5APXA

Sequence matkddian inserted between gcn4 adaptors - structure t9(6)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
60
structure length
60
Chain Sequence
b'VEELLSKVYHLENEVARLKKLMATKDDIANMKQLEDKVEELLSKVYHLENEVARLKKLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 25
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apxA00
2WT7A 3SWFA 2JJLA 1MFZA 2WPSA 5AW9B 1SP4A 4AQRD 1H89A 2XZRA 1CZQA 1A02F 1A02J 2VRSA 2E42A 1HBWA 2Z5IA 3M0DA 3HE5A 1J2JB 2N9BA 5APUA 3M06A 1GK6A 2QM8A 1KQLA 5AVVB 2WTYA 5APYA 1GTWA 3LIDA 1SLQA 2Z5HA 3LIEA 2P67A 2R3CA 1GD2E 3HE4B 2W27A 5AVUB 1NAFA 2BASA 4GKGA 5APVA 4I6MC 1GU4A 3VMYA 5AVQB 2XV5A 4C46A 3TYYA 2IPPA 1YYCA 2H7HA 5AW4B 2C9LY 1CSBA 3O8ZA 5AVSB 5APWA 2W6AA 3NFQA 2YNYA 1DH3A 3VMXA 1FOSF 2WWWA 2C9NY 3M0AA 5AVRB 2YO2A 1S9KE 1FAVA 3VMZA 2WPQA 5AVWB 3HE4A 3TK1A 3L37A 1FOSE 2YO3A 3A3YB 3UIAA 3V4WA 3MGNA 3OAKA 1JNMA 3L36A 2QM7A 5AW3B 1H88A 4XE5B 4LC1A 1CI6B 2KP8A 2WPRA 1GK4A 2ZXEB 3NMDA 1HJBA 1S9KD 1X8YA 2P7JA 3V4QA 3VN0A 1JUNA 3HTKA 3KDPB 1T2KD 3NXSA 2ZFCA 5AVTB 3A7OA 4RESB 2Q7CA 1H8AA 3VTPC 4KHXA 3VYIA 3A2AA 1T2KC 1GZLA 3TNUB 2R5DA 5AW7B 3L35A 3M9BA 3T97A 5APXA 1CI6A 3B8EB 1HWTC 1G2CB 1OWAA 1OXZA 4B86A 2E43A 2P2UA 4HYTB 1GU5A 3P7KA 4C7NB 3KQGA 1IO4A 5AVZB 4AYCA 2WT7B 4JYBA 5APTA 3MD0A 3P8MC 1NWQA 5APSA 3M91A 2Q3IA 5AW5B 2R5BA 3HE5B 3P32A 3NTNA 4JYCA 4M3LA 2R32A 5AW0B 5CMZA 5AW1B 3TNUA 5AVXB 3IR9A 3A5TA 4EOTA 4DZOA 1MUUA 5AW6B 4GT1A 5APQA 5AW8B 1MV8A 3V5BA 2XU6A 5AW2B 3I5CA 2Q5UA 4AUWA 4C7NA 1HUCA 4I2LC 5AVYB 3M9HA
chains in the Genus database with same CATH superfamily
2HODA 2YMYA 2AEFA 1SQBK 3E7KA 1NTME 2VRSA 3FX0A 2E42A 2Z5IA 3RK3D 1L0LD 5E79E 2YXRB 3LIDA 5CCHC 1IFMA 3RK2D 3B5NB 2K1AA 1N7LA 4WY4D 2QSIA 1RF1A 1BGYJ 3GMAA 5AVRB 1L4AC 2C0WA 4OGQD 3TK1A 4L76A 1BCCG 1OVUA 2IDBA 2E76D 5KLVD 3BASA 1EDIA 4IL6E 2BCCG 1IFNA 3GF7A 1JCCA 3A7OA 4RESB 3K5BA 1ZN5A 1BCCE 4N78E 2J5UA 3SFDC 5CCHA 2BCCE 1RQUA 2WT7B 2JR8A 1SQBG 3MD0A 2IFNA 3PHLA 4BRYA 1G1JA 5AW0B 3L73D 3CC7P 3AEGC 1DD3A 2FXMA 1MUUA 3H1KG 1VQNP 1LTJC 2KK7A 1L4AA 3WUUA 1YI2P 4R4LA 1SQBE 2JJLA 2J58A 1JY2O 1A02J 1SQVJ 2HPCA 5APUA 5B5EE 2XKMA 2WTYA 2FFDC 2WSSH 3H1HG 1URQC 2OYOA 1PGOA 3Q1MA 1NTMD 2NRGA 1IFDA 1KILD 3GW6A 3AE1C 1FBMA 3EFGA 1DX7A 1MFTA 2QIWA 2QJPB 3CWBG 2YO2A 1S9KE 3H1HE 1VQ6P 1PGJA 3H1JJ 1N2DC 2WVRA 3T97B 1PP9G 2OGUA 2O1KA 1GK4A 5CHXA 1JY2N 2HR3A 1X8YA 5M1BA 3H32B 1XTCC 3CWBE 2E75C 1LTJA 3MHVA 1EDJA 2Q7CA 3E1IA 3O6QB 2H89C 2FFDA 4TLFA 1VQ4P 1DIPA 2FYNB 1L2PA 2IBZG 5KKZC 1URQA 3ZDMA 1BCCD 1K73Q 4N78D 1L0LJ 5H2FH 5GTHH 1M8OB 1LTAC 2KIKA 2BCCD 2KS1B 1OW7A 2Q5UA 1VF5C 4HB1A 1E79H 3RL0B 2IBZE 1NTKJ 3CCSP 1P84E 4PV1B 1HBWA 2B89A 2CPSA 3L74G 1GL2B 2JWDA 4O9BA 4QMAA 3CCQP 2GM4A 3LIEA 1K8AQ 2I8DA 2R3SA 1SQBD 4H13D 1RE3C 1VQ9P 5CJ4A 1GU4A 2N1TC 4GOFA 4RKUJ 2QJYC 3HD7B 2IPPA 3L74E 1NH4A 4LLHA 1MKMA 1JMBA 3H1KD 1LTSC 1S5LH 1LJ2A 1DEEG 2M5AA 1J1DC 4GDOA 2JWAA 4HKZH 2KYVA 1JY2P 2M3EA 1SQXE 3BCCJ 4I7ZC 1JTHA 5DJTB 4R4MA 1S9KD 1N8RQ 3H1HD 1JM0A 4IL6H 3USSA 1GDTA 1L4AD 1UIIA 5CCGC 1N73B 1JB0J 5KJ7C 3WU2E 4U3FE 3L73J 5APXA 4PJ0E 1OWAA 4LGDE 4B86A 3CWBD 2Z4EA 5KAIE 2H43A 2A45G 1RE3A 2N1TA 3HE5B 3P32A 1PP9D 3VP8A 4DZOA 2ZJSE 4UB6E 2XU6A 1QGKB 2PRRA 1YJNP 3FGAD 1EQ7A 1LNQA 1ZR4A 5TISE 2WPVB 3PLNA 5L8RJ 1NJIQ 2K9JB 5B5EH 2IBZD 2W27A 1NAFA 3GHGB 4Y99C 2QVAA 1OVRA 5APVA 1NKNA 1P84D 5CCGA 5EFWB 1LWUC 5KJ7A 3VMAA 2Q6QA 3CXHE 4CPGA 4WY4C 1SFCA 2Y0DA 3CCLP 1DH3A 5CBOA 2R44A 4JBZA 4ASVA 1URQD 3CCVP 4OGQC 1QX8A 3L74D 5AW3B 2SPZA 3B71A 1TU3F 2E76C 2M3BA 1FE6A 1J1EC 1KFNA 2D2CC 1IFPA 3Q3DA 1BCCJ 1SQXD 2OYIB 1JOCA 1ZLLA 1ZV8A 4NPEA 2BCCJ 2P2UA 4ASWA 4GODA 2E75D 4XFJA 1R8EA 1ZW0A 1LWUA 2YIUB 3CMAP 2G3AA 2KZIA 2WSCJ 1QL1A 3TNUA 1KMIZ 4N3YB 4WY4A 3RGUA 4BWNA 1FZCC 1SQBJ 1BDDA 2FYUJ 5AW9B 4H44B 3E1RA 3TGUG 2OYHB 1P84H 4YXDC 3IN6A 2QM8A 3L70G 3HE4B 2BASA 2QJKC 2Y0CA 2ZT9C 3RK3B 3GG2A 3TGUE 1KILC 3SWKA 3H1HJ 2RMZA 2WWWA 3L70E 3RK2B 4D6TJ 4H0LC 2KNCB 3CXHD 2RKLA 4XE5B 1CI6B 3CWBJ 4EIJA 3VN0A 2CPBA 1FZCA 5KLVE 1G1IA 3CX5E 3H1LJ 1GW3A 3AE8C 3CC2P 1SQPJ 2JKVA 1IK9A 5B66H 4KT0J 5CBNA 1G2CB 1HGVA 1OXZA 4PJ0H 3P7KA 1FC2C 5KAIH 3I55P 5CCGD 1YQ3C 5KJ7D 1FJPA 1EXIA 4TT3H 1KILA 1NOHA 3V6IA 3CMEP 1FZBA 1OX3A 1Z56A 2Y0EA 4UB6H 1RY3A 1X79B 1JCDA 5GTIH 1VDFA 2A45H 3F5HA 2ITAA 2N9BA 5TISH 3KXDA 5AVVB 4A7PA 1L0NK 1SQQK 1UIXA 3QH9A 4GKGA 1KQFB 1N7SD 3IF4A 4W7ZA 4C46A 3HUSB 1HJ0A 2CK3H 1P84I 1Y8AA 3H1IJ 3CXHH 1FZGA 1KORA 1KILE 3KPEA 3II6A 3TDKA 3SSUA 4W80A 3M0DC 1SQXJ 3TGUD 2KXPB 3S9OA 1KQGB 2MJZA 1Q90D 2WSEH 3L70D 2KI7B 1USEA 3W67A 1S5LE 1M57D 1BE3J 4L73A 4YXWH 4U3FJ 2K9YA 3AE2C 2W90A 4DJGA 1OVVA 5BU5A 1GU5A 1LP1A 4C7NB 2M0BA 1VQLP 2HODB 3CX5D 5CJ0A 2D2CD 1YIJP 4HJGH 2Q3IA 2R5BA 1NTZK 3MUDC 3JCUH 1L0NG 1SQQG 1QL2A 1MV8A 4XA4A 4AUWA 1PZQA 2V4HA 2AEJA 1GW4A 1NU1K 1DEBA 3M0DA 1RF1B 1J2JB 1PIXA 4Y28J 5TJHA 1AJYA 1SQQE 5KLIB 1EZVG 2A45I 1EC5A 4RO0A 1KV4A 2P58A 4H13B 3L75G 1EZVE 1FAVA 1T8ZA 4PD4E 2KSJA 1GL2C 2WSEJ 3H1KE 3KZIE 2QM7A 2ZT9D 3AECC 2KP8A 1LT9C 3V4QA 3L75E 3HTKA 4H0LD 3HD7C 3RBXA 3NXSA 4BRYB 5KAFE 1NTZG 1PPJG 1H8AA 3CX5H 3Q5SA 1U7JA 3CCJP 3FXDA 1Q81Q 2JO1A 4EYYQ 2QA4P 2E74C 1IC2A 1L4AB 1Q2NA 1NU1G 2ZAEB 1D7MA 1FU1A 2FXOA 1PPJE 3JSVC 3NTNA 2HPCB 2Q1KA 3S1KA 2G8YA 2WITA 5AW8B 1PP9E 3OJAB 3BRTB 2LKMA 3M9HA 1VQOP 2I1JA 1NU1E 1R5LA 1GMJA 1FZFA 1YTZT 1GK6A 1CW5A 1W2BO 2ZYAA 1LT9A 4YTPC 2WZ7A 3Q5PA 4DCKA 1S3JA 2IZ0A 4ZKUA 1M90Q 1ZXGA 2OTLP 2ZYGA 1L0ND 1SQQD 2BEZF 1LTGC 4IFDK 1LTJB 3L37A 3UIAA 2W83C 3OAKA 4DT0A 2Q3EA 2YKQA 3R2PA 1H88A 1JY3O 1YJWP 2C0XA 1YHQP 1QEXA 3NMDA 2FFDB 1HJBA 3LW5H 1EZVD 4PD4D 5KLVJ 1KD1Q 1LTIC 1URQB 4RJTA 4JQ0D 2O1JA 1T2KD 3VTPC 2L91A 4IFFA 1JMMA 3M9BA 2GUVA 4MN4C 2H88C 1XTGB 3L75D 3CCRP 1IK7A 2A06G 5BVZA 1Q7YQ 2O01H 5AW1B 1M7LA 1BGYG 1SQVK 5B66E 2KB7P 5AVYB 1JY3N 2M8RA 2NPSC 3SWFA 1PPJD 2A06E 2O3JA 1VQMP 2WPSA 3BATA 4NPFX 1BGYE 2M5AB 1EDKA 1NU1D 5KKZB 5GTIE 4OH8B 1N7SC 1NTMJ 1JTHB 1LTTC 5AVSB 2KOGA 1W5CE 1VF5B 2YO3A 2OYHC 4PD4H 3CCEP 2QRXA 1S2EA 2MKVA 3KZIH 1KN7A 2AXCA 1LTBC 2B87A 4Z1MH 3RL0D 2J59M 3AE7C 1LGHB 5K5GB 2NPSA 1SQVG 1GL2D 2N1TB 3VYIA 2K88A 4L74A 2E5YA 2I1KA 2QJYB 1L0LK 5KAFH 3RBZA 3B8EB 3CC4P 2E43A 1NKZB 3MTUE 2B88A 3GLMA 1J1DB 2OARA 1NTKK 1Q86Q 1NWQA 3HD7D 5AW5B 1SQVE 1H0TA 1N7SA 1VQ8P 5AVXB 4I7ZB 1FZEA 1JY3P 3V5BA 2E74D 3Q2YA 4I2LC 1RE4C 1IZNB 2L5GB 3PRJA 3H1JG 2XNXA 2W6JH 2W6BA 1SFCB 3JCUE 4OWFA 1ZOYC 1SLQA 2R3CA 1FDIA 2A06D 1M1JC 3H1JE 1IJDB 1YJ9P 1BGYD 2HG5D 3TYYA 5BU8B 1KYOE 1FOSF 1T6AA 3M0AA 2PGDA 2WPQA 5AVWB 4JPZB 3H1KJ 2KLUA 2FXPA 3QWOC 1L0LG 4LC1A 2FYZA 2WPRA 1NTKG 4Y99B 1RE4A 1HVVA 1EZVI 1LWUB 4N6JA 4PD4I 3SFEC 3VP9A 3TNUB 5AW7B 3CI9A 4WY4B 2WMMA 4WBAA 1AVYA 3B5NC 1NTKE 4JYBA 3EQ2A 1M1JA 4OGQB 2ZVOB 2QEXP 4M3LA 4JYCA 3IR9A 1Y9BA 1R5SA 2Q9IA 1PP9J 4UB8H 2E76B 2K37A 1J1EB 2D2CB 1SQVD 3G6EP 1HF9A 1A02F 1AVOA 3BCCG 4EDFA 3D6YA 1GTWA 2QG4A 3Q5RA 2RN0A 2NPSD 2IYPA 2XV5A 3BCCE 1YYCA 5AW4B 2PFXA 2B9BA 1K9MQ 1KZUB 2HLOA 1FZCB 2POHA 2C9NY 3H1JD 3B5NA 3A3YB 1KYOD 1VQKP 2O01N 4JF7A 3U59A 1EDLA 5KLIC 4I1LA 2YMKA 3L74J 4OVNF 2IBZI 1T3UA 4YPCA 1HH0A 1JUNA 1WT6A 2QJKB 3AE3C 2ZT9B 1T2KC 1PV3A 2R5DA 3EWKA 3L72G 1KILB 1KB9E 4WVZA 1PL5A 4H0LB 2FYUK 3P8MC 4K35A 3BRVB 2OTJP 1WMKA 4ZMDA 2FY8A 3L72E 4ZKPA 2QJPC 1NTKD 1HUCA 2WT7A 1ZRTE 1MFZA 3IAOA 1NYHA 1VQ7P 1NAYA 1WRGA 2Z5HA 4NPDA 1GD2E 1JEKA 1JO5A 3GF3A 1FS0E 2HYNA 1KYOH 3VMXA 2FKWB 3V2PA 3V2NA 2FYNC 1L0NE 3R4YA 1OFCX 1Q82Q 2IX7C 3L71G 3AEEC 1SQPK 3BCCD 3L36A 3TF5A 3D71A 3P8CE 1OZHA 3I56P 2NZ2A 2P7JA 2RH0A 1LP1B 2FYUG 3RL0C 4IOIH 1IFJA 4KHXA 4PV1C 3L71E 1NVOA 3C8VA 3T97A 1E5WA 4ZNCA 2LXCB 3MUDA 2IFMA 3AE6C 1RHZB 3H32A 2FYUE 2YKOA 1YQ4C 4U7JA 3CXHI 3V2QA 1YITP 1NHLA 3O6QA 2R32A 3A0BE 2KLVA 1KB9D 3C9IA 1U7MA 1PFIA 2OTKE 3HRNA 5AW6B 4D6TG 1LT1A 3EFFK 1ZMEC 3B5ND 1H89A 3ABVC 3L72D 3BVHA 4W7YA 1NTZE 1HGZA 3CPWO 4D6TE 2KS1A 4GIFA 1ZRTD 4L75A 1S1CX 1VPCA 3D70A 3H1LG 1QLED 1SQPG 1N73C 1PGPA 1AA0A 2YXQB 1SQXK 1GL2A 1USDA 1S4XA 2AEMA 3NFQA 1YTZI 1SS1A 3AEDC 1M1KQ 3VMZA 3HTKB 3B4SA 2N9YB 3H1LE 3V4WA 1SQPE 2XNDH 3MIWA 3OW2O 1JNMA 3S4RA 3HD7A 2BEQD 3TGUJ 1KYOI 3L70J 2UWJE 3U1CA 2W8ZA 2AXTE 3P8CD 2WQYC 3L35A 2JP3A 1KB9H 3AE5C 1Y47A 1IO4A 2HFED 3GHGC 3CCMP 3PH0A 3L71D 1N73A 1X0TA 3H25A 5APSA 1OMIA 2P1JA 1M56D 2QE7H 3M9QA 5E79H 1S72P 3H1IG 1LT9B 3A5TA 1VQPP 3OA7A 2FYUD 3I5CA 1YBKA 1FDMA 2V7QH 1SQXG 4EI2A 1CZQA 3HE5A 3D6ZA 2Y9ZA 3M06A 3H1IE 5CCHD 1KQLA 1U57A 2FBWC 4UB8E 2E74B 3CX5I 2P67A 1BE3G 3N4XA 4U3FG 5KTBA 1AQTA 5DJUB 4I6MC 1RH5B 3KHUA 3FWLA 3VMYA 2E75B 3MZWB 2OYIC 1NTZD 1VQ5P 3CLQA 1VL2A 2C9LY 1CSBA 3O8ZA 4D6TD 1QVFO 3AEBC 2K9JA 1BE3E 1FOSE 2PAJA 3GHGA 1SFCC 1EXJA 3WUTA 3C1LA 3JC22 2YIUC 1FZAA 2ZXEB 1NO4A 3G71P 1IFIA 2WSFH 3H1LD 3AEFC 1SQPD 2ZFCA 1AFOA 4H44C 1SVFA 2KUBA 2GUSA 2WSCH 3LW5J 1MZ9A 2YKPA 1ZR2A 2DW3A 2JDIH 2OQQA 3RL0g 4AYCA 1W2EA 5APTA 2ZXXA 3RK3C 1X22A 3L72J 3A0HE 4PV1D 2OYIA 2V7QJ 4EOTA 3A0BH 1K05A 3RK2C 1N86A 3TSIA 1KB9I 3L4FA 1QVGO 2O01J 1SP4A 2XZRA 3G4SP 4HH2A 3VOPA 1BSHA 5AVUB 1NGMB 3AE9C 3PJSK 3G3ZA 2LXBA 5AVQB 3H1ID 3CD6P 2OYHA 4WB4A 5APWA 2B87B 1OW6A 1L0NJ 1SQQJ 3AE4C 5KLVK 3HE4A 1OW8A 3ITKA 2NPSB 3MGNA 1T3JA 2WSFJ 1BE3D 2K3RA 4U3FD 2KNCA 3L71J 1H0TB 2KZJA 1N7SB 1GZLA 3FWNA 2AXTH 3WMM0 1CI6A 1RF0C 2E5TA 4HYTB 3KQGA 2XDJA 2KSEA 5AVZB 1RQVA 3L75J 1FDOA 1KFMA 5CMZA 3HUSC 3RK3E 1L0LE 1PGQA 1G2CA 1VF5D 4GT1A 1FJKA 4WWIA 3AEAC 5APQA 5C39A 3W68A 1DD4A 1AQ5A 2LR2A 4K3AA 4AQRD 4GOEA 2Y9YA 1NTZJ 1NTMK 3G9RA 4BXLA 5KLVG 5APYA 2JEEA 4KJMA 3N7NA 1BDCA 1KC8Q 2N1TD 1NU1J 3IFMA 3U1AA 1HTLC 2H7HA 1RF0A 2W6AA 2YNYA 3CL3D 1KTMA 3FXEA 3WU2H 2IYOA 3HUSA 3L73G 1BSNA 3WUVA 2ZVNB 1ZP0C 2GA1A 2PP6A 3KDPB 1M1JB 5AVTB 3CCUP 1SFCD 3V2RA 3A2AA 3KYQA 1RF1C 1AV1A 4DOJA 1OIPA 3F89A 1K04A 3L73E 1HWTC 3PP5A 1S5LX 3SWYA 1KQSO 4IFMA 2ZYDA 3PTZA 1NTMG 5H2FE 4C7RA 3M91A 5GTHE 4H44D 2H8PD 2IZ1A 3A0HH 1X9VA 3MP7B 4IL6X 2P10A 4H13C 3H6PA 5AW2B 4C7NA
chains in the Genus database with same CATH topology
2M8RA 3B5ND 2HODA 2NPSC 2YMYA 3SWFA 5AW9B 2WPSA 1SQBK 1H89A 3BATA 2VRSA 2E42A 2Z5IA 3RK3D 2OYHB 3BVHA 4W7YA 2QM8A 1HGZA 3LIDA 5CCHC 4GIFA 1IFMA 3HE4B 3RK2D 3B5NB 1N7LA 2BASA 1VPCA 1N73C 3RK3B 4OH8B 1N7SC 4WY4D 1SQXK 1RF1A 1GL2A 1JTHB 1KILC 1LTTC 5AVSB 3NFQA 1YTZI 2WWWA 2KOGA 5AVRB 3RK2B 3VMZA 3HTKB 1L4AC 2C0WA 3TK1A 2YO3A 2OYHC 3V4WA 3MIWA 1JNMA 4XE5B 1CI6B 3HD7A 3BASA 4EIJA 1LTBC 3RL0D 3VN0A 1IFNA 2CPBA 1FZCA 2J59M 3U1CA 1G1IA 1LGHB 2NPSA 1JCCA 3A7OA 4RESB 1GL2D 1GW3A 2N1TB 3P8CD 3VYIA 2I1KA 1L0LK 1ZN5A 1IK9A 3L35A 4N78E 3B8EB 1G2CB 1HGVA 1OXZA 2E43A 1NKZB 3MTUE 3P7KA 5CCHA 1J1DB 1IO4A 2HFED 2WT7B 3GHGC 2OARA 3MD0A 1NTKK 5CCGD 2IFNA 1NWQA 1N73A 3HD7D 5APSA 5AW5B 5KJ7D 2P1JA 1FJPA 1G1JA 1N7SA 3M9QA 5AW0B 5AVXB 1LT9B 3A5TA 1KILA 1FZEA 2FXMA 1JY3P 1MUUA 3OA7A 3V5BA 1NOHA 3I5CA 1FZBA 1LTJC 1Z56A 4I2LC 1RE4C 1L4AA 2L5GB 1FDMA 1RY3A 1X79B 1JCDA 2JJLA 2J58A 1JY2O 1VDFA 1CZQA 2A45H 1A02J 2XNXA 2W6BA 3HE5A 2HPCA 2N9BA 5APUA 1SFCB 3M06A 5CCHD 1KQLA 2XKMA 5AVVB 2WTYA 2FFDC 1SLQA 1L0NK 2P67A 2R3CA 1SQQK 3N4XA 1URQC 4GKGA 1M1JC 1N7SD 5KTBA 4I6MC 1IJDB 3VMYA 1IFDA 2HG5D 1KILD 2OYIC 4W7ZA 3TYYA 4C46A 3CLQA 3HUSB 5BU8B 2C9LY 1CSBA 3O8ZA 1FOSF 1FZGA 1FBMA 3EFGA 1DX7A 3M0AA 2YO2A 1S9KE 3KPEA 2WPQA 5AVWB 1FOSE 3II6A 2PAJA 3GHGA 1SFCC 4W80A 3M0DC 1N2DC 2MJZA 4LC1A 1FZAA 2FYZA 2WSEH 2O1KA 1GK4A 2WPRA 2ZXEB 5CHXA 1JY2N 1X8YA 1NO4A 3H32B 1XTCC 1IFIA 2WSFH 1LTJA 4Y99B 1RE4A 1HVVA 2ZFCA 2Q7CA 1LWUB 4N6JA 3E1IA 1AFOA 1SVFA 3VP9A 3TNUB 5AW7B 3CI9A 2GUSA 4WY4B 2WSCH 1MZ9A 2YKPA 1ZR2A 2FFDA 5BU5A 1GU5A 4C7NB 4WBAA 3B5NC 4AYCA 2HODB 1URQA 4JYBA 1W2EA 5CJ0A 5APTA 3EQ2A 1M1JA 3RK3C 2Q3IA 2R5BA 1NTZK 4M3LA 4JYCA 4N78D 2OYIA 3IR9A 1LTAC 2Q9IA 4EOTA 1QL2A 1MV8A 4XA4A 3RK2C 1N86A 2Q5UA 4AUWA 3TSIA 3L4FA 3RL0B 1J1EB 1GW4A 1SP4A 2XZRA 1NU1K 1DEBA 1A02F 1HBWA 3M0DA 1RF1B 2CPSA 1J2JB 1GL2B 4O9BA 4HH2A 1GTWA 3VOPA 2GM4A 3LIEA 5AVUB 1RE3C 5CJ4A 2NPSD 3G3ZA 1GU4A 2N1TC 5AVQB 2A45I 2XV5A 3HD7B 2IPPA 1YYCA 2OYHA 1NH4A 4LLHA 5AW4B 4WB4A 1KZUB 5APWA 2HLOA 1LTSC 2POHA 1FZCB 2C9NY 5KLVK 1J1DC 1FAVA 1T8ZA 2KSJA 3HE4A 3B5NA 3A3YB 2NPSB 1GL2C 3MGNA 1T3JA 2KYVA 1JY2P 2QM7A 4JF7A 3U59A 2KP8A 4I1LA 1LT9C 1JTHA 1S9KD 3V4QA 1T3UA 1HH0A 1JUNA 1WT6A 3HTKA 1GDTA 1L4AD 5CCGC 3HD7C 1N73B 3NXSA 5KJ7C 1H8AA 1N7SB 1T2KC 1GZLA 2R5DA 3WMM0 5APXA 1CI6A 1RF0C 1KILB 1OWAA 4LGDE 4B86A 2Z4EA 1IC2A 4HYTB 3KQGA 2XDJA 1L4AB 2H43A 5AVZB 2A45G 1RE3A 2FYUK 3P8MC 1FU1A 1KFMA 2N1TA 3HE5B 3P32A 3BRVB 3NTNA 2HPCB 5CMZA 3HUSC 3VP8A 4DZOA 1G2CA 2WITA 4ZKPA 4GT1A 1FJKA 5APQA 5AW8B 2XU6A 3OJAB 1HUCA 3BRTB 2LKMA 3M9HA 2I1JA 2WT7A 1AQ5A 1MFZA 4AQRD 1EQ7A 1ZR4A 1FZFA 1NTMK 1YTZT 1GK6A 1CW5A 1LT9A 5APYA 2WZ7A 1WRGA 2Z5HA 2JEEA 1GD2E 2W27A 3N7NA 4ZKUA 1NAFA 3GHGB 4Y99C 2N1TD 5APVA 1NKNA 5CCGA 1LWUC 1JO5A 3IFMA 5KJ7A 3U1AA 1HTLC 2H7HA 4WY4C 1SFCA 1LTGC 1RF0A 2HYNA 2W6AA 4IFDK 2YNYA 1DH3A 3VMXA 3CL3D 2FKWB 3V2PA 1LTJB 3V2NA 3L37A 1URQD 3UIAA 3OAKA 2IX7C 1SQPK 3L36A 2YKQA 3R2PA 5AW3B 1H88A 3P8CE 1JY3O 3HUSA 2C0XA 3NMDA 2FFDB 1HJBA 3LW5H 2P7JA 2M3BA 2PP6A 1LTIC 1URQB 3KDPB 3RL0C 1J1EC 1KFNA 1M1JB 2O1JA 1T2KD 5AVTB 1IFJA 3VTPC 4KHXA 1SFCD 3V2RA 3A2AA 3KYQA 4IFFA 1RF1C 2OYIB 1JOCA 4DOJA 1JMMA 3T97A 1ZLLA 1E5WA 1ZV8A 2GUVA 3M9BA 1XTGB 1HWTC 3PP5A 2P2UA 3MUDA 2IFMA 3SWYA 3H32A 2YKOA 4IFMA 3V2QA 5BVZA 4C7RA 3M91A 1LWUA 1NHLA 2O01H 5AW1B 1M7LA 2R32A 1SQVK 2H8PD 1QL1A 2KLVA 3TNUA 3C9IA 4N3YB 4WY4A 1PFIA 3HRNA 5AW6B 1X9VA 2KB7P 1FZCC 3H6PA 5AW2B 4C7NA 5AVYB 1JY3N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WT7 A;  3SWF A;  2JJL A;  1MFZ A;  2WPS A;  5AW9 B;  1SP4 A;  4AQR D;  1H89 A;  2XZR A;  1CZQ A;  1A02 F;  1A02 J;  2VRS A;  2E42 A;  1HBW A;  2Z5I A;  3M0D A;  3HE5 A;  1J2J B;  2N9B A;  5APU A;  3M06 A;  1GK6 A;  2QM8 A;  1KQL A;  5AVV B;  2WTY A;  5APY A;  1GTW A;  3LID A;  1SLQ A;  2Z5H A;  3LIE A;  2P67 A;  2R3C A;  1GD2 E;  3HE4 B;  2W27 A;  5AVU B;  1NAF A;  2BAS A;  4GKG A;  5APV A;  4I6M C;  1GU4 A;  3VMY A;  5AVQ B;  2XV5 A;  4C46 A;  3TYY A;  2IPP A;  1YYC A;  2H7H A;  5AW4 B;  2C9L Y;  1CSB A;  3O8Z A;  5AVS B;  5APW A;  2W6A A;  3NFQ A;  2YNY A;  1DH3 A;  3VMX A;  1FOS F;  2WWW A;  2C9N Y;  3M0A A;  5AVR B;  2YO2 A;  1S9K E;  1FAV A;  3VMZ A;  2WPQ A;  5AVW B;  3HE4 A;  3TK1 A;  3L37 A;  1FOS E;  2YO3 A;  3A3Y B;  3UIA A;  3V4W A;  3MGN A;  3OAK A;  1JNM A;  3L36 A;  2QM7 A;  5AW3 B;  1H88 A;  4XE5 B;  4LC1 A;  1CI6 B;  2KP8 A;  2WPR A;  1GK4 A;  2ZXE B;  3NMD A;  1HJB A;  1S9K D;  1X8Y A;  2P7J A;  3V4Q A;  3VN0 A;  1JUN A;  3HTK A;  3KDP B;  1T2K D;  3NXS A;  2ZFC A;  5AVT B;  3A7O A;  4RES B;  2Q7C A;  1H8A A;  3VTP C;  4KHX A;  3VYI A;  3A2A A;  1T2K C;  1GZL A;  3TNU B;  2R5D A;  5AW7 B;  3L35 A;  3M9B A;  3T97 A;  5APX A;  1CI6 A;  3B8E B;  1HWT C;  1G2C B;  1OWA A;  1OXZ A;  4B86 A;  2E43 A;  2P2U A;  4HYT B;  1GU5 A;  3P7K A;  4C7N B;  3KQG A;  1IO4 A;  5AVZ B;  4AYC A;  2WT7 B;  4JYB A;  5APT A;  3MD0 A;  3P8M C;  1NWQ A;  5APS A;  3M91 A;  2Q3I A;  5AW5 B;  2R5B A;  3HE5 B;  3P32 A;  3NTN A;  4JYC A;  4M3L A;  2R32 A;  5AW0 B;  5CMZ A;  5AW1 B;  3TNU A;  5AVX B;  3IR9 A;  3A5T A;  4EOT A;  4DZO A;  1MUU A;  5AW6 B;  4GT1 A;  5APQ A;  5AW8 B;  1MV8 A;  3V5B A;  2XU6 A;  5AW2 B;  3I5C A;  2Q5U A;  4AUW A;  4C7N A;  1HUC A;  4I2L C;  5AVY B;  3M9H A; 
#chains in the Genus database with same CATH topology
 2HOD A;  2YMY A;  2AEF A;  1SQB K;  3E7K A;  1NTM E;  2VRS A;  3FX0 A;  2E42 A;  2Z5I A;  3RK3 D;  1L0L D;  5E79 E;  2YXR B;  3LID A;  5CCH C;  1IFM A;  3RK2 D;  3B5N B;  2K1A A;  1N7L A;  4WY4 D;  2QSI A;  1RF1 A;  1BGY J;  3GMA A;  5AVR B;  1L4A C;  2C0W A;  4OGQ D;  3TK1 A;  4L76 A;  1BCC G;  1OVU A;  2IDB A;  2E76 D;  5KLV D;  3BAS A;  1EDI A;  4IL6 E;  2BCC G;  1IFN A;  3GF7 A;  1JCC A;  3A7O A;  4RES B;  3K5B A;  1ZN5 A;  1BCC E;  4N78 E;  2J5U A;  3SFD C;  5CCH A;  2BCC E;  1RQU A;  2WT7 B;  2JR8 A;  1SQB G;  3MD0 A;  2IFN A;  3PHL A;  4BRY A;  1G1J A;  5AW0 B;  3L73 D;  3CC7 P;  3AEG C;  1DD3 A;  2FXM A;  1MUU A;  3H1K G;  1VQN P;  1LTJ C;  2KK7 A;  1L4A A;  3WUU A;  1YI2 P;  4R4L A;  1SQB E;  2JJL A;  2J58 A;  1JY2 O;  1A02 J;  1SQV J;  2HPC A;  5APU A;  5B5E E;  2XKM A;  2WTY A;  2FFD C;  2WSS H;  3H1H G;  1URQ C;  2OYO A;  1PGO A;  3Q1M A;  1NTM D;  2NRG A;  1IFD A;  1KIL D;  3GW6 A;  3AE1 C;  1FBM A;  3EFG A;  1DX7 A;  1MFT A;  2QIW A;  2QJP B;  3CWB G;  2YO2 A;  1S9K E;  3H1H E;  1VQ6 P;  1PGJ A;  3H1J J;  1N2D C;  2WVR A;  3T97 B;  1PP9 G;  2OGU A;  2O1K A;  1GK4 A;  5CHX A;  1JY2 N;  2HR3 A;  1X8Y A;  5M1B A;  3H32 B;  1XTC C;  3CWB E;  2E75 C;  1LTJ A;  3MHV A;  1EDJ A;  2Q7C A;  3E1I A;  3O6Q B;  2H89 C;  2FFD A;  4TLF A;  1VQ4 P;  1DIP A;  2FYN B;  1L2P A;  2IBZ G;  5KKZ C;  1URQ A;  3ZDM A;  1BCC D;  1K73 Q;  4N78 D;  1L0L J;  5H2F H;  5GTH H;  1M8O B;  1LTA C;  2KIK A;  2BCC D;  2KS1 B;  1OW7 A;  2Q5U A;  1VF5 C;  4HB1 A;  1E79 H;  3RL0 B;  2IBZ E;  1NTK J;  3CCS P;  1P84 E;  4PV1 B;  1HBW A;  2B89 A;  2CPS A;  3L74 G;  1GL2 B;  2JWD A;  4O9B A;  4QMA A;  3CCQ P;  2GM4 A;  3LIE A;  1K8A Q;  2I8D A;  2R3S A;  1SQB D;  4H13 D;  1RE3 C;  1VQ9 P;  5CJ4 A;  1GU4 A;  2N1T C;  4GOF A;  4RKU J;  2QJY C;  3HD7 B;  2IPP A;  3L74 E;  1NH4 A;  4LLH A;  1MKM A;  1JMB A;  3H1K D;  1LTS C;  1S5L H;  1LJ2 A;  1DEE G;  2M5A A;  1J1D C;  4GDO A;  2JWA A;  4HKZ H;  2KYV A;  1JY2 P;  2M3E A;  1SQX E;  3BCC J;  4I7Z C;  1JTH A;  5DJT B;  4R4M A;  1S9K D;  1N8R Q;  3H1H D;  1JM0 A;  4IL6 H;  3USS A;  1GDT A;  1L4A D;  1UII A;  5CCG C;  1N73 B;  1JB0 J;  5KJ7 C;  3WU2 E;  4U3F E;  3L73 J;  5APX A;  4PJ0 E;  1OWA A;  4LGD E;  4B86 A;  3CWB D;  2Z4E A;  5KAI E;  2H43 A;  2A45 G;  1RE3 A;  2N1T A;  3HE5 B;  3P32 A;  1PP9 D;  3VP8 A;  4DZO A;  2ZJS E;  4UB6 E;  2XU6 A;  1QGK B;  2PRR A;  1YJN P;  3FGA D;  1EQ7 A;  1LNQ A;  1ZR4 A;  5TIS E;  2WPV B;  3PLN A;  5L8R J;  1NJI Q;  2K9J B;  5B5E H;  2IBZ D;  2W27 A;  1NAF A;  3GHG B;  4Y99 C;  2QVA A;  1OVR A;  5APV A;  1NKN A;  1P84 D;  5CCG A;  5EFW B;  1LWU C;  5KJ7 A;  3VMA A;  2Q6Q A;  3CXH E;  4CPG A;  4WY4 C;  1SFC A;  2Y0D A;  3CCL P;  1DH3 A;  5CBO A;  2R44 A;  4JBZ A;  4ASV A;  1URQ D;  3CCV P;  4OGQ C;  1QX8 A;  3L74 D;  5AW3 B;  2SPZ A;  3B71 A;  1TU3 F;  2E76 C;  2M3B A;  1FE6 A;  1J1E C;  1KFN A;  2D2C C;  1IFP A;  3Q3D A;  1BCC J;  1SQX D;  2OYI B;  1JOC A;  1ZLL A;  1ZV8 A;  4NPE A;  2BCC J;  2P2U A;  4ASW A;  4GOD A;  2E75 D;  4XFJ A;  1R8E A;  1ZW0 A;  1LWU A;  2YIU B;  3CMA P;  2G3A A;  2KZI A;  2WSC J;  1QL1 A;  3TNU A;  1KMI Z;  4N3Y B;  4WY4 A;  3RGU A;  4BWN A;  1FZC C;  1SQB J;  1BDD A;  2FYU J;  5AW9 B;  4H44 B;  3E1R A;  3TGU G;  2OYH B;  1P84 H;  4YXD C;  3IN6 A;  2QM8 A;  3L70 G;  3HE4 B;  2BAS A;  2QJK C;  2Y0C A;  2ZT9 C;  3RK3 B;  3GG2 A;  3TGU E;  1KIL C;  3SWK A;  3H1H J;  2RMZ A;  2WWW A;  3L70 E;  3RK2 B;  4D6T J;  4H0L C;  2KNC B;  3CXH D;  2RKL A;  4XE5 B;  1CI6 B;  3CWB J;  4EIJ A;  3VN0 A;  2CPB A;  1FZC A;  5KLV E;  1G1I A;  3CX5 E;  3H1L J;  1GW3 A;  3AE8 C;  3CC2 P;  1SQP J;  2JKV A;  1IK9 A;  5B66 H;  4KT0 J;  5CBN A;  1G2C B;  1HGV A;  1OXZ A;  4PJ0 H;  3P7K A;  1FC2 C;  5KAI H;  3I55 P;  5CCG D;  1YQ3 C;  5KJ7 D;  1FJP A;  1EXI A;  4TT3 H;  1KIL A;  1NOH A;  3V6I A;  3CME P;  1FZB A;  1OX3 A;  1Z56 A;  2Y0E A;  4UB6 H;  1RY3 A;  1X79 B;  1JCD A;  5GTI H;  1VDF A;  2A45 H;  3F5H A;  2ITA A;  2N9B A;  5TIS H;  3KXD A;  5AVV B;  4A7P A;  1L0N K;  1SQQ K;  1UIX A;  3QH9 A;  4GKG A;  1KQF B;  1N7S D;  3IF4 A;  4W7Z A;  4C46 A;  3HUS B;  1HJ0 A;  2CK3 H;  1P84 I;  1Y8A A;  3H1I J;  3CXH H;  1FZG A;  1KOR A;  1KIL E;  3KPE A;  3II6 A;  3TDK A;  3SSU A;  4W80 A;  3M0D C;  1SQX J;  3TGU D;  2KXP B;  3S9O A;  1KQG B;  2MJZ A;  1Q90 D;  2WSE H;  3L70 D;  2KI7 B;  1USE A;  3W67 A;  1S5L E;  1M57 D;  1BE3 J;  4L73 A;  4YXW H;  4U3F J;  2K9Y A;  3AE2 C;  2W90 A;  4DJG A;  1OVV A;  5BU5 A;  1GU5 A;  1LP1 A;  4C7N B;  2M0B A;  1VQL P;  2HOD B;  3CX5 D;  5CJ0 A;  2D2C D;  1YIJ P;  4HJG H;  2Q3I A;  2R5B A;  1NTZ K;  3MUD C;  3JCU H;  1L0N G;  1SQQ G;  1QL2 A;  1MV8 A;  4XA4 A;  4AUW A;  1PZQ A;  2V4H A;  2AEJ A;  1GW4 A;  1NU1 K;  1DEB A;  3M0D A;  1RF1 B;  1J2J B;  1PIX A;  4Y28 J;  5TJH A;  1AJY A;  1SQQ E;  5KLI B;  1EZV G;  2A45 I;  1EC5 A;  4RO0 A;  1KV4 A;  2P58 A;  4H13 B;  3L75 G;  1EZV E;  1FAV A;  1T8Z A;  4PD4 E;  2KSJ A;  1GL2 C;  2WSE J;  3H1K E;  3KZI E;  2QM7 A;  2ZT9 D;  3AEC C;  2KP8 A;  1LT9 C;  3V4Q A;  3L75 E;  3HTK A;  4H0L D;  3HD7 C;  3RBX A;  3NXS A;  4BRY B;  5KAF E;  1NTZ G;  1PPJ G;  1H8A A;  3CX5 H;  3Q5S A;  1U7J A;  3CCJ P;  3FXD A;  1Q81 Q;  2JO1 A;  4EYY Q;  2QA4 P;  2E74 C;  1IC2 A;  1L4A B;  1Q2N A;  1NU1 G;  2ZAE B;  1D7M A;  1FU1 A;  2FXO A;  1PPJ E;  3JSV C;  3NTN A;  2HPC B;  2Q1K A;  3S1K A;  2G8Y A;  2WIT A;  5AW8 B;  1PP9 E;  3OJA B;  3BRT B;  2LKM A;  3M9H A;  1VQO P;  2I1J A;  1NU1 E;  1R5L A;  1GMJ A;  1FZF A;  1YTZ T;  1GK6 A;  1CW5 A;  1W2B O;  2ZYA A;  1LT9 A;  4YTP C;  2WZ7 A;  3Q5P A;  4DCK A;  1S3J A;  2IZ0 A;  4ZKU A;  1M90 Q;  1ZXG A;  2OTL P;  2ZYG A;  1L0N D;  1SQQ D;  2BEZ F;  1LTG C;  4IFD K;  1LTJ B;  3L37 A;  3UIA A;  2W83 C;  3OAK A;  4DT0 A;  2Q3E A;  2YKQ A;  3R2P A;  1H88 A;  1JY3 O;  1YJW P;  2C0X A;  1YHQ P;  1QEX A;  3NMD A;  2FFD B;  1HJB A;  3LW5 H;  1EZV D;  4PD4 D;  5KLV J;  1KD1 Q;  1LTI C;  1URQ B;  4RJT A;  4JQ0 D;  2O1J A;  1T2K D;  3VTP C;  2L91 A;  4IFF A;  1JMM A;  3M9B A;  2GUV A;  4MN4 C;  2H88 C;  1XTG B;  3L75 D;  3CCR P;  1IK7 A;  2A06 G;  5BVZ A;  1Q7Y Q;  2O01 H;  5AW1 B;  1M7L A;  1BGY G;  1SQV K;  5B66 E;  2KB7 P;  5AVY B;  1JY3 N;  2M8R A;  2NPS C;  3SWF A;  1PPJ D;  2A06 E;  2O3J A;  1VQM P;  2WPS A;  3BAT A;  4NPF X;  1BGY E;  2M5A B;  1EDK A;  1NU1 D;  5KKZ B;  5GTI E;  4OH8 B;  1N7S C;  1NTM J;  1JTH B;  1LTT C;  5AVS B;  2KOG A;  1W5C E;  1VF5 B;  2YO3 A;  2OYH C;  4PD4 H;  3CCE P;  2QRX A;  1S2E A;  2MKV A;  3KZI H;  1KN7 A;  2AXC A;  1LTB C;  2B87 A;  4Z1M H;  3RL0 D;  2J59 M;  3AE7 C;  1LGH B;  5K5G B;  2NPS A;  1SQV G;  1GL2 D;  2N1T B;  3VYI A;  2K88 A;  4L74 A;  2E5Y A;  2I1K A;  2QJY B;  1L0L K;  5KAF H;  3RBZ A;  3B8E B;  3CC4 P;  2E43 A;  1NKZ B;  3MTU E;  2B88 A;  3GLM A;  1J1D B;  2OAR A;  1NTK K;  1Q86 Q;  1NWQ A;  3HD7 D;  5AW5 B;  1SQV E;  1H0T A;  1N7S A;  1VQ8 P;  5AVX B;  4I7Z B;  1FZE A;  1JY3 P;  3V5B A;  2E74 D;  3Q2Y A;  4I2L C;  1RE4 C;  1IZN B;  2L5G B;  3PRJ A;  3H1J G;  2XNX A;  2W6J H;  2W6B A;  1SFC B;  3JCU E;  4OWF A;  1ZOY C;  1SLQ A;  2R3C A;  1FDI A;  2A06 D;  1M1J C;  3H1J E;  1IJD B;  1YJ9 P;  1BGY D;  2HG5 D;  3TYY A;  5BU8 B;  1KYO E;  1FOS F;  1T6A A;  3M0A A;  2PGD A;  2WPQ A;  5AVW B;  4JPZ B;  3H1K J;  2KLU A;  2FXP A;  3QWO C;  1L0L G;  4LC1 A;  2FYZ A;  2WPR A;  1NTK G;  4Y99 B;  1RE4 A;  1HVV A;  1EZV I;  1LWU B;  4N6J A;  4PD4 I;  3SFE C;  3VP9 A;  3TNU B;  5AW7 B;  3CI9 A;  4WY4 B;  2WMM A;  4WBA A;  1AVY A;  3B5N C;  1NTK E;  4JYB A;  3EQ2 A;  1M1J A;  4OGQ B;  2ZVO B;  2QEX P;  4M3L A;  4JYC A;  3IR9 A;  1Y9B A;  1R5S A;  2Q9I A;  1PP9 J;  4UB8 H;  2E76 B;  2K37 A;  1J1E B;  2D2C B;  1SQV D;  3G6E P;  1HF9 A;  1A02 F;  1AVO A;  3BCC G;  4EDF A;  3D6Y A;  1GTW A;  2QG4 A;  3Q5R A;  2RN0 A;  2NPS D;  2IYP A;  2XV5 A;  3BCC E;  1YYC A;  5AW4 B;  2PFX A;  2B9B A;  1K9M Q;  1KZU B;  2HLO A;  1FZC B;  2POH A;  2C9N Y;  3H1J D;  3B5N A;  3A3Y B;  1KYO D;  1VQK P;  2O01 N;  4JF7 A;  3U59 A;  1EDL A;  5KLI C;  4I1L A;  2YMK A;  3L74 J;  4OVN F;  2IBZ I;  1T3U A;  4YPC A;  1HH0 A;  1JUN A;  1WT6 A;  2QJK B;  3AE3 C;  2ZT9 B;  1T2K C;  1PV3 A;  2R5D A;  3EWK A;  3L72 G;  1KIL B;  1KB9 E;  4WVZ A;  1PL5 A;  4H0L B;  2FYU K;  3P8M C;  4K35 A;  3BRV B;  2OTJ P;  1WMK A;  4ZMD A;  2FY8 A;  3L72 E;  4ZKP A;  2QJP C;  1NTK D;  1HUC A;  2WT7 A;  1ZRT E;  1MFZ A;  3IAO A;  1NYH A;  1VQ7 P;  1NAY A;  1WRG A;  2Z5H A;  4NPD A;  1GD2 E;  1JEK A;  1JO5 A;  3GF3 A;  1FS0 E;  2HYN A;  1KYO H;  3VMX A;  2FKW B;  3V2P A;  3V2N A;  2FYN C;  1L0N E;  3R4Y A;  1OFC X;  1Q82 Q;  2IX7 C;  3L71 G;  3AEE C;  1SQP K;  3BCC D;  3L36 A;  3TF5 A;  3D71 A;  3P8C E;  1OZH A;  3I56 P;  2NZ2 A;  2P7J A;  2RH0 A;  1LP1 B;  2FYU G;  3RL0 C;  4IOI H;  1IFJ A;  4KHX A;  4PV1 C;  3L71 E;  1NVO A;  3C8V A;  3T97 A;  1E5W A;  4ZNC A;  2LXC B;  3MUD A;  2IFM A;  3AE6 C;  1RHZ B;  3H32 A;  2FYU E;  2YKO A;  1YQ4 C;  4U7J A;  3CXH I;  3V2Q A;  1YIT P;  1NHL A;  3O6Q A;  2R32 A;  3A0B E;  2KLV A;  1KB9 D;  3C9I A;  1U7M A;  1PFI A;  2OTK E;  3HRN A;  5AW6 B;  4D6T G;  1LT1 A;  3EFF K;  1ZME C;  3B5N D;  1H89 A;  3ABV C;  3L72 D;  3BVH A;  4W7Y A;  1NTZ E;  1HGZ A;  3CPW O;  4D6T E;  2KS1 A;  4GIF A;  1ZRT D;  4L75 A;  1S1C X;  1VPC A;  3D70 A;  3H1L G;  1QLE D;  1SQP G;  1N73 C;  1PGP A;  1AA0 A;  2YXQ B;  1SQX K;  1GL2 A;  1USD A;  1S4X A;  2AEM A;  3NFQ A;  1YTZ I;  1SS1 A;  3AED C;  1M1K Q;  3VMZ A;  3HTK B;  3B4S A;  2N9Y B;  3H1L E;  3V4W A;  1SQP E;  2XND H;  3MIW A;  3OW2 O;  1JNM A;  3S4R A;  3HD7 A;  2BEQ D;  3TGU J;  1KYO I;  3L70 J;  2UWJ E;  3U1C A;  2W8Z A;  2AXT E;  3P8C D;  2WQY C;  3L35 A;  2JP3 A;  1KB9 H;  3AE5 C;  1Y47 A;  1IO4 A;  2HFE D;  3GHG C;  3CCM P;  3PH0 A;  3L71 D;  1N73 A;  1X0T A;  3H25 A;  5APS A;  1OMI A;  2P1J A;  1M56 D;  2QE7 H;  3M9Q A;  5E79 H;  1S72 P;  3H1I G;  1LT9 B;  3A5T A;  1VQP P;  3OA7 A;  2FYU D;  3I5C A;  1YBK A;  1FDM A;  2V7Q H;  1SQX G;  4EI2 A;  1CZQ A;  3HE5 A;  3D6Z A;  2Y9Z A;  3M06 A;  3H1I E;  5CCH D;  1KQL A;  1U57 A;  2FBW C;  4UB8 E;  2E74 B;  3CX5 I;  2P67 A;  1BE3 G;  3N4X A;  4U3F G;  5KTB A;  1AQT A;  5DJU B;  4I6M C;  1RH5 B;  3KHU A;  3FWL A;  3VMY A;  2E75 B;  3MZW B;  2OYI C;  1NTZ D;  1VQ5 P;  3CLQ A;  1VL2 A;  2C9L Y;  1CSB A;  3O8Z A;  4D6T D;  1QVF O;  3AEB C;  2K9J A;  1BE3 E;  1FOS E;  2PAJ A;  3GHG A;  1SFC C;  1EXJ A;  3WUT A;  3C1L A;  3JC2 2;  2YIU C;  1FZA A;  2ZXE B;  1NO4 A;  3G71 P;  1IFI A;  2WSF H;  3H1L D;  3AEF C;  1SQP D;  2ZFC A;  1AFO A;  4H44 C;  1SVF A;  2KUB A;  2GUS A;  2WSC H;  3LW5 J;  1MZ9 A;  2YKP A;  1ZR2 A;  2DW3 A;  2JDI H;  2OQQ A;  3RL0 g;  4AYC A;  1W2E A;  5APT A;  2ZXX A;  3RK3 C;  1X22 A;  3L72 J;  3A0H E;  4PV1 D;  2OYI A;  2V7Q J;  4EOT A;  3A0B H;  1K05 A;  3RK2 C;  1N86 A;  3TSI A;  1KB9 I;  3L4F A;  1QVG O;  2O01 J;  1SP4 A;  2XZR A;  3G4S P;  4HH2 A;  3VOP A;  1BSH A;  5AVU B;  1NGM B;  3AE9 C;  3PJS K;  3G3Z A;  2LXB A;  5AVQ B;  3H1I D;  3CD6 P;  2OYH A;  4WB4 A;  5APW A;  2B87 B;  1OW6 A;  1L0N J;  1SQQ J;  3AE4 C;  5KLV K;  3HE4 A;  1OW8 A;  3ITK A;  2NPS B;  3MGN A;  1T3J A;  2WSF J;  1BE3 D;  2K3R A;  4U3F D;  2KNC A;  3L71 J;  1H0T B;  2KZJ A;  1N7S B;  1GZL A;  3FWN A;  2AXT H;  3WMM 0;  1CI6 A;  1RF0 C;  2E5T A;  4HYT B;  3KQG A;  2XDJ A;  2KSE A;  5AVZ B;  1RQV A;  3L75 J;  1FDO A;  1KFM A;  5CMZ A;  3HUS C;  3RK3 E;  1L0L E;  1PGQ A;  1G2C A;  1VF5 D;  4GT1 A;  1FJK A;  4WWI A;  3AEA C;  5APQ A;  5C39 A;  3W68 A;  1DD4 A;  1AQ5 A;  2LR2 A;  4K3A A;  4AQR D;  4GOE A;  2Y9Y A;  1NTZ J;  1NTM K;  3G9R A;  4BXL A;  5KLV G;  5APY A;  2JEE A;  4KJM A;  3N7N A;  1BDC A;  1KC8 Q;  2N1T D;  1NU1 J;  3IFM A;  3U1A A;  1HTL C;  2H7H A;  1RF0 A;  2W6A A;  2YNY A;  3CL3 D;  1KTM A;  3FXE A;  3WU2 H;  2IYO A;  3HUS A;  3L73 G;  1BSN A;  3WUV A;  2ZVN B;  1ZP0 C;  2GA1 A;  2PP6 A;  3KDP B;  1M1J B;  5AVT B;  3CCU P;  1SFC D;  3V2R A;  3A2A A;  3KYQ A;  1RF1 C;  1AV1 A;  4DOJ A;  1OIP A;  3F89 A;  1K04 A;  3L73 E;  1HWT C;  3PP5 A;  1S5L X;  3SWY A;  1KQS O;  4IFM A;  2ZYD A;  3PTZ A;  1NTM G;  5H2F E;  4C7R A;  3M91 A;  5GTH E;  4H44 D;  2H8P D;  2IZ1 A;  3A0H H;  1X9V A;  3MP7 B;  4IL6 X;  2P10 A;  4H13 C;  3H6P A;  5AW2 B;  4C7N A; 
#chains in the Genus database with same CATH homology
 2M8R A;  3B5N D;  2HOD A;  2NPS C;  2YMY A;  3SWF A;  5AW9 B;  2WPS A;  1SQB K;  1H89 A;  3BAT A;  2VRS A;  2E42 A;  2Z5I A;  3RK3 D;  2OYH B;  3BVH A;  4W7Y A;  2QM8 A;  1HGZ A;  3LID A;  5CCH C;  4GIF A;  1IFM A;  3HE4 B;  3RK2 D;  3B5N B;  1N7L A;  2BAS A;  1VPC A;  1N73 C;  3RK3 B;  4OH8 B;  1N7S C;  4WY4 D;  1SQX K;  1RF1 A;  1GL2 A;  1JTH B;  1KIL C;  1LTT C;  5AVS B;  3NFQ A;  1YTZ I;  2WWW A;  2KOG A;  5AVR B;  3RK2 B;  3VMZ A;  3HTK B;  1L4A C;  2C0W A;  3TK1 A;  2YO3 A;  2OYH C;  3V4W A;  3MIW A;  1JNM A;  4XE5 B;  1CI6 B;  3HD7 A;  3BAS A;  4EIJ A;  1LTB C;  3RL0 D;  3VN0 A;  1IFN A;  2CPB A;  1FZC A;  2J59 M;  3U1C A;  1G1I A;  1LGH B;  2NPS A;  1JCC A;  3A7O A;  4RES B;  1GL2 D;  1GW3 A;  2N1T B;  3P8C D;  3VYI A;  2I1K A;  1L0L K;  1ZN5 A;  1IK9 A;  3L35 A;  4N78 E;  3B8E B;  1G2C B;  1HGV A;  1OXZ A;  2E43 A;  1NKZ B;  3MTU E;  3P7K A;  5CCH A;  1J1D B;  1IO4 A;  2HFE D;  2WT7 B;  3GHG C;  2OAR A;  3MD0 A;  1NTK K;  5CCG D;  2IFN A;  1NWQ A;  1N73 A;  3HD7 D;  5APS A;  5AW5 B;  5KJ7 D;  2P1J A;  1FJP A;  1G1J A;  1N7S A;  3M9Q A;  5AW0 B;  5AVX B;  1LT9 B;  3A5T A;  1KIL A;  1FZE A;  2FXM A;  1JY3 P;  1MUU A;  3OA7 A;  3V5B A;  1NOH A;  3I5C A;  1FZB A;  1LTJ C;  1Z56 A;  4I2L C;  1RE4 C;  1L4A A;  2L5G B;  1FDM A;  1RY3 A;  1X79 B;  1JCD A;  2JJL A;  2J58 A;  1JY2 O;  1VDF A;  1CZQ A;  2A45 H;  1A02 J;  2XNX A;  2W6B A;  3HE5 A;  2HPC A;  2N9B A;  5APU A;  1SFC B;  3M06 A;  5CCH D;  1KQL A;  2XKM A;  5AVV B;  2WTY A;  2FFD C;  1SLQ A;  1L0N K;  2P67 A;  2R3C A;  1SQQ K;  3N4X A;  1URQ C;  4GKG A;  1M1J C;  1N7S D;  5KTB A;  4I6M C;  1IJD B;  3VMY A;  1IFD A;  2HG5 D;  1KIL D;  2OYI C;  4W7Z A;  3TYY A;  4C46 A;  3CLQ A;  3HUS B;  5BU8 B;  2C9L Y;  1CSB A;  3O8Z A;  1FOS F;  1FZG A;  1FBM A;  3EFG A;  1DX7 A;  3M0A A;  2YO2 A;  1S9K E;  3KPE A;  2WPQ A;  5AVW B;  1FOS E;  3II6 A;  2PAJ A;  3GHG A;  1SFC C;  4W80 A;  3M0D C;  1N2D C;  2MJZ A;  4LC1 A;  1FZA A;  2FYZ A;  2WSE H;  2O1K A;  1GK4 A;  2WPR A;  2ZXE B;  5CHX A;  1JY2 N;  1X8Y A;  1NO4 A;  3H32 B;  1XTC C;  1IFI A;  2WSF H;  1LTJ A;  4Y99 B;  1RE4 A;  1HVV A;  2ZFC A;  2Q7C A;  1LWU B;  4N6J A;  3E1I A;  1AFO A;  1SVF A;  3VP9 A;  3TNU B;  5AW7 B;  3CI9 A;  2GUS A;  4WY4 B;  2WSC H;  1MZ9 A;  2YKP A;  1ZR2 A;  2FFD A;  5BU5 A;  1GU5 A;  4C7N B;  4WBA A;  3B5N C;  4AYC A;  2HOD B;  1URQ A;  4JYB A;  1W2E A;  5CJ0 A;  5APT A;  3EQ2 A;  1M1J A;  3RK3 C;  2Q3I A;  2R5B A;  1NTZ K;  4M3L A;  4JYC A;  4N78 D;  2OYI A;  3IR9 A;  1LTA C;  2Q9I A;  4EOT A;  1QL2 A;  1MV8 A;  4XA4 A;  3RK2 C;  1N86 A;  2Q5U A;  4AUW A;  3TSI A;  3L4F A;  3RL0 B;  1J1E B;  1GW4 A;  1SP4 A;  2XZR A;  1NU1 K;  1DEB A;  1A02 F;  1HBW A;  3M0D A;  1RF1 B;  2CPS A;  1J2J B;  1GL2 B;  4O9B A;  4HH2 A;  1GTW A;  3VOP A;  2GM4 A;  3LIE A;  5AVU B;  1RE3 C;  5CJ4 A;  2NPS D;  3G3Z A;  1GU4 A;  2N1T C;  5AVQ B;  2A45 I;  2XV5 A;  3HD7 B;  2IPP A;  1YYC A;  2OYH A;  1NH4 A;  4LLH A;  5AW4 B;  4WB4 A;  1KZU B;  5APW A;  2HLO A;  1LTS C;  2POH A;  1FZC B;  2C9N Y;  5KLV K;  1J1D C;  1FAV A;  1T8Z A;  2KSJ A;  3HE4 A;  3B5N A;  3A3Y B;  2NPS B;  1GL2 C;  3MGN A;  1T3J A;  2KYV A;  1JY2 P;  2QM7 A;  4JF7 A;  3U59 A;  2KP8 A;  4I1L A;  1LT9 C;  1JTH A;  1S9K D;  3V4Q A;  1T3U A;  1HH0 A;  1JUN A;  1WT6 A;  3HTK A;  1GDT A;  1L4A D;  5CCG C;  3HD7 C;  1N73 B;  3NXS A;  5KJ7 C;  1H8A A;  1N7S B;  1T2K C;  1GZL A;  2R5D A;  3WMM 0;  5APX A;  1CI6 A;  1RF0 C;  1KIL B;  1OWA A;  4LGD E;  4B86 A;  2Z4E A;  1IC2 A;  4HYT B;  3KQG A;  2XDJ A;  1L4A B;  2H43 A;  5AVZ B;  2A45 G;  1RE3 A;  2FYU K;  3P8M C;  1FU1 A;  1KFM A;  2N1T A;  3HE5 B;  3P32 A;  3BRV B;  3NTN A;  2HPC B;  5CMZ A;  3HUS C;  3VP8 A;  4DZO A;  1G2C A;  2WIT A;  4ZKP A;  4GT1 A;  1FJK A;  5APQ A;  5AW8 B;  2XU6 A;  3OJA B;  1HUC A;  3BRT B;  2LKM A;  3M9H A;  2I1J A;  2WT7 A;  1AQ5 A;  1MFZ A;  4AQR D;  1EQ7 A;  1ZR4 A;  1FZF A;  1NTM K;  1YTZ T;  1GK6 A;  1CW5 A;  1LT9 A;  5APY A;  2WZ7 A;  1WRG A;  2Z5H A;  2JEE A;  1GD2 E;  2W27 A;  3N7N A;  4ZKU A;  1NAF A;  3GHG B;  4Y99 C;  2N1T D;  5APV A;  1NKN A;  5CCG A;  1LWU C;  1JO5 A;  3IFM A;  5KJ7 A;  3U1A A;  1HTL C;  2H7H A;  4WY4 C;  1SFC A;  1LTG C;  1RF0 A;  2HYN A;  2W6A A;  4IFD K;  2YNY A;  1DH3 A;  3VMX A;  3CL3 D;  2FKW B;  3V2P A;  1LTJ B;  3V2N A;  3L37 A;  1URQ D;  3UIA A;  3OAK A;  2IX7 C;  1SQP K;  3L36 A;  2YKQ A;  3R2P A;  5AW3 B;  1H88 A;  3P8C E;  1JY3 O;  3HUS A;  2C0X A;  3NMD A;  2FFD B;  1HJB A;  3LW5 H;  2P7J A;  2M3B A;  2PP6 A;  1LTI C;  1URQ B;  3KDP B;  3RL0 C;  1J1E C;  1KFN A;  1M1J B;  2O1J A;  1T2K D;  5AVT B;  1IFJ A;  3VTP C;  4KHX A;  1SFC D;  3V2R A;  3A2A A;  3KYQ A;  4IFF A;  1RF1 C;  2OYI B;  1JOC A;  4DOJ A;  1JMM A;  3T97 A;  1ZLL A;  1E5W A;  1ZV8 A;  2GUV A;  3M9B A;  1XTG B;  1HWT C;  3PP5 A;  2P2U A;  3MUD A;  2IFM A;  3SWY A;  3H32 A;  2YKO A;  4IFM A;  3V2Q A;  5BVZ A;  4C7R A;  3M91 A;  1LWU A;  1NHL A;  2O01 H;  5AW1 B;  1M7L A;  2R32 A;  1SQV K;  2H8P D;  1QL1 A;  2KLV A;  3TNU A;  3C9I A;  4N3Y B;  4WY4 A;  1PFI A;  3HRN A;  5AW6 B;  1X9V A;  2KB7 P;  1FZC C;  3H6P A;  5AW2 B;  4C7N A;  5AVY B;  1JY3 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...