5APXA

Sequence matkddian inserted between gcn4 adaptors - structure t9(6)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
60
structure length
60
Chain Sequence
VEELLSKVYHLENEVARLKKLMATKDDIANMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 25
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apxA00
1G2CB 5AVVB 5AW0B 4LC1A 2C9LY 2P2UA 5CMZA 2QM7A 1NWQA 3LIEA 3OAKA 1JUNA 2Q7CA 3IR9A 5APWA 3P32A 1GK4A 1JNMA 3NXSA 4AQRD 3UIAA 2N9BA 2WPRA 3P7KA 3T97A 1OXZA 1J2JB 1T2KD 1OWAA 5AW2B 2E43A 3MGNA 3VTPC 3VMYA 2KP8A 4JYBA 3TNUB 3L35A 4KHXA 2W6AA 2R32A 2P67A 3KQGA 4DZOA 1H89A 2WPQA 2ZFCA 1GZLA 2WT7A 4XE5B 3KDPB 1H8AA 1GTWA 1FAVA 3VN0A 4JYCA 5AW4B 3VYIA 5AW7B 4I6MC 1IO4A 5AW6B 3M0DA 5AVRB 1DH3A 5AW3B 4C7NB 2XU6A 5AW8B 3A3YB 1GU4A 1HJBA 1A02F 1MUUA 2WT7B 3L37A 1GD2E 3VMXA 2C9NY 2JJLA 3B8EB 1GK6A 1X8YA 5APUA 1A02J 2E42A 5APQA 3A5TA 3TNUA 3HE4B 3HE4A 1NAFA 4AUWA 3I5CA 3A2AA 4I2LC 4GT1A 1SLQA 3HTKA 4B86A 2IPPA 5AVTB 4EOTA 4C7NA 3NTNA 3NFQA 4M3LA 5AW1B 3V5BA 1YYCA 2W27A 1GU5A 2YNYA 2YO2A 5APTA 2QM8A 5APXA 1CI6B 2VRSA 4AYCA 3O8ZA 3HE5A 5APYA 5APVA 3M9BA 5AVSB 5APSA 1T2KC 3MD0A 3M9HA 4C46A 4HYTB 3P8MC 4GKGA 3V4WA 3L36A 2R5DA 1S9KE 1CZQA 2R5BA 5AVWB 5AVZB 2WPSA 3A7OA 5AVYB 1HBWA 2R3CA 1MV8A 1CI6A 3TYYA 2YO3A 2XZRA 5AW9B 1HUCA 1CSBA 5AVXB 3LIDA 2P7JA 2Z5IA 3HE5B 2Q5UA 2WTYA 1FOSE 1SP4A 2ZXEB 3M0AA 3M91A 5AW5B 2Q3IA 3VMZA 4RESB 1S9KD 3TK1A 3SWFA 1H88A 2H7HA 1HWTC 2WWWA 5AVUB 2BASA 2Z5HA 1FOSF 5AVQB 1MFZA 1KQLA 3V4QA 2XV5A 3M06A 3NMDA
chains in the Genus database with same CATH superfamily
2YKPA 2N1TC 5KAIH 1FZBA 2C9LY 2M8RA 4XFJA 1NTZK 5CMZA 3GHGA 4OGQC 2QM7A 2JDIH 2QIWA 2G3AA 3B4SA 4BRYA 2AXTH 4RJTA 1QVGO 3P32A 3VOPA 4AQRD 1SQVK 4IFFA 1W5CE 1YIJP 1RF0A 4PV1D 2N9BA 1P84D 1NTZG 1PIXA 3MP7B 1J2JB 1NU1E 3VMYA 1ZXGA 1EDIA 1W2BO 3A0HE 1LWUA 2IFNA 2W6AA 2E75B 2R32A 1RF0C 2A06E 2P67A 2BEQD 3Q5PA 2WPQA 1H89A 2KUBA 1RE3C 3OJAB 4WB4A 3L74D 3CI9A 3AEDC 1KQSO 1G1JA 4I7ZB 5DJUB 1NTKE 1DD4A 1JY3P 1SFCD 2KS1A 4JYCA 4QMAA 3V2PA 5AW7B 1SQQE 2NZ2A 4JF7A 2FYUJ 4EDFA 1RE3A 1Y9BA 4GDOA 1PPJG 4R4MA 1URQA 3AE8C 1FDMA 2UWJE 5BU5A 2C0WA 4PD4H 1DH3A 1NAYA 5AW3B 2M3BA 1LTSC 5BU8B 3O6QB 4OWFA 1JMMA 4H0LB 3RK3C 2LKMA 5M1BA 1L0LG 2HYNA 2QA4P 1ZR2A 1BCCD 2CPSA 3CWBD 3Q1MA 1BGYG 1PGQA 1SQPD 2CK3H 2HODA 2QRXA 2XNXA 1JEKA 3B8EB 3C1LA 3CLQA 1EZVG 3S4RA 2WSCH 5CBNA 1FZGA 1A02J 1LTBC 1ZV8A 1HGZA 1N2DC 1NU1K 2FYNB 2YMYA 2QSIA 4L76A 4PV1C 3CCLP 3H1KJ 3I5CA 4H44D 4L73A 5CHXA 4KT0J 1SFCB 1YJ9P 3A2AA 1S2EA 1G2CA 3L70D 1JCCA 3F5HA 3HD7C 3HTKA 3L74G 2KS1B 2OYOA 4B86A 1BCCJ 4NPEA 1L4AD 4I7ZC 5TISH 2W90A 2H88C 1NTKK 2IBZE 3CCVP 2CPBA 1YYCA 2W27A 2Y0DA 1L4AA 1SFCC 1L4AB 2IBZI 2YO2A 3L75E 1YITP 3VP9A 3D70A 1AJYA 3AE2C 3H1JD 2FYNC 2K1AA 2JKVA 2VRSA 1PP9G 2ZAEB 1PPJD 1UIIA 3EFFK 1RE4C 1KYOH 1Q90D 4K35A 4ASVA 1M8OB 1N7LA 3O8ZA 3PH0A 3CX5E 3M9BA 1BE3J 1IK9A 2BCCJ 2KNCB 1J1DC 1SVFA 1T3JA 2HLOA 3AEBC 1LT1A 3M9HA 3PTZA 4W7YA 1GL2B 3L71D 1GL2A 1GW4A 4TT3H 3V4WA 3WU2E 1M90Q 4Y28J 1S4XA 3PP5A 1KORA 3F89A 3BVHA 2E74C 1WT6A 2QJYB 1YQ3C 2ZXXA 3K5BA 1IFNA 5KAFH 5KTBA 2Q3EA 1URQC 3A0BE 1IZNB 2OYHB 1NU1G 2WSEH 1J1EB 1FE6A 1IK7A 4IOIH 4D6TJ 2XZRA 3BRVB 2OQQA 1URQD 1S5LE 2HG5D 5AW9B 1QL1A 4EYYQ 4EOTA 3SWKA 1FZAA 1OFCX 3LIDA 3V2RA 3ABVC 2A06G 1OVVA 2P7JA 2Z5IA 2WTYA 1EQ7A 1TU3F 1L0LK 2ITAA 1YJWP 1KC8Q 3S9OA 1RHZB 3JSVC 2FYUE 2H89C 3L75J 3RK2C 4JQ0D 4OVNF 1FDIA 3E7KA 1HTLC 3II6A 1JTHA 5AW5B 1JTHB 1L0ND 2IYPA 1VQ9P 2B9BA 3TK1A 1H88A 2H7HA 1KILD 1HWTC 1BDCA 1HGVA 1OVUA 2PAJA 1ZRTE 4PD4D 1KQGB 5K5GB 3Q5SA 4I1LA 3V2QA 3BCCJ 1EXIA 1VDFA 2KNCA 1M1JB 1LTTC 1MFZA 2V7QH 2ZT9B 3EQ2A 4NPDA 1DX7A 2NPSB 1SQXJ 2PGDA 3CWBG 2Y9ZA 2MJZA 3H1LG 1GL2C 2WPVB 2XV5A 4BWNA 1U57A 2IZ0A 2A45G 5GTIE 2GA1A 3IAOA 1J1DB 1Q82Q 3H1JG 1MZ9A 1KB9H 1N7SD 2E75D 3C9IA 2JO1A 3TF5A 4UB6H 1S5LH 2Q7CA 1R5SA 1XTCC 2YKQA 4U3FJ 2Y0EA 3NXSA 1SQQD 3H1KD 1MKMA 2N9YB 3QH9A 3MUDC 1IC2A 3AE5C 3P7KA 1NKNA 1WRGA 2KYVA 4WY4D 5APSA 2Y9YA 2GM4A 2AEJA 1T2KD 1OWAA 4L74A 5L8RJ 1PGPA 3KZIE 1W2EA 2KP8A 4WY4A 1RF1A 1NTZD 1L0LD 1OIPA 2A45I 3TGUE 4OGQB 3HUSC 1NTKJ 2O1JA 2O1KA 3KQGA 4HB1A 2LXBA 5TJHA 1VQPP 1Q86Q 2O01H 2ZFCA 3P8CE 5KJ7C 1QGKB 1Q2NA 1SQQJ 1AVYA 1PGJA 2YIUC 3KDPB 4UB8H 4YXDC 3Q2YA 2M5AB 3RBZA 2M5AA 3CCJP 3CC2P 1PP9E 2D2CD 5E79E 1HJ0A 4DCKA 1IO4A 1N7SB 5AW6B 2D2CB 3H1LD 3H1HE 1SQVD 1ZOYC 2QEXP 1L0NG 2BEZF 2D2CC 3Q3DA 1LP1A 2Y0CA 5TISE 1FU1A 2OTJP 1BGYD 1SQPG 3L73G 4LLHA 1UIXA 2MKVA 3G71P 3G6EP 1NTMJ 2OTKE 4C7NB 4U3FE 1K05A 3TSIA 5CCGA 1GU4A 2IBZD 1A02F 3TGUJ 2V4HA 1HJBA 1MUUA 3MUDA 3L71G 2WT7B 5KLVD 2KSJA 1NGMB 4H0LD 2E74B 1E79H 2DW3A 5APUA 1JO5A 2WSFH 3PJSK 1OW8A 1SQBK 2GUSA 3AEEC 4WY4C 2WVRA 4NPFX 4N3YB 1WMKA 1R8EA 1NHLA 1NOHA 1VL2A 4GT1A 2XDJA 2FXMA 2C0XA 1SQXE 2OARA 1T3UA 2PP6A 4JBZA 4TLFA 5AVTB 1T6AA 4C7RA 2LXCB 2N1TD 4M3LA 1USEA 1KILB 4PD4I 3V5BA 2I8DA 2NRGA 4MN4C 4BRYB 5B5EH 1GU5A 1YI2P 2YNYA 1GL2D 3CXHH 1EZVI 1R5LA 2E5YA 2G8YA 3HUSB 1PGOA 5APTA 2QM8A 4BXLA 1RF1C 1N7SA 3QWOC 1VQOP 1IFPA 1L2PA 1KZUB 2E76C 3RBXA 2HPCB 4AYCA 1NTME 1OW7A 3M9QA 3RK3E 1NH4A 5APYA 5APVA 4D6TD 1YTZI 2ZT9C 2ZYGA 1RY3A 1LWUB 2IDBA 3MD0A 4GOEA 2O01J 4HH2A 1ZR4A 1GDTA 3P8MC 4GKGA 2FFDC 1KD1Q 1ZW0A 4D6TG 1M7LA 4Y99C 3W67A 2R5BA 1FZCA 2K9JA 5AVZB 4IFDK 3L70J 5AVYB 1DD3A 1S1CX 1LTJB 1AVOA 1N86A 1HVVA 2IFMA 2JWDA 3L73D 4ZKUA 3CCEP 1CI6A 1XTGB 3I55P 2A45H 1JM0A 1JY2P 2J5UA 1FJPA 3B5NC 5AVXB 1NYHA 1KILA 1KFNA 3HE5B 2Q5UA 1S72P 1AQTA 1VQ7P 1Q81Q 1URQB 3MZWB 3L4FA 1FS0E 5KKZC 1KYOI 3KYQA 4WVZA 1SQVG 3H1HJ 3AE3C 4RESB 2H8PD 1S9KD 2J58A 3HUSA 3JCUE 3ZDMA 4DJGA 1LTJC 1KN7A 2FYUK 2R44A 2QVAA 1SQBD 1KB9I 3FXEA 1Y8AA 1P84E 2ZJSE 3CXHE 1NTZJ 2FXPA 2YKOA 1NU1D 5B5EE 2WSSH 5KLVG 1SQPE 3L73E 4H44B 2J59M 4R4LA 1NTZE 2IYOA 1OW6A 1X79B 4ASWA 4U3FG 3TGUD 2OYHA 3A0BH 2Q6QA 4WWIA 4LC1A 1N73A 4H13C 1X22A 3P8CD 4ZMDA 3WMM0 1L4AC 1SFCA 1FZCB 2K9JB 1NWQA 1QEXA 1JUNA 2K88A 2PRRA 3CPWO 1KTMA 3EWKA 2E76B 1GK4A 1JNMA 1RE4A 3G9RA 1KB9D 1L0NK 3L72G 4YPCA 2KSEA 1NTKG 2NPSC 4IL6E 1VF5D 3R4YA 3SSUA 3T97A 1NKZB 3H1HD 3FGAD 3G3ZA 3H32B 3AEFC 5AW2B 3BATA 1JCDA 3WUUA 3MGNA 1AQ5A 2K9YA 4JYBA 1IFJA 3L35A 4KHXA 4N78E 1VQ8P 3BCCD 1VQKP 4LGDE 1USDA 2NPSA 2E76D 2QE7H 5KLVK 1KQFB 2KK7A 1AV1A 4OH8B 1EDJA 1GZLA 1EZVD 1VQMP 1H8AA 1GTWA 1FAVA 1JOCA 3H1IJ 1G1IA 2B87B 3KPEA 3VYIA 5E79H 2FBWC 1IFIA 1NTMG 3H1KG 3TDKA 1BE3D 1U7MA 2BCCD 1QL2A 5KLIB 2FXOA 3FXDA 2OYHC 2KLUA 2QG4A 1RQUA 1RH5B 3M0DA 1NVOA 2ZYAA 4Z1MH 4A7PA 2RMZA 1BCCG 1KILE 3CC4P 4H44C 3B5NB 1E5WA 2W8ZA 3A3YB 3H1ID 2FYZA 3RK2B 2WMMA 1VQNP 1RQVA 3FX0A 4CPGA 3AEAC 4IFMA 3M0DC 1GD2E 4H0LC 2FFDA 2RKLA 1Q7YQ 2C9NY 1GK6A 2KZIA 3LW5J 4XA4A 1PP9J 1Y47A 1PPJE 3A0HH 2P10A 3L75G 1J1EC 3VP8A 5CCGC 3A5TA 3D6YA 1NTMD 3RK3D 1LTAC 2NPSD 4UB6E 1K04A 3N7NA 2I1JA 2QJYC 4ZKPA 1FDOA 2KOGA 1T8ZA 5CCHA 3BASA 1S3JA 1ZN5A 4I2LC 3SFDC 2YXQB 3KZIH 2IZ1A 1EDKA 1FZFA 3GG2A 1N73C 3AE6C 1MFTA 2OTLP 3NTNA 3NFQA 1LTGC 1M56D 3CWBJ 5AW1B 1YBKA 5CJ0A 5H2FE 2AEMA 2Q1KA 3CL3D 4ZNCA 4IL6X 4DOJA 2N1TB 5KAIE 1ZLLA 5APXA 1LT9B 5B66H 5CCHD 3OW2O 4L75A 1VF5B 2K3RA 1D7MA 1YHQP 2XNDH 5CJ4A 3D71A 3L74E 5BVZA 3B5NA 3Q5RA 5AVSB 5KJ7A 1T2KC 1PP9D 3S1KA 3L71J 3WU2H 3WUVA 2JEEA 2WSEJ 2AXTE 2R5DA 3L36A 1S9KE 3GW6A 1BSNA 4U7JA 1SQBG 1KMIZ 1LNQA 3L72E 1P84I 1M1JC 2QJPC 2M3EA 5GTHE 3A7OA 1JY3O 2L5GB 3L72J 3U1CA 5KAFE 4OGQD 4PJ0H 1MV8A 3TYYA 3PLNA 1NO4A 2Q9IA 3AE7C 1HUCA 1NTKD 4EIJA 4KJMA 3KXDA 3CWBE 1X9VA 1JMBA 1OX3A 2IX7C 4IL6H 4RKUJ 2POHA 3G4SP 2HPCA 3CX5H 3BRTB 2E42A 3AE4C 1LT9A 3M91A 1X0TA 1S5LX 2Q3IA 3VMZA 1KYOE 2WWWA 3CC7P 2WSCJ 1EXJA 3H1KE 1HH0A 2BASA 1FOSF 4PJ0E 4RO0A 3L70E 1NTMK 2KZJA 2YMKA 1Z56A 2W6JH 2JR8A 1BCCE 3HTKB 1AA0A 1JY3N 2QJKC 3V4QA 1M1KQ 1LJ2A 2ZVNB 3MTUE 2FYUG 2Z4EA 1LTJA 3LW5H 2KI7B 1PZQA 1G2CB 3NMDA 2V7QJ 5AVVB 2E5TA 5DJTB 5AW0B 1RF1B 3CMEP 1SQBJ 2P2UA 4JPZB 1CW5A 3B71A 1SQXK 3LIEA 3OAKA 3U59A 2JWAA 3IR9A 3CMAP 1H0TA 1FBMA 1IFDA 2OGUA 3AE9C 5APWA 1JY2N 1BE3G 1SQQK 2BCCG 2L91A 3CX5D 3PHLA 1LWUC 1QX8A 1ZRTD 3H32A 4GOFA 1GMJA 3UIAA 4O9BA 2WPRA 3BCCG 3GMAA 1BGYJ 3H1LE 4HKZH 1OXZA 2WZ7A 5GTHH 1VQLP 3MHVA 2AXCA 3CXHI 2E43A 3MIWA 3VTPC 4YTPC 1SQPJ 3AE1C 3L73J 3H1HG 2LR2A 3H1JE 3TNUB 3H25A 3E1RA 4U3FD 3SFEC 3TGUG 1FZCC 3H1IE 2WITA 4DZOA 2KB7P 4UB8E 5CCHC 2KXPB 2WT7A 1VQ5P 3N4XA 4XE5B 4DT0A 4YXWH 3IF4A 3RL0D 3VN0A 5AW4B 3W68A 5B66E 3L71E 3CCRP 5GTIH 4I6MC 2B88A 2FYUD 3CCQP 3RL0B 2HR3A 3HD7D 3EFGA 2OYIC 3H6PA 3RL0C 3RK3B 5AVRB 3U1AA 3I56P 3RGUA 2XKMA 3ITKA 2O3JA 4PD4E 2B89A 1SQBE 2XU6A 3GF7A 1M57D 5AW8B 5CCGD 2A06D 3CCSP 2FFDB 1DEEG 1EC5A 2AEFA 2FKWB 2P58A 3WUTA 2YIUB 1IFMA 1QLED 3CCMP 1VPCA 3L37A 3VMAA 3O6QA 3VMXA 1OVRA 2KIKA 1LTIC 2JJLA 1H0TB 1X8YA 5APQA 3TNUA 2HFED 1M1JA 2GUVA 3HE4B 1L0NE 3HE4A 2HODB 2R3SA 1SQVJ 1NAFA 3RL0g 1K73Q 4AUWA 1QVFO 3CD6P 1HF9A 4W80A 1VQ6P 3IN6A 4Y99B 1SLQA 1N73B 2JP3A 2E75C 2IPPA 5EFWB 3JC22 5CBOA 4C7NA 3L72D 4H13D 2N1TA 5KLVJ 2WQYC 4N6JA 3AECC 1SQPK 3USSA 3L70G 1DEBA 3GLMA 1GW3A 3L74J 1N8RQ 2W83C 1CI6B 4N78D 1JB0J 5KJ7D 3SWYA 2OYIA 4WY4B 1ZP0C 2ZYDA 1EDLA 4GIFA 4GODA 1SQQG 2QJKB 1YTZT 1BSHA 2KLVA 3HE5A 2K37A 3T97B 1KILC 4W7ZA 1SQXG 2RH0A 1FJKA 1U7JA 3R2PA 4H13B 4HYTB 4C46A 1VQ4P 1VF5C 1L0LJ 1KYOD 1AFOA 1K8AQ 1LT9C 1FZEA 1BE3E 1FC2C 1CZQA 2BCCE 2FY8A 3FWNA 1L0NJ 3GHGB 2WPSA 4WBAA 1SQVE 5AVWB 1L0LE 1SS1A 2B87A 3BCCE 2H43A 2O01N 2RN0A 3CXHD 3L75D 5H2FH 4EI2A 1OMIA 1BGYE 1N7SC 1LGHB 3H1LJ 2R3CA 1HBWA 2YO3A 1EZVE 2YXRB 4K3AA 1K9MQ 2PFXA 3HD7A 3HD7B 3JCUH 3KHUA 1CSBA 2M0BA 3E1IA 5C39A 1JY2O 2E74D 3GF3A 2P1JA 1LP1B 3H1IG 3H1JJ 3V2NA 5KKZB 5KLVE 3CCUP 3D6ZA 4D6TE 1FOSE 1SP4A 1ZMEC 4PV1B 1NU1J 2WSFJ 3CX5I 2ZXEB 3C8VA 1OZHA 1YQ4C 2W6BA 3M0AA 2QJPB 5KLIC 1PV3A 4HJGH 1KFMA 2ZT9D 3SWFA 3OA7A 5AVUB 1KB9E 3IFMA 2Z5HA 2IBZG 2OYIB 1P84H 1PFIA 1YJNP 1IJDB 2I1KA 1NJIQ 5AVQB 1BDDA 2SPZA 1PL5A 3GHGC 1KQLA 1SQXD 3AEGC 3FWLA 2ZVOB 3HRNA 3RK2D 1KV4A 3V6IA 3PRJA 1DIPA 3B5ND 3M06A
chains in the Genus database with same CATH topology
2YKPA 2N1TC 2C9LY 1FZBA 2M8RA 1NTZK 5CMZA 3GHGA 2QM7A 3P32A 4AQRD 1SQVK 4IFFA 1RF0A 2N9BA 1J2JB 3VMYA 1LWUA 2IFNA 2W6AA 2R32A 1RF0C 2P67A 1H89A 2WPQA 1RE3C 3OJAB 4WB4A 3CI9A 1G1JA 1SFCD 1JY3P 4JYCA 3V2PA 5AW7B 4JF7A 1RE3A 1URQA 1FDMA 5BU5A 2C0WA 1DH3A 5AW3B 2M3BA 1LTSC 5BU8B 3RK3C 1JMMA 2LKMA 2HYNA 2CPSA 3CLQA 2XNXA 2HODA 2C9NY 3B8EB 2E42A 1A02J 1FZGA 2WSCH 1LTBC 1ZV8A 1HGZA 1N2DC 1NU1K 2YMYA 3I5CA 5CHXA 1SFCB 3A2AA 1G2CA 1RF1A 1JCCA 3HD7C 3HTKA 4B86A 1L4AD 1NTKK 2CPBA 1YYCA 2W27A 1L4AA 1SFCC 1L4AB 2YO2A 3VP9A 2VRSA 1RE4C 1N7LA 3O8ZA 3M9BA 1IK9A 3VOPA 1J1DC 1SVFA 1T3JA 2HLOA 4W7YA 3M9HA 5APSA 1GL2B 1GL2A 1GW4A 3V4WA 3PP5A 3BVHA 1WT6A 1IFNA 5KTBA 1URQC 2OYHB 2WSEH 1J1EB 2XZRA 3BRVB 5AW9B 1URQD 2HG5D 1QL1A 3V2RA 1FZAA 3LIDA 2P7JA 2Z5IA 2WTYA 1EQ7A 1L0LK 3RK2C 3II6A 1HTLC 1JTHA 5AW5B 1JTHB 3TK1A 1H88A 2H7HA 1KILD 1HWTC 1HGVA 2PAJA 4I1LA 3V2QA 1VDFA 1M1JB 1LTTC 1MFZA 3EQ2A 1DX7A 2NPSB 2MJZA 1GL2C 2XV5A 2A45G 1J1DB 1MZ9A 1N7SD 3C9IA 2Q7CA 1XTCC 2YKQA 3NXSA 1ZR2A 1IC2A 3P7KA 1NKNA 1WRGA 2KYVA 4WY4D 2GM4A 1T2KD 1OWAA 4WY4A 1W2EA 2KP8A 2A45I 3HUSC 2O1JA 3KQGA 2O1KA 2O01H 2ZFCA 3P8CE 5KJ7C 3KDPB 1IO4A 1N7SB 5AW6B 1FU1A 4LLHA 4C7NB 5CCGA 3TSIA 1GU4A 1HJBA 1MUUA 3MUDA 2WT7B 2KSJA 5APUA 1JO5A 2WSFH 1SQBK 2GUSA 4WY4C 4N3YB 1NHLA 1NOHA 4GT1A 2XDJA 2FXMA 2C0XA 2OARA 2PP6A 1T3UA 5AVTB 4C7RA 4EOTA 2N1TD 4M3LA 1N73C 1KILB 3V5BA 1GU5A 2YNYA 1GL2D 3HUSB 5APTA 2QM8A 1RF1C 1N7SA 1KZUB 2HPCB 4AYCA 3M9QA 1NH4A 5APYA 5APVA 1YTZI 1RY3A 1LWUB 1GDTA 3MD0A 1ZR4A 4HH2A 3P8MC 4GKGA 2FFDC 1M7LA 4Y99C 2R5BA 1FZCA 5AVZB 4IFDK 5AVYB 1LTJB 2IFMA 4ZKUA 1N86A 1HVVA 1CI6A 1XTGB 2A45H 1JY2P 1FJPA 3B5NC 5AVXB 1KILA 1KFNA 3HE5B 2Q5UA 1URQB 3L4FA 3KYQA 4RESB 2H8PD 1S9KD 2J58A 3HUSA 1LTJC 2FYUK 2YKOA 2J59M 1X79B 2OYHA 4LC1A 1N73A 3P8CD 3WMM0 1L4AC 1SFCA 1FZCB 1NWQA 1JUNA 1JNMA 1GK4A 1RE4A 1L0NK 2NPSC 3T97A 1NKZB 3G3ZA 3H32B 1AQ5A 5AW2B 3BATA 1JCDA 3MGNA 4JYBA 1IFJA 3L35A 4KHXA 4N78E 4LGDE 2NPSA 5KLVK 4OH8B 1GZLA 1H8AA 1GTWA 1FAVA 1JOCA 1G1IA 3KPEA 3VYIA 1IFIA 2OYHC 1QL2A 3M0DA 3B5NB 1E5WA 3A3YB 3RK2B 2FYZA 4IFMA 1GD2E 3M0DC 2FFDA 1GK6A 4XA4A 3VP8A 3A5TA 1J1EC 5CCGC 3RK3D 1LTAC 2NPSD 3N7NA 2I1JA 4ZKPA 2KOGA 1T8ZA 5CCHA 3BASA 4I2LC 1ZN5A 1FZFA 3NTNA 3NFQA 1LTGC 5AW1B 5CJ0A 3CL3D 4DOJA 2N1TB 1ZLLA 5APXA 1LT9B 5CCHD 5CJ4A 5BVZA 3B5NA 5AVSB 5KJ7A 1T2KC 2JEEA 3L36A 2R5DA 1S9KE 1M1JC 3A7OA 1JY3O 2L5GB 3U1CA 1MV8A 3TYYA 1NO4A 2Q9IA 1HUCA 4EIJA 1X9VA 2IX7C 2POHA 2HPCA 3BRTB 1LT9A 3M91A 2Q3IA 3VMZA 2WWWA 1HH0A 2BASA 1FOSF 1NTMK 1Z56A 2Z4EA 3V4QA 3HTKB 1JY3N 3MTUE 1LTJA 3LW5H 3NMDA 1G2CB 5AVVB 5AW0B 1RF1B 2P2UA 1CW5A 3U59A 1SQXK 3LIEA 3OAKA 3IR9A 1FBMA 1IFDA 5APWA 1JY2N 1SQQK 1LWUC 3H32A 3UIAA 4O9BA 2WPRA 1OXZA 2WZ7A 2E43A 3MIWA 3VTPC 3TNUB 1FZCC 2WITA 4DZOA 2KB7P 5CCHC 2WT7A 3N4XA 4XE5B 3RL0D 3VN0A 5AW4B 4I6MC 3RL0B 3HD7D 3EFGA 2OYIC 3H6PA 3RL0C 3RK3B 5AVRB 3U1AA 2XKMA 2XU6A 5AW8B 5CCGD 2FFDB 2FKWB 1A02F 1IFMA 1VPCA 3L37A 3VMXA 1LTIC 2JJLA 1X8YA 5APQA 3TNUA 2HFED 1M1JA 2GUVA 3HE4B 3HE4A 2HODB 1NAFA 4AUWA 4W80A 4Y99B 1SLQA 1N73B 2IPPA 4C7NA 2N1TA 4N6JA 1SQPK 1DEBA 1GW3A 2OYIA 3SWYA 1CI6B 4N78D 5KJ7D 4WY4B 4GIFA 1YTZT 2KLVA 3HE5A 1KILC 4W7ZA 1FJKA 3R2PA 4HYTB 4C46A 1AFOA 1LT9C 1FZEA 1CZQA 3GHGB 4WBAA 5AVWB 2WPSA 2H43A 1HBWA 1N7SC 1LGHB 2R3CA 2YO3A 3HD7A 3HD7B 1CSBA 3E1IA 1JY2O 2P1JA 3V2NA 1FOSE 1SP4A 2ZXEB 2W6BA 3M0AA 3SWFA 1KFMA 3OA7A 5AVUB 1PFIA 3IFMA 2Z5HA 2OYIB 1IJDB 2I1KA 5AVQB 3GHGC 1KQLA 3RK2D 3HRNA 3B5ND 3M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2C B;  5AVV B;  5AW0 B;  4LC1 A;  2C9L Y;  2P2U A;  5CMZ A;  2QM7 A;  1NWQ A;  3LIE A;  3OAK A;  1JUN A;  2Q7C A;  3IR9 A;  5APW A;  3P32 A;  1GK4 A;  1JNM A;  3NXS A;  4AQR D;  3UIA A;  2N9B A;  2WPR A;  3P7K A;  3T97 A;  1OXZ A;  1J2J B;  1T2K D;  1OWA A;  5AW2 B;  2E43 A;  3MGN A;  3VTP C;  3VMY A;  2KP8 A;  4JYB A;  3TNU B;  3L35 A;  4KHX A;  2W6A A;  2R32 A;  2P67 A;  3KQG A;  4DZO A;  1H89 A;  2WPQ A;  2ZFC A;  1GZL A;  2WT7 A;  4XE5 B;  3KDP B;  1H8A A;  1GTW A;  1FAV A;  3VN0 A;  4JYC A;  5AW4 B;  3VYI A;  5AW7 B;  4I6M C;  1IO4 A;  5AW6 B;  3M0D A;  5AVR B;  1DH3 A;  5AW3 B;  4C7N B;  2XU6 A;  5AW8 B;  3A3Y B;  1GU4 A;  1HJB A;  1A02 F;  1MUU A;  2WT7 B;  3L37 A;  1GD2 E;  3VMX A;  2C9N Y;  2JJL A;  3B8E B;  1GK6 A;  1X8Y A;  5APU A;  1A02 J;  2E42 A;  5APQ A;  3A5T A;  3TNU A;  3HE4 B;  3HE4 A;  1NAF A;  4AUW A;  3I5C A;  3A2A A;  4I2L C;  4GT1 A;  1SLQ A;  3HTK A;  4B86 A;  2IPP A;  5AVT B;  4EOT A;  4C7N A;  3NTN A;  3NFQ A;  4M3L A;  5AW1 B;  3V5B A;  1YYC A;  2W27 A;  1GU5 A;  2YNY A;  2YO2 A;  5APT A;  2QM8 A;  5APX A;  1CI6 B;  2VRS A;  4AYC A;  3O8Z A;  3HE5 A;  5APY A;  5APV A;  3M9B A;  5AVS B;  5APS A;  1T2K C;  3MD0 A;  3M9H A;  4C46 A;  4HYT B;  3P8M C;  4GKG A;  3V4W A;  3L36 A;  2R5D A;  1S9K E;  1CZQ A;  2R5B A;  5AVW B;  5AVZ B;  2WPS A;  3A7O A;  5AVY B;  1HBW A;  2R3C A;  1MV8 A;  1CI6 A;  3TYY A;  2YO3 A;  2XZR A;  5AW9 B;  1HUC A;  1CSB A;  5AVX B;  3LID A;  2P7J A;  2Z5I A;  3HE5 B;  2Q5U A;  2WTY A;  1FOS E;  1SP4 A;  2ZXE B;  3M0A A;  3M91 A;  5AW5 B;  2Q3I A;  3VMZ A;  4RES B;  1S9K D;  3TK1 A;  3SWF A;  1H88 A;  2H7H A;  1HWT C;  2WWW A;  5AVU B;  2BAS A;  2Z5H A;  1FOS F;  5AVQ B;  1MFZ A;  1KQL A;  3V4Q A;  2XV5 A;  3M06 A;  3NMD A; 
#chains in the Genus database with same CATH topology
 2YKP A;  2N1T C;  5KAI H;  1FZB A;  2C9L Y;  2M8R A;  4XFJ A;  1NTZ K;  5CMZ A;  3GHG A;  4OGQ C;  2QM7 A;  2JDI H;  2QIW A;  2G3A A;  3B4S A;  4BRY A;  2AXT H;  4RJT A;  1QVG O;  3P32 A;  3VOP A;  4AQR D;  1SQV K;  4IFF A;  1W5C E;  1YIJ P;  1RF0 A;  4PV1 D;  2N9B A;  1P84 D;  1NTZ G;  1PIX A;  3MP7 B;  1J2J B;  1NU1 E;  3VMY A;  1ZXG A;  1EDI A;  1W2B O;  3A0H E;  1LWU A;  2IFN A;  2W6A A;  2E75 B;  2R32 A;  1RF0 C;  2A06 E;  2P67 A;  2BEQ D;  3Q5P A;  2WPQ A;  1H89 A;  2KUB A;  1RE3 C;  3OJA B;  4WB4 A;  3L74 D;  3CI9 A;  3AED C;  1KQS O;  1G1J A;  4I7Z B;  5DJU B;  1NTK E;  1DD4 A;  1JY3 P;  1SFC D;  2KS1 A;  4JYC A;  4QMA A;  3V2P A;  5AW7 B;  1SQQ E;  2NZ2 A;  4JF7 A;  2FYU J;  4EDF A;  1RE3 A;  1Y9B A;  4GDO A;  1PPJ G;  4R4M A;  1URQ A;  3AE8 C;  1FDM A;  2UWJ E;  5BU5 A;  2C0W A;  4PD4 H;  1DH3 A;  1NAY A;  5AW3 B;  2M3B A;  1LTS C;  5BU8 B;  3O6Q B;  4OWF A;  1JMM A;  4H0L B;  3RK3 C;  2LKM A;  5M1B A;  1L0L G;  2HYN A;  2QA4 P;  1ZR2 A;  1BCC D;  2CPS A;  3CWB D;  3Q1M A;  1BGY G;  1PGQ A;  1SQP D;  2CK3 H;  2HOD A;  2QRX A;  2XNX A;  1JEK A;  3B8E B;  3C1L A;  3CLQ A;  1EZV G;  3S4R A;  2WSC H;  5CBN A;  1FZG A;  1A02 J;  1LTB C;  1ZV8 A;  1HGZ A;  1N2D C;  1NU1 K;  2FYN B;  2YMY A;  2QSI A;  4L76 A;  4PV1 C;  3CCL P;  3H1K J;  3I5C A;  4H44 D;  4L73 A;  5CHX A;  4KT0 J;  1SFC B;  1YJ9 P;  3A2A A;  1S2E A;  1G2C A;  3L70 D;  1JCC A;  3F5H A;  3HD7 C;  3HTK A;  3L74 G;  2KS1 B;  2OYO A;  4B86 A;  1BCC J;  4NPE A;  1L4A D;  4I7Z C;  5TIS H;  2W90 A;  2H88 C;  1NTK K;  2IBZ E;  3CCV P;  2CPB A;  1YYC A;  2W27 A;  2Y0D A;  1L4A A;  1SFC C;  1L4A B;  2IBZ I;  2YO2 A;  3L75 E;  1YIT P;  3VP9 A;  3D70 A;  1AJY A;  3AE2 C;  3H1J D;  2FYN C;  2K1A A;  2JKV A;  2VRS A;  1PP9 G;  2ZAE B;  1PPJ D;  1UII A;  3EFF K;  1RE4 C;  1KYO H;  1Q90 D;  4K35 A;  4ASV A;  1M8O B;  1N7L A;  3O8Z A;  3PH0 A;  3CX5 E;  3M9B A;  1BE3 J;  1IK9 A;  2BCC J;  2KNC B;  1J1D C;  1SVF A;  1T3J A;  2HLO A;  3AEB C;  1LT1 A;  3M9H A;  3PTZ A;  4W7Y A;  1GL2 B;  3L71 D;  1GL2 A;  1GW4 A;  4TT3 H;  3V4W A;  3WU2 E;  1M90 Q;  4Y28 J;  1S4X A;  3PP5 A;  1KOR A;  3F89 A;  3BVH A;  2E74 C;  1WT6 A;  2QJY B;  1YQ3 C;  2ZXX A;  3K5B A;  1IFN A;  5KAF H;  5KTB A;  2Q3E A;  1URQ C;  3A0B E;  1IZN B;  2OYH B;  1NU1 G;  2WSE H;  1J1E B;  1FE6 A;  1IK7 A;  4IOI H;  4D6T J;  2XZR A;  3BRV B;  2OQQ A;  1URQ D;  1S5L E;  2HG5 D;  5AW9 B;  1QL1 A;  4EYY Q;  4EOT A;  3SWK A;  1FZA A;  1OFC X;  3LID A;  3V2R A;  3ABV C;  2A06 G;  1OVV A;  2P7J A;  2Z5I A;  2WTY A;  1EQ7 A;  1TU3 F;  1L0L K;  2ITA A;  1YJW P;  1KC8 Q;  3S9O A;  1RHZ B;  3JSV C;  2FYU E;  2H89 C;  3L75 J;  3RK2 C;  4JQ0 D;  4OVN F;  1FDI A;  3E7K A;  1HTL C;  3II6 A;  1JTH A;  5AW5 B;  1JTH B;  1L0N D;  2IYP A;  1VQ9 P;  2B9B A;  3TK1 A;  1H88 A;  2H7H A;  1KIL D;  1HWT C;  1BDC A;  1HGV A;  1OVU A;  2PAJ A;  1ZRT E;  4PD4 D;  1KQG B;  5K5G B;  3Q5S A;  4I1L A;  3V2Q A;  3BCC J;  1EXI A;  1VDF A;  2KNC A;  1M1J B;  1LTT C;  1MFZ A;  2V7Q H;  2ZT9 B;  3EQ2 A;  4NPD A;  1DX7 A;  2NPS B;  1SQX J;  2PGD A;  3CWB G;  2Y9Z A;  2MJZ A;  3H1L G;  1GL2 C;  2WPV B;  2XV5 A;  4BWN A;  1U57 A;  2IZ0 A;  2A45 G;  5GTI E;  2GA1 A;  3IAO A;  1J1D B;  1Q82 Q;  3H1J G;  1MZ9 A;  1KB9 H;  1N7S D;  2E75 D;  3C9I A;  2JO1 A;  3TF5 A;  4UB6 H;  1S5L H;  2Q7C A;  1R5S A;  1XTC C;  2YKQ A;  4U3F J;  2Y0E A;  3NXS A;  1SQQ D;  3H1K D;  1MKM A;  2N9Y B;  3QH9 A;  3MUD C;  1IC2 A;  3AE5 C;  3P7K A;  1NKN A;  1WRG A;  2KYV A;  4WY4 D;  5APS A;  2Y9Y A;  2GM4 A;  2AEJ A;  1T2K D;  1OWA A;  4L74 A;  5L8R J;  1PGP A;  3KZI E;  1W2E A;  2KP8 A;  4WY4 A;  1RF1 A;  1NTZ D;  1L0L D;  1OIP A;  2A45 I;  3TGU E;  4OGQ B;  3HUS C;  1NTK J;  2O1J A;  2O1K A;  3KQG A;  4HB1 A;  2LXB A;  5TJH A;  1VQP P;  1Q86 Q;  2O01 H;  2ZFC A;  3P8C E;  5KJ7 C;  1QGK B;  1Q2N A;  1SQQ J;  1AVY A;  1PGJ A;  2YIU C;  3KDP B;  4UB8 H;  4YXD C;  3Q2Y A;  2M5A B;  3RBZ A;  2M5A A;  3CCJ P;  3CC2 P;  1PP9 E;  2D2C D;  5E79 E;  1HJ0 A;  4DCK A;  1IO4 A;  1N7S B;  5AW6 B;  2D2C B;  3H1L D;  3H1H E;  1SQV D;  1ZOY C;  2QEX P;  1L0N G;  2BEZ F;  2D2C C;  3Q3D A;  1LP1 A;  2Y0C A;  5TIS E;  1FU1 A;  2OTJ P;  1BGY D;  1SQP G;  3L73 G;  4LLH A;  1UIX A;  2MKV A;  3G71 P;  3G6E P;  1NTM J;  2OTK E;  4C7N B;  4U3F E;  1K05 A;  3TSI A;  5CCG A;  1GU4 A;  2IBZ D;  1A02 F;  3TGU J;  2V4H A;  1HJB A;  1MUU A;  3MUD A;  3L71 G;  2WT7 B;  5KLV D;  2KSJ A;  1NGM B;  4H0L D;  2E74 B;  1E79 H;  2DW3 A;  5APU A;  1JO5 A;  2WSF H;  3PJS K;  1OW8 A;  1SQB K;  2GUS A;  3AEE C;  4WY4 C;  2WVR A;  4NPF X;  4N3Y B;  1WMK A;  1R8E A;  1NHL A;  1NOH A;  1VL2 A;  4GT1 A;  2XDJ A;  2FXM A;  2C0X A;  1SQX E;  2OAR A;  1T3U A;  2PP6 A;  4JBZ A;  4TLF A;  5AVT B;  1T6A A;  4C7R A;  2LXC B;  2N1T D;  4M3L A;  1USE A;  1KIL B;  4PD4 I;  3V5B A;  2I8D A;  2NRG A;  4MN4 C;  4BRY B;  5B5E H;  1GU5 A;  1YI2 P;  2YNY A;  1GL2 D;  3CXH H;  1EZV I;  1R5L A;  2E5Y A;  2G8Y A;  3HUS B;  1PGO A;  5APT A;  2QM8 A;  4BXL A;  1RF1 C;  1N7S A;  3QWO C;  1VQO P;  1IFP A;  1L2P A;  1KZU B;  2E76 C;  3RBX A;  2HPC B;  4AYC A;  1NTM E;  1OW7 A;  3M9Q A;  3RK3 E;  1NH4 A;  5APY A;  5APV A;  4D6T D;  1YTZ I;  2ZT9 C;  2ZYG A;  1RY3 A;  1LWU B;  2IDB A;  3MD0 A;  4GOE A;  2O01 J;  4HH2 A;  1ZR4 A;  1GDT A;  3P8M C;  4GKG A;  2FFD C;  1KD1 Q;  1ZW0 A;  4D6T G;  1M7L A;  4Y99 C;  3W67 A;  2R5B A;  1FZC A;  2K9J A;  5AVZ B;  4IFD K;  3L70 J;  5AVY B;  1DD3 A;  1S1C X;  1LTJ B;  1AVO A;  1N86 A;  1HVV A;  2IFM A;  2JWD A;  3L73 D;  4ZKU A;  3CCE P;  1CI6 A;  1XTG B;  3I55 P;  2A45 H;  1JM0 A;  1JY2 P;  2J5U A;  1FJP A;  3B5N C;  5AVX B;  1NYH A;  1KIL A;  1KFN A;  3HE5 B;  2Q5U A;  1S72 P;  1AQT A;  1VQ7 P;  1Q81 Q;  1URQ B;  3MZW B;  3L4F A;  1FS0 E;  5KKZ C;  1KYO I;  3KYQ A;  4WVZ A;  1SQV G;  3H1H J;  3AE3 C;  4RES B;  2H8P D;  1S9K D;  2J58 A;  3HUS A;  3JCU E;  3ZDM A;  4DJG A;  1LTJ C;  1KN7 A;  2FYU K;  2R44 A;  2QVA A;  1SQB D;  1KB9 I;  3FXE A;  1Y8A A;  1P84 E;  2ZJS E;  3CXH E;  1NTZ J;  2FXP A;  2YKO A;  1NU1 D;  5B5E E;  2WSS H;  5KLV G;  1SQP E;  3L73 E;  4H44 B;  2J59 M;  4R4L A;  1NTZ E;  2IYO A;  1OW6 A;  1X79 B;  4ASW A;  4U3F G;  3TGU D;  2OYH A;  3A0B H;  2Q6Q A;  4WWI A;  4LC1 A;  1N73 A;  4H13 C;  1X22 A;  3P8C D;  4ZMD A;  3WMM 0;  1L4A C;  1SFC A;  1FZC B;  2K9J B;  1NWQ A;  1QEX A;  1JUN A;  2K88 A;  2PRR A;  3CPW O;  1KTM A;  3EWK A;  2E76 B;  1GK4 A;  1JNM A;  1RE4 A;  3G9R A;  1KB9 D;  1L0N K;  3L72 G;  4YPC A;  2KSE A;  1NTK G;  2NPS C;  4IL6 E;  1VF5 D;  3R4Y A;  3SSU A;  3T97 A;  1NKZ B;  3H1H D;  3FGA D;  3G3Z A;  3H32 B;  3AEF C;  5AW2 B;  3BAT A;  1JCD A;  3WUU A;  3MGN A;  1AQ5 A;  2K9Y A;  4JYB A;  1IFJ A;  3L35 A;  4KHX A;  4N78 E;  1VQ8 P;  3BCC D;  1VQK P;  4LGD E;  1USD A;  2NPS A;  2E76 D;  2QE7 H;  5KLV K;  1KQF B;  2KK7 A;  1AV1 A;  4OH8 B;  1EDJ A;  1GZL A;  1EZV D;  1VQM P;  1H8A A;  1GTW A;  1FAV A;  1JOC A;  3H1I J;  1G1I A;  2B87 B;  3KPE A;  3VYI A;  5E79 H;  2FBW C;  1IFI A;  1NTM G;  3H1K G;  3TDK A;  1BE3 D;  1U7M A;  2BCC D;  1QL2 A;  5KLI B;  2FXO A;  3FXD A;  2OYH C;  2KLU A;  2QG4 A;  1RQU A;  1RH5 B;  3M0D A;  1NVO A;  2ZYA A;  4Z1M H;  4A7P A;  2RMZ A;  1BCC G;  1KIL E;  3CC4 P;  4H44 C;  3B5N B;  1E5W A;  2W8Z A;  3A3Y B;  3H1I D;  2FYZ A;  3RK2 B;  2WMM A;  1VQN P;  1RQV A;  3FX0 A;  4CPG A;  3AEA C;  4IFM A;  3M0D C;  1GD2 E;  4H0L C;  2FFD A;  2RKL A;  1Q7Y Q;  2C9N Y;  1GK6 A;  2KZI A;  3LW5 J;  4XA4 A;  1PP9 J;  1Y47 A;  1PPJ E;  3A0H H;  2P10 A;  3L75 G;  1J1E C;  3VP8 A;  5CCG C;  3A5T A;  3D6Y A;  1NTM D;  3RK3 D;  1LTA C;  2NPS D;  4UB6 E;  1K04 A;  3N7N A;  2I1J A;  2QJY C;  4ZKP A;  1FDO A;  2KOG A;  1T8Z A;  5CCH A;  3BAS A;  1S3J A;  1ZN5 A;  4I2L C;  3SFD C;  2YXQ B;  3KZI H;  2IZ1 A;  1EDK A;  1FZF A;  3GG2 A;  1N73 C;  3AE6 C;  1MFT A;  2OTL P;  3NTN A;  3NFQ A;  1LTG C;  1M56 D;  3CWB J;  5AW1 B;  1YBK A;  5CJ0 A;  5H2F E;  2AEM A;  2Q1K A;  3CL3 D;  4ZNC A;  4IL6 X;  4DOJ A;  2N1T B;  5KAI E;  1ZLL A;  5APX A;  1LT9 B;  5B66 H;  5CCH D;  3OW2 O;  4L75 A;  1VF5 B;  2K3R A;  1D7M A;  1YHQ P;  2XND H;  5CJ4 A;  3D71 A;  3L74 E;  5BVZ A;  3B5N A;  3Q5R A;  5AVS B;  5KJ7 A;  1T2K C;  1PP9 D;  3S1K A;  3L71 J;  3WU2 H;  3WUV A;  2JEE A;  2WSE J;  2AXT E;  2R5D A;  3L36 A;  1S9K E;  3GW6 A;  1BSN A;  4U7J A;  1SQB G;  1KMI Z;  1LNQ A;  3L72 E;  1P84 I;  1M1J C;  2QJP C;  2M3E A;  5GTH E;  3A7O A;  1JY3 O;  2L5G B;  3L72 J;  3U1C A;  5KAF E;  4OGQ D;  4PJ0 H;  1MV8 A;  3TYY A;  3PLN A;  1NO4 A;  2Q9I A;  3AE7 C;  1HUC A;  1NTK D;  4EIJ A;  4KJM A;  3KXD A;  3CWB E;  1X9V A;  1JMB A;  1OX3 A;  2IX7 C;  4IL6 H;  4RKU J;  2POH A;  3G4S P;  2HPC A;  3CX5 H;  3BRT B;  2E42 A;  3AE4 C;  1LT9 A;  3M91 A;  1X0T A;  1S5L X;  2Q3I A;  3VMZ A;  1KYO E;  2WWW A;  3CC7 P;  2WSC J;  1EXJ A;  3H1K E;  1HH0 A;  2BAS A;  1FOS F;  4PJ0 E;  4RO0 A;  3L70 E;  1NTM K;  2KZJ A;  2YMK A;  1Z56 A;  2W6J H;  2JR8 A;  1BCC E;  3HTK B;  1AA0 A;  1JY3 N;  2QJK C;  3V4Q A;  1M1K Q;  1LJ2 A;  2ZVN B;  3MTU E;  2FYU G;  2Z4E A;  1LTJ A;  3LW5 H;  2KI7 B;  1PZQ A;  1G2C B;  3NMD A;  2V7Q J;  5AVV B;  2E5T A;  5DJT B;  5AW0 B;  1RF1 B;  3CME P;  1SQB J;  2P2U A;  4JPZ B;  1CW5 A;  3B71 A;  1SQX K;  3LIE A;  3OAK A;  3U59 A;  2JWA A;  3IR9 A;  3CMA P;  1H0T A;  1FBM A;  1IFD A;  2OGU A;  3AE9 C;  5APW A;  1JY2 N;  1BE3 G;  1SQQ K;  2BCC G;  2L91 A;  3CX5 D;  3PHL A;  1LWU C;  1QX8 A;  1ZRT D;  3H32 A;  4GOF A;  1GMJ A;  3UIA A;  4O9B A;  2WPR A;  3BCC G;  3GMA A;  1BGY J;  3H1L E;  4HKZ H;  1OXZ A;  2WZ7 A;  5GTH H;  1VQL P;  3MHV A;  2AXC A;  3CXH I;  2E43 A;  3MIW A;  3VTP C;  4YTP C;  1SQP J;  3AE1 C;  3L73 J;  3H1H G;  2LR2 A;  3H1J E;  3TNU B;  3H25 A;  3E1R A;  4U3F D;  3SFE C;  3TGU G;  1FZC C;  3H1I E;  2WIT A;  4DZO A;  2KB7 P;  4UB8 E;  5CCH C;  2KXP B;  2WT7 A;  1VQ5 P;  3N4X A;  4XE5 B;  4DT0 A;  4YXW H;  3IF4 A;  3RL0 D;  3VN0 A;  5AW4 B;  3W68 A;  5B66 E;  3L71 E;  3CCR P;  5GTI H;  4I6M C;  2B88 A;  2FYU D;  3CCQ P;  3RL0 B;  2HR3 A;  3HD7 D;  3EFG A;  2OYI C;  3H6P A;  3RL0 C;  3RK3 B;  5AVR B;  3U1A A;  3I56 P;  3RGU A;  2XKM A;  3ITK A;  2O3J A;  4PD4 E;  2B89 A;  1SQB E;  2XU6 A;  3GF7 A;  1M57 D;  5AW8 B;  5CCG D;  2A06 D;  3CCS P;  2FFD B;  1DEE G;  1EC5 A;  2AEF A;  2FKW B;  2P58 A;  3WUT A;  2YIU B;  1IFM A;  1QLE D;  3CCM P;  1VPC A;  3L37 A;  3VMA A;  3O6Q A;  3VMX A;  1OVR A;  2KIK A;  1LTI C;  2JJL A;  1H0T B;  1X8Y A;  5APQ A;  3TNU A;  2HFE D;  1M1J A;  2GUV A;  3HE4 B;  1L0N E;  3HE4 A;  2HOD B;  2R3S A;  1SQV J;  1NAF A;  3RL0 g;  1K73 Q;  4AUW A;  1QVF O;  3CD6 P;  1HF9 A;  4W80 A;  1VQ6 P;  3IN6 A;  4Y99 B;  1SLQ A;  1N73 B;  2JP3 A;  2E75 C;  2IPP A;  5EFW B;  3JC2 2;  5CBO A;  4C7N A;  3L72 D;  4H13 D;  2N1T A;  5KLV J;  2WQY C;  4N6J A;  3AEC C;  1SQP K;  3USS A;  3L70 G;  1DEB A;  3GLM A;  1GW3 A;  3L74 J;  1N8R Q;  2W83 C;  1CI6 B;  4N78 D;  1JB0 J;  5KJ7 D;  3SWY A;  2OYI A;  4WY4 B;  1ZP0 C;  2ZYD A;  1EDL A;  4GIF A;  4GOD A;  1SQQ G;  2QJK B;  1YTZ T;  1BSH A;  2KLV A;  3HE5 A;  2K37 A;  3T97 B;  1KIL C;  4W7Z A;  1SQX G;  2RH0 A;  1FJK A;  1U7J A;  3R2P A;  4H13 B;  4HYT B;  4C46 A;  1VQ4 P;  1VF5 C;  1L0L J;  1KYO D;  1AFO A;  1K8A Q;  1LT9 C;  1FZE A;  1BE3 E;  1FC2 C;  1CZQ A;  2BCC E;  2FY8 A;  3FWN A;  1L0N J;  3GHG B;  2WPS A;  4WBA A;  1SQV E;  5AVW B;  1L0L E;  1SS1 A;  2B87 A;  3BCC E;  2H43 A;  2O01 N;  2RN0 A;  3CXH D;  3L75 D;  5H2F H;  4EI2 A;  1OMI A;  1BGY E;  1N7S C;  1LGH B;  3H1L J;  2R3C A;  1HBW A;  2YO3 A;  1EZV E;  2YXR B;  4K3A A;  1K9M Q;  2PFX A;  3HD7 A;  3HD7 B;  3JCU H;  3KHU A;  1CSB A;  2M0B A;  3E1I A;  5C39 A;  1JY2 O;  2E74 D;  3GF3 A;  2P1J A;  1LP1 B;  3H1I G;  3H1J J;  3V2N A;  5KKZ B;  5KLV E;  3CCU P;  3D6Z A;  4D6T E;  1FOS E;  1SP4 A;  1ZME C;  4PV1 B;  1NU1 J;  2WSF J;  3CX5 I;  2ZXE B;  3C8V A;  1OZH A;  1YQ4 C;  2W6B A;  3M0A A;  2QJP B;  5KLI C;  1PV3 A;  4HJG H;  1KFM A;  2ZT9 D;  3SWF A;  3OA7 A;  5AVU B;  1KB9 E;  3IFM A;  2Z5H A;  2IBZ G;  2OYI B;  1P84 H;  1PFI A;  1YJN P;  1IJD B;  2I1K A;  1NJI Q;  5AVQ B;  1BDD A;  2SPZ A;  1PL5 A;  3GHG C;  1KQL A;  1SQX D;  3AEG C;  3FWL A;  2ZVO B;  3HRN A;  3RK2 D;  1KV4 A;  3V6I A;  3PRJ A;  1DIP A;  3B5N D;  3M06 A; 
#chains in the Genus database with same CATH homology
 2YKP A;  2N1T C;  2C9L Y;  1FZB A;  2M8R A;  1NTZ K;  5CMZ A;  3GHG A;  2QM7 A;  3P32 A;  4AQR D;  1SQV K;  4IFF A;  1RF0 A;  2N9B A;  1J2J B;  3VMY A;  1LWU A;  2IFN A;  2W6A A;  2R32 A;  1RF0 C;  2P67 A;  1H89 A;  2WPQ A;  1RE3 C;  3OJA B;  4WB4 A;  3CI9 A;  1G1J A;  1SFC D;  1JY3 P;  4JYC A;  3V2P A;  5AW7 B;  4JF7 A;  1RE3 A;  1URQ A;  1FDM A;  5BU5 A;  2C0W A;  1DH3 A;  5AW3 B;  2M3B A;  1LTS C;  5BU8 B;  3RK3 C;  1JMM A;  2LKM A;  2HYN A;  2CPS A;  3CLQ A;  2XNX A;  2HOD A;  2C9N Y;  3B8E B;  2E42 A;  1A02 J;  1FZG A;  2WSC H;  1LTB C;  1ZV8 A;  1HGZ A;  1N2D C;  1NU1 K;  2YMY A;  3I5C A;  5CHX A;  1SFC B;  3A2A A;  1G2C A;  1RF1 A;  1JCC A;  3HD7 C;  3HTK A;  4B86 A;  1L4A D;  1NTK K;  2CPB A;  1YYC A;  2W27 A;  1L4A A;  1SFC C;  1L4A B;  2YO2 A;  3VP9 A;  2VRS A;  1RE4 C;  1N7L A;  3O8Z A;  3M9B A;  1IK9 A;  3VOP A;  1J1D C;  1SVF A;  1T3J A;  2HLO A;  4W7Y A;  3M9H A;  5APS A;  1GL2 B;  1GL2 A;  1GW4 A;  3V4W A;  3PP5 A;  3BVH A;  1WT6 A;  1IFN A;  5KTB A;  1URQ C;  2OYH B;  2WSE H;  1J1E B;  2XZR A;  3BRV B;  5AW9 B;  1URQ D;  2HG5 D;  1QL1 A;  3V2R A;  1FZA A;  3LID A;  2P7J A;  2Z5I A;  2WTY A;  1EQ7 A;  1L0L K;  3RK2 C;  3II6 A;  1HTL C;  1JTH A;  5AW5 B;  1JTH B;  3TK1 A;  1H88 A;  2H7H A;  1KIL D;  1HWT C;  1HGV A;  2PAJ A;  4I1L A;  3V2Q A;  1VDF A;  1M1J B;  1LTT C;  1MFZ A;  3EQ2 A;  1DX7 A;  2NPS B;  2MJZ A;  1GL2 C;  2XV5 A;  2A45 G;  1J1D B;  1MZ9 A;  1N7S D;  3C9I A;  2Q7C A;  1XTC C;  2YKQ A;  3NXS A;  1ZR2 A;  1IC2 A;  3P7K A;  1NKN A;  1WRG A;  2KYV A;  4WY4 D;  2GM4 A;  1T2K D;  1OWA A;  4WY4 A;  1W2E A;  2KP8 A;  2A45 I;  3HUS C;  2O1J A;  3KQG A;  2O1K A;  2O01 H;  2ZFC A;  3P8C E;  5KJ7 C;  3KDP B;  1IO4 A;  1N7S B;  5AW6 B;  1FU1 A;  4LLH A;  4C7N B;  5CCG A;  3TSI A;  1GU4 A;  1HJB A;  1MUU A;  3MUD A;  2WT7 B;  2KSJ A;  5APU A;  1JO5 A;  2WSF H;  1SQB K;  2GUS A;  4WY4 C;  4N3Y B;  1NHL A;  1NOH A;  4GT1 A;  2XDJ A;  2FXM A;  2C0X A;  2OAR A;  2PP6 A;  1T3U A;  5AVT B;  4C7R A;  4EOT A;  2N1T D;  4M3L A;  1N73 C;  1KIL B;  3V5B A;  1GU5 A;  2YNY A;  1GL2 D;  3HUS B;  5APT A;  2QM8 A;  1RF1 C;  1N7S A;  1KZU B;  2HPC B;  4AYC A;  3M9Q A;  1NH4 A;  5APY A;  5APV A;  1YTZ I;  1RY3 A;  1LWU B;  1GDT A;  3MD0 A;  1ZR4 A;  4HH2 A;  3P8M C;  4GKG A;  2FFD C;  1M7L A;  4Y99 C;  2R5B A;  1FZC A;  5AVZ B;  4IFD K;  5AVY B;  1LTJ B;  2IFM A;  4ZKU A;  1N86 A;  1HVV A;  1CI6 A;  1XTG B;  2A45 H;  1JY2 P;  1FJP A;  3B5N C;  5AVX B;  1KIL A;  1KFN A;  3HE5 B;  2Q5U A;  1URQ B;  3L4F A;  3KYQ A;  4RES B;  2H8P D;  1S9K D;  2J58 A;  3HUS A;  1LTJ C;  2FYU K;  2YKO A;  2J59 M;  1X79 B;  2OYH A;  4LC1 A;  1N73 A;  3P8C D;  3WMM 0;  1L4A C;  1SFC A;  1FZC B;  1NWQ A;  1JUN A;  1JNM A;  1GK4 A;  1RE4 A;  1L0N K;  2NPS C;  3T97 A;  1NKZ B;  3G3Z A;  3H32 B;  1AQ5 A;  5AW2 B;  3BAT A;  1JCD A;  3MGN A;  4JYB A;  1IFJ A;  3L35 A;  4KHX A;  4N78 E;  4LGD E;  2NPS A;  5KLV K;  4OH8 B;  1GZL A;  1H8A A;  1GTW A;  1FAV A;  1JOC A;  1G1I A;  3KPE A;  3VYI A;  1IFI A;  2OYH C;  1QL2 A;  3M0D A;  3B5N B;  1E5W A;  3A3Y B;  3RK2 B;  2FYZ A;  4IFM A;  1GD2 E;  3M0D C;  2FFD A;  1GK6 A;  4XA4 A;  3VP8 A;  3A5T A;  1J1E C;  5CCG C;  3RK3 D;  1LTA C;  2NPS D;  3N7N A;  2I1J A;  4ZKP A;  2KOG A;  1T8Z A;  5CCH A;  3BAS A;  4I2L C;  1ZN5 A;  1FZF A;  3NTN A;  3NFQ A;  1LTG C;  5AW1 B;  5CJ0 A;  3CL3 D;  4DOJ A;  2N1T B;  1ZLL A;  5APX A;  1LT9 B;  5CCH D;  5CJ4 A;  5BVZ A;  3B5N A;  5AVS B;  5KJ7 A;  1T2K C;  2JEE A;  3L36 A;  2R5D A;  1S9K E;  1M1J C;  3A7O A;  1JY3 O;  2L5G B;  3U1C A;  1MV8 A;  3TYY A;  1NO4 A;  2Q9I A;  1HUC A;  4EIJ A;  1X9V A;  2IX7 C;  2POH A;  2HPC A;  3BRT B;  1LT9 A;  3M91 A;  2Q3I A;  3VMZ A;  2WWW A;  1HH0 A;  2BAS A;  1FOS F;  1NTM K;  1Z56 A;  2Z4E A;  3V4Q A;  3HTK B;  1JY3 N;  3MTU E;  1LTJ A;  3LW5 H;  3NMD A;  1G2C B;  5AVV B;  5AW0 B;  1RF1 B;  2P2U A;  1CW5 A;  3U59 A;  1SQX K;  3LIE A;  3OAK A;  3IR9 A;  1FBM A;  1IFD A;  5APW A;  1JY2 N;  1SQQ K;  1LWU C;  3H32 A;  3UIA A;  4O9B A;  2WPR A;  1OXZ A;  2WZ7 A;  2E43 A;  3MIW A;  3VTP C;  3TNU B;  1FZC C;  2WIT A;  4DZO A;  2KB7 P;  5CCH C;  2WT7 A;  3N4X A;  4XE5 B;  3RL0 D;  3VN0 A;  5AW4 B;  4I6M C;  3RL0 B;  3HD7 D;  3EFG A;  2OYI C;  3H6P A;  3RL0 C;  3RK3 B;  5AVR B;  3U1A A;  2XKM A;  2XU6 A;  5AW8 B;  5CCG D;  2FFD B;  2FKW B;  1A02 F;  1IFM A;  1VPC A;  3L37 A;  3VMX A;  1LTI C;  2JJL A;  1X8Y A;  5APQ A;  3TNU A;  2HFE D;  1M1J A;  2GUV A;  3HE4 B;  3HE4 A;  2HOD B;  1NAF A;  4AUW A;  4W80 A;  4Y99 B;  1SLQ A;  1N73 B;  2IPP A;  4C7N A;  2N1T A;  4N6J A;  1SQP K;  1DEB A;  1GW3 A;  2OYI A;  3SWY A;  1CI6 B;  4N78 D;  5KJ7 D;  4WY4 B;  4GIF A;  1YTZ T;  2KLV A;  3HE5 A;  1KIL C;  4W7Z A;  1FJK A;  3R2P A;  4HYT B;  4C46 A;  1AFO A;  1LT9 C;  1FZE A;  1CZQ A;  3GHG B;  4WBA A;  5AVW B;  2WPS A;  2H43 A;  1HBW A;  1N7S C;  1LGH B;  2R3C A;  2YO3 A;  3HD7 A;  3HD7 B;  1CSB A;  3E1I A;  1JY2 O;  2P1J A;  3V2N A;  1FOS E;  1SP4 A;  2ZXE B;  2W6B A;  3M0A A;  3SWF A;  1KFM A;  3OA7 A;  5AVU B;  1PFI A;  3IFM A;  2Z5H A;  2OYI B;  1IJD B;  2I1K A;  5AVQ B;  3GHG C;  1KQL A;  3RK2 D;  3HRN A;  3B5N D;  3M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...