N7SC 1MV8A 5APWA 5AVVB 1M1JC 2IPPA 1GK6A 1KFNA 5KKZB 2IBZI 1FZGA 3S1KA 1HF9A 2D2CC 1IFNA 3K5BA 1HWTC 4AUWA 2XDJA 3MUDA 2E76D 3KZIE 3IR9A 1BE3E 2Q3EA 1OIPA 2WSSH 1SFCA 1N86A 1EXJA 5AVWB 1PGOA 2KLUA 1NU1E 4TLFA 3L71D 1AVOA 4Y99C 3IN6A 1M1KQ 2E75D 5BU5A 3L74D 1KQSO 3AEBC 3B5NB 3CXHE 4H0LB 1K9MQ 1E79H 1FS0E 3V2NA 3HE4A 1PV3A 3NXSA 3VOPA 4BRYA 5KLIC 4ZMDA 1OVVA 1BE3J 3N7NA 5E79E 5AW6B 1HJ0A 3L74G 1SVFA 3M0DC 4BXLA 1G1IA 1NTKE 1VQNP 2W8ZA 3VN0A 2B89A 2JP3A 2QJYC 1NU1J 1H89A 2GM4A 3PLNA 2ZT9B 1JY3P 2ZVOB 1T8ZA 5GTHE 3RK2D 3H1KD 3SFEC 2KB7P 4PJ0E 1KC8Q 2W6JH 1BCCD 3P8MC 2K9YA 3CC2P 2FYNC 1JM0A 1KTMA 1PL5A 5TJHA 1DEEG 3L37A 1NKZB 3L75E 3MD0A 3H1JE 1SQXJ 1FBMA 1S5LH 2XNXA 3AE2C 1RF0A 5CCHC 5CMZA 2I1KA 2FFDA 1NH4A 2H43A 3CCQP 1H0TA 1SQBD 3RBXA 1NTKJ 3H1KG 3H6PA 2KSEA 3CX5H 2JJLA 2AEFA 2KI7B 2C9NY 4H13B 1BCCG 1PPJD 1RH5B 1HVVA 4ZNCA 5KAFH 2WSCH 3IF4A 1FJKA 3HE5B 2BASA 1FOSE 2M3BA 5AVXB 3FXDA 3AE4C 4WY4D 3M9BA 1SQBG 3L75J 3H1JJ 3GW6A 1EDLA 4W7YA 1PPJG 5APQA 1NTMD 5KLVE 5AW0B 2P2UA 1SQBK 2IBZD 4Y28J 1LTGC 2YO3A 4I7ZB 3BRTB 2A06D 1SQVD 2O3JA 4OGQB 1OXZA 2FKWB 1R8EA 1YJ9P 3Q5RA 3KDPB 1HJBA 3V4WA 4C7RA 1SFCB 1YJWP 2IX7C 4GT1A 4XA4A 1NTMG 1EDJA 1BGYE 1NTZD 3WU2E 3C8VA 1QL1A 1X79B 1FOSF 4WY4A 3L73G 1GMJA 2QJPC 3G4SP 1KILD 2A06G 5KLVJ 1VF5C 2ZYGA 1SQVG 1RHZB 1S9KE 1MFTA 3PRJA 1EXIA 1KB9I 3ABVC 3H32B 2W6AA 2HPCA 1L4AD 1P84I 2E76C 1NOHA 1NTZG 2ZVNB 2OYIA 2PP6A 1QGKB 5APTA 5L8RJ 1KYOH 3C9IA 2JWDA 3I56P 1LWUB 1KZUB 3CD6P 1BGYJ 2V7QH 1USEA 1PP9D 1X22A 2NPSB 3CCUP 2KXPB 3CMAP 2E75C 4UB8H 1J1DC 1AJYA 4NPEA 3RK3B 1MZ9A 2WSFJ 4DZOA 5B5EE 3T97B 1KILA 1RF0C 2WSEH 3NTNA 2CK3H 2FFDC 1VQ5P 1CI6A 3B5ND 3CWBD 3IAOA 1H0TB 1KD1Q 3V4QA 3AE5C 2ZYAA 2IFNA 1LTJC 1L4AA 1KV4A 3MTUE 2OTJP 4EOTA 2BCCE 4DT0A 3KHUA 2W90A 1NO4A 3H1HJ 3MZWB 1N7LA 1WRGA 1SQQE 3A5TA 3RK2C 1VL2A 2WPRA 1SQPE 3CWBG 5TISH 3BASA 1NHLA 1NWQA 2J5UA 3F89A 2QEXP 3JC22 3O6QB 2I1JA 2XZRA 3PH0A 1IFMA 2ZT9D 1EZVG 2HODB 1KQFB 3BVHA 5BU8B 1G2CB 1JUNA 3L72J 1URQB 1ZOYC 1FDIA 4IOIH 1LTSC 1OW7A 3BCCD 3B5NA 2BCCJ 2WPSA 2YMYA 3HTKA 3SWYA 1PGJA 3EFFK 1MUUA 1SQQJ 3VYIA 3TGUE 3P8CE 1BSNA 1SQPJ 1IK7A 5GTIH 3MP7B 2KS1B 2QJKC 4WY4C 4H13D 3BCCG 1PGQA 1T3UA 1J2JB 1W2EA 3A7OA 2RMZA 1FZCB 2MJZA 2KYVA 3H1LJ 3CC7P 3SWKA 1IC2A 2WTYA 2Y0DA 4D6TE 3V6IA 3OAKA 1KB9D 1L0ND 4ZKUA 1HGZA 1P84D 2OYIB 3TGUJ 4KHXA 3CX5I 3IFMA 3CCLP 1GTWA 1RE3C 5AVYB 1T2KD 3LIEA 5DJUB 2KK7A 3D6YA 4KT0J 3GMAA 3D71A 4U3FD 5APUA 2E42A 1T3JA 2WPQA 4OGQD 1FC2C 3WUVA 1U7JA 4QMAA 5KAIH 2KOGA 1IFDA 1KILC 1SFCD 4JF7A 3CCSP 4UB6H 3H25A 4WB4A 1M56D 1NKNA 1L0LD 2POHA 2QSIA 4L73A 3HE5A 2YIUB 2C0WA 1L0NK 3ITKA 1HUCA 5CCGD 4PD4H 1L4AC 1OFCX 1K04A 2FYUD 3CLQA 3AECC 4L76A 3H1ID 5KKZC 1LJ2A 2OQQA 4JPZB 3WUUA 2P58A 3Q3DA 4W7ZA 1JO5A 2OYHB 3RL0B 4WBAA 4PV1B 3A2AA 3EFGA 1BSHA 3QWOC 1SP4A 5CBNA 4HB1A 2C0XA 4L74A 1L0LK 3TYYA 5EFWB 2QM7A 2NPSD 2YKOA 1RQVA 3CL3D 2LKMA 2PRRA 3I5CA 3CX5E 3B5NC 3RK3D 4ZKPA 3L70D 2FYUK 3JCUH 2L5GB 1OW6A 5CCGA 1PFIA 1VQPP 2WITA 3HTKB 1KYOI 2Z5IA 4RKUJ 1FZAA 1DH3A 3E1IA 4R4LA 2CPSA 2R32A 3V2RA 5AVTB 5DJTB 2YNYA 2MKVA 1SQXE 2BEZF 3H32A 5C39A 4C46A 4R4MA 2O1KA 3L71G 2YO2A 3L70G 1JCCA 2N9BA 2IFMA 2ZT9C 2JR8A 1PGPA 1LWUA 4YXDC 1FE6A 1A02J 1JY2P 1X9VA 1M90Q 2NPSA 1BE3D 4OVNF 5CJ4A 4EYYQ 1BCCJ 4DOJA 4HJGH 2WSCJ 1HH0A 3NMDA 2Q7CA 4N6JA 1NU1D 3AE1C 3T97A 1X0TA 1URQD 2G3AA 2QRXA 2V4HA 1K05A 1LTIC 4DCKA 3CXHD 2P10A 1USDA 2Y0EA 4KJMA 5AVZB 1EC5A 4IL6X 1R5SA 2M0BA 3KXDA 2NRGA 4GODA 4H13C 1DX7A 1L2PA 3L73E 1JOCA 3M0AA 3HUSB 3PTZA 2M5AA 4N78E 1FZFA 2A45G 1OVRA 1Q81Q 1J1EB 1LGHB 2O01H 4IL6E 1S72P 1QEXA 2A45H 1EZVI 1ZP0C 5M1BA 1NTKD 2P1JA 1M7LA 4LC1A 1FU1A 1KYOE 1JB0J 1NU1K 3CXHH 3O6QA 4U7JA 2OTKE 1QLED 2HODA 2XKMA 1G2CA 1NTMJ 3GHGB 2RH0A 2RKLA 3HRNA 1AFOA 1T2KC 1URQA 3PJSK 4LGDE 4TT3H 1MFZA 4I7ZC 3MUDC
chains in the Genus database with same CATH topology
2HPCB 3U59A 2E43A 4Y99B 1JY3N 1GDTA 2A45I 1JY3O 3V4QA 3KQGA 2H8PD 4HH2A 2IFNA 3HD7B 1LTJC 3M9QA 1L4AA 2JEEA 3MTUE 1SQXK 4I6MC 1YTZI 5APXA 3OJAB 4EOTA 1SFCC 5AVUB 1NO4A 1WT6A 2OARA 1N7LA 1WRGA 2P67A 3OA7A 2Q9IA 1JCDA 2M8RA 1NTKK 1CZQA 3A5TA 5CCHA 3RK2C 1XTGB 2WZ7A 2WPRA 5KTBA 5CCGC 3BASA 1EQ7A 1NHLA 4M3LA 1NWQA 1GL2B 2KLVA 1FZCA 2I1JA 2XZRA 1IFMA 2HODB 2Z5HA 1A02F 3BVHA 2P7JA 1JNMA 5BU8B 1KILB 5BVZA 1G2CB 1JUNA 3V2PA 1H88A 1G1JA 1RE4C 2N1TC 5AW7B 1URQB 1LT9A 1SLQA 1CI6B 2YKQA 3A3YB 5AVQB 2J59M 2O1JA 1LTSC 2W27A 3MGNA 1VPCA 3B5NA 4OH8B 3P32A 4GIFA 2WPSA 2J58A 1IFJA 2GUVA 1L4AB 2YMYA 3HTKA 3SWYA 3VMYA 3HUSC 1N7SC 4IFMA 1MV8A 5APWA 5AVVB 1M1JC 1MUUA 2IPPA 1GK6A 3VTPC 1LTTC 3VYIA 1J1EC 1KFNA 3P8CE 5KJ7D 1N73A 1FZGA 3RL0D 2NPSC 4RESB 1IFNA 1HWTC 4AUWA 4O9BA 2XDJA 3MUDA 4C7NA 3V5BA 2R5DA 4WY4C 3NFQA 3RK3C 1GD2E 3IR9A 5CHXA 1T3UA 1J2JB 3A7OA 1W2EA 1LTJA 4LLHA 1GU4A 3SWFA 1FZCB 1HTLC 2MJZA 2KYVA 4HYTB 1SFCA 2FXMA 1N86A 3GHGC 1IC2A 3VP8A 2WTYA 1OWAA 5AVWB 2ZXEB 1H8AA 1LT9B 3TSIA 2WT7A 3OAKA 4Y99C 5BU5A 3B5NB 4ZKUA 1HGZA 1ZN5A 2R5BA 3HD7C 5AW1B 3TK1A 5KLVK 1S9KD 1JY2N 5AW9B 1JY2O 3VP9A 2OYIB 4KHXA 3V2NA 3IFMA 3EQ2A 3HE4A 5AVRB 3NXSA 1GTWA 1XTCC 1RE3C 5AVYB 3VOPA 1T2KD 3LIEA 3KPEA 1N73B 2QM8A 5KJ7A 5APUA 2E42A 5AW4B 3BRVB 2OYHA 1JTHA 4C7NB 3TNUA 2KSJA 1T3JA 2WPQA 3N7NA 1GL2C 4N78D 1ZV8A 5AW6B 1SVFA 3M0DC 1G1IA 1GW3A 1RF1A 4I2LC 1CSBA 2KOGA 1IFDA 1KILC 1SFCD 3M91A 4JF7A 3VN0A 1H89A 2GM4A 3MIWA 1URQC 4WB4A 4AYCA 2WWWA 1NKNA 2CPBA 2GUSA 1JY3P 1T8ZA 2POHA 3RK2D 3HE5A 2YKPA 2C0WA 1L0NK 3VMXA 2KB7P 3G3ZA 2W6BA 1HUCA 5CCGD 3KYQA 1L4AC 3P8MC 3R2PA 3CLQA 5AW3B 1NTMK 5APYA 1HGVA 5AVSB 1LTBC 3L37A 1JMMA 1NKZB 3HE4B 3MD0A 3VMZA 4EIJA 1FBMA 2XNXA 1LWUC 2N1TD 1RF0A 5AW2B 4GKGA 1RY3A 5CCHC 4I1LA 2I1KA 2PAJA 5CMZA 2FFDA 1NH4A 4W7ZA 1JO5A 4JYCA 2OYHB 3RL0B 4WBAA 1IJDB 1JTHB 2H43A 1SQVK 3TNUB 3A2AA 3H6PA 1FZCC 4IFFA 3EFGA 2JJLA 1N7SD 1SP4A 1RF1B 2C9NY 2C0XA 1HBWA 1HVVA 2XV5A 1L0LK 1RE3A 5AW8B 3TYYA 1LT9C 3WMM0 2QM7A 2WSCH 2NPSD 2Q5UA 1LTAC 1FJKA 1NTZK 2YKOA 4N3YB 3CL3D 2C9LY 2LKMA 5CJ0A 3HE5B 2BASA 1FOSE 2M3BA 5AVXB 3I5CA 3U1CA 3B5NC 4WY4D 3RK3D 4ZKPA 1FZBA 3M9BA 1ZR4A 2FYUK 2L5GB 2OYIC 5CCGA 1J1DB 1ZR2A 1PFIA 2VRSA 2WITA 3N4XA 3V2QA 2H7HA 3HTKB 1YTZT 1QL2A 4W7YA 5APQA 2Z5IA 1N73C 1FZAA 1DH3A 3E1IA 4AQRD 5AW0B 2CPSA 2P2UA 1FAVA 3LIDA 3O8ZA 1RE4A 2N1TA 2R32A 5AVTB 3V2RA 2FFDB 1SQBK 2YNYA 3H32A 3CI9A 1AQ5A 1LTGC 2YO3A 1FZEA 2FYZA 3HD7D 4C46A 2O1KA 1N2DC 3BRTB 1GZLA 2YO2A 1JCCA 3P8CD 1OXZA 2N9BA 1SQQK 2FKWB 1LTJB 3HUSA 2IFMA 1N7SA 4IFDK 3KDPB 1HJBA 3V4WA 1ZLLA 1SQPK 4C7RA 3UIAA 1M1JA 1SFCB 1LWUA 1CW5A 2IX7C 4GT1A 4XA4A 1A02J 1JY2P 1X9VA 3P7KA 2WSFH 4XE5B 2NPSA 2ZFCA 2WT7B 3LW5H 3RK2B 3PP5A 1GL2D 5CJ4A 1QL1A 2KP8A 1X79B 5AW5B 4DOJA 2HYNA 1FOSF 1FJPA 1HH0A 4WY4A 3NMDA 4B86A 1KILD 2HG5D 4N6JA 2Q7CA 3T97A 1S9KE 1GW4A 1URQD 3M9HA 1GK4A 1GU5A 3GHGA 5KJ7C 1LTIC 1FDMA 2N1TB 2OYHC 3RL0C 3II6A 1Z56A 5AVZB 3L35A 3L36A 3H32B 1E5WA 2W6AA 3M06A 2HPCA 1L4AD 1NOHA 1YYCA 1RF1C 2OYIA 1DX7A 3HD7A 1KFMA 1KQLA 2PP6A 5APTA 1JOCA 3C9IA 3M0AA 3HUSB 1N7SB 4N78E 1M1JB 1FZFA 2A45G 4W80A 1LWUB 1KZUB 1X8YA 5CCHD 2R3CA 1J1EB 1IFIA 3B8EB 4JYBA 1LGHB 2O01H 3L4FA 2A45H 2HFED 2NPSB 1NAFA 2P1JA 3BATA 1M7LA 4LC1A 1FU1A 1J1DC 4WY4B 3RK3B 1GL2A 1NU1K 1MZ9A 5APSA 1VDFA 4DZOA 1DEBA 3M0DA 2HODA 2XU6A 1KILA 5APVA 3U1AA 1RF0C 2XKMA 1G2CA 2WSEH 3NTNA 3GHGB 2Q3IA 3HRNA 1AFOA 1T2KC 2FFDC 1URQA 4LGDE 1CI6A 1MFZA 3B5ND 1IO4A 1IK9A 2Z4EA 2HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE4 B;  3MD0 A;  3VMZ A;  1GU4 A;  1A02 J;  3SWF A;  2E43 A;  3P7K A;  4XE5 B;  3V4Q A;  2ZFC A;  3KQG A;  2WT7 B;  5AW2 B;  4HYT B;  4GKG A;  5CMZ A;  2WTY A;  4I6M C;  1OWA A;  5APX A;  5AVW B;  2KP8 A;  5AW5 B;  1FOS F;  4JYC A;  4EOT A;  2ZXE B;  1H8A A;  3NMD A;  4B86 A;  3TNU B;  5AVU B;  2WT7 A;  3A2A A;  2Q7C A;  2P67 A;  3OAK A;  3T97 A;  1S9K E;  2JJL A;  1SP4 A;  3M9H A;  1GK4 A;  2C9N Y;  1GU5 A;  1CZQ A;  3A5T A;  2R5B A;  1HBW A;  1S9K D;  5AW1 B;  3TK1 A;  2XV5 A;  5AW9 B;  2WPR A;  4GT1 A;  4KHX A;  5AW8 B;  3TYY A;  2QM7 A;  5AVZ B;  3L35 A;  3L36 A;  4M3L A;  2Q5U A;  2W6A A;  1NWQ A;  3HE4 A;  3M06 A;  5AVR B;  3NXS A;  1GTW A;  2C9L Y;  5AVY B;  2XZR A;  1T2K D;  3LIE A;  3HE5 B;  2BAS A;  1FOS E;  2Z5H A;  5AVX B;  1YYC A;  3I5C A;  1A02 F;  2P7J A;  1JNM A;  2QM8 A;  1KQL A;  1G2C B;  5APT A;  1JUN A;  5APU A;  2E42 A;  3M9B A;  5AW4 B;  1H88 A;  3M0A A;  5AW7 B;  4C7N B;  3TNU A;  1SLQ A;  1CI6 B;  3A3Y B;  5AVQ B;  2VRS A;  2WPQ A;  2H7H A;  1X8Y A;  2W27 A;  2R3C A;  5AW6 B;  3B8E B;  4JYB A;  3MGN A;  5APQ A;  2Z5I A;  4I2L C;  1CSB A;  3P32 A;  1DH3 A;  1NAF A;  3M91 A;  4AQR D;  5AW0 B;  3VN0 A;  2WPS A;  1H89 A;  2P2U A;  1FAV A;  3LID A;  3O8Z A;  2R32 A;  3HTK A;  4LC1 A;  5AVT B;  3VMY A;  2YNY A;  2WWW A;  4AYC A;  1MV8 A;  5APW A;  5AVV B;  1MUU A;  2IPP A;  2YO3 A;  1GK6 A;  3VTP C;  4C46 A;  3VYI A;  5APS A;  4DZO A;  3HE5 A;  3M0D A;  1GZL A;  3VMX A;  2YO2 A;  2XU6 A;  5APV A;  1HUC A;  1OXZ A;  2N9B A;  4RES B;  3NTN A;  2Q3I A;  1T2K C;  1HWT C;  4AUW A;  3P8M C;  3KDP B;  1HJB A;  3V4W A;  4C7N A;  3V5B A;  1CI6 A;  2R5D A;  3UIA A;  5AW3 B;  3NFQ A;  1GD2 E;  1MFZ A;  5APY A;  3IR9 A;  1IO4 A;  5AVS B;  1J2J B;  3L37 A;  3A7O A; 
#chains in the Genus database with same CATH topology
 3U59 A;  3L73 J;  1JY3 N;  1JY3 O;  1NTK G;  3L75 D;  2E5Y A;  2W83 C;  3KQG A;  2H8P D;  4OGQ C;  3H1J D;  3HD7 B;  4HKZ H;  2K9J A;  1SQX K;  3FWL A;  4NPF X;  3OJA B;  1T6A A;  1SFC C;  3D6Z A;  1YQ3 C;  3RBZ A;  2KNC B;  5AVU B;  1WT6 A;  3R4Y A;  2P67 A;  3OA7 A;  2Q9I A;  2RN0 A;  1NTK K;  1NTZ J;  2KS1 A;  1R5L A;  2JKV A;  5CCG C;  1EDK A;  1EQ7 A;  2IBZ G;  3AE3 C;  1AA0 A;  1GL2 B;  2V7Q J;  3L75 G;  1FZC A;  1ZRT E;  1QVG O;  2P7J A;  5BVZ A;  3CPW O;  2DW3 A;  2O1J A;  5TIS E;  4L75 A;  2K37 A;  2UWJ E;  2WSE J;  2E74 B;  4OH8 B;  3P32 A;  4GIF A;  1EDI A;  1IFJ A;  1VQK P;  5KLV D;  3I55 P;  1Q82 Q;  1EZV E;  3VTP C;  2LR2 A;  1OMI A;  3RL0 D;  2NPS C;  4PV1 D;  3H1H E;  1KMI Z;  2NZ2 A;  4O9B A;  3AE8 C;  3S4R A;  3V5B A;  2R5D A;  1S2E A;  3NFQ A;  3RK3 C;  1GD2 E;  4PD4 I;  2AXT H;  1GU4 A;  3SWF A;  1VQ4 P;  4HYT B;  5KLV G;  2FXM A;  5H2F H;  1YBK A;  1W5C E;  3VP8 A;  2LXB A;  5GTI E;  2IYP A;  1BGY D;  2ZXE B;  4DJG A;  1H8A A;  1LT9 B;  4WWI A;  3CWB J;  3FGA D;  3AEG C;  3L72 E;  1ZN5 A;  1PP9 G;  2R5B A;  4H0L D;  5KLV K;  1S9K D;  2K88 A;  2B9B A;  3VP9 A;  1W2B O;  1YJN P;  1K73 Q;  1NYH A;  5AVR B;  3Q5P A;  1XTC C;  2M5A B;  2B87 B;  1KQG B;  1N73 B;  1WMK A;  2QM8 A;  1BGY G;  1JMB A;  4ASW A;  1AV1 A;  2OYH A;  1S4X A;  4C7N B;  2IDB A;  3E1R A;  1NAY A;  1GW3 A;  2QIW A;  1FDO A;  1URQ C;  2N9Y B;  3H1L E;  3Q1M A;  2YKP A;  3VMX A;  3G3Z A;  3GF3 A;  3WUT A;  1IFP A;  5KAI E;  1OVU A;  2R3S A;  5AW3 B;  4UB6 E;  2K9J B;  5B66 H;  2HR3 A;  1JMM A;  4EIJ A;  3AEE C;  5AW2 B;  4GKG A;  1ZW0 A;  4I1L A;  4PD4 E;  1IJD B;  1JTH B;  3TNU B;  2L91 A;  1Q90 D;  2BCC D;  2Q1K A;  3GF7 A;  3ZDM A;  1FZC C;  1RF1 B;  5K5G B;  1YIT P;  1HBW A;  2ZXX A;  1SQQ D;  3G6E P;  5B5E H;  5AW8 B;  5CBO A;  3WMM 0;  1VQ8 P;  1SQP D;  2Q5U A;  4N3Y B;  5CJ0 A;  3U1C A;  2SPZ A;  1ZR4 A;  2OYI C;  1ZR2 A;  1M57 D;  2H7H A;  3H1L D;  2FY8 A;  1Q7Y Q;  1SQQ G;  1FAV A;  3TDK A;  1RE4 A;  3JCU E;  2FYZ A;  3HD7 D;  1N2D C;  1GZL A;  4GDO A;  3TGU D;  3P8C D;  1SQQ K;  1L0N G;  3HUS A;  4IFD K;  1ZLL A;  2FBW C;  1SQP K;  4RO0 A;  1KB9 H;  1CW5 A;  1JEK A;  2YIU C;  3A0H H;  3P7K A;  1P84 H;  4XE5 B;  2ZFC A;  3LW5 H;  3E7K A;  3CC4 P;  3PP5 A;  4H44 B;  1GL2 D;  4U3F G;  2HG5 D;  2JWA A;  1OX3 A;  3L74 E;  4D6T D;  2YMK A;  1DIP A;  3M9H A;  1GK4 A;  2OYO A;  3GHG A;  3CCJ P;  1S5L X;  2N1T B;  2OYH C;  3RL0 C;  2IYO A;  1Z56 A;  2E74 D;  3L36 A;  1L0L G;  4PV1 C;  1E5W A;  3A0B H;  1BDC A;  1U57 A;  2PFX A;  3HD7 A;  2E5T A;  1KFM A;  1KQL A;  4RJT A;  1S5L E;  1N7S B;  2KNC A;  1M1J B;  4D6T G;  2FYU G;  1X8Y A;  2ZAE B;  2ZYD A;  2R3C A;  4JYB A;  3AEF C;  3H1I G;  1NAF A;  3L71 J;  2D2C B;  3BAT A;  3L70 J;  3L74 J;  3H1K E;  4H0L C;  1YIJ P;  1GL2 A;  1IZN B;  5APS A;  1VDF A;  1DEB A;  3FX0 A;  3PHL A;  5KAF E;  1BCC E;  2XU6 A;  5APV A;  2Q3I A;  2OGU A;  2KZJ A;  1IK9 A;  2HLO A;  4Y99 B;  4HH2 A;  3FXE A;  2JEE A;  1SQB E;  1NJI Q;  3G9R A;  2OAR A;  1PPJ E;  1Q86 Q;  2K3R A;  3AEA C;  5KLI B;  1N8R Q;  1TU3 F;  3H1K J;  2IZ1 A;  4JBZ A;  1S3J A;  1VQM P;  5KTB A;  3S9O A;  3OW2 O;  2KZI A;  4MN4 C;  4M3L A;  2O01 J;  2KLV A;  4A7P A;  1A02 F;  4OWF A;  1YI2 P;  4XFJ A;  2QJY B;  1LP1 B;  3CX5 D;  1H88 A;  1RE4 C;  5AW7 B;  2AXC A;  3FWN A;  1LT9 A;  1SLQ A;  2YKQ A;  3A3Y B;  5AVQ B;  2J59 M;  2W27 A;  1NTM E;  3MGN A;  2ITA A;  1SQB J;  1QVF O;  1BE3 G;  2IBZ E;  3VMY A;  3HUS C;  3KZI H;  4IFM A;  2FYN B;  4K3A A;  2A06 E;  2QE7 H;  2B88 A;  1LTT C;  1J1E C;  1SQV E;  1SQX D;  3Q2Y A;  5KJ7 D;  2B87 A;  1N73 A;  1NU1 G;  1ZXG A;  3CCR P;  2QG4 A;  4RES B;  2ZJS E;  2G8Y A;  1PIX A;  4C7N A;  4GOF A;  4YXW H;  3MHV A;  5CHX A;  1LTJ A;  4LLH A;  1NTZ E;  1HTL C;  3D70 A;  1PZQ A;  4GOE A;  1YQ4 C;  3GHG C;  3JSV C;  1OWA A;  1KIL E;  1Q2N A;  1UII A;  2K1A A;  1SQX G;  1AQT A;  3TSI A;  3AED C;  2WT7 A;  4UB8 E;  2AXT E;  3AE6 C;  3HD7 C;  5AW1 B;  3TK1 A;  1JY2 N;  5AW9 B;  5H2F E;  1JY2 O;  1SQV J;  2YXR B;  5E79 H;  3EQ2 A;  2KUB A;  3KPE A;  1K8A Q;  4ASV A;  5KJ7 A;  1LT1 A;  3AE7 C;  5AW4 B;  1NGM B;  3BRV B;  1JTH A;  3L73 D;  5GTH H;  3TNU A;  2KSJ A;  1YHQ P;  2H88 C;  1GL2 C;  4NPD A;  1PP9 E;  4N78 D;  1ZV8 A;  1RF1 A;  4I2L C;  4PJ0 H;  1CSB A;  3M91 A;  3H1J G;  3MIW A;  1UIX A;  2WWW A;  4AYC A;  2CPB A;  2GUS A;  1KYO D;  4H44 D;  1OW8 A;  2E74 C;  2FXP A;  2W6B A;  1Y8A A;  2I8D A;  3KYQ A;  3R2P A;  3CWB E;  2AEM A;  1NTM K;  2QJP B;  5APY A;  1HGV A;  5AVS B;  1LTB C;  1VF5 B;  3HE4 B;  3CCV P;  2R44 A;  3VMZ A;  3CME P;  1LWU C;  2N1T D;  4BRY B;  3G71 P;  1RY3 A;  2PAJ A;  2WMM A;  2WPV B;  1PP9 J;  4IL6 H;  4JYC A;  4K35 A;  1SQV K;  3B4S A;  3SFD C;  5B66 E;  4IFF A;  4EI2 A;  2E76 B;  1N7S D;  2H89 C;  2GA1 A;  3QH9 A;  2Y9Z A;  1DD3 A;  2XV5 A;  1QX8 A;  1RE3 A;  1MKM A;  1LT9 C;  1LTA C;  1NTZ K;  1BDD A;  2D2C D;  2C9L Y;  3B71 A;  1OZH A;  3GLM A;  1FZB A;  1ZRT D;  2E75 B;  1VQ7 P;  1J1D B;  2JDI H;  1LNQ A;  2VRS A;  3N4X A;  3V2Q A;  3BCC E;  3SSU A;  2Y0C A;  1DD4 A;  1YTZ T;  1QL2 A;  1N73 C;  1Y47 A;  4AQR D;  1VQ6 P;  3O8Z A;  3LID A;  2N1T A;  2FFD B;  3CI9 A;  1AQ5 A;  1FZE A;  3RL0 g;  1EZV D;  2O01 N;  3WU2 H;  3CCM P;  2WQY C;  1LTJ B;  1N7S A;  2BEQ D;  3UIA A;  1M1J A;  3H1H D;  3W68 A;  2YXQ B;  2OTL P;  2WSF H;  2WT7 B;  3RK2 B;  3W67 A;  3GG2 A;  3BCC J;  2KP8 A;  5AW5 B;  1FJP A;  2HYN A;  4B86 A;  1NVO A;  2QA4 P;  1D7M A;  3USS A;  1KB9 E;  4EDF A;  1L0N E;  2Y9Y A;  1RQU A;  3TF5 A;  1GW4 A;  1ZME C;  1VQL P;  3A0H E;  1GU5 A;  3F5H A;  1P84 E;  1S1C X;  5KJ7 C;  3L72 D;  1FDM A;  3H1H G;  3II6 A;  3L35 A;  3M06 A;  1VQ9 P;  4U3F E;  1YYC A;  3AE9 C;  1RF1 C;  1VQO P;  2Q6Q A;  2JO1 A;  4W80 A;  1AVY A;  5CCH D;  1IFI A;  3B8E B;  3A0B E;  3C1L A;  3L4F A;  2HFE D;  3L72 G;  2LXC B;  1L0L E;  3EWK A;  1L0N J;  2QJK B;  3CCE P;  4WY4 B;  3RGU A;  3VMA A;  1U7M A;  2BCC G;  3M0D A;  2QVA A;  3LW5 J;  3U1A A;  1LP1 A;  2FYU E;  1SS1 A;  3H1I E;  4U3F J;  1IO4 A;  2Z4E A;  3Q5S A;  1SQP G;  2HPC B;  2E43 A;  1KOR A;  4WVZ A;  2AEJ A;  1GDT A;  2A45 I;  1KN7 A;  3M9Q A;  2IZ0 A;  4I6M C;  1YTZ I;  5APX A;  4PD4 D;  2XND H;  3CXH I;  3H1L G;  1JCD A;  1L0L J;  2M8R A;  1CZQ A;  4YTP C;  5CCH A;  2WVR A;  4H44 C;  1XTG B;  2PGD A;  2WZ7 A;  2FXO A;  3L71 E;  3RK3 E;  2FYU J;  4D6T J;  3L70 E;  2Z5H A;  1M8O B;  1JNM A;  1KIL B;  4BWN A;  3TGU G;  4JQ0 D;  3H1I J;  4YPC A;  3V2P A;  1G1J A;  2N1T C;  1Y9B A;  1CI6 B;  2KIK A;  1VPC A;  4Z1M H;  2M3E A;  2J58 A;  2GUV A;  4CPG A;  1L4A B;  1VF5 D;  1N7S C;  1MV8 A;  5APW A;  5AVV B;  1M1J C;  2IPP A;  1GK6 A;  1KFN A;  5KKZ B;  2IBZ I;  1FZG A;  3S1K A;  1HF9 A;  2D2C C;  1IFN A;  3K5B A;  1HWT C;  4AUW A;  2XDJ A;  3MUD A;  2E76 D;  3KZI E;  3IR9 A;  1BE3 E;  2Q3E A;  1OIP A;  2WSS H;  1SFC A;  1N86 A;  1EXJ A;  5AVW B;  1PGO A;  2KLU A;  1NU1 E;  4TLF A;  3L71 D;  1AVO A;  4Y99 C;  3IN6 A;  1M1K Q;  2E75 D;  5BU5 A;  3L74 D;  1KQS O;  3AEB C;  3B5N B;  3CXH E;  4H0L B;  1K9M Q;  1E79 H;  1FS0 E;  3V2N A;  3HE4 A;  1PV3 A;  3NXS A;  3VOP A;  4BRY A;  5KLI C;  4ZMD A;  1OVV A;  1BE3 J;  3N7N A;  5E79 E;  5AW6 B;  1HJ0 A;  3L74 G;  1SVF A;  3M0D C;  4BXL A;  1G1I A;  1NTK E;  1VQN P;  2W8Z A;  3VN0 A;  2B89 A;  2JP3 A;  2QJY C;  1NU1 J;  1H89 A;  2GM4 A;  3PLN A;  2ZT9 B;  1JY3 P;  2ZVO B;  1T8Z A;  5GTH E;  3RK2 D;  3H1K D;  3SFE C;  2KB7 P;  4PJ0 E;  1KC8 Q;  2W6J H;  1BCC D;  3P8M C;  2K9Y A;  3CC2 P;  2FYN C;  1JM0 A;  1KTM A;  1PL5 A;  5TJH A;  1DEE G;  3L37 A;  1NKZ B;  3L75 E;  3MD0 A;  3H1J E;  1SQX J;  1FBM A;  1S5L H;  2XNX A;  3AE2 C;  1RF0 A;  5CCH C;  5CMZ A;  2I1K A;  2FFD A;  1NH4 A;  2H43 A;  3CCQ P;  1H0T A;  1SQB D;  3RBX A;  1NTK J;  3H1K G;  3H6P A;  2KSE A;  3CX5 H;  2JJL A;  2AEF A;  2KI7 B;  2C9N Y;  4H13 B;  1BCC G;  1PPJ D;  1RH5 B;  1HVV A;  4ZNC A;  5KAF H;  2WSC H;  3IF4 A;  1FJK A;  3HE5 B;  2BAS A;  1FOS E;  2M3B A;  5AVX B;  3FXD A;  3AE4 C;  4WY4 D;  3M9B A;  1SQB G;  3L75 J;  3H1J J;  3GW6 A;  1EDL A;  4W7Y A;  1PPJ G;  5APQ A;  1NTM D;  5KLV E;  5AW0 B;  2P2U A;  1SQB K;  2IBZ D;  4Y28 J;  1LTG C;  2YO3 A;  4I7Z B;  3BRT B;  2A06 D;  1SQV D;  2O3J A;  4OGQ B;  1OXZ A;  2FKW B;  1R8E A;  1YJ9 P;  3Q5R A;  3KDP B;  1HJB A;  3V4W A;  4C7R A;  1SFC B;  1YJW P;  2IX7 C;  4GT1 A;  4XA4 A;  1NTM G;  1EDJ A;  1BGY E;  1NTZ D;  3WU2 E;  3C8V A;  1QL1 A;  1X79 B;  1FOS F;  4WY4 A;  3L73 G;  1GMJ A;  2QJP C;  3G4S P;  1KIL D;  2A06 G;  5KLV J;  1VF5 C;  2ZYG A;  1SQV G;  1RHZ B;  1S9K E;  1MFT A;  3PRJ A;  1EXI A;  1KB9 I;  3ABV C;  3H32 B;  2W6A A;  2HPC A;  1L4A D;  1P84 I;  2E76 C;  1NOH A;  1NTZ G;  2ZVN B;  2OYI A;  2PP6 A;  1QGK B;  5APT A;  5L8R J;  1KYO H;  3C9I A;  2JWD A;  3I56 P;  1LWU B;  1KZU B;  3CD6 P;  1BGY J;  2V7Q H;  1USE A;  1PP9 D;  1X22 A;  2NPS B;  3CCU P;  2KXP B;  3CMA P;  2E75 C;  4UB8 H;  1J1D C;  1AJY A;  4NPE A;  3RK3 B;  1MZ9 A;  2WSF J;  4DZO A;  5B5E E;  3T97 B;  1KIL A;  1RF0 C;  2WSE H;  3NTN A;  2CK3 H;  2FFD C;  1VQ5 P;  1CI6 A;  3B5N D;  3CWB D;  3IAO A;  1H0T B;  1KD1 Q;  3V4Q A;  3AE5 C;  2ZYA A;  2IFN A;  1LTJ C;  1L4A A;  1KV4 A;  3MTU E;  2OTJ P;  4EOT A;  2BCC E;  4DT0 A;  3KHU A;  2W90 A;  1NO4 A;  3H1H J;  3MZW B;  1N7L A;  1WRG A;  1SQQ E;  3A5T A;  3RK2 C;  1VL2 A;  2WPR A;  1SQP E;  3CWB G;  5TIS H;  3BAS A;  1NHL A;  1NWQ A;  2J5U A;  3F89 A;  2QEX P;  3JC2 2;  3O6Q B;  2I1J A;  2XZR A;  3PH0 A;  1IFM A;  2ZT9 D;  1EZV G;  2HOD B;  1KQF B;  3BVH A;  5BU8 B;  1G2C B;  1JUN A;  3L72 J;  1URQ B;  1ZOY C;  1FDI A;  4IOI H;  1LTS C;  1OW7 A;  3BCC D;  3B5N A;  2BCC J;  2WPS A;  2YMY A;  3HTK A;  3SWY A;  1PGJ A;  3EFF K;  1MUU A;  1SQQ J;  3VYI A;  3TGU E;  3P8C E;  1BSN A;  1SQP J;  1IK7 A;  5GTI H;  3MP7 B;  2KS1 B;  2QJK C;  4WY4 C;  4H13 D;  3BCC G;  1PGQ A;  1T3U A;  1J2J B;  1W2E A;  3A7O A;  2RMZ A;  1FZC B;  2MJZ A;  2KYV A;  3H1L J;  3CC7 P;  3SWK A;  1IC2 A;  2WTY A;  2Y0D A;  4D6T E;  3V6I A;  3OAK A;  1KB9 D;  1L0N D;  4ZKU A;  1HGZ A;  1P84 D;  2OYI B;  3TGU J;  4KHX A;  3CX5 I;  3IFM A;  3CCL P;  1GTW A;  1RE3 C;  5AVY B;  1T2K D;  3LIE A;  5DJU B;  2KK7 A;  3D6Y A;  4KT0 J;  3GMA A;  3D71 A;  4U3F D;  5APU A;  2E42 A;  1T3J A;  2WPQ A;  4OGQ D;  1FC2 C;  3WUV A;  1U7J A;  4QMA A;  5KAI H;  2KOG A;  1IFD A;  1KIL C;  1SFC D;  4JF7 A;  3CCS P;  4UB6 H;  3H25 A;  4WB4 A;  1M56 D;  1NKN A;  1L0L D;  2POH A;  2QSI A;  4L73 A;  3HE5 A;  2YIU B;  2C0W A;  1L0N K;  3ITK A;  1HUC A;  5CCG D;  4PD4 H;  1L4A C;  1OFC X;  1K04 A;  2FYU D;  3CLQ A;  3AEC C;  4L76 A;  3H1I D;  5KKZ C;  1LJ2 A;  2OQQ A;  4JPZ B;  3WUU A;  2P58 A;  3Q3D A;  4W7Z A;  1JO5 A;  2OYH B;  3RL0 B;  4WBA A;  4PV1 B;  3A2A A;  3EFG A;  1BSH A;  3QWO C;  1SP4 A;  5CBN A;  4HB1 A;  2C0X A;  4L74 A;  1L0L K;  3TYY A;  5EFW B;  2QM7 A;  2NPS D;  2YKO A;  1RQV A;  3CL3 D;  2LKM A;  2PRR A;  3I5C A;  3CX5 E;  3B5N C;  3RK3 D;  4ZKP A;  3L70 D;  2FYU K;  3JCU H;  2L5G B;  1OW6 A;  5CCG A;  1PFI A;  1VQP P;  2WIT A;  3HTK B;  1KYO I;  2Z5I A;  4RKU J;  1FZA A;  1DH3 A;  3E1I A;  4R4L A;  2CPS A;  2R32 A;  3V2R A;  5AVT B;  5DJT B;  2YNY A;  2MKV A;  1SQX E;  2BEZ F;  3H32 A;  5C39 A;  4C46 A;  4R4M A;  2O1K A;  3L71 G;  2YO2 A;  3L70 G;  1JCC A;  2N9B A;  2IFM A;  2ZT9 C;  2JR8 A;  1PGP A;  1LWU A;  4YXD C;  1FE6 A;  1A02 J;  1JY2 P;  1X9V A;  1M90 Q;  2NPS A;  1BE3 D;  4OVN F;  5CJ4 A;  4EYY Q;  1BCC J;  4DOJ A;  4HJG H;  2WSC J;  1HH0 A;  3NMD A;  2Q7C A;  4N6J A;  1NU1 D;  3AE1 C;  3T97 A;  1X0T A;  1URQ D;  2G3A A;  2QRX A;  2V4H A;  1K05 A;  1LTI C;  4DCK A;  3CXH D;  2P10 A;  1USD A;  2Y0E A;  4KJM A;  5AVZ B;  1EC5 A;  4IL6 X;  1R5S A;  2M0B A;  3KXD A;  2NRG A;  4GOD A;  4H13 C;  1DX7 A;  1L2P A;  3L73 E;  1JOC A;  3M0A A;  3HUS B;  3PTZ A;  2M5A A;  4N78 E;  1FZF A;  2A45 G;  1OVR A;  1Q81 Q;  1J1E B;  1LGH B;  2O01 H;  4IL6 E;  1S72 P;  1QEX A;  2A45 H;  1EZV I;  1ZP0 C;  5M1B A;  1NTK D;  2P1J A;  1M7L A;  4LC1 A;  1FU1 A;  1KYO E;  1JB0 J;  1NU1 K;  3CXH H;  3O6Q A;  4U7J A;  2OTK E;  1QLE D;  2HOD A;  2XKM A;  1G2C A;  1NTM J;  3GHG B;  2RH0 A;  2RKL A;  3HRN A;  1AFO A;  1T2K C;  1URQ A;  3PJS K;  4LGD E;  4TT3 H;  1MFZ A;  4I7Z C;  3MUD C; 
#chains in the Genus database with same CATH homology
 2HPC B;  3U59 A;  2E43 A;  4Y99 B;  1JY3 N;  1GDT A;  2A45 I;  1JY3 O;  3V4Q A;  3KQG A;  2H8P D;  4HH2 A;  2IFN A;  3HD7 B;  1LTJ C;  3M9Q A;  1L4A A;  2JEE A;  3MTU E;  1SQX K;  4I6M C;  1YTZ I;  5APX A;  3OJA B;  4EOT A;  1SFC C;  5AVU B;  1NO4 A;  1WT6 A;  2OAR A;  1N7L A;  1WRG A;  2P67 A;  3OA7 A;  2Q9I A;  1JCD A;  2M8R A;  1NTK K;  1CZQ A;  3A5T A;  5CCH A;  3RK2 C;  1XTG B;  2WZ7 A;  2WPR A;  5KTB A;  5CCG C;  3BAS A;  1EQ7 A;  1NHL A;  4M3L A;  1NWQ A;  1GL2 B;  2KLV A;  1FZC A;  2I1J A;  2XZR A;  1IFM A;  2HOD B;  2Z5H A;  1A02 F;  3BVH A;  2P7J A;  1JNM A;  5BU8 B;  1KIL B;  5BVZ A;  1G2C B;  1JUN A;  3V2P A;  1H88 A;  1G1J A;  1RE4 C;  2N1T C;  5AW7 B;  1URQ B;  1LT9 A;  1SLQ A;  1CI6 B;  2YKQ A;  3A3Y B;  5AVQ B;  2J59 M;  2O1J A;  1LTS C;  2W27 A;  3MGN A;  1VPC A;  3B5N A;  4OH8 B;  3P32 A;  4GIF A;  2WPS A;  2J58 A;  1IFJ A;  2GUV A;  1L4A B;  2YMY A;  3HTK A;  3SWY A;  3VMY A;  3HUS C;  1N7S C;  4IFM A;  1MV8 A;  5APW A;  5AVV B;  1M1J C;  1MUU A;  2IPP A;  1GK6 A;  3VTP C;  1LTT C;  3VYI A;  1J1E C;  1KFN A;  3P8C E;  5KJ7 D;  1N73 A;  1FZG A;  3RL0 D;  2NPS C;  4RES B;  1IFN A;  1HWT C;  4AUW A;  4O9B A;  2XDJ A;  3MUD A;  4C7N A;  3V5B A;  2R5D A;  4WY4 C;  3NFQ A;  3RK3 C;  1GD2 E;  3IR9 A;  5CHX A;  1T3U A;  1J2J B;  3A7O A;  1W2E A;  1LTJ A;  4LLH A;  1GU4 A;  3SWF A;  1FZC B;  1HTL C;  2MJZ A;  2KYV A;  4HYT B;  1SFC A;  2FXM A;  1N86 A;  3GHG C;  1IC2 A;  3VP8 A;  2WTY A;  1OWA A;  5AVW B;  2ZXE B;  1H8A A;  1LT9 B;  3TSI A;  2WT7 A;  3OAK A;  4Y99 C;  5BU5 A;  3B5N B;  4ZKU A;  1HGZ A;  1ZN5 A;  2R5B A;  3HD7 C;  5AW1 B;  3TK1 A;  5KLV K;  1S9K D;  1JY2 N;  5AW9 B;  1JY2 O;  3VP9 A;  2OYI B;  4KHX A;  3V2N A;  3IFM A;  3EQ2 A;  3HE4 A;  5AVR B;  3NXS A;  1GTW A;  1XTC C;  1RE3 C;  5AVY B;  3VOP A;  1T2K D;  3LIE A;  3KPE A;  1N73 B;  2QM8 A;  5KJ7 A;  5APU A;  2E42 A;  5AW4 B;  3BRV B;  2OYH A;  1JTH A;  4C7N B;  3TNU A;  2KSJ A;  1T3J A;  2WPQ A;  3N7N A;  1GL2 C;  4N78 D;  1ZV8 A;  5AW6 B;  1SVF A;  3M0D C;  1G1I A;  1GW3 A;  1RF1 A;  4I2L C;  1CSB A;  2KOG A;  1IFD A;  1KIL C;  1SFC D;  3M91 A;  4JF7 A;  3VN0 A;  1H89 A;  2GM4 A;  3MIW A;  1URQ C;  4WB4 A;  4AYC A;  2WWW A;  1NKN A;  2CPB A;  2GUS A;  1JY3 P;  1T8Z A;  2POH A;  3RK2 D;  3HE5 A;  2YKP A;  2C0W A;  1L0N K;  3VMX A;  2KB7 P;  3G3Z A;  2W6B A;  1HUC A;  5CCG D;  3KYQ A;  1L4A C;  3P8M C;  3R2P A;  3CLQ A;  5AW3 B;  1NTM K;  5APY A;  1HGV A;  5AVS B;  1LTB C;  3L37 A;  1JMM A;  1NKZ B;  3HE4 B;  3MD0 A;  3VMZ A;  4EIJ A;  1FBM A;  2XNX A;  1LWU C;  2N1T D;  1RF0 A;  5AW2 B;  4GKG A;  1RY3 A;  5CCH C;  4I1L A;  2I1K A;  2PAJ A;  5CMZ A;  2FFD A;  1NH4 A;  4W7Z A;  1JO5 A;  4JYC A;  2OYH B;  3RL0 B;  4WBA A;  1IJD B;  1JTH B;  2H43 A;  1SQV K;  3TNU B;  3A2A A;  3H6P A;  1FZC C;  4IFF A;  3EFG A;  2JJL A;  1N7S D;  1SP4 A;  1RF1 B;  2C9N Y;  2C0X A;  1HBW A;  1HVV A;  2XV5 A;  1L0L K;  1RE3 A;  5AW8 B;  3TYY A;  1LT9 C;  3WMM 0;  2QM7 A;  2WSC H;  2NPS D;  2Q5U A;  1LTA C;  1FJK A;  1NTZ K;  2YKO A;  4N3Y B;  3CL3 D;  2C9L Y;  2LKM A;  5CJ0 A;  3HE5 B;  2BAS A;  1FOS E;  2M3B A;  5AVX B;  3I5C A;  3U1C A;  3B5N C;  4WY4 D;  3RK3 D;  4ZKP A;  1FZB A;  3M9B A;  1ZR4 A;  2FYU K;  2L5G B;  2OYI C;  5CCG A;  1J1D B;  1ZR2 A;  1PFI A;  2VRS A;  2WIT A;  3N4X A;  3V2Q A;  2H7H A;  3HTK B;  1YTZ T;  1QL2 A;  4W7Y A;  5APQ A;  2Z5I A;  1N73 C;  1FZA A;  1DH3 A;  3E1I A;  4AQR D;  5AW0 B;  2CPS A;  2P2U A;  1FAV A;  3LID A;  3O8Z A;  1RE4 A;  2N1T A;  2R32 A;  5AVT B;  3V2R A;  2FFD B;  1SQB K;  2YNY A;  3H32 A;  3CI9 A;  1AQ5 A;  1LTG C;  2YO3 A;  1FZE A;  2FYZ A;  3HD7 D;  4C46 A;  2O1K A;  1N2D C;  3BRT B;  1GZL A;  2YO2 A;  1JCC A;  3P8C D;  1OXZ A;  2N9B A;  1SQQ K;  2FKW B;  1LTJ B;  3HUS A;  2IFM A;  1N7S A;  4IFD K;  3KDP B;  1HJB A;  3V4W A;  1ZLL A;  1SQP K;  4C7R A;  3UIA A;  1M1J A;  1SFC B;  1LWU A;  1CW5 A;  2IX7 C;  4GT1 A;  4XA4 A;  1A02 J;  1JY2 P;  1X9V A;  3P7K A;  2WSF H;  4XE5 B;  2NPS A;  2ZFC A;  2WT7 B;  3LW5 H;  3RK2 B;  3PP5 A;  1GL2 D;  5CJ4 A;  1QL1 A;  2KP8 A;  1X79 B;  5AW5 B;  4DOJ A;  2HYN A;  1FOS F;  1FJP A;  1HH0 A;  4WY4 A;  3NMD A;  4B86 A;  1KIL D;  2HG5 D;  4N6J A;  2Q7C A;  3T97 A;  1S9K E;  1GW4 A;  1URQ D;  3M9H A;  1GK4 A;  1GU5 A;  3GHG A;  5KJ7 C;  1LTI C;  1FDM A;  2N1T B;  2OYH C;  3RL0 C;  3II6 A;  1Z56 A;  5AVZ B;  3L35 A;  3L36 A;  3H32 B;  1E5W A;  2W6A A;  3M06 A;  2HPC A;  1L4A D;  1NOH A;  1YYC A;  1RF1 C;  2OYI A;  1DX7 A;  3HD7 A;  1KFM A;  1KQL A;  2PP6 A;  5APT A;  1JOC A;  3C9I A;  3M0A A;  3HUS B;  1N7S B;  4N78 E;  1M1J B;  1FZF A;  2A45 G;  4W80 A;  1LWU B;  1KZU B;  1X8Y A;  5CCH D;  2R3C A;  1J1E B;  1IFI A;  3B8E B;  4JYB A;  1LGH B;  2O01 H;  3L4F A;  2A45 H;  2HFE D;  2NPS B;  1NAF A;  2P1J A;  3BAT A;  1M7L A;  4LC1 A;  1FU1 A;  1J1D C;  4WY4 B;  3RK3 B;  1GL2 A;  1NU1 K;  1MZ9 A;  5APS A;  1VDF A;  4DZO A;  1DEB A;  3M0D A;  2HOD A;  2XU6 A;  1KIL A;  5APV A;  3U1A A;  1RF0 C;  2XKM A;  1G2C A;  2WSE H;  3NTN A;  3GHG B;  2Q3I A;  3HRN A;  1AFO A;  1T2K C;  2FFD C;  1URQ A;  4LGD E;  1CI6 A;  1MFZ A;  3B5N D;  1IO4 A;  1IK9 A;  2Z4E A;  2HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...