5AQ0A

The structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'SGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOXYPEPTIDASE D
publication title The Structure of the Ttldomain of the Human Carboxypeptidase D
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 5aq0A00
4FXTA 4EIUA 3MN8A 4FL4C 2B59B 2NSMA 4WI0B 2XHNA 3E8VA 3HN5A 3KCPA 5G5DB 1NKGA 4IYKA 1UWYA 5AQ0A 3G3LA 3NJVA 1H8LA 4YOKA 5K39B 1QMUA 3NJXA 4U3SB
chains in the Genus database with same CATH superfamily
4EIUA 3WTWA 3MLRL 4PJHF 1IC5L 3VXTB 3ZZSA 2F74A 3AADB 1Q38A 2Z8SA 1NGXB 2XSKA 3DHUA 4LL1A 1BM3H 3GXMA 4WGWB 3X3GL 1M9WA 2ZG2A 4YX2H 3FUNA 5JZ7C 1ZRUA 3S9DB 4TNWF 1VEOA 1Y6KR 1DL7H 4YBQC 5C0RL 5KVMC 4LSSL 4NQXB 5L4MA 2H1LM 3GHEL 2A9NH 4BFJA 2ORBL 2VJ8A 4JX0A 4J6IA 2WBJB 3FQUA 1JCVA 2M8XA 2XWTB 5C6TL 4WY7L 2WZ5A 1E8WA 2B59A 3BP4A 3M7OA 4LPUA 5CKGA 4GEJA 5FUCC 4MMZB 1UEYA 4BK5C 3WENA 4H8VA 4FTVA 4QRFA 2OP4L 1KPVA 5TTRA 3BZFB 2NX5D 3GIZL 1P6FA 4ZTOL 4FQ1H 5AZ2L 2VDKH 1KY7A 3IBEA 2F53D 4W1TA 1CQKA 4ZMQA 1EAQA 3BP7B 4N2MA 1BG1A 1RHHB 2EC8A 5HJGA 1H6TA 4Q52A 1C5CH 4NQCA 4AIOA 2OX5A 4EDWH 4AZ8A 4MJHA 3HNTL 1S78D 4X7CC 5HHMB 3OMNB 5DEGA 3OJ2C 4H1LG 1CD0A 2VH5L 5EFIB 3NRFA 1RJZA 4DWHA 4FXTA 4WDIA 2PPAA 1J87A 1FGVL 3B3IB 3P0GB 2N4IA 4XBPA 5GS0D 1REIA 5EIIB 5DWUH 1KIPA 1RURL 2YPLD 3P1VA 4EKJA 3MROB 4A6YL 2CRZA 4HUVB 4XN1A 1CD9B 1JHTA 2FBRA 3TT1H 5FECB 3FU3A 4KRPD 1MCWM 2JI1A 3STZB 1QFWM 4DK3A 1K3ZA 2HLEB 1F6LL 5EO9B 5HYFA 1TNNA 1UT1A 2D3JA 1KCVH 2BS8A 3EFDH 4XP6H 3V5HB 4FXKB 1P84K 3H7BB 3X1EA 1P6AB 3QCTH 2ODIA 1T22A 1TQBC 3CBJB 1Z7JA 1Z9NA 2R7EB 4BJLA 3TH3T 5BZDB 4OM0L 1J9TA 3QR2A 5I1GL 2IH1B 3BOVA 4X8JB 3CHPA 3BAEL 2OBGA 2R59A 4LESA 4K5LA 3TN0C 3U6XS 3NABL 4HIEA 4KX7A 1X5IA 4BKLA 3KPNA 4XPGH 5E8NA 1YYLL 4Z7IA 3VB8A 2IDCA 3EYUH 3D3VB 1THAA 1QR4A 1FL5A 1F00I 3BIAX 1S4IA 2BMKB 5FFOA 3WHE0 3KGRA 2HVKB 2JCCF 3VQMA 2VN4A 4JFYA 1AVAA 3TLRA 1NDMB 4RFEA 5DVKA 3IEAA 3VM7A 4HUWA 5A43C 2AJVH 4NN5C 3I50L 1T20A 2NDFA 1KGUA 1B0GA 5CJQH 1MHCA 4EIGB 4JKLA 5C08D 5KBDA 1QNZL 1ZK5A 3WHXA 3PPSA 4Y88A 4YUEL 4LCCB 5FYJU 3DJZA 4KTYA 3BCFA 3OKKA 3O6FD 4BE5A 4M5SA 4M48H 1PAZA 4PQXA 5IHZB 2K8MA 3TO2B 3U1SL 2BVYA 5AWNL 3KR3L 3WEXA 1OWWA 3UCRA 2I69A 3MOAH 4X4YA 1HH6A 1ZIAA 3WLBA 4H4NA 1NGWB 2DQTL 2VR6A 3PP4L 2H3NA 5EZOH 5MP6H 4A6YA 2EH8L 5BO0D 5DQJA 1FGNH 2NXYD 1P4LA 3FUHA 5AG8A 5HBBA 3QDAA 1HI6A 4I3SL 3W0WE 4ORGA 1M42A 1G9EA 1VZHA 5HHOB 1AZZC 4HV8A 2P28B 3O2WH 3PHQA 1FLRL 2HTLC 1UM6H 1H3UA 2F08A 1R3IH 1UA6H 1E3XA 5TF0A 3I9IA 3EJTA 3GMNB 4HJSA 3FO2B 1MG3C 2QGBA 2G9KA 1VA9A 4XP9L 5I18L 5FO7B 5IG7A 3ZZ1A 2C3GA 4JZJA 3PWPA 5FDWB 1QI4A 1TJGH 4FQ2H 4RMWA 5K1JA 1NFIA 4K3HA 1GIGH 1HWWA 3M17A 3SDXF 4AMWA 3OPZL 2FAUA 3HI6H 1DSYA 3K2UL 3BPOC 4RETB 1S7UA 4URTB 3ZE0E 3VXOA 1H8LA 4TSCL 4DTGL 5HYEA 4F33B 1UFGA 4XO8A 2NY6B 5IOPB 3HBQA 3BVWA 4FYRA 5B4MD 1EFQA 1RZQA 3NFSH 3PDOB 1MHPL 2VXTH 1IBZA 1CS6A 3IPBA 4JFZH 5DEJA 5CGYD 4U6VH 4GG6A 1YVLA 1CK0H 4UWQB 2ERJC 3N44F 1IUZA 1BVZA 3BZEA 1WRFA 2A6IA 2XC8A 4PTUB 2YD3A 4XC1H 2ZAHA 4TNEA 2DYRB 1U4EA 1X5FA 3EYVA 5ILTH 2BX5A 5CWSA 5JW4M 3QNYB 4X7FC 3MCLL 4Y9GA 1QPXA 3IMSA 1C5BH 4PCKA 3IAPA 2Z91A 1NGQH 2BWQA 3V10A 5ISZA 2E7MA 3HJ0A 3PGDB 3BIKB 2DQJL 4YK4C 5EEUA 4BUQA 1CYGA 2PYFB 4B9GA 43C9B 4EZKA 5IIEA 5DC9B 3G6DH 2J72A 3NA9H 3VSVA 4FKKA 5HGAA 2Y7MA 1IJNA 5T1LB 5FM4A 4Q89A 4O58H 1UCBH 2JQAA 4G6MH 1TZ8A 4L29B 1IE5A 5L7XH 4EVNA 5I1LB 3ZZQA 1K6QL 1MCHA 5PCYA 4PY7B 4XNBA 1XGZA 4YDKL 5BRPA 4HG4J 3L2MA 1KXVC 5E7FA 2J5LC 3ORJA 3N04A 3VI3A 4X8XA 1KYAA 2QQLH 1G0DA 3C09B 5DJ0A 1AI1H 5I15H 4GSDH 1T03H 2H0JA 4D8OA 2CCLA 1GYWA 2D4FA 4P2OB 4K15A 1Y18B 2J25A 1QFUH 3GS0A 1PD1A 1S5IL 4MJ5A 4ZAKB 4NT6B 3OF6A 2WSPA 3DYOA 3LSOA 2JKNA 3QJXA 2EDKA 4PGBA 5DT1H 3O6LL 2QSQA 4K55A 5T1KB 1BXUA 4N2GA 2F5BL 5D1QE 4CN1A 3KWWB 4YE4L 3LOWA 5C2BH 4FQXD 3L1OL 2OYMA 4UANA 1KGXA 2JIXD 1R47A 1RJYB 2UXTA 3HN3A 1UD4A 1WZ1H 1UOLA 3MRPA 5GGTL 3KPOA 5I8EB 4WFFD 1A4KA 5CN1A 3EBHA 2BCKB 2PP8A 2Y7NA 4ZFZB 3CN4A 2BP3A 2XG5A 2XHNA 1BEXA 1X5ZA 2AV7A 4MRBA 3QPQD 4ZFOL 4H8WL 1UZ8A 1DFXA 3FB7B 4XVUD 2C9AA 4X9HA 3WHE1 4ZTEA 4XPFL 1UADC 2XIBA 3QC6X 3UOAB 1KFAH 1J10A 1V3LA 2BVQA 1SBSH 4LVNC 1PCXA 2B2XH 4Y4KA 2MKLC 2HX9A 4RIRB 5A2AA 1Q0XH 1P9MC 4LLQB 3FSAA 4BIKA 2NDGA 3FKUS 1TZIA 4H0LC 1FP5A 1QYGL 4WW2B 1J1XH 2MCAA 2VDOB 1ZHKA 1FDLL 4HEMA 3WIHH 1CGXA 2N0MA 2H0FA 2AMGA 5IGXL 2NY7L 5SWSE 4JM4L 4BUHA 5F7NC 4NZFA 3QUMB 5IKCB 3LEXA 4BFNA 5GS3A 2Q7YB 1LEGA 3MJ7B 5C0BA 3NFPA 2I24N 1FV1B 4HP5A 3X1BA 5DK2B 1GZQB 3Q6FA 5F9OH 2QR0A 5MEND 3T3MB 3ZDXE 3HOGA 3SKJL 4C56D 4L3FA 3MNDA 2PLTA 1BYOA 4BFIB 4NQDA 3VB9A 1A6UL 4PRNB 4PYGA 5GGTA 4F7TA 3HZKB 4LLDB 4PJBE 1FVCB 1HOEA 1EV2E 3D39A 3RIAK 2P4AB 4QHNA 3RDJA 1K4CA 4X99A 3WUWG 1MVYA 1EEZB 4ZFOA 3EADA 4F9PA 1EANA 1KYUA 2WXNA 1AY1H 2DLFH 4WF7A 4GRWF 5IW1B 3MRBA 5T1MB 2JH2A 5FLVA 4IU3A 4NS0A 4LDOB 1WFJA 2NY4C 4U1LB 4KXZH 1F3JB 1LTXA 4EI0A 1NWPA 1P2CA 4KTEH 4ZSOB 1AKJB 5HPMA 4ZOAA 1JCKA 1R19A 5TPWH 4CSSA 3IGAA 4KDWA 3NSFA 4KHTH 4IRSB 4AEEA 1X4ZA 4LCYA 1HXMB 1RFDH 3AREB 4ZMVA 4WFHD 4HSQA 2K4WA 3SO3C 3QWNA 3V0WH 3NP4A 4FLSA 2V0AA 1NAMH 4KDTC 4A1RA 1I85C 3GJEB 4XVTH 3VVWA 1F0LA 2OMBA 1BVLB 2H1PH 32C2B 1IAII 2APBA 3RWJA 1IBFA 2VR5A 1S8DB 4P06A 5IHLB 3M7FB 5E9DD 3Q05A 3SKNB 2BRQA 2DQHL 4PJEA 1QBLH 4XMVA 1LEIB 1W91A 3ZMRA 2JKJA 2Y3NA 1MDAA 3EDDA 4FFVD 4L1HA 2IADA 1N7MH 4MS8C 5EWIH 3WSQL 2VQ4A 2YPVH 2FQEA 2MRYA 1GS8A 4GSQA 3NCYS 4K94C 1E4XH 4RNRA 1I8UA 3CDCA 3INUL 4FXGA 2JKSA 1H8NA 2HFEA 4HHAB 3MAWA 2XZCH 4JY4A 3PAZA 4JG1H 2Z8VC 3IFNL 3BFWA 4HMCA 3QXTA 2Y5TA 3SGEH 3NA4A 2ATPB 4W9IC 1F4YH 3U6RA 1AGEB 3PWUB 5HDLA 3CQQA 4NKDA 1CE6A 4YHMH 4UQIM 4YFLI 4XPTH 1OY3B 3LDBC 4AGLA 4X6CE 2PMZA 5TQ0L 1N8ZA 4AYID 2X1PA 3GLZA 4GH7B 4PVLA 4XCNA 3Q5YA 3IKCA 3AQZA 4KI1A 5D7IA 4F2MB 5IJCC 3GSQA 2FUQA 3HE7C 1MH5B 2R29A 3ULUF 4X5RA 3FN0H 3AWGA 4W9LC 4Z7AA 2IC2A 2E7LC 1KPUB 3DOSB 1KUMA 4I85A 1MWAH 3GXNA 4TTGA 1N8OE 5JR1L 3MI6A 2IGFH 3SBWC 2ARWA 2FT7A 1QBML 4UOW1 3O8XB 2ZOKA 1KACB 1TQTA 2OZNA 2BPBA 5FCUH 2DY2A 3H0TB 3K72A 4OAWB 4YDMA 2WVVA 5HD8C 2A77H 1E5BA 1NCOA 3NZSA 4KK5D 4ODUA 4YDNA 2ARJQ 2OR9L 4MJ6A 1B3JA 4M6OL 4HKXB 3G5ZB 3RQ3A 1AH1A 1HHHB 2ICWJ 4TUJB 1AAJA 1J9SA 3RIFK 3T2LA 4M6NH 2ADGB 3ABKB 4IEFA 2YMOA 3KPRE 4OCSL 4PLKC 3RUGB 1GPOH 1HZHH 4R4BA 3KD4A 3N42B 2J44A 2VLLA 3MV8A 2UVFA 4S1RL 3JTTA 2BVPB 2XV6B 2I9TB 4PJCF 3ARGC 1XH3B 2VDLL 5CF3A 2HVBA 4XNXL 3S2AA 1RHFA 3MA9L 3O4LE 1Q1PA 3RVVD 1HCVA 3V4UL 1TVBB 3WMQA 1UG9A 5D55A 5EU7E 2QPFA 4XE0A 1UWEH 4K94H 1IQWH 1T2XA 3VGHA 3D2UD 2IQAA 4GAJH 1CD8A 4KO9A 4Y5XA 2KPNA 1LK3H 5HDBF 3IDYC 2NQCA 2P5WE 3QUXA 1B6UA 1WCBA 4L8BA 3UG4A 1R3HA 3D51A 3L8QA 5IJVB 2WKOF 1MY7A 3QG7L 4Y4HC 2Q1EA 4CILA 4P5RA 3HLKA 5F7HA 2IWKA 1F8TH 1IGYA 1CXFA 3K6SA 2VDQL 1WHPA 1RZFH 1T7XA 1QZNA 4K8RD 4U1SA 2PCFB 3ARWA 3GXDA 3EDJA 5DJDA 5EIIG 1OTUC 5CZKA 4N2IA 2X42A 2ZKHH 1E9OB 2ENPA 2QKIC 2GBUA 1MCOH 1XTLA 5EU7C 4JQXA 5I2IA 2YD1A 4WU5A 4GRMB 2ZUQC 3IVKA 5DUBB 5H37G 3SDAC 1MDTA 2EE2A 5JW4Q 2BK8A 2PW2B 5IHWA 5LBVA 4B7IA 5E2UL 3NCCB 1HVXA 3BQUB 2D31A 1KCRL 3OAYH 4L23A 3ZSTA 4BFOA 4E9YA 3G5WA 3QIBD 1P4BH 2BVOA 4UDUA 4PG9A 4E9TA 1N10A 2R23A 4PM1A 5CMAB 3WS3A 5C3IA 1T89C 4LVHC 1JZ5A 4G9DB 4BCYA 5DDHA 3SYQA 2O5YH 4EAEA 1DUZB 4MNHA 3ES6A 4HWZB 4XP1L 3VNYA 3FTVA 5C0IA 2WJ7A 2NR6D 5LAXB 4DKFL 3KPTA 1GCFA 3F7VA 3ZN6A 4OM1H 3K1DA 2EUWA 3MLYL 3QPXH 1H19A 1NUGA 1TTAA 4UQCA 1GZPB 1T6BX 2AXGB 4YHKL 3SEPA 4J8QA 7CGTA 3SPCA 4POUB 2E9IA 3MRRA 4IYKA 1OB0A 1Q9KB 1WBYA 4Z7NF 4PJ6A 1LMIA 4OFYD 2BNUA 4IBVA 3KM1A 1PLBA 5ANMA 5C0FA 4UZSA 3BGFB 1OAYH 2NY5H 1A9BB 5FYKU 1VEPA 3MJ6A 3OWEA 2OI9B 5FC9A 1OAQH 3X14A 4EI6B 5F3BB 3VD0A 1XD1A 2UYLA 5F96L 4JHAL 1N18A 4IBUA 1E90A 1WGOA 1VFAA 1NBVL 1T0NA 3CFNA 1ET8A 1AQKL 4WWKA 1NCNA 4EZLA 2XPZA 3ZLQC 1I4FB 5ALCL 4BFBD 4QLRA 4ESKA 1BJ8A 2VTFA 3MODH 4KRNA 1QEWB 4KY1L 4UT9H 2BHFA 4X7SH 5TQ2H 3EXJA 2DMBA 1AD0A 1S7TB 2P49B 3D0VB 4APXB 5T33H 2YD0A 2VWEE 4Y1AA 1XGTA 3QYCA 3X17A 1JVKA 1D5ZA 1H3PH 1J12A 4DGYH 1T83C 1SDAB 4BCZA 3SCMC 2JJSA 3O0RH 4HT1H 1OAUH 3ZTJG 1MLBB 1Q9LA 1SZNA 1MQKH 2WNXA 3LKSB 2BS9A 5D7LE 3Q43A 4V1DE 3FYIB 4GIPD 4N0UA 4PJGB 1EAPA 3BSZL 4PWKA 4XPAL 2BFGA 4PP2A 3GSOB 2YD9A 5C7XL 3QAZC 5BQ7A 5D5MA 4PJFF 1IE4A 4Z7VE 4EXPX 3G5YB 3T1FB 1UYWL 4A37A 1JN6A 3BH4A 1KLGA 1NDGA 2VWEC 1L4IA 1QP1A 3FQNA 4F1SA 4HQQL 1A7NH 2VDMH 5F89A 4AUJA 3DO3A 4HJEA 4BFEA 2DQIH 4EI5C 1NFKA 5CLTA 3VXPB 1FZMB 4M7LL 3ZW3A 3LY6A 4ZO6A 1BIIA 1JHLH 1K4DA 4Y9FA 4JDTL 3QI9D 4L0PB 4YFEA 4WHYG 2BO0A 1DJYA 4M7JL 5E4IA 5CO1A 1ND0A 2C26A 3V0FA 1AXTL 4HGWA 1AS8A 5DUMH 4U1GB 2EEAA 1GZHC 3U46A 3FFOA 5C6WH 1IIKA 2GAZB 3AY4C 5EZLA 8CGTA 2BC4B 3L4CA 5INDB 3TBWA 2CIKB 4WUUB 4I0PB 4QDGA 1BP3B 4FNRA 5IEKB 2EDHA 4AMXA 1JNJA 1TQBB 2FECL 3ZE2F 2WUCH 2GSMB 1LE5B 3CSPA 5DI8A 4LLYB 1NJ9B 2RJMA 2NUTB 3MBEC 4JDEA 1D5BA 1CCZA 1X9QA 3FFDB 3JV5A 3FSOA 4V2BA 4R4FH 4XNAA 3RDTA 4ZUSA 5JHDD 4YZWA 2KLTA 1SDDA 3TN0B 3JWOL 4YO0A 4HK0B 4WW1A 5T1DL 3VWJD 4C4KO 4Z6AT 4XMXA 4N8UA 1UOWA 5CEXB 4NQEE 4TVPE 2VGLM 1PZSA 3D0AA 4PRPE 5AVWB 4GUCA 5G4MA 1Q9OA 5EOTA 3QDGD 3RVUC 4PJXA 4JO4H 4QRPA 4BV1A 1N0XL 4NHCL 3S5ZA 1NFDB 4U1HA 4DETA 3GUTB 1RXLA 4DGIH 4N8CH 3ARFA 3KJ6H 4AE0A 5BVJA 3BZ4A 2HKAA 1KLFA 1M4KA 2Y6SD 3QPKA 2D0GA 5TDOB 4JZOA 4AUYA 4Y4FC 2NNAB 2WKLA 3AT9A 3MGOA 2YR3A 3DSFH 4OJEH 4WIQA 4XX1G 5B38A 3WV0A 4GOSA 1KJ3H 3WY2A 3DROB 1L0QA 1ETB1 4XXWC 3L3GB 2ZG3A 5KOMC 1W8EA 4P05A 4XMKL 4DAGL 2XNAA 1GW0A 5JORB 3PV7A 1TMQA 4ZO9A 4LLMB 3P11L 4UU9A 1WO2A 4QRAA 5A16B 3FJTA 2KZWA 5E4OA 1HEHC 4W93A 1ZHBB 1N5AA 1Z3GL 3V5DB 1BGXH 3SE9L 2GC4C 5HHNA 4QUOA 3QQ3A 4B60A 3NJMA 3BPOB 1OAXH 4NUGH 1HH9B 2DKSA 2CJSA 1IAIM 3PUCA 4D94A 3IAQA 4QRUB 3TBBA 5AW2B 4WEBL 3W0WB 4JPWL 4MQTB 2OLDA 5E2JA 1D9KA 1IFHL 2WIMA 4Q97A 4F93B 2RFXA 1U8QA 4M7ZC 4CVXB 3IDNB 1IL1A 3FTZA 4H8UA 4N2OA 4Z7WA 4PR5A 1U8IA 2G3XA 4JFOB 5AZEH 2ZUSA 3TEWA 5JPMC 1UJ3C 5KSBA 2NY1D 3MV01 3T1WA 3CSBA 1ES0B 3ZL2A 1PL3A 3FU8A 4PJAB 3OJMB 2ZOLB 1TT6A 4F8LA 5B39A 1A4BA 4N8PA 1GYCA 1H9VA 3RIKA 5IWLC 4W9DC 2R0LH 2WP3O 4HEPG 4BBWA 2H4EA 5I76B 3AROA 3ZE0B 2AKRA 4WI3A 5FA4B 4AQ8C 4I1PA 1DBAH 5M94B 4FN0A 3FQYA 1VHPA 3ULVL 1N6QH 4PJDF 4Z7UE 3RVTD 4KKQA 4YK4B 3MO1B 1MI5E 1EEUA 2DQDL 3B9KA 1HQ4A 1JWUA 1KIQA 4JY5H 4JG0H 1C08B 3FSVA 3WJMB 3A47A 3BD4A 4HJGB 1G6VK 5IMMB 4HOXA 4XWOC 7FABL 3GJFH 1ONQB 2DM2A 3WDJA 2ATKA 1ZXQA 4XT1C 1VFBB 3FU9A 1BF5A 2DMHA 3CIAA 3MBWA 4Y19E 1VAHA 1YNLH 3HC3L 3G6JA 3NFNB 2VL5B 1JI1A 5D4HA 1YEIH 3NJIA 1KN4L 4MVBC 2GFBA 4HC1L 1FO0A 4N28A 4QTIH 4TOYL 5LGHL 2J5LB 5EOCL 3WFZA 2ZUVA 3LN5B 1FBIL 1SUJA 4W9GC 2ICWB 5EBWA 2YUZA 3IGLA 2GT9B 4IGBD 1K2DA 4UQ2A 1USZA 4WO0A 4LPTA 1B9KA 2LLNA 2CALA 1ORQA 3E8VA 4LASL 1UATA 4OT1H 1S7WB 2XWXA 1LO2L 1S6NA 1NCBH 4HF5H 3SYOA 3T8VA 3TO4B 4K73A 5IB3B 4JQVC 4BSJA 3QQXA 2V17L 1KCKA 4MD0A 3TNNA 4OGAC 4LXFA 3BLBA 3OKLB 4P4RB 2MQ3A 3N1PC 2PYEE 3CSYB 4DO5A 1IRAY 2HLAA 1TVHA 3B8SA 4A7QA 2PABA 1CFQA 5E99L 1NSNH 3VU2A 3UJJH 3QH3B 4WSGA 5JQHC 1HINL 1U9KA 1O6SA 2O1AA 2Y1YA 4QTFA 3TBVA 3ECQA 4QY8A 4JFVA 1CE1H 4WTZG 3HC4L 1S9WB 4OZHA 3SZKC 3VFSA 1NEUA 3L1FA 2APWA 3BSGA 4XOBA 5CCKH 1F4XH 2OKMA 1MFBL 1AHMA 3L3KB 4HH9A 2OL3H 2VXSL 3SDDD 1FUNA 2JLLA 5LBSH 4RGNB 1J1PH 1VFUA 4LVNB 1HNGA 2UY6B 1EHNA 3T6VA 2HLFC 4JRLA 4EOWH 4LPCA 2FWOA 3L3JB 4RZCB 2X5PA 4ANKA 1XIWA 4PHXA 3QFGA 5I1AB 4PWGA 5IESH 4Q6KA 4HC1A 4JFFD 1FNEA 5B1CA 2X4PB 3SDYL 3AMKA 1ADWA 3NPZB 3TVMA 4E9XA 1AZCA 4WU7B 2IVFC 4BQ9A 3B9AA 2NZ1A 3IMVA 3W56A 3TEUA 1AO7D 4DFIA 3NJJA 4QRSA 4M9OA 5J1AA 2IALB 2JV6A 4LHUD 2BNRD 2AZAA 1ROWA 2YMXL 1EGJL 5EV7A 3FMGL 2GSIB 2BOLA 3LRSB 4H26B 2R56H 5D6DC 4AGQA 3H7LA 5DJZB 4Z3JA 2FJGB 2O93L 2WBKA 1P0SE 4BSVB 1JXGA 2B15A 3UYPA 1YPZA 3C60D 3JZ7A 1IC7H 2VAJA 1P1VA 4MQSB 4YHNA 4AGMA 1Z66A 1MLCB 3U7AA 2VN6A 3ZGHA 3CQFA 3DSNB 4KROB 4A04A 3ZDYE 1SXNA 1IM9B 3HHSA 2C1PB 3IPEA 1IGJA 2R69H 2B7DT 5EEVA 3FTWA 1RV6X 4PRAB 1U36A 3ETBJ 3LEYH 4LAJH 4L1DA 1MWAB 3ZTDC 9PCYA 4NRYB 2UWEE 1RIUL 2XN9E 3T9WA 3DXAE 4P59H 1A1NB 4YVUA 4W9EC 2H3KA 2ADIB 5GGSA 2FJHA 4JJOA 1GTNA 4PJBB 4UV4H 1U92A 2EE9A 1AANA 4UDTB 2G2RB 3X1NA 5DD6A 3F58L 4OD1H 2L3BA 2WXGA 2Z31B 3SJVB 3TJHC 2DQUH 3QXUA 3T8MA 4F7PB 5AD0A 2CO6A 1I7TA 1X3DA 1EGJA 2XPYA 3UERA 3P9MB 4OF3A 3L3HB 2WLIB 5HGHA 4G5AA 3DRQB 5JUEH 2IF7A 2FWSA 2HX8A 5AENA 4FFZL 5AAMC 5IW3A 3BAWA 3AG3B 1QBAA 3WS6A 3R8QA 3SGKA 3N2JA 4KKLC 1MG2C 4PJ5E 1S7VB 2VO8A 3FDWA 4M6ML 4P5KB 5IF0B 5IVNA 1ZANH 2WJ5A 4LU5L 3KPSD 1W72B 2QZ5A 4MXQD 4MXVE 3VU1A 3WFDH 4F2FA 1BQUA 3JVGA 4WTQA 3W2DL 4M62H 3DHMA 3ZE1E 2CKBH 4ODWB 2IH3B 3V6OA 4CN4A 4L0YA 1GYAA 3L4ZA 3DETD 3HAEB 1R4XA 2YWZA 3PU7A 4LIQE 2LGNA 4Q0XL 3VWKC 4P5TB 1ZWIB 4GUPB 2H2SC 3CZSA 4P2AA 1XZ0B 2WW8A 1O7VA 3WMSA 5K9KB 5DLLA 1J0HA 8FABB 2HUHA 3CPLB 5IVXE 3LDBB 3LKPB 2P9RA 5JYMA 2K7PA 3TBYA 2VT0A 1EHKB 1FSKC 1EJFA 3FFCD 4PUBL 3ZDXF 3BKJH 1OIOA 3HE7B 3WJJC 4A2LA 3D7PA 1UGKA 1XT5A 4N2BA 4GLRI 1G1YA 3ATFA 1OOWA 4E5XB 4HIPA 1H8OA 4JRXE 1KBPA 1CI3M 3OGCB 1ACYH 1TQCC 2GUOB 3SBRA 4C58B 2WGNB 2MIZA 2VDPH 1NBZA 4CAGA 4I48B 2M26A 2WQVA 1O0VA 4FFZA 1SEBB 1E9QB 1RZIB 3QDJE 4MLIA 1VSCA 3HUJA 1F90H 3TCXA 1BQHA 2IMMA 2WD0A 3I6GA 4GP4B 5KSUA 3AS2A 5C3TA 4RFOL 1B4TA 1KC5L 3IDGA 1I75A 3CC1A 3V0IA 3OHXA 4JDZA 4G3YH 3FONA 1IB5A 3T3PF 4IBSA 3HZYB 3LD8C 3QQDA 4XOAA 5TK4A 2BXYA 5DUJA 1I1AC 3O3AB 4W6XB 1ZPLA 2Q87A 1GSMA 4JO8A 1DFBH 4MTMA 3DPDA 3RAJH 3GMLA 1NGYB 3DX4A 4WFGE 2CGRL 2J1YA 5IK3A 2UUDH 1KGIA 3ARGB 3D25B 1XGUB 4IRZL 4A2GA 3PQYE 3LS4L 2BZ7A 2GJ6A 2ADFL 3P2TA 5CKAA 3FT4B 3O9WA 1E2ZA 2VN3A 3K4DA 2B1OA 2G75A 2DM7A 4LCWD 3VFUB 2V9RA 2I5YH 4J1UA 5GJTL 2X0UA 1S7SA 1A6WL 4N5UA 1E43A 2YGOA 2KUTA 3U0WL 5LN8A 3ET9F 1TVDA 4Y4HB 4W9ZA 4P46B 1MPAH 1A7RH 5FWQA 3WE1A 4NZJA 1OF2B 3SDCD 4ZFGL 4KK8C 3AM8C 4AEHH 2CJUH 4E0RB 2DMKA 1A3LL 2HFFA 4L48A 2EYRA 4RBPK 3UX9B 2JKXA 1ZK9A 3MLWH 3DMMB 4TF4A 2XACC 1YEKL 2CDEA 1FL6A 1NA8A 4LDCA 1F45A 4Y2DC 4ZO8A 2QKIB 5ECGA 3LPPA 2W95A 2NY3C 4MA3A 5EN2A 1HHJA 5E95B 3RGVB 3CHQA 5B8CC 5T1JA 3Q06A 4HS3A 5DR5L 2ZUQB 3SDAB 3CH1B 1FF5A 1QFOA 3ECBA 5I0ZA 3HW7A 2B0SH 3GXPA 3EG9A 3FOMA 4ETQB 2QVMA 4H88H 1G0XA 3C5JA 1NCDL 4GKZA 1XWVA 1GC1C 3RIAF 1J5OL 2G30A 2VDNH 4PGZA 3CDZB 4PREB 5AL8A 5KZCD 4BK5A 1TYRA 1B0IA 5GS0L 1YNTF 3FQWA 4KVCH 1IAIL 1RK1A 2AQQA 1BMZA 3GXTA 4LVHB 4W9FC 4QGTA 4NQCE 2DJUA 1R5WA 3NJHA 3H6JA 2L7QA 3NYKA 2VDMB 1YEEH 1P7QA 3ZHLA 3REVB 4KAQH 1BMWA 1UXWB 1V5JA 4FG6C 4JDVA 4ZMTA 5FM8A 4JM2A 1S9YA 2KKQA 4HKBB 4A2HA 3QO0A 2WMPA 4U33A 2EZ0D 2DQFA 1OW0C 2OQJB 3ZRFC 3OKMB 2R8SH 2CDFB 1QG3A 1BLNA 4Y2OB 4L8CB 4V33A 2Q7NA 4G7SB 3QO1A 5D70L 2Y6TE 2F54A 2Z1PA 4JHUA 1KENH 2NX5A 3KYMB 2F6AA 2Q8BL 2JKRM 3NIDB 2FEDC 3DV4B 2WO3B 4N2AA 2E46A 4HSCX 3ZKXC 2ZX7A 1BFTA 2F53A 4ZG1A 3G5VB 4HJ0C 3WNPA 3KEDA 2KBGA 1B2WH 1EFXA 1R46A 1DEDA 3BT2L 3IJ8A 4WUKH 3SPJA 1G7JA 2J88H 1BZEA 4OF5A 2G4EA 2VLKB 5DVLA 3S6CA 2F8OA 4N8VA 4KU1A 4MQ7A 5TGBA 5J13C 5LLIC 1IAKA 3S88L 4HPYL 4O00A 1XCQB 1C7SA 3QHFH 2PW1B 3TIEA 4UQBA 2JXMB 1HL8A 2LU7A 1DBJH 4QRQA 1UHVA 1UB6A 1MRCL 2JCWA 2YPLA 3TJEH 2X70B 4PLJD 3U7YL 4NIYE 3ZL4H 4EIZC 4JFXB 3K4AA 1FAIH 1QHQA 3DX6A 4NKIH 2KLSA 3LNFA 3D18B 2OR7A 1YN7B 2ETWA 3U9WA 5KANG 4MYWB 1ZIBA 2G2NA 3O4OB 1MEXL 4B0MB 3C5ZB 4R26L 3RA7L 4HISA 5D4QA 1K5NB 1WUZA 3FPYA 4BHUI 1GC1H 5CBEA 1RUQH 1NKGA 2XY1A 4WKXA 5FXCH 1OSZA 1KTLA 5EZIH 1LQSR 3JTSB 4F37K 3MLTA 5FOBA 4IIQA 2K0RA 3L6FA 4Q2ZB 5IFJA 1DLFL 2O61B 1TQVA 1NCWL 1BZ9B 4M1GL 2X44D 2R27A 3B2XA 3ARBD 4WV1B 3AWFA 3DURA 3QAZB 4WCYH 3KDPB 3BUTA 2Y7QB 5I6OA 3IDIA 1FFQA 3VRJA 3C5SA 4OUUB 1T2QH 4GKNB 1WBZA 2CNZA 3H8NA 2DF3A 3RL2B 1KXTB 3PWPE 3W57A 4AVKA 1IC4H 1KJ2L 1W8NA 2RQ8A 4UT7L 5T3XL 1OV8A 5CLXA 4EBQL 2EDEA 2IBZX 4KX8A 3RIFF 1NC4D 5ESAA 4MAYB 1FZJA 2ED6A 2CBOA 2RB8A 3FOLB 3MBXH 3O6FA 5K9OA 2IAMB 2CUMA 2DTSA 2XN2A 3ILPA 4IM8A 4BH8A 4C57C 4PJHA 4F7MA 3VD4A 3HG1D 5CD3A 3K2MC 2DQEH 1JYVA 2VE6B 3LIZL 4LHQB 2AEQH 3H55A 2A4ZA 2AEPH 1VGEH 4WNQB 4XMUA 2EC9T 4I77H 4KMTH 4GG6E 1ODUA 2DYPB 2VSDA 3J07A 5CBAB 3LIUA 5EUOB 2EJ1A 4PTTB 3CXFA 2VMDA 5JIMA 4YHLH 4ZPVB 4JZJC 4Y16B 2CXKA 3FU7B 3CE1A 4OZGB 2GJZA 2UZYA 3PWLB 2VERN 5DJXA 2WYHA 2YK1H 2X0VA 3CH8A 1YO4A 4KKRA 5E6IB 1TEFA 3E1ZA 1XF3B 2P8MB 1NL0L 3QT2A 3X3GH 3BXNA 1E9PA 5ISZE 2NNXA 3HNSH 3UTTE 1GJIA 4QTHA 5HYQB 2CGYA 2FSEA 2EDBA 4BINA 4ANWA 1R34A 1A7QL 1Z9MA 2WLNA 5GZOC 4HXAH 5F70A 5DQ9B 5C6TH 4JCMA 4PRIA 1ZT4A 4JM0A 2C8NA 4N90D 4DKAA 1DZ0A 4JPIA 4L9LA 4LEXH 1HEZB 1KJ2A 1CDIA 1WFUA 3FB5A 2R83A 4PV8B 4RVBA 1G5GA 4JB9H 3D87B 4D9QE 3TZVD 2IH9A 5DZNA 3TBTB 4MNGB 3L1GA 3VXQB 4W4NA 5L0QC 1KB5L 3VI3E 1H5BC 2P5EA 2OK0L 1EO7A 3BZ5A 3GJFB 3LIZA 1KTDB 1AQMA 4UAOB 4HUCA 4M43L 2OTWA 2VXUH 1HDMB 5LB1A 2OAAA 4WAFA 1IBBA 1X9LA 4HIIB 4MDIB 4U7SA 4ZYKA 1HXKA 1E7VA 3EDEA 4EN2A 2A9DA 4BDVA 2H9GA 3EFFB 3GSRA 5HI4D 4HUXB 4ZRGA 4Z0BL 1W0VB 3VTAA 1FG9C 5FFLA 4Z7VF 43CAA 4OUOA 4B97A 4A6YH 2LABA 2F7OA 4Z7OE 4IBTA 3MHZA 2I9LB 2Z0BA 1F1AA 4X8GA 4AW4A 3GIVB 4RAUA 2JK5B 4R4ND 1LDPH 5KW9L 2CO1A 1AG0A 1MFUA 3R06B 1CFTA 4W68A 1RJLA 5JNYB 1Z32X 1T21A 1NC2A 4U2YA 1QLEB 4YDIL 1C12A 5CJOH 5KG9A 3EOBB 3RHWF 4OZFB 3DX0A 3GI9L 5MI0B 3FRPB 1G4RA 4O4YL 3ZKNC 4J4PA 4S1SH 4AENA 1KG0A 1X6LA 4ISVB 3NGBC 4X6EB 5K69A 2W0FB 3VSTA 5IFAH 2AJYH 4L0ZA 4MCZB 1U8HB 2WYIA 3BWSA 3ARDA 2YLHA 3LV3A 2QPDB 1EEYA 5KN5B 4G1MA 5KVEL 3QIUC 2I07A 3A4AA 1KTJA 1DJIA 1FQ9C 2YFNA 2QQQA 4MJIA 5EIQA 1DR9A 1HWHB 2JSFA 4B9KC 1KB5A 1ZLWH 4B50A 3BQVA 4HEME 4WHTA 5JLZA 1FCCA 2F18A 4QF1B 2E7DA 4KQ3L 5MHSE 5AALA 4HCRL 5I73C 2AXHA 3HI1A 1R1CA 4YUEH 4A2FA 5C0BE 1AKPA 2LR4A 2X2IA 1T04A 1AGCA 4PJ9D 4J27A 3MRNB 5AWNH 4Y4KC 4PJ8A 2BSED 5DK0A 4B6ZA 3BVVA 4UM9A 4DH2A 5IMLA 3PDGA 1QRNB 3CZFA 2RCSL 3KHQA 3MRJA 4CVZB 3TYFB 3TFBA 5KVFL 1YY8A 2MQ0A 4NQDE 3BUIA 3GMOB 3PJSB 5LO7A 3D39E 2XX0A 5TDPB 1I7UA 2XBDA 5CIPA 4E36A 2AJ3B 2VIRA 4PGDA 1I7RA 1CL7H 3W11C 5I18H 4NN7C 2P44B 1YMHA 4C4UA 1IVTA 4JKWA 4KJQC 2A6KA 1YYCA 2JI3A 4FI8A 3U36A 3FH7A 3RL1A 3V7MA 2EDFA 1LLAA 2FJSA 2R1YB 1PBYA 3OPZH 3HAEG 4A7SA 1P6WA 1ZV9A 1Z9LA 4TSCH 4DTGH 1EBPA 4U7KA 4A2DA 2DMGA 1BQRA 5CP7A 5SWZB 3L3DB 2R0WH 1EVTC 3F00A 3HPLB 5MENA 1XGPB 4AEFA 3OBAA 5GRJH 1MHPH 1A47A 4CNIB 3H9SA 3KXFA 4HJJL 4YL9A 3IFPA 4Y19B 4D0DA 5HHMD 3U0TA 1UD5A 3U7WL 4GNKB 1JSYA 2XQYG 3GPSA 1EO8L 1U41A 4H8WC 4HCRA 3W38A 4F9PC 2H6OA 3WLWD 5E6ZA 3QUYB 3WD5H 1I8IA 4U3XA 4D3CL 4PY8J 3D4CA 4HUUB 1QR1B 5FA3B 3MCLH 5FYLL 1LMKA 1DQLH 4P2RB 1OM3L 4IU2B 1DHKA 2UZIL 2VLMD 4PJEE 3P4LA 4OR1A 4E5XG 4RRPA 4ODVH 2VAAB 3GZPA 4OD2A 4X6DE 1OLZA 5CS7A 5KJRH 1PDKA 5GSRA 2VDRH 4AIZA 4TULH 5K39B 4DN4L 5FK9A 3P4OA 1RUKH 2A73B 3SOBH 3RX9A 4DEPC 3CWGA 4G6KH 4PMFA 3MLXH 3FQ1A 1U3HA 4CU6A 4IMLB 4RDBA 3DJRA 1S9XB 4LSTL 4PI2A 2DQCH 2NT1A 3D3VD 1K6QH 3MV9E 4F15C 2CKBB 3VCLA 3BYTA 3WFBL 2E8ZA 4AQ1A 4YDKH 3TA3B 1CT8A 5CGMA 3LPOA 2VMJA 4K3GA 4FS0A 5C0ND 4U4BA 2DBLL 3AAZA 4MCYA 1H9DA 4NYLA 1F4HA 1CVRA 3II2A 3DARA 3QNXA 5D7IE 4ZQKA 5ES4B 1DEEB 2B4CL 3LZFH 3IDMA 4U6HA 4XI5C 4R2GD 1S5IH 1MZZA 4RMQA 5DRWB 1W80A 4QT5B 3MRMB 5IQ9A 2EP6A 3SO5A 1IJ9A 4H5SA 1U2YA 3BVNA 5DRNB 3ELAT 4GRLB 5GHWH 1RSYA 4FMFA 4O2EB 1FLTX 4PS7A 4R9HA 3OD3A 5GGTH 3QWOA 1SN5A 2D9QB 4IBQA 5EU6A 3S8FB 1BCIA 3V95A 4FA6A 3W5NA 2IBZY 4NHUA 1WWBX 3LQZA 4GSUA 1Q72L 2VDPB 5FW6A 1USQA 2C1OA 2X4UA 3PXLA 5CUSL 4AYEC 3CVHL 3ZZLA 4H8WH 4NO2B 1K8IB 3D8MA 4TTDC 4XPFH 4NGHL 2GBAA 2WWMC 2AP2A 3ESOA 1W9XA 3C2SA 3M45A 1INQA 4L3EB 4QCIB 4A63A 3CZEA 3MV8E 4J8RB 3IB4A 2J1XA 3B7SA 3D34A 3GSVA 5FF6A 2EEBA 1G7MA 4OLUH 5IM7A 3S34L 5MEOA 2VN7A 1UA3A 1GGUA 4P3CL 4AQEA 2VOTA 2ZOTA 3B43A 5ICZA 2X53A 4K8RL 1LXMA 3K46A 3S0PA 5AW6B 3VSQA 3HG2A 1THCA 4N9OB 5AUMA 1XSIA 2B5IB 1WHOA 2W0PA 1FDLH 3KLAB 4YZFE 4WW2F 3U82B 2ENJA 5I71C 3PGCA 5E9NA 5IGXH 5LG1A 4JM4H 3DXAB 1HYSD 4XO4A 4D7PA 3EO1B 5CEZE 1JNHB 2G5UA 2HG5B 3ME0B 4EN3A 1HFUA 1TTFA 3VGAC 2PCPB 3WG7B 1DDHB 4ICXA 2QPSA 3EBGA 1QLRB 1WGVA 4P2QD 3UZVA 3CVDA 2VSCA 3ILEA 1QUPA 3KYOA 3QC5X 1R24A 3ZPDA 3D85A 5E7BA 1IM3B 1A6UH 4AV0A 3N41B 1ZGLM 3DV6A 1JMZA 3BJ91 1XL4A 2CQVA 4R7DB 5KYUA 4U1IB 2D0FA 5KYWA 3WL9B 4LSVL 1GL4B 3D12B 3ZQWA 5AOJA 4CADB 3CVHA 1H0DA 1ZXKA 3QUXC 1SJXA 5CEYB 5AVXB 3DX9A 3M8OL 3DX7A 3K0WA 5IB4B 5T1LD 1B0RB 2ZUTA 5IW6B 5ICXB 1UKTA 3KS0H 4EO5A 3NCWA 1CDBA 3F5WA 1OGAB 3ZE1B 3Q8EA 3L5WA 1ET5A 3E6HA 3PLYA 4DGUA 1E5UI 2EXSA 4TPRL 1VGKA 4G8EA 4JVUA 3PJNA 3F7PC 3VXMB 4LBAA 3M1OA 5DYFA 4JQXC 4AVIA 1TQCB 1WFMA 4FQLH 1M05A 1UEMA 3LEVL 2FIKB 4CJ1A 2M83A 1NLDL 1HNYA 2E74C 5EU5A 3LTVA 4K4KA 1T4KA 1ZA6A 2P80A 2R29H 4S10A 5DXWA 4P2OD 2CU9A 4YHPA 1EERB 1YDPB 2VCOA 3CMOL 4ZUWA 2X4QA 2FDBP 2JF1A 2E7CA 2X4TA 3MLSH 4ZAKD 2BNQE 1RZJH 4NO0D 5HJ3B 2OW6A 3QORA 3L13A 4N2FA 2UWEF 4BKTC 5HYSB 2CJTA 4ABUA 1QRKA 5ANME 3P69A 3CVIL 3QIBA 1I1AB 5JA8B 3S7GA 3BISA 4ZUUB 4CC4A 5JO5A 3CCHB 3VG9C 4LNRB 5G5DA 3HNVL 2IAND 3IMUA 4PEEA 5DYOA 2YD6A 1FNAA 4Z8FL 1LO5B 3INUH 3EHBB 1OT1A 2XWZA 2CR6A 2NR6A 2G0KA 4UZUA 3IFNH 3RWDA 1ZV2A 2A74A 5DUPH 3WYRA 4Z0XB 2ITEA 3LB6D 3BIBX 5D1XD 2NNFA 4YWGL 2YXVA 3MU3A 2Y36L 1RPKA 1SVZA 3VFNB 5D8JL 3UTSD 1OGSA 1NUDA 2CMRL 5IY5B 4AJWA 2P3YA 1MAJA 3IJ7A 4XHJC 3ZSSA 3BPLC 4DVRH 5TQ0H 1U8CA 1T1WB 4HFWA 1S5HB 2WVSA 5BV7C 5E5UB 4Y1AE 4P48A 2WZAA 2YAOA 2BY2A 3G6AB 5HI3D 5CEZH 1LO0H 1TFPA 5AYUL 1GYVA 4Y2DB 2D3VA 2E0PA 1A6VL 4HIJB 3V9EA 3OC8A 1JF5A 3OMAB 3Q5OA 4WWKC 2Y9RT 4QHUB 5ETUA 5JR1H 1N59A 5DMGC 3X1FA 2KZ1B 5MEPB 1SYVB 4N0UE 5FCSH 1U6AL 1FAKT 3CU7A 4X2UA 5D71H 3EJYD 4ZX4A 1BVKB 4FZ8L 4NBYB 4XB3A 4KRPB 1TEGA 3QEGH 3PUUA 1JGEB 3KLKA 5D5ME 5IVXF 2OR9H 1FE8H 5L2KD 3DUSA 4TUKL 2X2YA 3L17A 1GCYA 2FBJL 2R1XB 3FQRB 5D4IA 4UM8B 2QSCH 4NBZB 3WUZA 1QW9A 2XIIA 5I8OH 1AIZA 1KYOJ 2QQKL 3ZL1A 4X5QA 2OXGB 3QK0A 3NCFB 4PVMA 2H32B 3KS0J 3N42F 1CGVA 1HL5A 1F6FB 2WKOA 3V6ZA 4YC2B 4CSTA 2EIDA 5HSFA 1ZVSB 2VDLH 2QSTA 1DVSA 2Y2YA 4MAZA 5BUGA 2B59B 5IJDC 1Q94A 3BP4B 3V4UH 2IWEA 4Y5YC 1YEDA 1XO8A 1G6RH 3HE6A 4EIBA 4LL9A 4DHLA 3CFBA 3MGTB 3VFMA 4FHKA 4HGMA 3QFJA 4DUVA 3Q2NA 3WEOA 4IIZA 4IRSD 3U1PA 3FT1A 3EH3B 2Q10A 4DP5X 2LLGA 4JFEA 2N1TE 5C08B 3EOYG 3NVQA 4KI5F 1FVEA 1TTRA 2XWBB 4NQCB 4LCIH 5CD5D 1H3TA 2Q5BA 5I75C 1MHEA 5ID1A 2Y1AA 3FW6A 1Z9OA 5ENWA 3TBSB 3BE1L 3FCGA 1R3JA 4J12A 1EHLL 4Q9BA 5C0DB 1CJYA 3HC0B 3UG5A 3MRDB 3QS2A 4ZS7H 2EXTA 2VXVL 5EZJB 1DLHA 1XGQB 1JE6A 4HYTB 2O5ZH 4UNIA 2BIMA 5E6UB 2NXYB 4XBPB 2QJDA 2ZSWB 4GKSB 5FX3A 1ASOA 1KIPB 3QI9A 5BV7H 1U95A 1MRFL 2GW5A 4QHLA 5L4IA 5J13B 4DK5A 3DO4A 5F6HJ 1BBJA 3S98A 1LD9A 1SM3H 2WXRA 1J1OL 5HYJA 3IBOA 3POHA 2CUIA 3VRIB 3T0DA 4PJXE 4QRPE 3FTSA 4EXKA 4OZFG 3FPXA 1D5MA 3LNHA 3FRPG 4C55A 1KCRH 5D7KD 2ZNWA 1MFEH 1W0WA 1U3NA 2QVFB 2Y69B 3ECVA 3RDTC 5KUKA 4N6QA 3MRQB 4HIEB 1XCWA 3BEVB 1UOVA 1CD1A 2YRPA 2CO4A 3KPNB 3X12A 1DBML 3Q01A 3V4LA 5E8EA 2C7FA 1WZMA 1TJXA 4KJYB 1BZOA 5AVSB 2VITA 5JHDA 4MLSA 1CTMA 5HGGS 3GLDA 4DKFH 5B3NA 2LAAA 1M6OB 1RVFH 3BW9A 2Q6WA 2HJKB 1TQWA 2Z8WC 1H3GA 4IKLA 3NACH 4I87A 4RFEB 3MLYH 1HU8A 2GIMA 4KRLB 1MVUA 1IIIA 1S9VA 1PD6A 2IQ9L 2HRPL 2J6EH 1UURA 3BUQA 3MMEB 1OP3K 1R3KA 1OSPL 1MHCB 3AY2A 2ZXCA 3MCKA 5AVTB 1MJ8L 3BESR 1Z2KA 3ARFC 3WHXB 3DO7B 3O8XD 2E9GA 1LP9B 4Q58C 1M3IA 1A5FH 3Q8BA 2QL1A 4D2NA 1BD2A 4LBEA 5DURD 1RQ5A 3WLBB 4IK6A 5C2UB 3BDYH 4ZFFB 1UENA 1JYXA 3L45A 4TRPL 4B5EA 4K7FB 1IGCL 4XAKE 3V6BR 4NN6C 2C4XA 3NG5A 2XWEA 3TXAA 4IRJD 2L4OA 1AQKH 4HV8B 1OD9A 4DCQB 4Z7WE 3RY6A 5IHHA 2JB6B 5ALCH 1KEML 1I53A 1HAWA 5KSBE 5TK2A 2ZJSL 3EJZC 1UXLA 4KY1H 3UIYA 5HDQL 3JWOC 4JZJB 4OI8A 4PGJA 3VMOA 1A1MB 3V4PB 1NFIB 3KG5A 2HJLB 2HT2D 1FVDB 4F20A 4OSUH 4X5WB 5C9JA 1TCRB 1KPRA 3UO1H 3VXOB 3AGVA 1P7HL 1MCPL 3MUHL 1SGKA 5I6KA 5DO2C 1J8HA 1QZ1A 2EC9U 1D9KC 1OLLA 2Z93A 4XGZA 2Z92B 3GLEA 1ORSB 3V0DA 2FO4B 3L5HA 4LNVA 1BM7A 5FKPB 4DT2A 3WTYA 4NP9A 3PNWA 1GGYA 4XPAH 3BZEB 3HPJA 1TFHA 2A6IB 2YKLL 4L8SA 2J71A 3OPUA 3W81A 3KJ4C 5C7XH 1OGTB 2IFFH 2JIXB 4JKMA 5DC2A 3QDHA 1UYWH 2AK4D 1A0QL 1JWMA 4N1CA 3G6JE 1WICA 5DJ2A 1SMAA 3RTQA 4FA7B 1A6TA 2EDJA 3K91A 1NM4A 1U42A 3QDMA 4FNPA 3NZUA 4F92B 3AGWA 5ISZB 4M7LH 4R8WL 1KTBA 1ZY9A 3UTTB 1H5BB 4I8DA 4AKOA 3MKGA 1C1EH 3V9CA 1JTOA 5FYJH 5LAPA 4OV6F 2X4SB 5IIEB 3B9KC 2LU5A 1OOAA 5ACZA 1Q1JL 4M7JH 1QHPA 3K6OA 3BRDA 1IGMH 2C5DC 1OT2A 3RP1A 5F9DC 3VFVA 3B9EA 1FFOB 4JO2L 4ECNA 4ODHL 2BP5M 5C71A 4JO1L 3VGGA 1DQJA 4HZ1A 4OIBA 5EU4A 3WIIL 2ILLA 4M3JA 1ANUA 4P5MA 3ULVE 2VM3A 3BKYL 4LCVA 4L4JA 2BRRL 3ASNB 4PBXA 4BM7A 4OZHE 1O5DT 4DO4A 5I16A 2XZQL 4TUUA 3OAUH 4JFDD 3AW5A 3GSXB 4U6YB 4C56B 4ZNEA 2EIJB 3ENEA 5F1IA 2LFGA 3FK3A 3NAAL 4HCFA 5DS8A 4G70B 3I75A 4ONFL 1F3DJ 4GG6F 5FGRA 3QIUB 4FKHA 4NZRH 1TITA 5I6MA 1CDUA 1AR1C 2P1YA 3ULVC 4OGXL 2VDRB 4PWIA 4XRCA 5FGCE 1RK7A 1ROCA 1R3LA 4KZEL 5FM5M 1UZ8B 5I73B 3QR1A 3UC0L 4H0HB 25C8L 2OMWB 1KV3A 4ELKB 2XV0A 3QXDB 5EHFA 4HUNB 3IGKA 2F7PA 2EINB 1WQVT 4JQIL 4F8TA 3L4WA 2GSGA 2F1EA 4RWHA 1J9CT 4G7RB 4ODSL 1XIWC 4OB5L 4S1DC 1LNUB 3CXHJ 4C83B 3TEZA 4JFWA 1MZYA 4BCXA 2Q2LA 1YPZE 4FCAA 1IU1A 1PJWA 4DERA 5JZ7D 1OP5K 3TVMC 4QRRD 4YBQD 4F37F 1IGTA 1A7OL 4G6JL 1XGRB 4FNTA 5L6YH 3MR9A 4OZIB 4NN7B 2XKUA 1CICA 4MMYA 5JPNA 1L7TL 1PG7X 4HKZB 3VI3F 3SPVA 3DVFA 1E5CA 3HMWL 1DN0A 4U3CA 4LHUA 1RSFA 3U9PL 2QR0B 1UT9A 1P7BA 2WTOA 3SE9H 3T77B 5SX5K 4W4OA 1M53A 4BHUA 1FO0H 4RSVA 3PWVA 1RZ8A 1EXUA 3OZKA 3U0PB 4IHOB 4JPWH 2YS4A 3OX8A 5FB8A 1L0PA 1HILA 2RR3A 4LFHG 1K4CB 3N0PB 2X7LA 2YD5A 1A14L 4I18B 4Z7OF 5DRZB 1CR9L 3FC8A 4X99B 1YMMA 4PJDA 3AVEA 4DZ8A 1A8JH 1DQKA 2ZWLT 3CZUB 1JFQL 4JL2A 4KV5E 4FQCH 4PJAF 2X9XA 2EKJA 3S37X 1BMGA 3SQOL 3CHXA 1PLCA 4IOIA 2AGJL 4KKAC 2R2EA 4FNLL 5KSAA 2APVA 3ZDZE 1DSFL 3ULVH 5IVZA 4JKNA 3PY9A 4UMGA 1I9RL 3X1GA 1E27A 4O2CA 4B9YA 3D0LB 3RWCB 4IHBA 5AW4B 3EJPA 3V6OE 4PN6A 4DEPB 1P5UA 4DOHE 3BYYA 5F93C 3ATEA 4XP4H 3TN0D 2X4RA 1CMOA 1ZTXL 4C47A 2GEQA 1SXCA 1RUPL 1X6NA 1TZAA 3ABLB 4WHDA 1UM5L 2L7EA 5HYSG 4PRDB 3ECUA 1NCAL 1BQSA 3HC3H 4F58L 4F15B 3WS6C 3SGKC 1A25A 1KN4H 3VFPA 1UGNA 2VLRA 1OE2A 4HC1H 2GTQA 5LGHH 3Q2LA 4L1TA 1HHKA 4X6DB 1NGZA 4H0IA 4OLXL 3MYJB 1IAOB 3K71B 4P3DA 4E42A 2J4WL 1TJIL 2DWTA 2F7QA 1JF1B 3D6GA 4QIRA 4NM4L 3UTQB 3BLKA 4Q6IB 5HVWA 1I9IH 3ZXAC 3V6OC 1YEFL 4U05A 1BJ1H 2HFEB 1XAKA 2XICA 2OXHA 4LASH 2OULB 4L1BA 3W39B 3KWUA 4AJYV 1KNOA 3H2WA 2ICES 2V17H 2MHAA 3L3OB 2J57A 1UA7A 2XV3A 4RA3A 2XVGA 2GTZA 3QWQB 3MV9B 4GAGL 1AGDB 3HUJE 4QHKJ 3T4AB 1RZPA 1KZYA 4G43B 4F7EA 3IF1A 3CFJA 4GINA 4APQA 2X6CA 1N8ZB 4GG8A 4LOVA 1T7VA 2XG4A 3CFCL 3IFOB 3P4MA 3WN5A 5JW5B 1Y6MR 1TQSA 3HC4H 4H1LA 3VGBA 15C8H 1INEL 4YEEA 2HTLD 3A4FA 2ZKXA 4G8AC 1Q90A 1AHWA 4FADA 3IPFA 2J73A 4N6RA 4AYFA 5CFHA 3T65A 1R5IA 1C8PA 2Z6FA 1U8NB 3ARPA 1A4JA 2P45B 1KFGA 4ZS6C 3IWUA 2FK9A 3G7TA 5TD4A 3MLZL 1P7KB 2YPKB 2GJ6E 2C7UA 3FCBA 4XCYA 5I23A 3SDYH 3D09A 1T1XA 2AI0L 2XU9A 1VF5C 4ZQTA 3SE3C 1QVOB 2AXFA 3Q1EA 1MY5A 4J2QA 1J9RA 5A2JH 3W0WD 4LT7A 1NCHA 1UZ6E 1PX4A 3GSNL 2OTUA 4GAYA 3T0EA 2VRAA 1HKFA 4KVPA 1Z5LA 4IEFB 4PJEF 1YQVL 2YMXH 4N25A 3ISYA 1EGJH 1FA4A 1F4AA 4YHIA 3RWFA 2VLLB 1T6WA 3VGAB 2L7JA 4NNYA 5LUMA 3JTTB 1X7QA 1T1YB 4G5ZL 4QKXB 4JANA 5E5MB 5BCAA 2V7NB 1T7YA 1GTFA 1G9MC 2XPGA 2I26N 4KKCD 4F3FB 3V55A 2N56A 1G7QB 3U6XA 3O9WC 2F8XC 1ET7A 3K4ZA 1E28A 1XB6A 4CMMB 4UZGA 2CUAA 4D9RE 1L5GA 2R0KL 3I85A 2EVHA 3P73B 5HY9A 2GBVA 4TUOB 1DQQA 4D8PB 4L5FL 2VB5A 5AB0A 3EUDA 5J6HB 3CFEA 2QDVA 4KJWC 4J3WA 3KM2A 1IGYB 3CFKA 4OD3L 5DZAA 4O02B 4ZUVB 5D7IF 1RIUH 4W81A 2WNKA 1OXYA 5ITFA 1MFNA 2R1WB 3SYCA 3L7FB 3ZKSD 2EIZB 1J05A 3SDCA 2WQUA 2IWFA 1OPGH 3ROLB 3MCYA 3QQ4B 3OKNB 3EZ8A 4QKTA 2BFVH 3GSNA 3HKZA 2TRYA 3C6LA 3F58H 4OV5A 3I9AA 1BFOB 2FATL 1URZA 3VD5A 4UIMB 3GZQA 1DBKL 4JR9L 5EU3B 5HGBA 3B2UC 2EE0A 4QRBA 3K1KC 5D2NA 5JIDA 5IVOA 1L7IH 3KGSA 3ZJAA 5KAQG 4LEOA 4FFZH 4NC0B 4UDUB 1JWSA 1HXYB 4GQRA 5BO1L 5JOPE 2F54E 2V3DA 2NX5E 4XXDB 5FYKE 1NANH 4M6MH 2OMYA 2JNZA 2MMXA 1I3RB 2RIKA 3NCJH 4MNHB 2JJTA 3ES6B 1G6RB 1RZ7L 2F53E 1D5XA 3LS5H 2D03L 3F7VB 3VXNA 3LXCA 1NCCH 1CLZL 5A6MA 5IUSA 1S3RA 1KJVA 2BERA 2NY2C 3BDXA 5DWPA 2WZ6A 3ETTA 2OMVA 2CCVA 1RULL 4WEUD 5EBMA 2VLJA 3CZLA 4JM2C 1K3IA 3IT8D 2BNQB 1UWGH 3MCG1 3MA7A 3MZTA 4LF3A 3SE8L 1AGFA 1NAKL 1G9MH 1WBXB 1WBYB 1A6AB 2FYYA 3HLAB 2CRYA 5I6PA 5TH2B 4LKCB 4L4TA 1F13A 1HJBC 1OM9A 3GBEA 2BNUB 1BBDH 2YPLE 3JV4A 4HWNA 2MCG1 3UG3A 4JW3A 3BWZA 1P4IH 5T5FL 3HVNA 4LSRH 4RMVA 1G9NC 3WTSA 3K8LA 5D93C 5B7FA 5BV7B 3ZQXA 1GHFL 1QQDA 3X14B 3TEYA 1CFSA 5AEAA 4ES8A 5JIQA 2EVIA 1ODAA 4MKMA 2B1HL 3EOAB 3N3EA 2DD8L 4JFQB 2KDYA 1GGIH 3MRIB 5CZXC 4OFDA 4WWKB 1AZVA 3R0MA 2DQGH 1N67A 1UKQA 2K9UA 3VUAA 4AH2B 1R17A 5CHNA 4PHZA 2AJSH 1FNLA 4UINL 3MNZA 2CHDA 2CRMA 2M1KA 1OK0A 4RFOH 3EH5B 2Z9TA 2WN2A 4HIHB 4NERA 1UKSA 1PD0A 1DVQA 4UTBL 4J3BA 3EDKA 4ODTH 4KROD 3FT3B 2YQBA 3ZX1A 5ID0A 4CW1A 4E41A 1EEQA 3AB0C 1VACB 2PXYB 3O2VH 1FFRA 5BOZG 1N64H 2UX6A 1IEAA 1YEHL 3QUZA 4IIQC 3BO8A 1C5DB 3MPCA 3MTXA 4XBGB 5IB1A 1WA1X 5FFGA 1EAPB 1OCZB 4PJHE 3LS4H 3VWJB 4PP2B 3U25A 4KJPC 4Y5YB 5DC0A 3Q1SH 5D5MB 5BQ7B 5K9JH 4J2XA 1CB4A 1HTYA 3QDGB 1KLGB 1ED3A 5GJTH 3GXIA 2V2XA 3RPKA 1A6WH 2CSPA 4OTXH 4NUJA 3WO4C 2Z8RA 4NRZB 4ANXA 2ZYSA 1R5VA 2WLYA 2A0LC 2Z31D 4JRYA 3SJVD 3QJHA 4GY4A 4DGVL 1BHGA 5A2LH 4KX9A 3DX1A 3EF4A 3LVTA 2JB5L 4ONHB 2ADYA 2XKSA 1PKQA 1RKRA 3I6KA 3APMA 2XJKA 4OY9A 4AGPA 3A22A 5JHAA 2WWKO 5GS1B 5FYKH 1RMFL 3OXSA 3RRQA 3UTZB 4ZW3A 1YEKH 1LE9A 1NC4A 2FNBA 5I0DA 4KBPA 1G9NH 1ZS8A 2CBPA 3W9DA 4M5YL 1YNTA 4MS8D 1UXSB 2BS71 3MC0A 5DR5H 2HRGA 3D69A 5LNDA 1ZDSA 2MTAA 4UTBA 4AT6A 5EZLB 4PRIE 4OCYL 1MELA 5DZ9A 4DPAX 4XNQA 1M7DA 1GMEA 1I8MA 3P02A 3UZEA 3GMQB 1J5OH 1PG7L 5T3XE 1WJ3A 1I1FB 3HI5L 5DI8B 3TIDB 2DM3A 4JDEB 4KH2A 3LKOB 1D5BB 2E9BA 4ZUSB 3RDTB 1AYRA 1OT4A 2WQAA 1NCGA 4OIIL 4UQ9A 3PE9A 3QXAB 2XQ0A 1KMGA 1T6VN 2P5EE 4YO0B 3L16A 4U1KB 1U58B 1AZUA 5HGDB 5J11C 4NP4H 3WUWA 1JV2B 4P3WA 3RFRA 3HE7D 5CZVL 1GAFH 2X89D 4QRPB 3ZKMC 2NY1B 4U1HB 4LHJB 1L0YA 2GHZA 3VX0A 5FDYA 1FPTL 4K9EL 1Z1WA 4NZDA 1JRHH 4FABL 3S37L 3S8WA 3VXUA 3ARFB 3GRGA 5ERWA 2WSKA 3OB8A 2LT9A 2Q8BH 4TSBL 4MNQB 5HD8D 5GGVY 1GW6A 4RFNC 4QHMA 3NIDF 1AC6A 3ZMNA 3GMPA 4ZPTA 5FO8B 5B38B 1RIVH 3QEQA 3CFDB 1KGWA 4LLUB 4UCFA 2ADJA 5C8JA 1X5YA 4P9HC 4OJAA 4W9JC 4NN6B 1M71B 4OZ4B 1N2RA 5D2LA 1CXKA 1HSBA 1EHXA 3S88H 4G8FA 4HPYH 4P2CG 5ESVB 1EZUA 5FWRA 3ARGD 3L2NA 5ESQB 4MJIE 1MRCH 5CJ5A 3FB6A 2V5RA 3ILDA 4YAQA 1RK0B 5LCVA 2XWCA 3NIGB 1DJWA 5KANI 5FGBC 3NOIA 5FHBL 3FUEA 1ACZA 4WENB 3Q13A 3BH9B 1UZGA 3QQ3B 3VFWB 4J4PC 1ZT1A 4NO3B 1FZOA 2ZXBA 1MEXH 1U8PB 5BZXA 4R26H 3ZOAA 1U8OB 1QPKA 3FB8B 4IJTA 5FV2A 3KPRD 1D9KB 4Y4HD 2H8PA 4HS8H 3ARDC 2EDMA 2DICA 2NYZA 3ROOA 4AL8L 2ED7A 1DLFH 1NMAL 4XBEH 1LWHA 1NUFA 3H9HB 5HDRA 3PIQB 5J06A 2LE9A 5DJYA 2PTTA 4PJXF 1OTUD 4G72B 2IBBA 3VD2A 1CLOL 3QJUB 1GOHA 5K1NA 1PZ5B 1HKLL 4IBYA 5E2WL 4QXTB 1NKRA 4QEGA 4RDQF 1L9OA 3PP3K 3SDAD 1JZ2A 2XLLA 3NSDA 4CMHC 2P5WD 5EMYA 1IKFH 1KJ2H 4PJ8C 1X9RA 2W9DH 3HJEA 2FZ3A 3CFUA 4EBQH 2HMIC 5GGVL 2XQBH 5BPPA 4G7VL 5SWQB 3B9KB 1JWUB 3ATAA 3C9NB 4J3OC 5LVEA 2G9HB 5KVEE 5E00B 3JWNE 1U91B 2F7RA 4LOUC 3T71A 4LP4A 5MENE 5F0LB 5HVFB 3BKML 3LIZH 1MCIA 4K3DL 2EYSB 4Q9RH 3H9SE 3KXFE 2Q8AL 3D4GA 3J2PA 1M1XB 4M7LT 1ITCA 5INCB 1BZ7A 4BXVA 1A3ZA 2GFBB 2J8UB 1FO0B 3ALPA 1JJUA 1AO7B 4P9HH 4B27A 1JTTA 4NQXA 2ZCZA 1ZGLB 3MJWA 2BNRB 5I6LA 3HN5A 2BIPA 4S11A 1OGPA 1MCJA 1UVQA 2F61A 2WBJA 2XWTA 3OKDA 3U4KA 3VYNA 4OJDH 3QRGH 1MXDA 1JNNL 4NNPL 4KHXL 5A3IC 1NL0H 3JWNC 4MMZA 4ENZA 1ORQB 4KXZI 2J2ZB 2N7BA 3OB0K 4NKOB 5KVFE 4AYDC 1IMHC 2ZSVB 3WDHA 3BZFA 2W80C 3EH4B 3JT0A 4Z7QE 2YIHA 1QA9B 2FVNA 1JDDA 3KWVA 2HX7A 4IOSD 3TWCH 1CGUA 3PF2A 2CHWA 4Z7WF 1HESA 4FTDA 3BP7A 2LVCA 1V7NL 2W91A 5KSBF 1D5RA 4P4KC 1RHHA 4ACPA 4NXKA 4GMTL 4WFHE 4QXVA 2YD7A 2J55A 3KW7A 5EFIA 2ITCB 1MCSA 1OL0A 4MSWA 1V3KA 4OGYL 4WJ5B 3VFSB 3B3IA 3FBQA 2PPFA 4L8DB 3EYFA 3IDXH 5DHVB 5EBGA 5EIIA 5I1IH 1KB5H 1GA2A 2YBRB 3MROA 2OK0H 5K93A 1KYOK 5C0CA 3STZA 1I9JL 3NTCL 2FWOB 5EO9A 1RY7B 2DLIA 5H37A 2VQ1B 1E4XI 4XPHL 1WV7T 4FXKA 5F1OB 2I7OA 2Z3FA 3H7BA 3T0VA 1DYZA 1PG7W 2X3CA 4AQZA 4OCWH 5A2BA 3VQ1C 1U3HC 3P3YA 4N0YL 1CGSH 2R7EA 2DLHA 4XNYL 2MQGA 3WKMH 4NM8H 3SCMD 1J7VR 3OGOE 5FGCB 5F3HB 4X8JA 12E8L 5FYLE 4XCFL 1I1RA 3T04D 4J3OH 3QZMA 3DVNB 3SGEI 4AQ1C 3GO1H 3MQIA 5B1AB 4MS6A 4NZ8A 5CJ8A 5EU6E 5D4JA 2CH8A 4HX1B 2YRLA 2BMKA 2OW7A 4EUPH 4POYA 5CIPH 3KPPA 1AC0A 5JDJA 2E59A 3GI9H 5EA0H 2HT4D 4AQOA 1NDMA 1TR7A 2F5AH 3RPIA 5JYLA 4E9LA 5G55A 4MCMA 3ZBMA 3ZU8A 2YLKA 3PAVA 4NJAH 4U1JB 2A4EA 1ETZA 1OO2A 2XXFA 4S2SB 5K59F 5D7LD 4BK8A 1HT6A 4V1DD 4MAYD 3JWNH 2A83B 2J1KA 2QTVA 1IGJB 4KMQA 1ZLVK 3QYNA 3A67L 4GMSL 5IROA 3FQXA 4L4VA 5E8DL 1AIFB 1S2EA 1NGWA 4FE9A 5I8KH 1UM4L 4CDHA 4DKEL 3LNGA 4OZHF 1MIML 3HN8A 3BKCH 4HCRH 3KCPA 2DYPD 3KPLB 4XMLH 5DO8A 4GXVL 3FL7A 3OJDB 3K5SA 2GJRA 5HHOA 3NZ8A 1G1KA 3MACL 3DRTA 3NSXA 3BAXA 3OAZH 4X98B 1MSPA 1KBGL 1BYNA 4HJTA 3GMNA 2H47C 3FO2A 5DD6B 5FO7A 1SXBA 3MBED 4GRWE 1BX2B 2CO6B 4YIQA 1JV5B 4X7TB 5I6XB 1O9WA 1WYJA 1DDTA 3WN6A 2LLLA 3EYSL 2ENQA 4HAFA 1H6FA 3GK8L 4R6UA 1G7HA 3CU1A 2VZTA 3DTDA 4HBCL 4F33A 1IEBB 5E03A 2B4CC 1T3FB 5IOPA 2PKDA 4R3SB 3PL6B 1DCLA 2X0WA 2ZE0A 1D5IL 3O0LA 3PDOA 2F0CA 4EN3C 3RVUD 1F11B 1XSOA 5EEXA 4XNDA 3CK0H 4U3SB 1CXLA 4LK4A 2YUXA 3ESPA 2RGSA 2V9UA 2K70A 3ZHFA 4FL4C 5CP3H 2EDWA 4PTUA 4ZBJA 4LARL 1SF3A 1YPZF 2HSIA 3QNYA 4ZK8A 4GUQA 4BWUA 3MRFB 4IBWA 4Y4FD 4IK7A 1NWOA 3U7WH 3E2HC 4LCWB 4Y5VA 3PGDA 2WQSA 4YLCA 3BIKA 4PRPD 3IJYB 1HE8A 4D3CH 2PYFA 4DW2L 43C9A 3DHJA 3GZKA 3F7KA 4MAUH 4YNYA 3ZIYA 1NEZB 2UZIH 3GXUB 4M7KH 5DK3A 5DJCB 4B3VA 1DQVA 3F7YB 4XNZC 3VMPA 4OLVL 4YQXL 1NIFA 2C9UA 5I1LA 4XPBL 3II1A 4WK0B 5SX4H 4DN4H 3RWEA 5DVPA 3O41B 4PY7A 4M93C 5BQDA 2F58H 3RFZB 1P4UA 2L8AA 3V6FB 2TAAA 2VDOL 4XN8A 4QOKB 3HG0A 3DKHA 1V3MA 3JV6B 4OLYL 3UAJA 1M2VB 1Y18A 4HJUA 3QORC 4D9LH 2QVKA 5F7LB 4B96A 2X3BA 3C6SB 1UWXH 5KZCB 2O5XL 3QQDB 4NT6A 5ACLA 5TE4L 1IO4C 4O2FB 2UZXB 1V7ML 2YEZB 4WFEE 1DVTA 5T1KA 3C08H 3ZDZF 4CC4C 2EYTB 2G3ZA 4WO4B 1I8KB 4LE8A 2HH0L 2XTJB 1QKZH 4R97C 2WXHA 2VZ3A 4Q9QL 2UY7B 1RJYA 4QMEA 2C3HA 4GAFB 3DECA 5JW3H 5LGKA 5IB5B 2FB4L 1U33A 5DHXB 2BCKA 3S36X 3OLIA 4EPSA 3Q6GH 2A74C 4Y8DC 3TV8A 3GC3A 5BRZB 4NFCA 4POZC 5ICYB 1S7SB 3FB7A 4YSEA 4JFHE 4ZZKA 4GRWH 4QXGL 5KBLA 1G7PB 2QDWA 4NI6A 3UADA 1JGDB 5DRXA 3A5VA 4LL4A 2R2BB 4EZJA 1TPXB 3DPBB 2OYPA 1RP8A 4XNUL 3F7RA 4B53A 4XWOD 3MXVL 4RIRA 4ALAL 3AG1B 2HFFB 3GB7B 4GFTB 3T2NL 4OBSA 4P07A 3CVHH 4LLQA 1LO4L 3VJ6B 3GFUA 2QMKA 5TE6L 4WW2A 4MVBD 1FL6B 1X5LA 4Y8AA 3MV7A 5ADOH 4OCRH 2OSLB 1MFAL 1A66A 2F8IA 2ZONA 4UT6L 4ZI8A 5IKCA 1VPOL 1MI5D 4TQEH 5IP4A 2Q7YA 2G5BB 1E4WH 1EUUA 4XCCL 3HUJF 2GPZA 4X4ZA 2N7SA 3VD7A 5DK2A 1GZQA 2MEJB 4GKZB 1F97A 4X5XB 1MCEA 2YOAA 5BVPL 1O6VA 5L88L 4KUCD 4AK2A 3QFJE 3UPRA 2NLJB 3N5AA 4LDEB 3BMWA 4OGAD 2R9HC 4BFIA 4XMPL 4Y19D 2DJSA 2H7WA 4ZOEA 3IFLL 4PRNA 4JFEE 5F7BA 3HZKA 4LLDA 5BJTB 1FVCA 2COVD 4GW1B 2W8CA 3ELQA 1ZJBA 2P8PB 4JN2B 4X5PA 1H8SA 4WI0B 2NSXA 2FGWL 1E50A 1PY4A 3WXVL 4LEEA 1INDL 4P2RD 4OF6A 5E08L 4YVNA 2NY2B 4PRHB 1VKXB 1UD8A 2YAEA 2GHWB 1CXEA 1QEXA 2YXFA 5F3FA 5T1MA 3VG0L 4Y9BA 1S9YB 3HE6C 4F8PA 5KVDE 2WMPB 3ARBB 4GQ9H 3AUWB 2WWOA 3JT2A 2DQFB 2QQNL 2AJZB 1GVIA 3HS0A 1F3JA 4U1LA 4TQPA 3VI4B 2HLFD 1PLGL 2FX9L 4B5ZA 2CHNA 2Z1KA 1AKJA 1ZCRA 5HYJE 2PYED 4LAQL 3KZ8A 3M8OH 2Y06H 3SB3A 5L2JB 5CU5A 5B38G 5TDNB 1HXMA 3ULUH 3AREA 3C8HA 4BZ2L 2FR4B 1SJHB 5D93B 3D4ZA 2LU3A 4UT6A 1EFXB 4XWGL 2F2HA 3GJEA 3KE0A 5DFVC 5FGSA 3TA3D 3DBXA 32C2A 3NN8A 4X4XB 4K5PA 1UB5B 3BWUC 3OXRA 2EEFA 3QI9C 1S8DA 4NAQA 3HG1B 1AMXA 5JHDE 1EAJA 3AQDA 5E4EC 3SKNA 2KT6A 3CN3A 3WIFB 1OAKL 5DA0B 1LEIA 3QJZA 4YBHA 2CA3A 5KOVC 1UB6B 4RMBA 3MXWL 2ZZUT 1QSEA 1G43A 3DGGB 2X05A 1NQBA 1W15A 2WZPD 4F1ZA 3D48R 4XVSL 2V7HB 3ABZA 3F85A 3HHMA 4MA1B 4HHAA 2W65B 4YHOL 35C8L 4F91B 3OKOB 2OMUB 1AE6L 1A6PA 1BD2E 1OSZB 3FO9B 1KTLB 3MTRA 3RURA 3V9FA 5BUAA 2WXOA 3PWUA 4XR8C 2ZUYA 4Z8FH 4I0CC 1ZVHA 3FHQA 2BSTB 4FJZA 5I82A 4JE0A 2QZQA 2WAHA 3EO9L 5JQ6L 4WI7A 4JM2F 2KERA 2ZX9A 3W9EB 4ZW8A 2E3VA 4BZ2A 5E5RB 4YWGH 4WTZA 3WO4B 5F7EL 1MH5A 2FX8H 4DP9X 2APTA 5F44A 1JXDA 1KPUA 5ALBL 3TJHD 1WBZB 4WKZB 2V3FA 2NUPA 3U4EB 3TZVB 3LMJL 3ZK0A 4N3TA 3APNA 4DFHA 3WKNA 1WWCA 5KYXB 3O8XA 4CGTA 4GQPH 5IMKB 3CX5J 5ESAB 4J23A 2Y6SC 3LQAL 5K9OB 3H0TA 1AP2B 4N2NA 4F7MB 4F9LC 2B1AH 3ILPB 4B7LA 1HAUA 2XN9D 1DJSA 1E4KA 5EO1B 3DXAD 1J8HE 3F83A 3I02B 4MDRA 5AYUH 1HL4A 4JHZA 5AB2A 4WI8A 5I1KH 4HKXA 3G5ZA 1QX1A 1A6VH 4S0SD 1HHHA 3F6JA 4NQSB 3L5XH 4TUJA 5BMFL 2ADGA 4YSRA 3SSGA 1RZKL 1E8ZA 3DHPA 1BM3L 3DWTA 4NCDA 3RY6C 4YX2L 2IH8A 3VA2C 1UACH 2DEYX 3U1QA 4JO3H 2QKSA 2A9NL 3FS9A 1IM3D 1CIDA 5KVDH 1NM9A 2UZYB 1O9ZA 1Y6NR 3VWKD 4N22A 4BZ1H 2AJXH 1FNGB 4GFXA 2H2SD 3DJSA 4LVOC 1GGCL 1TVBA 3QDME 4LFHD 1MW2A 3B34A 1E9PB 1GRWA 1SYSB 1T5XB 2BZCA 3NCBB 3NP3A 5GXBB 2CA4A 3ILQC 4IBLT 4HDIB 4UB0H 3B5GA 1OGAD 5IJVA 3ZE2E 5M7QA 2K9FB 1C5CL 1LK2B 1EZSA 2B08A 2BWDA 4L8SC 2HPOA 4B9CA 4EDWL 4CKVX 1K5WA 3CUPA 4UILL 4JPIB 2Z4TA 3U83A 3F8UB 1M7UA 3FB5B 3KLHC 4FHJA 2PCFA 3DI3B 3RTQC 4YFLF 1UQSB 4N3UA 1DSWA 2WCGA 3GKZA 1E9OA 4R90H 2VABB 5DWUL 3VDCA 2HTKC 2P5EB 3O3EB 4GRMA 5DUBA 3TT1L 4K2UL 5JW4N 5JIKA 1CLYH 2FE0A 1KCVL 1QMUA 4XP6L 1EHLH 3KLLA 1Q0YH 3TJPA 4ZYKB 2FLMA 3BQUA 3QCTL 4BDVB 3UDWA 2A3TA 2H9GB 3FTYA 4ZNEE 2V37A 2WOBA 5DLML 1I1AD 1YG9A 43CAB 1JPEA 5TF1L 4JRXD 5KVGE 4PGCB 3BT0A 1U3JA 4I9WE 5B1JA 3FN9A 5CMAA 1U0QA 3EOTL 4XPGL 4G9DA 1RAMA 5F7UA 3QDJD 1DUZA 3EHBD 4H44C 1RCYA 4HWZA 4ZMYA 2JCCB 2FLBT 1NC2B 4LZKA 1LQBC 3K7UA 2WXPA 2WTPA 4HU8A 4PS4H 4XZUB 3ARZA 1QI3A 4YXLL 5EUKB 1ZDQA 4YJZL 3L4XA 2AXGA 4ELDA 3APCA 5I0VA 3RB7A 1I3UA 2ITDB 4A66A 4WVRA 5CJQL 3TT3L 1VFOA 2GKIA 3PWNB 3UABA 4CVUA 1Q9KA 2Y2TA 3G5XA 1A9VA 4KK9C 4KK8D 3HB3C 4MA8H 4DQOH 3GYRA 3PQYD 3HR5B 1S7RB 1A9BA 1JZIA 1WFNA 2HRPH 5EZOL 1T7ZA 1B9ZA 2BY1A 1QASA 4Y2DD 2NY3D 1OSPH 3CDYA 4EI6A 1JGLL 5I5MA 5I66A 2NYKA 1TU2A 3QXWA 3LRHA 2ZICA 1AHKA 3EH1A 5I30L 2XXMB 2XDHA 1XL6A 1S9KC 1B4RA 2AQNA 3GTVA 5BZZA 1EDYA 3O2WL 1N3NB 1A7PH 1UM6L 3NJKA 5T3ZH 1R3IL 1UA6L 3R18A 2XZAH 2BHZA 4OFVA 2ZCKL 2CO3A 5AB9A 4TRPH 1PIGA 4FA8A 1FN4A 3SDXB 1S7TA 1T4WA 2OMZA 4I1NB 3D0VA 4FQ2L 4APXA 3ZYOA 1GIGL 3UPAA 5IBTH 4EUPB 3RU8H 3HI6L 1IGIH 4JG5A 4PGDB 1YMME 4LOFA 4PJDE 1KEMH 2ZJSH 3HA0A 1CICC 3EO0B 3IJHB 5JPNC 3DIDA 1VERA 3L2LA 3NFSL 2EEXA 1KN2H 1P5VB 3NSYA 5FO9B 4TSAH 4FG6D 5TJWK 4U6VL 1NDTA 4ELMF 2K45A 3N44B 1CK0L 1VB9A 4PJGA 3TC9A 4Y2NA 3GSWB 4JS7A 2NOYA 5I6NA 3MUUA 5J89A 3QJOA 3GSOA 4ZX5A 4XAWH 2KH2B 3L9YA 5ILTL 4KKBC 4DZBA 4R2GB 3KPMB 3N55A 3S36L 1JAEA 2FEDD 4NQCD 5TFSH 3WAKA 2FX7L 3MOBL 2B9AA 3IFPB 2MQCA 3VXPA 4HJ0D 1NGQL 1XEUA 4KXAA 1C16B 4P4KB 1U2HA 4WEEA 2YKLH 3ALXA 4MB5A 4KRMB 3TURA 1XF5A 4TS6A 1LWRA 3BVTA 1NEZG 2HFGL 5KVGH 3G6DL 3WTUA 2XA3A 1X4XA 5IJBC 2CLZB 3N85H 3G04B 3RJOA 4O58L 2VLRE 2W07B 5KSAC 1UCBL 4OD2B 5C0JB 4G6ML 1I7ZA 5L7XL 5CCGE 3QULB 3UACA 3CN0A 1YSOA 3OLGA 5E6YA 4BK4A 1N5YL 2GAZA 5FK9B 3S5LB 1N9PA 2BC4A 4Q8BA 4ABQA 3GI8H 5INDA 5AW1B 1VDGA 2CIKA 4U6TA 4WUUA 1P5UC 4FFTA 4I0PA 4J3OF 2DWEA 5IEKA 2A9BA 4JK0D 2QQLL 5I15L 1AI1L 4WWID 4GSDL 1TLMA 4LLYA 2DEXX 1NJ9A 4KQ0A 1SPDA 4JO2H 4ODHH 4HWBH 4I2XB 1QFUL 1ILUA 4LCUA 4JO1H 1OVZA 3M6DA 3WIIH 1T0PB 4YPJA 4HK0A 4JKPL 5CEXA 4O5LL 5C2BL 2AMUA 2BRRH 2OSWA 1NBYB 1BFSA 3QNXB 1V05A 5KWYC 5D7HA 1VLXA 4U6HB 4FQJH 4MXQC 2DDQL 2E9WA 3FCUB 1DUYB 1NFDA 1PNCA 1B2YA 2Y22A 2EIKB 3MUGA 4P2QB 3GUTA 2D7NA 1DTUA 1MFDH 3NAAH 4RSYA 4I7ZC 1ZTXE 2ZP0T 5DJAB 4EF3A 5IQ9B 1XXFC 2QFRA 3VGEA 3O3DB 4ONFH 4NX0A 3QP3A 2KQMA 5EF3A 2CK2A 2VC2B 4KO5A 2YOCA 1V55B 5TDOA 1YJDC 5EU6B 2NNAA 3REWB 4APQC 4Y2LA 4OGXH 3U30B 4BQBA 1FYTA 3QEUB 2MNUA 3WN5C 2HRLA 1Q0XL 3T0EE 4FLOA 2X4UB 3DROA 1J48A 4KH9A 1ECYA 3UC0H 1AHWC 2PR4H 2P48B 2WK2A 25C8H 5J7CC 3L3GA 1J5CA 1OPOA 2DPKA 2VSMB 3N1MC 1D6EB 1XXDC 4MB1A 4Z7QF 3K6IA 4GW5B 3WIHL 5JORA 3RX8A 3EXLA 3PWPD 3GSVB 1LILA 5FF6B 4LLMA 5IM7B 1LVEA 3WNLA 4R0LA 5A16A 4OB5H 1OE1A 3NQIA 5D7JA 3APDA 1ZHBA 3V5DA 5AOKA 4NRXB 3R19A 3ZTEA 4G6JH 3PGCB 3RTLA 1YHPA 1HH9A 3T0EC 4RGMC 2IGLA 1BQLL 4QRUA 1TCMA 2IGTA 4NO0B 5GZOD 2MPAH 2RMNA 3D07A 3TH4T 4NENB 1L7TH 4D0CB 1F4WH 1U30A 1R0AL 4YDLC 4CVXA 1QUNA 1CU4L 4JFOA 1TSHA 3U9PH 3UYRL 4B0MM 4XODA 4G42B 1ES0A 1G7IB 2GQHA 5BOPA 4PJAA 3R8BB 2IANB 4FL4B 1UOKA 4Y1SA 1WA2X 3D85B 3Q2VA 5L4JA 2DLFL 4Q74A 3CHOA 1G4MA 3NRQA 3VO0A 3V0JA 3DV6B 5E51A 5ISZD 4JKKA 3UTTD 5I76A 4ENEC 4EZMA 1A14H 5FA4A 1CR9H 2GCYA 4ERSL 4R7VA 3BPCB 3CMGA 5E8OB 2WNWA 3GNML 3CVHB 5IB2B 4LDLB 5D1XB 2ZCLH 5TPWL 4BELD 3DX9B 4LSDA 4YGVB 5D1QC 4LPWA 5JA9A 3CDGB 5D2NE 3MO1A 4KHTL 4PG2A 1O6TA 3QGVA 3UTSB 4FQHB 3BPNC 1J86A 3F5WB 3BP5B 3V0WL 1GY1A 1C08A 5E6RB 4HJGA 1OB1B 2X12A 1QOKA 5F6IC 4D9QD 4XVTL 2AGJH 4YL4A 5FR3A 3SDCC 1MF2H 1YJDH 1DSFH 1JHKH 1VFBA 4MZRA 4FZEH 1MIEL 3B7UX 2YO3A 1DO5A 3NFNA 1I9RH 2QGCA 2VL5A