5AQ0A

The structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
SGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Ttldomain of the Human Carboxypeptidase D
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CARBOXYPEPTIDASE D
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 5aq0A00
1UWYA 4FXTA 4FL4C 4YOKA 2NSMA 3NJVA 1H8LA 3E8VA 4EIUA 2XHNA 3NJXA 4U3SB 5G5DB 4WI0B 5K39B 3MN8A 5AQ0A 2B59B 1NKGA 3HN5A 4IYKA 3KCPA 3G3LA 1QMUA
chains in the Genus database with same CATH superfamily
4YSUA 1ORSB 5T5NF 1BIHA 4LLYA 5JXAL 4QXVA 3MJ8B 4ES9A 2WZ5A 32C2A 4I0PB 5C08B 1C7SA 2X1PA 2WAQA 4FQHB 1N26A 5LQBL 4UINH 4LIQE 3HC3L 1UWGL 2N0MA 2Y3AA 3CPLB 4GXUM 4LCCB 3O4OC 3RVVD 1MCBA 2X0WA 2Q8BL 3MLXL 5EOQH 2COVD 3P4OA 5IB4B 1RVFL 1B6DA 2YEZA 3UGXA 3PWPD 5IVZB 3FONB 3GC3A 1WDAA 3RIKA 4PRPB 3D25A 3V9CA 4HBQA 2WC7A 3PWVB 4I4WA 1D7FA 3IN0A 2JJWA 2WXJA 3O3DB 1S3KH 5GZOD 1HH9A 2NY0C 1QVOA 3LIZH 5EOCH 4KK9D 4KVNH 1U3YA 3IAPA 3OG6B 3KMDA 2QVFB 2EUZA 4MHHG 3EYFB 3QEUA 4ZTPL 1WD8A 4E5XA 1S9YB 3GJFA 5DS1A 3H9SD 4PVMA 1MNUH 4LRNH 5E4EB 2QQQA 4PJEB 4WI4A 2VL5B 3FB6A 5I1DA 3OR7B 3IGUA 4B9GA 4WEEA 3AROA 4LAJH 5A2CA 3NG5A 3WIFA 4G9DB 3FQUA 3PDOA 1ZHLB 4C56A 1BGXH 1JXDA 3ATBA 4L0ZA 3TNNB 5J89A 3E0GA 3MNZA 3D85B 1HHGA 1IGTB 4Z7UB 2NOYA 1U8QA 4BFBD 3N44B 3LXBA 4P99A 1YMMB 1MIEL 5SWZA 1FNGB 2APSA 3L4TA 1V3LA 1LDSA 4FCHA 5IJVB 5JW5B 2HKAA 4N8CL 4P5MB 3B9DA 2YEVB 4B0MM 2FLMA 3TH2T 3ZLQC 4DPRA 2ZUSA 3PQYB 4RMRA 3SDYL 4EXPX 4MBRA 5E9DB 2GUYA 4PUBL 5IQ7L 1A3RL 3CC5A 1TMQA 3FHQA 1NDGA 4WEUD 1ETB1 5CXPA 4EZLA 4OD2B 1S3RA 1JERA 1B9KA 3V7MA 5D7JB 3NT0A 4OB5H 4R7VA 1EX0A 4GXFA 1WRFA 1MRFH 1FI8C 4KGJA 3X11A 3COOA 1MHHB 1E65A 4JB9H 3T4YB 1J0HA 4KTGA 3GUTB 3WJJA 3A5VA 3P77A 4Z95H 5L6YL 1OTUD 3VD4A 2V5RA 2IPUK 1JDDA 3F62A 1KCLA 4QYOA 5C09D 3U30B 4LIQL 5DRXA 3IFPB 1NGXB 4YGVA 3FTGA 3SZ6A 1CD8A 2IDTA 2WUBH 1F6FB 1CS6A 2CH8A 4RWYL 1VF5C 3GIZH 2YS4A 3ILEA 3NABL 3ATDA 1YEIH 2D0FA 2DYSB 2WCGA 4G71B 1I4FA 2N7AA 3H8NA 4HWBA 4M48H 1A3ZA 2XBZA 1NCWL 2RQ8A 2I24N 3IRZA 3PFQA 5KBDA 1C5DB 1S9VA 1MCRA 3BPNB 1F90L 4QDGA 1R3IH 5KG9A 2IPKB 3AREB 1WBZA 1M7XA 1DCLA 3DDFA 4OV6F 3D85D 1IAIH 5HVWA 8FABB 4H26A 4Q9QH 1TLKA 3CQFA 1DUYB 1ZV9A 3B1TA 3PYCA 4UUJA 2GBUA 4NSKB 4HUXA 3RFZA 3HLKA 4WTWA 5D9SB 2GK0A 4LCWB 4KVPA 2XUWA 3W0WD 1I8AA 5FHBH 3IJYA 1FO0A 4IOSD 3ARGA 4LF3A 1KB5H 1AQDA 2PYED 3CSGA 1D5BA 1Y7VA 2DMCA 2QZ5A 4FXGB 4KZ0A 2QQKH 5CHNA 4R83A 4CL7A 1R5IA 3S37H 2EKJA 4FTDA 5KUKA 2BSDA 4PM1A 4PLKC 1RP9A 5MEQA 1HHIA 5E8OB 1VSCA 2YARA 4N90E 1N2RA 1JGIA 3VFOB 5B3JE 4PV8A 2JELL 1U8MA 3OKLB 2BCKB 3L45A 3NQKA 1NLBH 2NY5L 4OLYL 4POUB 2VDPL 5M94B 4X6FA 1A4JA 5K33A 4DUVA 5I6NA 1Z66A 4FQQB 4W70A 2V6HA 2GAZB 3KW8A 2BP5M 5D6CA 5MENB 1JBJA 1BVKA 5FK9B 3C5SB 4P0DA 2KZBA 2AP2A 3LXCA 3CZSA 2CIKA 3N04A 2WZ6A 3FU3A 5FKAA 5J1SC 4OZHB 2MKWA 1MXDA 3L9RB 4JFDD 3V95A 4FLOA 3EO9L 1PU0A 3G6JF 4MNGB 4P3DA 1MCOH 2WVTA 1HKFA 3BDXA 1CDBA 4KQ4H 2QTEA 3QEHB 3UTQB 4FQCL 1B0WA 3A4FA 2Y5TA 1NKRA 4XXDA 5J11C 5LBGA 3TEUA 4RRPA 2KMWA 2WWMC 35C8H 2EJ1A 3S7GA 5CGYC 5D7IF 1CFSB 1EGJH 3RGVD 4AJWA 4Y5YB 3JV5A 1VFAB 4HWZA 4BD4A 1OKEA 3FT4A 1BYPA 4H7VA 4A7UA 5KSAB 2BPBA 3V0JA 2I07A 3IKKA 4FD0A 1EJOH 1DSFL 1I85C 4X7FC 5HHPA 5ISZA 4NQSA 2ISDA 1LEKA 3BUYB 5AW4B 3HZ3A 3GSWB 1KYDA 3QUZD 4J3OD 3S8WA 4N2OA 4W6YB 2ZNXA 1FG2A 1LK2B 5KSBB 4NIKB 2DF3A 2P8LA 4ZQKA 1RK0A 2R0WH 4MVBC 1SLXA 1RZKC 4QTHB 1F11A 2HVKB 2JKSA 2GT9A 5EZLB 1SJHA 1HAUA 1XFPA 3RA7L 2CJSA 3K71B 4PJHA 2H1LM 4JUSA 3W56A 4AENA 1G9MC 2VLRA 3BLBA 1P2CB 4TQEL 4NFBA 2Y36H 4FYTA 1Z5LA 4K23L 1A7RL 1Q9OB 1TQBB 3RWDA 3SD5A 1V55B 5T5NG 5D2NA 3RL1B 1ROWA 1F4XH 5EO1A 2CO7B 4TLKA 3RG1C 4JUTA 3IDIA 2X44D 1AZZC 2GITB 2C9SA 4JQIH 3T77A 4E2OA 5HXMA 3D52A 3S98A 3ML9A 2ZT9C 4PSRA 2I60L 3QRFM 4H0GA 2YPVH 1QP1A 1X4YA 5DO2D 1O6SA 3BPCA 1CFMA 1NCIA 5J1AA 4GQ9H 4H13C 4PJHF 5H8DA 4HC1H 4CMHC 3WHE0 2C3HA 5TGBA 3P4MB 4Y5XB 4DP1X 1BQHA 2OMUB 2AJXH 2AERT 3QULA 5MP6L 4U1SA 4PJFB 3EYFA 1MOEA 3QEUB 4E5XB 4FA6A 3NJGA 3Q6FA 5IJBC 4LK4A 3FQTA 3RZCB 4U2YA 2WXGA 5D96C 5AB2A 1TXKA 1QTPA 3NCXA 3VH8G 1HH6A 1ET8A 3G5ZA 2V2TA 1FIGL 5JNYA 1H8NA 3AQYA 1QFOA 1SY6A 2WXIA 3H3PL 4NKDB 1E8XA 5D1XA 1MH5A 4P2AA 1H6UA 1KB9K 2HMIC 2XCMC 3CVDA 4UM8A 4AM0Q 2EKSA 2AEPL 5C71A 4JFYB 3G6JE 1AD9B 4TOYL 3D25B 4JGMA 4XNAA 2BSRA 2AEQL 3KGUA 2WZ0A 4JDEB 5SX4H 1X3DA 3RKDD 1NCNA 5JR1L 5B21A 4PJ7E 1HVXA 2NRDA 1OP4A 3MQIA 4X6BB 3JYBA 1EQWA 4ZPTA 1EEYA 4J3XA 2DM4A 1VAHA 3H55A 1JCKA 4JFEA 5KOMC 4KK9C 5JPMB 3KPQA 3X1EA 2P8PA 2ORBL 1M56B 3SJVE 4IDJH 3T0ED 4K23H 4PS3A 2Q1EA 2YPLB 3ALWA 3VXMA 3BP4A 1QZNA 3BUPA 3E3QC 4WNJA 1RKRA 1E4XL 1TJHH 2OTWB 1F4YH 2EIJB 1Z7JA 2BH0A 4KH2A 5CP3H 4WGVB 2OFQA 3TZVC 5FIEA 4PPTA 4ZFZA 4YHYC 1PPIA 3R4DA 3V0HA 5IIEB 1PX3A 4JDZB 3UBXA 1RUQH 1JVLA 2OCJA 4D0BB 2EDHA 3KLDA 4L3EB 4NHUB 3UTTE 3Q9PA 3HAEB 1XGQA 2RQEA 5HYSG 4M1GH 4AITA 3QULB 4NZFA 5B4MC 1T0MB 5CJOL 3QZPA 3OGCA 4YSCA 1Q9WB 2O6PA 3FSVA 2Z3FA 3DJSA 4YWGL 2VZTA 5LGKA 1SM3L 3F83A 4G7YH 3L2LA 3VXTB 3ZDYF 1G7JA 1J10A 1MNUL 4LRNL 4ZMWA 2YUZA 4JM4L 3H53A 3WL9B 1QAWA 2R0ZH 1EBPA 1AZNA 3WIHL 4GMTL 4WUUA 3IDGA 4KX7A 1Y1UA 4YSOA 4F7MB 4Z7WF 2BY0A 3MRKB 4PHXA 3Q5YA 4DP4X 1L5GA 3DX9A 3MUGB 2EE3A 3X1BA 3MV8B 5DU7A 4QHNA 2EDTA 1MCOL 3AC0A 4WHTA 5JA9A 4DK5A 5JXEA 4UI2A 1KJ2L 4NN5C 2FWSA 4LL1A 5TE7H 1DBMH 5ABAA 4A2LA 3SQRA 4D9QD 3P4NA 1G0YR 1KJ2B 1A9BB 2W0FA 2JKXA 1R46A 2VNCA 1OHZA 2YD5A 4CMMB 5C3TA 5E0QA 3VWKC 5I74B 4F8TA 2X9YA 4PJDB 4FFVD 2W0LA 3LV3B 1SVBA 5GRJH 5FUCC 1RFDH 2H8PA 5AZ2H 5KBLA 2IWFA 2Q7AA 3I9IA 5DD1L 1XF4B 3QC5X 2WY3B 4ONHB 4BQ9A 4WCYH 3OKEB 1J8HA 1FYTB 1SQMA 2QKIA 3QUZC 4KROD 1SN0A 4MSWA 2FO8A 4DFIA 4DWHA 3WIIH 2MQ0A 3NIDE 5F6IC 3HS0B 1JNLL 2F15A 3O8XC 2WO2B 1E2VA 1KXHA 3MLRL 4ZMQA 4LQ1A 1CFTB 1VCBC 1MFBL 4LU5H 1UOWA 4Z77A 4TQ8A 1CFVH 2Q0ZX 3PWUB 1KUMA 3PXJA 3NGBC 3D2TA 3D2UA 4JPIA 2WWMD 1J9RA 4WTXA 4JM2B 5AL0A 5F7DA 4PJ8C 4MWFB 3NACL 1S7TB 5ES4B 5HGAB 4OZGA 3D34A 2EDRA 1IAOB 4JO3H 2VLLA 4JVPA 4L4TA 1L7IH 3D0VA 2P42B 3BZ4A 2NX5A 1A6AA 3BSZL 3R8QA 5E1GA 1E4KC 1FQ9C 1KC5H 4FFZH 4YVUA 3VXNA 2Z8SA 5AZUA 4FL4B 2R0KH 1QFHA 1G7PA 3AS1A 1JL8A 2OZNA 4ELME 1NCWH 4N6QA 2FUTA 3NJHA 3TJEL 4Z23A 1XGPB 3IKCB 3JV4B 4JFXA 1E5UI 4FI6A 2EP6A 4TRPH 5EWIH 3ROOB 4N0RA 1SF5A 2W07B 2E75C 2KPNA 2OZ4A 1OALA 1NGYB 4M4RA 1E4WL 1IGJB 5AAPA 1UB5A 1E9OB 1NLDH 4HX1A 4L1DA 4W4OC 1FAIL 3S34H 5LAXB 3I02B 2R69H 1IJNA 4RFNC 4JFED 1TNNA 3CMGA 3T1FA 4FXGA 1EAPA 2CLZA 2CHDA 2VDML 4PB9L 4KQ4L 2R29A 3VXMD 4YDVB 3BWZA 4IOFD 1NCAH 1JPST 4R3SB 5KYUA 5JYLA 5DC2A 2OJ1A 3IJHB 3NQIA 2BSRB 5DWPA 3BAEH 3THMH 2CHZA 3UTQA 5K1NA 3KPTA 5L8JB 4XNUH 4RCAA 2HFEA 3FO1B 1A7OH 2R8SL 4Z3FA 3HR5A 4JZOB 1IM9B 1FYTE 2EXYD 3G5ZB 2V2TB 3T8XB 4X8GA 4YJZL 3SY0B 4Q6IB 4NLAA 1T1WB 4NRZB 3D1MC 5C0JB 3X1FA 3H9HA 2F08A 1BMWA 1DQDH 4P2RD 4Z8FH 4JG5A 1IMHC 5GS2D 5C3IA 2A4CA 5DUBB 5FR3A 5IJDC 2Y6TE 1SMAA 2JK5A 3P30H 3ZDYB 5K5YA 5EU3A 4XCCL 5DK2B 4JNXA 1ND0A 4ZNCD 4UTAL 2BZ7A 5J1AB 1DBJH 3BVUA 3R7QA 4Y19A 2HRHA 1QSFD 5LO7A 4BQBA 1LP9F 1F86A 5I0YA 1MAKA 2Y7MA 3U7YH 4LASL 4IIQC 5K9KA 3PNWB 3QDGB 5HVHB 4NQVB 1QUNB 2WK2A 1P7QA 5FOJA 3FQ4A 2VYRE 4XN8A 2YK1H 1PZ2A 4KXCA 3NSDA 4BKTC 1W0YT 4Y4HD 4AOFA 5IMLA 4Q7DA 4XMTA 2QPFA 2P5ED 3OWRA 1BQHG 1JV2B 4OLUL 1MUJB 2DS4A 3TT3H 3CLEL 4Y4KA 1VHPA 3CC5B 3SY6A 2R27A 3S36L 4DZ8B 4CVXA 4HKZB 1J8HD 4XP4L 3RTQD 5KG9B 1RUPH 4QHNB 1ZGLB 4J28A 3TBVB 4HHWA 2EINB 5I8EB 4HEMA 5D70L 2AGJL 4LFHG 4R7DB 3HAEH 3KJ4C 1MCDA 2ZOKA 3ZY7A 3L95A 4M6NH 5A2BA 2WBWB 2YMXL 4L8DB 1BQHB 2OMUA 1IBDA 4B60A 1X7SA 2ADIB 1J12A 3GNML 4MLIA 2DTMH 3HTLX 4PS7A 4MNGA 1Z9SA 3TNNA 3HEIB 7PCYA 3MXVL 4KOBA 4OR1A 5E7BA 1YQ2A 1YC8A 2QQNL 1HL8A 1KFAH 3G9AB 4FLSA 4M8RA 4J3TA 1JP5A 4JDZA 3MFFA 4PGJA 3WTSA 2NY5C 1OWWA 4LLUA 4K7PY 1ZGLM 2IH8A 3QWOB 4FFYH 3TIEA 5JTWA 4HU2A 3NIFE 5B3JF 3MBEC 5JHDD 4ZAKB 4LHUG 4FXLA 1ZY9A 2HTLC 3MV7B 4HS8L 4JCMA 3K6SB 5JOFB 2XOTA 5B8CA 3X2QB 1QFWI 2DWSA 1IFGA 1TKWA 4MLSA 1KIQA 2VW7A 4NNXA 4D9RE 2P8PB 2A77H 4GG6A 1EJFA 2ADFH 5ESQB 5BUGA 3D5OF 3VXME 4PJCE 1YY8B 1HCFX 4LVOB 4P59L 3DIFA 4YLQT 3NMEA 4XBMA 3ARGB 1KY6A 4DN3L 4ELMF 4OCYH 4KQ3H 4ODUA 2IH9A 2NXYC 2CDGA 1TJMA 3C5ZD 1ML0A 4RNRB 2HA1A 2R2BB 3B3IB 5BVPH 1SJEA 2A73B 2CGYA 4PJ7A 2Q86B 3HMXH 5KAQF 4S2SB 3QG7H 3PV7A 1WZ1H 3K2MC 5B1JC 1CD0A 4Q4EA 3GZPA 4A6YL 1EXHA 3GRWA 1M7DB 1FV1A 3FU9A 3S4SG 3KPRA 1GY2A 4HT1H 4OCWH 2XZCH 1MVUA 3DMMC 3RJOA 1RQ5A 3NRPA 4M6ML 4XP6L 3M6DA 3VFSB 1NCGA 3S34L 1KCWA 1SMDA 1NUGA 3L3DA 2MCAA 4URKA 4Y16C 3QP3A 4Q9RH 1DJHA 2ZWNA 2Y23A 1AHWC 3FOLB 2X3BA 1OCCB 4NWUL 4Z3EA 2H1XA 5CLTA 1B0RB 1IBBA 2IFGA 1MIEH 2IAND 3DJZA 3LHPL 5FKPA 5B38A 3A6CL 3PP4H 4FMKA 4MS8C 2CKBH 2R1YA 2ZONA 5H37A 2EIBA 1XEUA 5F0PB 5D1QE 4MCYB 1UCTA 5ID1A 3WN6A 4OCXL 5JHBA 2JELH 4GI9A 3MBEA 5E1AA 3KD4A 3FQYA 1BQ5A 1F3JA 3M07A 5E00A 3P3RA 1AKJB 4Z5RB 1MF2L 2ICWB 5IFHL 3N40F 2JNZA 1YN6B 2WBKA 4HETA 2OK0H 4N3UA 1M2VA 2EH7H 2Z93B 1KLFB 4Y1AE 3SKOB 3GXPA 3GSNL 1R5IB 2VDOB 1TQUA 2VAAB 1KB5L 1PZDA 4OD2A 5TE6L 1NCBL 4NQXA 4WI7A 5CEZH 2H3NA 2ROYA 1EZVY 1KCUL 3GSUA 4ZUSA 5FW7A 4FRWA 1HSBA 3MJ8A 4XVUD 4BQ8A 3ZKMD 2LT9A 3QQ4A 4AIZB 4NUJA 1NIAA 5SWZD 1KIRB 1IAII 5HJDA 3C5ZB 2J12B 2UZXA 1HL9A 5ID1B 4PJCB 2B5IC 2OMZA 4KZCA 5ESQA 2WCSA 2GI0A 4XI5D 3CHXA 3KLSA 3T65B 3ZT5A 6PAZA 5GRUH 5D1ZB 3WBDA 4KAQL 4U1KA 3VXQA 2I07B 3MNZB 2BCMA 4OJDH 3PWNA 5GIRB 3UDWC 12E8H 2C9PA 2BXYA 1PEWA 4X7SL 5EOTB 3FOLA 2YPVL 2A83A 1GKEA 4WQOA 1TO5A 3CVHA 2E5EA 5CZRA 5EF2A 3V4VL 3K4DA 1I3RA 5GGVY 2FX9L 5I1LA 5KSUB 1TZOA 4JLRA 1M2OA 1JFHA 1HE8A 7FABL 1HOCA 2PABA 5I6PA 4CJ0A 4OIIL 4WVRA 2P3YA 5C0IA 4QYOB 4HZAA 5T3ZH 3WEXA 3RZWA 3GM8A 3I6LD 3VO0A 3BPLB 1RZGB 4PYHA 5AVZB 2N59A 4I89A 1GMEA 2FX8L 3KCPB 4K5MA 5I19L 2RD0A 5JW3H 5D1ZA 1R24B 2ZUQB 4QY8A 5DJAA 1DVUA 1L0PA 1AKJD 1RJCA 4QRPE 5CZKA 1KEML 4PJ7F 4M7LH 2BZCA 1SOKA 2WBJB 3PWVA 4KKNA 2MSPA 4PJ9D 5I1CL 1XF4A 1ZHBA 1P7KA 5DQJB 2Z31A 3QUKA 3TBVA 1BFSA 3QUXD 5GS1C 1GPOH 5D7IB 3CSFA 2IQ9H 4OQTL 1QVOB 4YZWA 1WF5A 3WE6A 2RHEA 5GGRA 5ADPH 2Z92B 3DV6A 3FT0A 5DFTA 1RHFA 3AG3B 1I82A 3CPLA 3O3BB 4JRXB 4OCLC 4X4ME 3LN9A 3GMRB 4M00A 2BVEA 3C8HA 1J0ZA 3OHXA 3VSVA 3X14B 5HHMB 4ALAL 1I1RA 1MQKH 3F7QA 3FFCB 3TT1L 3CXHJ 5BZXA 4LQFH 1XF3A 1BMGA 3KL3A 1P7QB 2DV6A 5HGHA 2EDMA 3JTTB 4LCCA 4OFKA 5DJDA 5KUMA 3C60D 2XQYK 1IGIH 2X0UA 2WXFA 3VRLE 2YKKA 1BEYH 3FQUB 2H47C 3K2UH 1QWHA 4Y19B 4XN4A 1KN2H 2E0PA 5TDPA 1BZEA 1LWRA 1DQLH 1KXVA 2PCPB 1U3HC 4I5BA 4L1HA 2H2SD 3ESMA 1N8OE 1X5KA 3SCMD 1E4WH 4XP1L 3FBKA 3KWUA 5JLZA 5IFAH 4ORZC 2X4UB 1QSEB 3RY6C 3N42F 3KWWA 4AW7A 4NN6C 2KZKA 3DSNA 4AH2A 2QADC 3A4EA 1F42A 3H3KA 2D0HA 2A77L 4G8IB 5SX4I 1EERB 5AFAA 5CN1A 5BXFB 4PGDB 1G9ML 1HSAB 1I7RB 4Y2DC 4XMUA 3MRDA 3Q3GB 3VRJB 4WHCA 1CFQA 1X7TA 1A2YA 2PXYB 2VAJA 5DRXB 5F7KC 4TSCH 5ECGA 4PYGA 4F37K 1LD9A 1ZLEA 3LRSA 4R7NB 4ZTOH 1F4YL 3VSUA 2YLHA 3RX7A 3K80A 1JPFA 4HUUA 4JFDB 4P04A 4F7TB 3M7FB 1TSHA 4X4ZA 4XOAA 2R23A 1CQKA 3VXSE 4N6RB 4BSJA 4YEEA 1CDYA 3GKZA 1AXSB 5K9KB 3AWGA 3FO2B 4XO8A 1DJSA 5FOBB 5DMYA 1JD9A 5AEAA 1QTSA 3D9AL 4HFUL 3MLWL 3V4VB 1SNRA 1JZJA 2PYFA 3ALPA 4ZUUB 1K3ZA 3S35H 2BP0A 1ZS8A 1P9MC 2BVPB 4CC0A 4HUVA 1P69B 3EJUA 2Y9RT 5ISZD 3FU5A 4RDQG 3MRLB 4XC3L 3NZHL 2YFOA 3BZFA 1C1EH 2G60L 4OCMC 6TAAA 5K9JH 1BP3B 1FO0H 4G9FB 1YA5A 4PJIB 2E7MA 2CGRL 1WTGT 2HVBA 3IRCA 3EDEA 5HHME 3IXAB 3IDMB 5L7XH 3HNSH 5T8IA 1DVTA 1UASA 1P5UB 4H20H 5GS0L 5DZNA 4WDIA 5CIPH 5LJYH 5D93B 3HR5B 4HJUA 1YMHB 3QDGD 2P5WE 4M1DL 1DVQA 2Q3AA 5DJ2B 1PZBA 3MJ7A 2OL3L 3VVVA 4QRRB 2Z64C 1G6RA 1QSED 1HIMH 1M3JA 4HT1L 4OCWL 2LAAA 5E0FA 1S9YA 3GJFB 4HIJA 1E9PB 2DW5A 3T0DA 4GW5A 4NZTL 2ZYHA 3DXAD 4LKXA 5DRZA 1DR9A 3T77B 3B2MA 2EC9U 2AV1B 1MRFL 4W81A 4DKEL 4OGXH 2C5DC 2G3XA 2ZF8A 3L5WB 1XH3A 5JW4N 3W5NA 3C6LB 2DIEA 2PXYD 3FCTA 3QRGL 1CPUA 2L0DA 3KR3L 1U8PA 3QW9A 4DO4A 3ELQA 1QEWA 3OC5A 3ENEA 4N87A 1NM9A 3QDJA 4N2FA 2CBOA 3WEAA 4WEMB 2YD2A 1WS8A 2ODHA 2YA2A 1QPXA 4FQJH 1OE1A 1MVFA 2Z35B 5DEGA 2MPVA 2EABA 4HIPA 3FTSA 2WWKT 1QEXA 4H1LG 2DYPB 1BZ7A 3HC0A 3D69B 5DFAA 3VXSB 1PGRB 4EI6A 4MMXC 2YRZA 2A6JB 4NQCB 2BLFA 1SXCA 4IS6B 3ESPA 4DZBA 4UZGA 3G08A 4I48B 3O9WD 3V2AR 5ISZB 2M2DA 1TJIL 4L4VB 1XCWA 2AK4D 4WU7B 2W65A 2Y6SD 3ZU8A 2GTZB 1WVZA 1U8PB 1TO4A 2G4EA 3IRPX 4MCZA 1RJYB 1YC7A 4IMKA 4NWTH 1A6UL 1PY9A 5DLML 1OGSA 4MDJB 3T3MB 5DMGD 3PL6D 3S88L 1JPTH 3W5MA 3APNA 1OIOA 1MPAH 5DZOA 1UZ6F 3HRZA 3GNMH 3U4BL 2IAMC 4XTRC 3QNYB 5C0EB 5KJ7E 5TFSL 3K5RA 1CBJA 4JZOA 2L3BA 3VXRD 4Y5VC 3FTZA 4HJJL 4L2YA 1P1VA 1I8LA 2BHFA 5B39G 4IGBA 5IREA 1G7HA 1R19A 5E5MA 1G87A 1GYCA 2PP8A 5I71B 4TQPA 1SQ2N 3DXAB 2AFNA 4F37F 2WQSA 3DK2A 3MTRA 4GI6A 2BC4B 5DJ6A 2B4CH 4L3CB 1E5BA 3MREB 5EU7E 5FGBC 3DJRA 4JZJB 5C8JB 1YECH 2R56H 3CXDL 4KFMA 1M1SA 2DQGL 4LVHB 3WUWA 2PCXA 3P4NB 4A2DA 4XMZA 1GXEA 3LB6D 3LZQA 4OCRL 4PJGB 4W9EC 1E28B 5L8LB 4F7CA 3E38A 4ONGH 3ZVVA 5T3ZD 5AOIA 4RZCB 3T0VA 5HI5C 1R34A 3T4AB 1KIUA 5J3HC 3ABKB 1Q94B 1DJZA 1XT5A 1OARL 5TDOA 3UO1H 2QVTA 3DUUB 3HE7C 5EZJB 1AQDB 1MFEL 2IG2L 1L9PA 4QKTA 1LNUA 5TE6H 1CXEA 4Y1TA 5AW0B 2OJZL 5E2TL 2XV2A 3IAGC 4G7VL 5FCUL 3ZE2B 2EADA 4XCCH 5H37G 3DO4A 1A64A 1WUNT 1CUOA 1PCSA 3FCSA 1A7QH 2EKSB 3MV9E 2Z6FA 4WWKC 1XX9C 1GZPA 4NUMA 1TVBA 3EHBB 4N26A 1C08B 1LDPL 4ELKB 2UWEE 3AREA 1ORQB 5EZOL 2EXWD 5GXBB 1KGCE 1WAAA 5T33H 2CKNA 1RLWA 4LCUB 2BDNL 2RJMA 4FYSA 4OH2A 4AV0A 4CVZB 4ZW6A 2X70B 4YDIL 4M48L 1DBKH 3DROA 4JX0A 4HA1A 5IQ9B 1EO8L 2MNWA 1K6QH 2EEFA 2W9LA 4G7QB 4MYPA 1IKNA 5D1QC 4XNQB 4X6CB 2V17L 3TC9A 5I15L 3E9TA 1DBML 4MX7A 2PCPA 4S0TD 3TPUB 3BGFC 4KROB 3HG2A 3OLEA 5HBBA 1X5YA 5ELIA 3BUQA 5EO9B 3DI2B 5DD3L 1RXLA 2WIIB 2NY2B 4H5SB 3E6FA 3MLUH 5HHNB 2HKFL 4AVKA 4BJLA 3Q06A 3UP1A 4WU5B 5I24A 3K46A 3RIFK 3MO1A 1IGCH 4XRCA 1J8HE 3N41B 4UDUA 5K9OA 4UIMA 4N24A 5K69A 2LU4A 4NNPH 4LSTL 1AO7E 5I1IH 3S96A 1XAUA 4PRBA 3RILA 3T0WA 4OCYL 1CLZL 1I8KA 4MZIA 5DZLA 1JI1A 3H9ZA 1II4E 3WE6B 4KVNL 1A22B 2Z92A 3UAJC 3ZHFA 2IAMA 1RK0B 1NLBL 3ECWA 4R0LA 4MAYD 1MKFA 5JORB 4HCRH 1JN6B 2O93L 5T5FA 1LDPH 3EJYD 4K7FA 4HS6B 4U1SB 4H8WH 1UB6B 3S37X 1OAYL 2RCSL 1RU9H 1U91A 3QZOA 3TH3T 2ZXBA 5JQIB 1FL5A 4NUPA 1J1OL 5HHVL 1AY1L 2CXKA 1KNOB 1S7SA 1U6AL 1P9MA 1GC1C 1OE2A 1XTMA 4U1NA 2GC4C 3PL6A 3MLXH 1MG2C 4KX9A 4IKNA 2Q8BH 5EO0A 1ZE3H 4GQRA 4C56B 1JWSB 2EXYC 5E6UB 5CGMA 5FHBL 4Q9BA 2X2YA 3DX7A 3FJTA 1A2YB 2C3VB 3TS8A 1LWJA 4KMQA 2FX9H 1JK8B 2JKLA 3D33A 4EO5A 3WG7B 1Q0XL 1J0YA 3TF7C 1EZSA 2CCWA 2QV4A 3KJ6L 4Q0XH 4FQXB 2Q2LA 2TAAA 3UG5A 1P4BL 4NLHA 3OSVA 3WEMA 1AP2B 1FCCA 4HIQA 4R26L 4XT1C 1AOZA 4NO5B 1RFDL 3QZBA 4X7CC 4Z7QF 1F11B 4N8VG 1IQWH 3PGDB 3GO1L 5FK9A 2I85A 1U8NB 3LKQA 3L6FA 4F8NA 1KJ3H 1WWAX 4MD4A 4XVTL 4NZJA 1KEGH 3GIZL 4JRWA 2ICCA 3S8GB 1ZT7A 2F19L 4IRSB 4W68A 3VVWA 2XWDA 3V6BR 4Q9RL 4AM0B 2VJXA 4HFWA 4OKVB 1CICB 4UILL 2G2RB 2FE0A 4Q2ZA 2R2HB 3BXNA 3CFKA 2L4OA 2GW5A 1LE5A 3ZDZE 2VN6A 1MPAL 2J6EH 3KJ6H 4Q0XL 4LOUD 1VFAA 2H5UA 1BX2B 3FUKA 1YYML 3BJLA 3ESVF 4OZIE 2ESVA 2BIOA 1E67A 3VI3B 2YGOA 1HH6B 3L4ZA 4JEGB 1CB4A 1E27B 2X2IA 3L3IA 4TUKL 3RY4A 1D5RA 3IDJB 4MD5B 4Z5RA 3QZLA 5SV4A 2HTKC 4UANA 3RNKA 4BZ2H 3C5JB 3JWOH 3EJQA 1A3RH 3DYPA 4DP6X 1A4BA 5AVYB 1ULVA 1QX1A 3ESOA 4ZMNA 1JPSH 1RULL 2X9WA 4RGMC 4IRJB 4DGYH 1J86A 2Q5BA 1RUQL 5I8KL 3NAAH 4JFFE 3B9KA 1AZVA 5GRYA 4LDEB 4NP4H 1HXMB 2X3CA 4L37A 4P2OD 1IEAA 4QHUB 4L8BB 4M62L 1UJ3B 1DVFB 3SOBH 3D4GA 1SHWA 5C9JB 1SHXA 3BQUD 4UZUA 3SDXF 3I9GH 1KJMA 4HIEB 1I7TA 2ESVE 2CLRA 1L9TA 4XR8C 3VG9B 4R90L 3SBQA 5BO1H 4P2YA 3ULUE 3B2XA 3T6ZA 4PQXA 4FYRA 2NT1A 3GQFA 3ARDB 4GBXB 3SEPA 4XNBA 2X4NB 3GZQA 1EAPB 5CMAA 3PDGA 2X28A 5F7BA 3MNWB 1RK1B 3UYPA 4X6DA 4Y2DA 5IR1B 4HJ0C 1H5BC 5H37H 4KXDA 2YXFA 3UPAA 2O5YL 3O81A 5EUOB 3W9EB 4BV1A 4PJCA 5BW7A 2YMXH 1EEZA 1T83C 2BFGA 3RIAF 2K8QA 4NDMA 3O2DH 2O6DA 3U0WL 4D9QE 1FNEB 5DA4A 1MNNA 4RLDA 5CJXA 2AXHA 4WUKH 4NS0A 4HUWA 5BQDA 3BIKA 3TFKC 1WWWX 4APQC 1AI1L 2G75A 2GHWB 1HOEA 5DEFB 3FUFA 1AIZA 5EZPA 4S10A 3TBSB 1I4FB 2JVUA 5A2IH 5T1JA 3GRBA 5IT2H 1C1EL 2ZXEB 3NFSH 1OSPL 3KYOB 3DGGA 4GEJA 4N2LA 3KPPA 3IPBA 3OJDB 4TVPE 1P4IH 5J8OA 5IG7A 4F92B 3NEXA 4YNYA 1X5MA 3B8YA 5F7DB 4G6FD 4NRYA 4PB0H 1KGIA 1T66C 2EXWC 5EIIA 2FVNA 5AVWB 1R3LB 2AABL 43CAB 1MN4A 1FFRA 3RVUC 5IEHA 1GW0A 1FSKC 4ODBD 3GJFK 2K3TA 1X5LA 3FAXA 1QQDA 3K0WA 4PJXE 4Z7VB 3ZE1B 3U1SH 4P9MH 2QMKA 4WFEE 1OARH 3G5VB 3AQZA 4L8DA 3FCBA 2EH8L 1BLIA 2XFXB 2ZPKH 2UYLB 2NNRA 4TULH 3RWCB 4KKCC 3APMA 4LBAA 4Z8FL 5EBMB 2LFGA 1X5FA 2BVTA 1HESA 1RUPL 3WOVA 1UOLA 5J3HD 3O2WL 4JFOB 4UT6A 3RJDA 4B9FA 1HHIB 5E8OA 2FO1A 1GGBL 2ALWA 3SDAC 5GISH 4R8WH 4CUCA 3TN0B 1B4RA 3E8VA 5J7CC 3F84A 2YZ1A 3NZ8B 3RVTD 1WP6A 2IBBA 2FD6L 1UXLA 1KCVH 3UTSA 5JDJA 4UIMB 2BHYA 4K7PH 1XHHA 4HUXB 2H1PH 3QDGA 3DX9B 1L5GB 3UYPB 2ZKXA 4A2EA 4FABH 3VQLA 5JQ6L 3TURA 4WUUB 1C5CL 1UKTA 5CKAA 4KKLD 1HS6A 1ZPLA 2AQTA 5EEXA 2WGXA 3QR2A 4N2NA 4RZKA 3P9MA 3N9GL 1T7ZA 5I16B 1MLCB 2IPKA 4Y4FA 2Z0UA 1M7IA 3LNIA 4O2CA 4BKLB 5JIQA 3NIGB 1TTBA 2ZWYA 1KCSH 4LNRB 4ZK8A 2DQTL 1WJ3A 3HG5A 2EDBA 3L7FB 3LMJH 4PP1D 5DHYA 5FPIA 4JHAL 2XXCB 4MA1B 1MJ7L 3ARBA 2FT6A 3VFWB 3CLFH 3M17B 1DN2A 1LP9E 1L9NA 2G3MA 3OLIA 4JFPA 4LCUA 4PY8J 4IIZA 3TYFB 1K2DA 4LLWB 1WIUA 4HXBH 3VFNA 5DT1L 3K74B 4M93B 1ZVYA 2WINB 3MBWA 1T5XA 1KC5L 3O9WC 5CU9A 5FA4B 2DLFL 2JB6B 4L8CB 3IU4H 2BP3A 3IXTA 4BQ6A 3RURA 3QQ3A 5GRZA 3FQ2A 4XN2A 2QELA 3LZOA 4XBEH 4EN3B 1JGDB 4ZI8A 2YWYA 4XWOC 3W11C 1KZYA 1J87A 1JWMB 1A1MB 4OD3H 3FUNA 4UV4H 2Q6WA 43C9A 4NO2B 1WLHA 3KHQA 1HCZA 3OPZH 2ORBH 1NFAA 4XNMB 3WKPA 1LO2H 1S7VB 2RH0A 3GBDA 3KL5A 1S7QA 1M71B 1TZGH 1K3IA 5IBLD 3DUSB 3G5XA 2FQDA 1ZAGA 2VLJB 3R19A 4J3OC 4HHGA 5E9DA 4R2GD 2ENSA 2OZ4H 5LAXA 1PIFA 3MXVH 3GDCA 5AG9A 1JCVA 1ZVSB 2FJGB 3M1BA 2YSTA 3RDJA 5CAYB 3OKKA 1AGDA 1NDMA 1GH7A 4OM1H 4S1SL 4AQEA 2D7QA 4MYWB 4MXQC 2FB4H 1KB9J 3TJHC 3SDAD 2IANA 4APQA 4JFXB 3CFCH 1IAMA 4OD1L 5BRZE 2AJYH 4M03A 4XNXH 4JQVA 1DQJB 3RWFB 2LU7A 3OXRB 1ZA6A 5CZXD 2A38A 2R39A 1VFUA 2VMDA 4QRQB 2GVYA 3B2PA 5GGTA 3STZA 5KANI 1BD2E 2OP4H 5KS9B 5IW1A 4LCWE 1MCPH 1U8IB 1M05B 3BT2H 3JXAA 3CTTA 3NACH 4G72B 2BHZA 4RMSA 1IGFL 5E03A 2X1QA 3JV6B 3BZEB 1YEJL 5EF0A 2E6PA 3IT8D 2GITA 2J88L 3OZLA 3K1DA 4BK4A 1I1AD 3CFTA 3VX0A 1TQSA 2BVQB 1IM3B 2NYKA 3N1MC 1PCXA 3RGVA 2W65B 1RIVH 3UTZB 1KLUA 1P1ZA 2M1KA 3OMNB 1TCRA 2VABB 1HH9B 1LQBC 2XTJB 5DMKB 3ZZSA 3GJEB 3MCLL 4PWKA 4PBWD 1G84A 2VLRB 4NFDA 4U2ZA 1YEFL 3CX5K 2ADJA 4H1LB 1OAXH 2ZKWA 1CZ8H 1AZBA 2JXMA 1XV8A 3QO1A 4RAUB 4RX4D 4GY4A 3G5YA 2AXJA 1AR1D 1W9XA 3I9GL 3RQ3A 3TO4B 4TVUA 3TJPA 5I9QC 1GOFA 3Q9QA 3LV3A 4I3GA 2I25N 1BZDA 4JKKA 5AUMB 4YHKH 1HYRC 3UFIA 5EFIB 2X5PA 4PRIA 3U9UA 2KBGA 5I8KH 3GHPA 1LE9A 5F70A 3STBA 4JCLA 1O9WA 3UTZA 1OM9A 3GXFA 5ADOH 1NMCC 4XPAH 5JPNB 1MI5A 3FT4B 4H8QA 3OKDA 4JL1A 2QADD 4N1EA 4QHKJ 4P8QA 4QRFA 4ZMLA 1E5CA 1T7WA 1XR9B 3DX8B 1FNSL 3MCLH 4FG2A 4GOSA 3ULUC 1R0AH 4ORGA 4CN6A 5JO5B 5AW3B 3VB9A 1U8CB 4PRPD 3DHJA 1WAPA 1X5IA 3E2HC 3SKUD 4MHHI 3CE1A 2F53D 4CGTA 3L5XL 4XGZB 4X6CF 3ZYJA 4LSDA 5DD5H 1ETZB 2FQEA 2FT8A 1G7HB 2WKOA 5FM8A 2AEPH 3EYVA 2FIKB 4DN3H 3JYCA 4DP2X 1ZLUK 5F9DC 2EE9A 1GZHC 4FZ8H 2JI2A 5AW5B 5C7XH 3H54A 5T1LD 1HKLH 4IHOA 2HUEA 1BZQK 3BHBA 3X17A 1O7DC 3IE4A 3B9EA 3MV7D 3NFNB 4H8UA 3ZDYE 3IJSA 3TXAA 2XFGB 1F3DH 3P11L 4Z3TA 2J1XA 1V7ML 4MXWL 3BZFB 4AMKL 4OFIA 1DDHB 3NSJA 1IGYA 3V5KA 4N28A 3C09C 3CCHB 2YGPA 4HWBH 4W9ZA 4WRLA 5A2FA 4R4ND 4ZMVA 3B7RL 4JY4B 4XC3H 4KVCH 3KNBB 4Q97A 3KXFA 1UA6L 2EO9A 3G6DL 3C60A 4S1SH 1YEGL 1S9XB 2I60H 4HIXH 4JPSA 4UOW0 1S7VA 1QZ1A 2Y2WA 4ZOBA 1DO5A 3QCVL 4ZSOE 1EEYB 2V2XB 1G9NH 1RUKL 4KTEL 2R23B 5DD6B 3GBLA 4LLAA 3ZL1A 1KCUH 3FQWB 5EBLB 4B53A 5T3XH 4P4KD 3WN5C 4EN3A 1PZ3A 2IGTA 3Q8AA 4AQ1A 1YMME 3DOHA 4TQEH 4NO0A 4MA8H 3ZOAA 4JO2L 3BT0A 5C07B 1BD2D 1OAJA 4P5TB 1UJTA 1ZOXA 1QABA 2K9UA 4GFTB 5FUCE 3SKNB 3RZCC 4LVEA 3CBJB 5F3BB 4APXB 1FDLH 1UKSA 3BLKA 3HB3B 5E9DE 3Q6FB 2QSCH 4Y4HA 1S7RB 3SDDB 4FADA 5CSZA 2F54D 1NCCH 5BUAA 5AZ2L 4E0RA 3ARWA 4J27A 1AGEB 5ENWA 5JUEL 1IO4C 3UABA 2DYPD 4PP2A 4XVSL 5J6GA 1A0QL 4LBEA 5FYKD 4I1PA 3H4HA 1SFDA 2R2EA 3ZGHA 3QFJA 4YR6A 4H25A 5D8JL 3DETD 1I1AA 4YAQB 3N3EA 2JTYA 3HUJF 2CBTA 3BVXA 3FB5A 4YHPA 5FS5A 4ZZKA 5DXWA 3ZDZF 5A2JH 3L5JA 2A6IA 5I66A 1JZ7A 4MA8L 1NM4A 2D9QB 4H1LH 3UO8B 2E4TA 2V8LA 3WS6A 1KGJA 3BQUC 3MRRA 3U4BH 4ZFGL 5J12C 1Q9OA 5DJZA 3L2MA 3KH3A 2IVFC 1T6VN 1IU1A 4OM0H 4OZFG 1CTMA 2C7FA 4PRIB 1KN4H 3BMWA 2OR7A 2PWDA 1PG7H 4I18B 5BVPL 2VZUA 3R06B 2ZX8A 3FMGH 3S2AA 4KQ3L 1EEQA 2R0WL 4BUHA 2VZ1A 3LH9A 1OD7A 3PABB 4DQOH 2G4GA 4YHOH 2EIZB 2J7LA 4PV9B 2EYRB 2QJDA 1J5OL 2ADJB 1KT2A 3HFFA 2MKLC 3GINA 4M6AA 4LLQB 1IBGH 1FGNH 4QY8B 5H94B 1IBHA 4Z7WA 3BGMB 4L8SC 2BSTA 1ZJAA 2J8HA 3BEWB 3VXUD 2DLIA 3QQ3B 3KLHD 2K45A 1HEZB 4ES8A 1QRKA 4NI3A 2OMYB 1FORH 3LS5L 1AH1A 5C0CD 4WKXA 2H32B 3QIBD 1Z0NA 1YZZA 5L2KE 1P4LA 2HWZL 2VXQA 4FQCH 1HC1A 4I3SL 3S4SB 3EO0B 5DZAA 3D8MA 3QJRB 3EDDA 4PJFA 3ZQWA 2JCCE 4AV4A 2XWCA 4BFGA 4GRMB 4L3AA 4LZKA 4OVUA 2OMXA 3SE8H 3SQOL 3JWDC 1BFOA 1AFVL 1BVKB 1W0VB 2YD7A 1EDHA 3ZHNA 2PYEA 2ZUUA 4LSQH 5JDSA 1NEZG 4X80H 4LT7A 3QIUC 5HD8C 2LQRA 4U6YB 2KDYA 4ILDA 5C0BD 1I8LC 2ZUTA 1Q9KB 3BSZH 3FTYA 1DVFD 1U8MB 3OKLA 4QNPE 4K9EC 5CCJA 1MCCA 4N86A 1FGVH 3VFOA 5FYLH 2NUTB 4HKJB 4OTXL 1N4XH 4KO9A 4NC1C 5KSAD 4XN7A 4PJIF 3O2DL 5CBAB 1R75A 2A6KB 3X14A 5F7EL 2XZAL 3N5AA 5HI5D 3O41A 4MA3B 4AT6B 4RMQA 2NY7H 1YAZA 2BWDA 5DO8A 3TO4A 1H3XA 3AG1B 4JG0L 5D2NC 1OQOA 5JIMA 1BD2A 2GQHA 4F58H 2P49B 4WFGE 1T2QH 2Q3XA 2Z35A 3OKOA 1ACYH 1TU2B 4Z7UF 4L9DA 3GXNA 2PTVA 5DEGB 2OK0L 2TSAA 1MCQA 4MMXA 4U1MA 1L6XA 1P4IL 3GJEA 5CEZE 2QPUA 1AJ7L 5EN2B 3OKNB 5B38B 2EIEA 3MRDB 1XB8A 2EICA 4U6VH 1C5DA 3TYGL 2IAMD 4U0RB 3WFHB 4FF9A 5MHSE 1KTLB 1E4HA 1QA9B 5FYLD 3VFWA 2E7HA 4HWZB 4P23B 3ERXA 4PG9A 3WUZA 3OG4B 1BAFL 3IVKB 2DB8A 1HQRA 2P5PA 4UT9L 1CCZA 3RY5A 3I3DA 4OU3A 1QD0A 4NRYB 1NKGA 4PJEE 4XXWA 5JOPE 1LM8V 3L3DB 3PPEA 2CSPA 5F88B 1FLRL 1A9EB 2EILB 3E6HA 4N2GA 2EVHA 4N20A 4FXTA 5AVSB 4OLUH 4LKCA 1K4CA 4G8GD 1FL6B 4U4IA 4XP6H 1KXTA 3TBSA 4ZFOA 1DL7H 2VR9A 3LVTA 3GT6A 4QD2E 1KCRH 3FQXA 2VSMB 3M1CA 5SWSE 5LDSA 4LARL 1N8ZB 4JB9L 2EUVA 3VYPA 3ULVD 5C0DB 5BRQA 3RBGA 4ELMA 4MQSB 2IDFA 4OF6A 3Q8BA 1KN2L 4OGQC 3RUGB 4WLCA 3IMBA 4F20A 4BUGA 4WAFA 4N1CA 2B59A 2KT6A 4R96B 2YAHA 1BF5A 1SF3A 2Z8RA 4LPWA 5A43C 1U3ZA 4UCFA 1UWYA 3EIFA 1AACA 4LHJB 2IV9A 3HNTL 5CM1A 2F54E 3SDYH 4FABL 5I6KA 1QI4A 5JQ6H 3V6ZB 4UWQB 2B16A 1HI6B 3FCUB 3VNYA 3PAUA 4ZO9A 4J4PA 2YJLA 3LZNA 2OX5B 4JBSA 2PO6B 4Q8BA 3BVWA 4YHKL 4QLWA 1A1NB 4QIRA 3NAAL 4IMKC 4O4YL 4Z7AA 3TN0D 3QORD 1E8YA 4IBYA 4PG2A 3HN5A 1LVEA 2VQTA 4NZRL 2R7EB 5C0GA 4Z7UA 2LOEA 1H6TA 4XNUL 4HJTA 1UD5A 3SSGA 2H32A 4FKEA 3BAEL 3THML 2YAEA 3MACH 4GINA 5C0IB 4OSUL 4GYBA 2NTFA 3IDXL 3FB6B 5I1DB 5T5FL 4Z3GA 3P0YH 3HZYA 3CZFB 2Q10A 2A9BA 3U2SB 1THAA 1QSEE 1R1CA 4HKXA 1I9IH 3FN3A 5H94A 1PFOA 1DFBH 1IBFA 1N7ML 1UXSB 3U1SL 3CVHB 1GY1A 3CN4A 5TQ0L 2X3AA 3APCA 4ZRGA 3BRDA 5K39A 4FG4A 2I7OA 3S3DB 1MFUA 5I8EA 4D8PB 4HV8A 1YN7B 3AWFA 3I6GA 4R7XA 4X6CE 5FO9A 3SD2A 3SPVA 4E9YA 1MLCA 3QUYA 4G3YL 4KKRA 1ZANL 2WYIA 2YQ2A 3ARYA 4CBZA 4E9LA 5IB5B 1MFDH 3BKCL 3RY6A 1YECL 2AJXL 4NC2B 3GBNL 1FZOA 1VZHA 1E8WA 4FNLH 4MDIA 3CG8A 4MD0A 2IMNA 2CDGB 4GKZA 3LEXA 3QJTB 2HH0H 2DEXX 1UZGA 4IBQA 4NYLA 1K5WA 2MHAA 2JKJA 3OJ2C 1XGYL 3N55A 5I1IL 1RJZB 5E1IA 3G9VA 1PX8A 4BFNA 1J9TA 5DGQA 5B22A 3O6MH 3DV6B 2SODB 3P2BA 2OSWA 3RL2A 4HWUA 2YD6A 3X3FH 1QLFB 1ZGLP 5CZXC 3MV8E 3NFPA 5BV7B 3EDJA 1YN7A 2WXPA 3I6GB 5DK2A 3HG4A 4MAZA 3HC4H 2XJKA 1GHFH 1GIGL 1UVQB 2JH2A 2OMWA 3QG6A 4PJ8D 5CR8A 2D7OA 1A65A 5E1AB 5LAPA 5HDQL 3C8KA 3EFOB 3I75B 3ME0B 4KTDH 4XVJL 1JNHA 5I8CA 3P0YL 3WIAA 1UFGA 4D9RD 5LVEA 2KC0A 2YXMA 2P24B 1T1WA 4NRZA 4B95C 3TBWA 3EBAA 3KCPA 5AWNH 5IJKC 1WCBB 4FTVA 5D7KD 4LLMA 3LKNA 2XWEA 5A6LA 2WQWA 2XDHA 1WV7T 1YNKL 4RX4A 3TONA 3RVXD 3CH1B 4BK5C 3PUCA 3TBYB 2E7DA 4OUOA 1S78D 1HWWA 1N59A 2ZZUT 3CWGA 1I3RB 2J21A 4YNYB 5CEXA 2DEYX 4R3SA 3SO3C 5L2JA 2EE2A 4Z7UE 3MUY1 4HEPG 5CGYD 3RGVC 2UZYB 4AQAA 2YZ8A 1REIA 4MA3A 4MKTA 1ITCA 3VWKD 4CVWA 3MOBH 4HS6A 1A14H 1KYUA 4KV5F 5CLXA 3AT8A 5DVNA 2XN1A 3WXWL 1I1FA 3PG2A 4TMPA 2AJUL 4LHUA 3UPRB 3GRWL 2A9DA 3VU1A 3ZTJH 1IM3D 3P40A 2CBQA 1HHKB 1MZYA 2I27N 2DQMA 3OBAA 5GGRY 4AM0A 4AEEA 4PLNC 2L7EA 4ZG1A 4KMTL 2FJUB 1KIRA 3Q2CA 4PRPA 1DZ0A 2OSLB 1FNLA 4P48A 1TPXC 1WWBX 4L3CA 4JN2B 4TL4A 2P45B 5CZVL 3FSOA 1XGPA 1KELL 3IKCA 3JBG7 4ELMB 3GB7A 3OHMB 4KZDL 3KS0J 3MO1B 4HS3B 4CKQA 1AP2A 2YGNA 2QR0A 1YY9C 1PS3A 2VDPH 3WJJC 3D0VB 4WWOA 2MOQA 2BIHA 3LKOA 5KVMC 2C1PB 3J2PA 4JJ5A 3NSCA 1PVHA 3F7YA 3FT3A 1QASA 1I3GL 4PP2B 4AXWA 1DUZB 3WY1A 2BNRB 1EPFA 4C54A 5EU6D 4L4JA 3L3HA 1PAMA 1SN2A 3HCVB 2DL9A 2QLYA 3H9HB 3WTVA 4LLVA 3KPLA 3HPLB 2FSEA 3EYOB 2A9NL 4UQIM 3RWJA 2JQZA 2AW2A 1WIPA 2NY1B 3EJSA 3U0TA 4MBOA 4QTIH 4AMWA 4WV1C 3K5SA 2H3KA 5FFGA 4CJ1A 4FNRA 2WXHA 1E7UA 1W15A 3MLWH 1GZPB 2QGCA 4F2EA 5B38G 5EH1A 5FW6A 1OCWL 4X9BA 4UDTA 1TU2A 4FYQA 1DQMH 5D1ZC 2ZUWA 4YK4C 2Y5EA 5D5MB 3FT2B 4PJ9A 1IARB 4QXGL 5B7FA 4H88H 5TD4A 4PJDA 4AYSA 1NDTA 5FV1L 1PZAA 1YQVH 2WLIB 4P07A 2GJ6D 2J5LC 1NGWB 2NY4B 2R4SL 3QIBB 2VW4A 4HUCA 4LHQB 1PZ5B 1U3HD 1G43A 3C60B 1P5VA 4XMXA 3V5HB 2A73A 1ROCA 2Z91B 4NQQA 3NA9H 4WHTB 3ZYZA 5I17A 5AZEL 1ZT1A 4HFWB 4JDVA 3OAZH 2GTQA 3RI5F 4G6AC 5E94A 5JHAA 1DBBL 5IB1A 1KJ2H 5FHAL 2L8AA 4G1MB 3GMOB 4JFWA 4O51B 4UQCA 4E41B 5IGXL 3MREA 3ZUCA 5IOPB 5IB2A 4TV3A 4P2QA 3L4YA 1GGCL 2AK1H 1NFDB 2X6BA 2XPGB 4HMEA 4AZ8B 3B7UX 3BEVA 1N7MH 3R7RA 3CGTA 4AGNA 4G6KL 4CU6A 2E76C 1L7TL 3OTTA 2LABA 2C9VA 3SDXB 1VFOA 5I76A 5KVDL 3MOQA 2IBGA 5DMIH 4M5TA 4P06A 2XTLA 5DRNB 2P5WB 4X4YB 2HWZH 1S7RA 3IU3B 3S4SA 1KTKE 1DJYA 5BO0D 5DD0H 2P7TB 5ID0B 2W80C 3VJ6B 2B20A 4JHUA 4LDCA 3TTSA 4HG4J 2WWKO 1H15B 4BSWB 3BP6B 5FDWA 4MJIA 2WHVA 2A74B 2A1WL 4RRPM 3VXOA 3WAJA 3ARZA 5LWYH 3IFOA 1WC7A 4FDWA 4LP5A 2Y07H 2FJGA 3M1BB 3MUJA 4N2EA 2Y07L 1JXFA 3I3EA 1JF6A 3A4AA 4N68A 2FT7A 1DBAH 1XD1A 4NQDB 2YPLA 3TVMC 1J48A 2H0FA 4C58B 3BH8B 4G7SB 4JM2D 4K94H 5ETUA 1R9FA 4LHUD 1BXUA 4YDJB 4NZUH 1S78C 2OYMA 1H0DA 2CKBA 2CDFA 3ECBB 4DN4H 5TDOB 1AXSA 2CLZB 3A24A 3VFRB 1UYWL 4OFVA 3O0RH 2YAFA 4N8PA 2NY4D 1ZTXE 1BFVH 1W80A 3C75A 1FC2D 2DQTH 4WI5A 5LGJB 4CMHB 5ILTH 1U8KA 1RIVL 4I18A 3KG5A 3O3AA 4L9LA 5E8DL 1BW8A 3ARBC 4R4FH 1SDYA 5CEYA 1DE4A 3KYAA 1IUZA 3JTSA 2CRIA 3OM3B 5L0QC 1BQRA 3NSXA 3O6LL 2BMKA 1NC2B 3CDZA 4Y2OB 5IGXH 2AITA 2A3TA 4UBDD 2E3VA 3MV7E 3MRRB 4XCYA 2VR6A 1DCEA 3TYFA 4FP8H 5EEUA 1GKOA 2VR8A 4MNHA 2B08A 3BWSA 3NIGF 1W6WA 2HJFB 4WK4B 3DIDA 3KPNB 1T7YA 4XVTH 1W16A 2ENPA 4Q74A 1ERNA 4JFEE 3JVGC 1ETZA 1N67A 3IS1X 1I9JH 2VERN 1Q1JL 4E41E 1PKQA 1UXWA 2XSKA 4ODWA 1W2KT 3V4PB 1UM6H 4C83B 5MI0C 5JMRA 4IJ3B 1H5BA 2R9HD 4QR7A 4GW4B 3OR6B 1NJ9A 5AB9A 4AKPA 4JHWL 5KYXA 4LEBA 3II2A 4GW1B 5GS3A 2DYRB 4IIQA 3Q48A 4YZFE 2OULB 1DQML 5F1IA 2MCPL 1IKFL 4UM9B 4A38A 4CVZA 2ZWZA 1RUMH 5TPWH 2LTQC 4F7PA 1OAQL 3SY0A 2CO3A 4XCYB 1GJUA 3BFOA 3TIDB 3REVB 4UYQA 3UC2A 4UU9A 4TUJA 4OFYA 3EH5B 3VWJB 5EEVA 4X98A 3AADB 1B2WH 5GJTH 4AEHH 3OKMB 3QCUH 1FRGH 1KBGL 4YSSA 4APQD 1CLOL 1U3NA 3WFBH 4LVNC 4NQCD 3BAWA 3MX0A 1S9KC 3P30L 5E2WL 2P9RA 5C6TH 4DPCX 3FXIC 4UYPA 1L0QA 2P8LB 2NUPA 4QUOA 4A68A 1S7QB 1CYXA 2JXMB 2BOBB 4U3SB 2F7RA 3FO2A 4PGEA 2D7NA 4WNSA 1N0LB 4XH2A 2WXMA 1LLAA 4DPAX 1TQWA 1A1MA 2R56L 3BH8A 2CALA 4LSUL 4OF5A 4YBLB 1F56A 3DA0A 5ETUB 3GTVA 3NJFA 4JY4A 4IEFB 4AMKH 1KSRA 3FU7A 5AW6B 4WENB 2YPLE 4U1JB 3VFVA 3L1GA 2XKSA 4XO9A 3NCMA 3PXHA 4PLOB 1YPZE 4TNFA 5FYJL 3GXIA 1ASPA 1JOIA 1NBQA 4L8CA 1G9EA 1ZTMA 4JZNB 3QORC 3IDGB 4RDBA 3NFNA 1CFQB 1HKLL 1XSOA 2QSVA 3V0EA 4R5TA 2X1OA 2VMFA 4X9GA 3BSZA 4HOXA 3CDCA 1W72L 3KPMB 4LCIH 3M17A 2ICEA 2X4QB 5AG8A 1G7IA 1DN0A 3GSNB 5IW1B 3QWQB 4J6RL 1TTGA 1T83A 2CO2A 3IDNA 5B1CA 4AZUA 4UIKH 1DVYA 2GC7C 2D3VA 3Q44A 4ZUWB 5A2AA 1HILA 2YA1A 2I9LB 3HHMA 1LJMA 4AZ8A 1A25A 1A7PH 3CMOL 4LEOB 4PRHB 1OOAA 4ORGB 2EDOA 1RIHL 5LGYA 4BZYA 1FL3A 1Y6MR 2HCZX 4X4KA 4BEIA 1J18A 4YDIH 3VFMB 3L8QA 5HI4C 5E6SB 1KJVB 4NXSA 3MRLA 4NX0A 1UT9A 2Q8AL 5JHDA 4AIZA 1N2RB 4EDXB 3QI9C 4KI5D 5FDYA 5CIPA 2OMTA 3GSXA 1ID2A 4LSRH 2JJVA 5JHLH 1ZLWK 3MLPA 4BSVA 4WI0A 2PWFA 3OKYA 2F7QA 2VRAA 4IBZA 3HVDA 3VH8A 5LN8A 1O75A 2FGWH 3TN0A 1N0LA 1Y18A 1XSJA 5HYJE 5I6OA 4PS8A 4Y1AD 4ZPTB 2WQRA 3EYUH 3IJYB 4KDTC 3UZVB 3ESUF 4IDJL 3AB0C 1BBJA 1VFBA 2X6AA 3CDGB 4MJ4A 4PJ9B 2HP4A 1JIBA 3QFDB 3TNMB 1KYAA 3FTWA 4F7TA 3RIFF 4A7GA 2CR3A 3ASWA 2QT6A 4JFYA 2Y06L 3MRBA 2WBJA 5JOPD 1MCSA 5INCA 1JHLL 3SODB 3OAYK 5I71C 5E8PA 3HHSB 5JXAH 4QCIB 3D18A 1HXMA 3WFDH 1UH3A 3RAJL 5HTSA 3BE1H 4YLCA 1QACA 5FW8A 4EMZA 1QNIA 1GSMA 3TFBA 1JNHB 3WLBB 2FJSA 3WDHA 4Y5YA 2UX7A 5HDBB 4KKQA 4WJG3 5DJCA 2IALB 1WA1X 4O02L 5C92A 1GTFA 3KL0A 5E8EB 2OP4L 3BO8A 3JUZA 4OZFH 3MMEB 1U2YA 1JGUL 3OMAB 4K2UL 1QRND 2XX0A 1U8IA 3C2SA 3IMUA 1NGXA 3NEOA 4WUKL 3QUGA 1G9MH 4YGVB 4PJFF 5E6ZA 4P3DB 1YUHB 1J1XL 4NQED 3EF4A 3BPOB 1NUNB 5IQNA 2G60H 2J6WA 3QEQD 4PCKA 4KMLB 4Z18A 5G4NA 4HOWA 4MAYC 4YDZA 1MHHA 4EOWH 3ILQC 4MZ2A 5D7JD 3NRFA 3S5ZA 2DMGA 3ARVA 4HAKA 4PU2A 2HJLB 3CIQA 5DJ0B 3S88H 2YHGA 1DEDA 4NP9A 3HBZA 4G8GE 3EUDA 1I7ZB 4R2GB 4KKPA 3QUYB 2HZHA 1I8MB 1D5IH 1IT9H 1U8NA 4KY1H 1Y6KR 2VDRL 3H42H 3V4VA 1FH5H 1OEZW 4TNWF 5J56B 4FOMA 5CJQL 2J1YA 2TSBA 5SWZE 1EHLH 2XFXA 1JG9A 1JWMA 3GGWA 3MV9A 2BWQA 4L1SA 3F7KA 2VLKE 1I31A 3O8XA 3LRGA 2EYSB 2VERA 3SKMA 2QL1A 1DFXA 1T4KB 4AG4L 3DSFL 3ZKNC 4F33B 1ZD6A 1T4WA 3K4AA 1INEH 3QJOA 2VUYA 4M5YH 2ZUVA 1EO5A 4FE9A 4R0LC 4CSZA 3LZLA 2XX1A 1YEWA 4NHCH 3KYMB 3KLLA 4PJAF 2EVIA 3VWKA 1C5BH 2NCMA 1I7UA 3V0WL 5ALBH 4HAGA 1MCEA 3NH7H 4HXAL 5EOTA 1BOGA 1B0GA 3L9RA 4X5WA 3RNKB 2AEQH 4DEPB 1WFIA 1GJIA 1IGIL 3L3OB 4GSUA 3N06B 4RFOH 4J3SA 2UY7B 2LFEA 4XPAL 4EDWH 5K9QI 2O61A 2V5TA 1TTFA 3QNZB 4HKZA 4UOW1 3RRQA 2HN7A 2HT3C 2J4WL 4Y4FB 5D55A 4L3FA 3VI3F 2WJ7A 1BX2A 1FN4B 1NIEA 4PRNB 2AF2A 5D7KE 3TT1H 1H3PL 2RACA 2JFCA 1A4JB 1MFAL 4JANB 2YJQA 2CWRA 2KI6A 1KIPA 2ITFA 3ZPDA 5ICYB 5D4HA 4GKZB 4V33A 2ATKA 2HH0L 2ZD0A 3CDGA 2G0LA 4K3DL 2YEZB 3T0EC 3GS0A 3FQNB 5F0JB 3POHA 3X13B 2R4SH 2AQRA 2DQFA 4P3CL 1T2XA 4LOEA 1RHHB 2O5XL 5IM7B 1XZWA 5E24E 3LYRA 2F18A 4Y8AA 1GS8A 1WCQA 3CHOA 2YQBA 3LZPA 4G8GB 32C2B 4I0PA 5C08A 1BM3L 3WO3B 2CNZA 3CFJB 5KVGE 5BOJA 5D1ZI 5DHVA 5TH2B 2IIJA 2ERJB 1UH4A 3CU1A 3ZHLA 1H3WM 3PF2A 5F88A 3WEBA 4UTBA 3F5WB 5C6TL 4GSRA 3NDYE 4KTDL 3VRIB 3B7SA 4UUJB 3K0YA 4WWKA 3VM5A 5I75C 3AU1B 3ZSTA 1T1ZB 1MRDL 2IFFL 1JGEA 2PF6A 5F7EH 1VEMA 2WJ5A 1IGFH 2O5NA 1HYSC 2MQGA 2WQUA 3CZFA 1DDTA 1CC3A 4Z7VA 3EH2A 1U6AH 2WCPA 4UNTA 3LEYL 4MXVE 4ZTOL 5GJSH 5A6MA 5KS9E 4ONGL 2DQCH 4OLVH 4U1MB 2C9UA 1ZHKA 3B9KD 4G9DA 3PGFH 3MRQA 2XWBB 1OP5H 3VDCA 4AGPA 1BQLL 3QXVA 3LRKA 2F58H 3MC0A 4NXKA 1Q38A 5IG7B 5IHUH 2FO4B 3QDJD 1NANI 1OGTB 1T80A 3DGGB 7CGTA 1QPKA 3TO2B 4I3RH 3FTGB 4GIAA 3DECA 2ZOKB 3O11B 1QLEL 4LO9A 1PDKA 3E3QE 2CJUH 4PJGF 5I30H 2A6KA 4E68A 4DEUA 1EJOL 3FH5A 4HS3A 5AENA 1L3WA 1TVHB 2EDLA 3CDYA 5KVDE 1PJWA 5T1DL 3VFPB 4JO4H 1K8IA 4ZFQA 1VLXA 3WJMB 5C86A 3KM2A 3T6QC 3NCYP 4FHBD 2OSLA 5DQDL 3ABZA 5CUSH 3KPRD 1T0OA 4U1GC 2CK2A 1BQSA 4OLEA 5DZPA 4Y9CA 1MREL 2QGEA 2H26A 3RUGA 4EIGB 2NUPB 4GSDH 3T2LA 3ZYOA 2AQ2A 3TZVD 4NWTL 2Z4QA 3HNVL 3C2AL 1TZHA 2F6AA 4UAOB 2H2SC 1UWEL 3E6FB 4BUQA 1WBYA 4R4BB 5FA3B 3GI8L 5IJVA 2GUOB 1NCDL 3KM1A 3MVSA 5L88L 5BPPA 3ULUD 4NAJA 2FJHA 3O4LA 4DT2A 1QBMH 4KUZL 3D0LB 4PAZA 2ZUXA 1B4LA 1X4XA 3PWPE 2AK4E 1HHHA 3LS4H 1T3FB 2X4SA 3VQ1C 2KZWA 5D4IA 3MRQB 2KS0A 4NNYB 1GZQA 2FLBT 3NZUA 4OJFH 3JVFC 5HY9A 1NJ9B 2VL5A 1CQYA 3B9KB 3NCYS 2YSSB 1CGTA 1G9NC 2B15A 4XNDA 1GGUA 2DH3A 2BIPA 1JGEB 4AC4A 3KPSE 1OAXL 2VH5L 3RX9A 3H9SB 1T66D 3IK2A 5BS0D 4HIHB 5E2UH 3HZKA 4MJ6A 3PABA 5IQMA 1EHXA 4L4TE 3MA7B 4LEEA 4FTVD 4HPOH 3EGXB 2ZX9A 4OLXH 1LO3H 4NM4L 1SRDA 3DUUA 1OXYA 2W60A 4DO5A 2ZX7A 1DVXA 2APVA 5ABZA 4PRAA 5B1BB 2JJTA 4P9HC 1NGQL 4TSBL 5SWSB 2Q3ZA 5D70H 1XZ0A 4HHAA 4ODUB 5I18L 1SVCP 4ZSOB 2WSDA 3IJEB 5GPRA 3W2DL 2NX5D 1FJ1B 4GO6B 3W2DH 2VIRB 4NQDD 4Y5YC 1BVNT 4IDLA 4B5EA 3HBQA 1URIA 4FXKA 3MRPA 1JYVA 1CL7I 3BW9A 3U0WH 4YE0A 2B9AA 2VMCA 4XPFL 5GSVA 1TF4A 3QQ9C 2J57A 3OX8A 5D6DA 4PJ5D 1DZBA 1X5XA 4N5EC 3CVIL 4QOKB 2CPCA 4GRMA 4PREA 3B34A 2OTUA 2WBJC 2BP8A 3W0WE 5DUBA 1WWCA 1OCZB 3JT0A 4P46A 5ERWA 3IDYC 3RWGB 2X12A 3QCVH 2DQHL 3TOPA 1P5UA 1QTYT 2NY3D 3ORJA 5L2KD 4ABQA 4FA7B 3MOAH 4LSSL 5AKTA 1XMEB 4HJIA 4EN3D 3A67H 1LGVA 1NIFA 2K7PA 4CA4A 9CGTA 3TN0C 4G8EA 4JAMA 2YGQA 1CU4L 3W3BA 1JI2A 1WSST 4Y9BA 1IEHA 1OLLA 1TR7A 3BEWA 5AW8B 5BZZA 1UQSA 1HL5A 3PWJA 4M1CC 2IXQB 4QRPA 2R1XA 2QSTA 4X0KB 1QWUA 1KNOA 1S7SB 4KRPC 3FU7B 3HE6B 2XN0A 1SXSA 5GSVB 2B1HL 4ZX4A 3FTXA 1A7BA 4I48A 4ZMYA 4WNQB 4KJWC 1XL6A 3L7EB 1DYZA 1DLFH 3MRGA 4IBLT 4KQ0A 4U1IA 4WGWB 2A0LD 5FM5M 5EMYA 4ESKA 2HTKD 2Q8AH 1AC6A 4DW2H 1N5YL 3NJNA 3ZTDC 1GC1H 3H6AA 5ITBL 5LKNA 3FB8B 1PBYA 1J5HA 2ZWLT 3X3GL 1ZK5A 3L9EA 4CNIA 3T2NH 1EGJA 2K7QA 1P5VB 1BXVA 5E4IA 5EV7A 5D4QA 5F3HA 3WO4C 1XO8A 3KLAA 1JF1B 2PPFA 3GKWH 3OWEA 1N6QH 3WKYA 1E2ZA 5JNYB 3UBFA 4KITB 5CGBA 1WIOA 3LN5B 4IBWA 4GQPH 1AO7A 3SYAA 5F21B 5IBUB 1X9RA 3GMPB 4KUCD 3GRWH 3PWLA 1NOAA 5AKRA 4CW1A 1RAMA 5EPMB 3WFZA 4IMLA 3QRLA 4WWPA 3HI6L 3S3CB 4AGOA 1DLHA 2GJ6B 2F19H 1I1AB 3OR6A 1F1GA 4H20L 2ZCKH 2R2EB 1VKXA 1U93B 4YR6B 2ZSWA 3BVDB 4HGKC 4MX7B 1BPVA 1S7TA 4PWGA 2IALA 4QYAA 3AQXA 5C0CE 3T0EE 2DJSA 2E7CA 4JDTH 3VXOB 4B9ZA 4XP9H 1C9SA 2NY3B 5L2KB 4L29A 2UXFA 5IHZA 2CO7A 3PCYA 1A4CA 4K15A 5LCVL 5HGHB 4OZIB 3H2QA 3EKCA 4TQHA 4FCAA 3KYNB 5LNEA 4ABUA 5IMMA 3BIBX 1BAGA 5J5EA 2WTRA 5EA0H 4Z0XB 2XWJB 3T6WA 1LMIA 1B2YA 4NT6A 4JKPH 3BQVA 3QCUL 2CUAA 3BVNB 1V10A 3BUTA 2WZAA 3GWJA 4YDLC 2NDFA 3TWCL 3K6DA 4AYMC 5HPOA 1JPGA 4XCNA 4PI0A 3RNQA 4AJ0A 5DFWH 1FG9C 1YLBB 4TKWA 1QSZA 1NLDL 1UFUA 3KLAB 4NJ9L 4Q9QL 4HH9B 4KKBD 2IWEA 2EDDA 2CK0L 4X5XA 3FU0A 1ZSDB 4K71C 5D7EA 1E28A 2DQGH 3VDAA 2QDVA 3BP5A 3T2PA 1UWFA 3GO1H 3L5HA 3RPKA 1VJSA 1I1FB 3IJ7A 3QUMH 4OF8A 1G6RL 2O6EA 3P1VA 2VXQL 5DC4B 3SGEI 4X80L 1S4IA 1A6WL 1OF2A 1Q1JH 4GXVL 3KWTA 3BSHA 4ODSL 4X7DC 3BHBB 1N70A 3HA0A 4XP1H 4HCRA 2Y5TB 3DXAA 1EZLA 2HLAA 4Z78A 1H3PH 4IJTA 5DLLA 1TYEB 4HIHA 3U7YL 3H9YA 4U31A 4CDHA 3WNPA 2VWEC 4HPYH 4JPWH 4M8QA 3UROR 2NQ3A 2J6EA 5A16A 5HVFB 4WO4C 3ZKND 4WDIB 5DYFA 5AVVB 5C9KA 2VRKA 4FFWC 3KZ8A 1DFBL 1H6FA 1M1XB 4QRRE 4LQFL 2JIXD 4ERSH 1NMAH 1WA0X 3IGLA 5IB2B 4QRPD 4HC1A 4HJ0D 4PWJA 1U8LB 2AJZB 4M8VA 5I1JL 1K4DA 2B1AL 3NCFB 2BIIA 4ODTL 1AGBB 3MLYL 5ADOL 3QQ4B 4L4VA 2DAVA 1MELA 2FDBP 2GSGB 5K1VA 4XCFL 1A7NL 3MUHL 1MRCL 2GUOA 2YN5A 2VMEA 4XCFH 3A6CH 3VGAC 1LE9B 1NCDH 1M9WA 3OHXB 3T6VA 3CSPA 4M62H 1J0JA 1S8DB 4UTBL 1SY6H 3ZKQD 1MW2A 4PRIE 1IFHL 3S2CA 5E5RB 4JM0A 2Z93A 1AO7B 4B3EA 1J9QA 2ARJQ 2GY7B 2X4RA 2H2PD 1BA9A 2ZCZA 5CJQH 4NKOA 1A6VH 4YEFA 1NBYB 4XB8A 3I84A 4I85A 1UUSA 1MAML 5FA4A 3NIFB 3MRIA 4O5LH 5GJTL 4AEHL 4GMTH 4BE5A 2NCEA 4RAVB 3E1ZA 7FABH 5HGDA 3B37A 3FB8A 1B4JL 2E27H 2HTLD 3O0LA 1PQZB 3WEXB 3WTWA 3HJ0A 4FAAB 2CD0A 4X8JA 2BSSB 2Y7QB 5FX3A 1HAWA 2HRPH 3LIZA 3WV0A 3WYRA 4N9GA 2ZSWB 4EUPG 3SJVA 2OSXA 4RFNB 1CDHA 3MCG1 3GUFA 2VN4A 4H2AA 1SDAB 4QRRA 3GZKA 2P80A 4GRWH 1U92B 3KPRB 1ZIBA 5IK3B 2NSMA 3WNOA 1XCTB 1GZQB 2PW2B 1FVDA 1DQJA 3RWFA 3EJZC 3ZDXB 1VFMA 3LRHA 2GJZA 5DJDB 4LCYB 3GB7B 4XNYH 4V2CB 1E6OH 5GGTH 1FFPA 4CN4A 3OVUB 1QO3A 3MXWH 3QZMA 5AYUH 3W9DB 3O6LH 1UWGH 1MRDH 1VADB 1KFGA 4E36A 5CBEB 4NRXA 3EG9B 4IKIA 4V2BA 3K6FA 4CN1A 1ADQH 2VN3A 4WV1A 3S35L 1MXGA 1T2QL 2KQNA 3QJFA 1GYVA 1ZS8B 6PCYA 3BW9B 1XBDA 5IFHH 2Y06H 2IQAA 2C4FT 3GIVB 2V4LA 1M71A 2GG1A 2VXTH 2W95A 4N1HB 1ZHBB 3CFDB 1ET5A 1BM3H 4HQQH 3RVWD 1F6LL 4B41A 2IH1A 3D4CA 4YE4L 1F90H 3Q2VA 2UZYA 1RZIA 3P9WB 3LKRB 2AMGA 2BIMA 1N3NA 1JGDA 4NCC1 2HLFC 2WBXA 1RCYA 3ZE2E 2BRQA 2D7TH 3BJ91 3UZQB 4WSJA 2GIXA 2HUHA 2AJ3A 1QLRB 2XN9B 2VSKB 1R3LA 1GAFH 2HFFB 2YQGA 5I2IB 5D2NE 2C26A 5ANHA 3ULVF 4LLWA 5FUZL 5DT1H 2ITCA 4QXTA 4NBYB 3WHXB 4PRDB 1HTYA 4EUPH 5E8EA 1CLZH 4X5WB 2JMRA 2YK1L 2IDSA 4ZOEA 2FEEL 2XWTB 5DURD 2BS9A 3I6KB 3ZRFC 3L48A 3W37A 4U1LA 5AOKA 5DZVA 1RZJC 1OAKH 3BAIA 3BAXA 1OM3H 5LLIC 1E3ZA 3CFEB 4UQDA 2PETA 5KS9F 4GRLC 5EN3A 3OKNA 2O4EA 4QTFA 4E9XA 2VH5H 4X9HA 2WV3A 1UM4L 2JWYA 4NKQB 2LU3A 3C08L 1EHAA 1U41A 2IGFH 4XOCA 2H4EA 5ISZE 4L1LA 3FQNA 2O72A 2H1PL 9PCYA 5A2KH 5E5LA 4A7TA 5HYQB 1V27A 5H4YA 2J73A 1SHMA 2VDLH 1ZHNA 1G4RA 1Z6JT 2CXGA 4HKBA 1SEQH 1HQ4B 2YD8A 1ONQB 3D39A 3GMMA 3GSXB 1PLAA 5J9PA 3A6BH 5D7IA 5HHXL 3S97C 4ODTH 5LG6A 2GK0B 1ND0B 4YL4A 3H1ZA 4FQXC 3K6SA 2APXA 3FFDB 2OI9B 4GO8A 5DYOA 2XTJE 3EOBA 3MBEB 3C12A 5ALCL 3TO4D 5JW5A 1NGZB 4JKNA 4KJYA 4DPBX 4HLZG 4H1LA 1HK6A 5IBTL 5KJRH 2FX8H 3G5VA 4D0DA 4UQ3B 1MLBB 3KBEA 2QV2A 1NIDA 4NZTH 1HE7A 3PJLA 2J88H 2O5ZL 2AZAA 4F15B 2OMXB 2FJFB 5KOVC 5FM4A 4OJAA 1C8PA 4UMGA 4YIQA 3RPIA 5GRVL 5FGRA 3UIZA 3OR7A 2NNXA 3GSNA 4QRUB 4I2XB 5GGQH 3ARBD 3NIDB 4E42B 2XKNA 4UQ2B 4FI8A 4U6XA 5JXEC 4UF7C 2FCBA 4I1RA 4NKMA 5D8JH 2CJUL 1AGCB 3OXSA 3L08A 5I30L 1R5WB 5FYKH 2EDYA 3QDMA 4I3RL 3U30C 1QA9A 5FKAB 5ACMA 4XP5H 1ZA3B 5EU4B 3BOVA 1E50A 2GEEA 2FECI 2E9BA 2WLKA 3HR6A 1U4EA 4F2ME 1AI1H 1ZIAA 4OLXL 1PF3A 15C8L 1OTSD 3B83A 3MV9B 1ZSDA 5T1MB 3X11B 4OZ4B 5IBLC 3LRMA 1IKNC 5D1QA 3SGEH 2ZPKL 2ZXWB 4KPHH 3OKKB 5EORL 1HEHC 2YR3A 3DUHA 1SEBA 1QYGL 3B4NA 5TK4A 3V5DB 2GK2A 1N12A 2ARWA 5EUOA 2O5YH 5J9PB 1OT1A 3ATEA 1HSBB 4F1ZA 2VQ1A 2CR6A 4ENEC 4LPTA 4Y9GA 5JHLA 4P23C 3WTXA 4X6DE 3U6XS 3P3TA 3PWPA 3U7WH 3V0GA 3IDXH 1J1OH 3V0DA 1E90A 2BOCB 1RU9L 1KLFA 2HT4C 3PL6C 4LKCB 4M43H 4A66A 1P6FA 4FNQA 1BVOA 2CM6A 3OMIB 3P73B 4ZPVA 3DOSB 2DLFH 1HHGB 1IGTA 1K4DB 1SFHA 4MWFA 5KYWA 1QATA 1QBML 4KUZH 4WFHE 5AAMA 1I1YB 4ETQB 4ZUVA 1MQ8A 2C7UB 4PW9A 1JK9B 4HF5H 4JFHE 5C0NC 1JWSA 4GKNB 4XCEA 1B3IA 4I0PD 5C08D 1WZMA 1YYLH 3RUGE 3T3PF 1JUFB 1JSYA 5C0RH 5FKPB 2QKSA 2D8KA 5ICUA 2H9GA 4QLRA 3V6FB 1K72A 4DEWA 5GS0C 3HHSA 1NH6A 5LBSH 1UACH 2Z7ZA 2F1EA 2J72A 3GXTA 4U33A 2VXSH 35C8L 2B5IB 1D5ZA 2OMWB 2E9IA 3RWHB 1IC7H 4ZX6A 1GYWA 5C0FB 4K3EH 1FZMA 1YCSA 1OPGH 5ANME 5DHVB 2EVJA 1OZTG 4P9HH 3P2DA 4BH8B 4GAYA 4IGBC 3IS0X 4WJKB 3MV9D 2LHAA 1V5JA 4K9EL 3HG3A 1I1CA 1F00I 2AXGA 4X5RA 3SGKA 5J11B 2QPEB 4UILH 5JHDB 4C56E 2OJEA 3L4UA 4XXWC 3LY6A 3DPBA 3HRZC 1L9OA 3DI3B 3Q0HA 4JANA 3EJPA 5GISL 3T08A 4E9TA 2GTWB 1CXFA 1QHPA 2F1AA 2AJVH 3VH8B 2YBRB 5SWQB 2X6VA 2WIIA 4H5SA 3LNDA 3LKQB 3S9DB 3PHQA 4H40A 5CLZA 4MD4B 5F0LB 3SPIA 1GYUA 3IN2A 2F5BL 3ZJAA 3QIWB 1FLTX 4QRPB 1IQWL 4MJ2A 2YPLD 4Z7QB 1CFBA 1ECZA 1JPSL 1RULH 3VMPA 4XMLH 5I1AB 2YWZA 2UYLA 1AJ7H 1GW6A 2W59A 3CUPB 3TIEB 2CNYA 4D8OA 4LU5L 1GYAA 4KTEH 3X3FL 3EBGA 3IETA 4KK6D 3RHWK 3EYQC 4I0PC 2CJ3A 3U2JA 1S2EA 4OSUH 2F53A 1AIFB 1WYJA 1WD9A 1BBDH 3D3VD 4YDNA 5DUML 2O6CA 4XO5A 4B97A 3PAYA 3V6OA 3EGSB 4KVCL 1VDGA 2G9HB 4K8RL 3FUJA 1I85A 4P3CH 3QJUB 2K3HA 1V3KA 2OXGA 1FL5B 5KAQG 4GIPD 4N2KA 1T89C 3NESA 4GAFB 2HJKB 4ZS6C 5EC2B 1U42A 4JZNA 1OF2B 4TSCL 4HEPA 3PWLB 1AE6L 1DTUA 2VUKA 4XZUB 3CSYB 3GIVA 3T3ME 1X9UA 2XBTA 5I18H 3BAYA 4P4RB 5I5JA 5JIDA 4M61B 5I17B 3RX8A 4LPYA 4HEME 4N5UA 4DZ8A 4D0CB 3RDTC 3QNFA 1AD9A 3AMKA 4K73A 3UC0L 4AWJC 3MRCB 5TE4L 2IH3B 4AEIH 1SYSA 4WZ9A 3VXPB 4YFLI 3CAFA 5LG1A 5INDA 5F7AA 5GGUA 3TCTA 4YFLF 2Z7WA 3DVFA 3UZVA 4KY2A 3V0WH 3D51A 3GHBL 5DCCA 1J8RA 1BEYL 2FZ3B 2DWDB 2XRAL 4H8PA 1B9ZA 2WYHA 4P4KA 5F93C 5AAMC 4UMSA 4LRIC 1BG9A 2Z31D 4XO3A 2Y1AA 4NZRH 2YMOA 1S9WB 1N5YH 3GSOA 4Y8DC 5KYNA 1UZ6E 4ODWB 5LBSL 1MW0A 1WH0A 5F8QC 4UM9A 3FPXA 1XB3A 4IIQB 5CCHE 2DWEA 4YSQA 4KWUA 4LE8A 2IGLA 1TZIB 5IMKA 1BYNA 5TK2A 4YZFF 2IC2A 3ZQ9A 1A8JH 5C07D 2FYVA 1RURH 5T33L 1J5CA 2E74C 3T5WA 1HL4A 4X9IA 2MPAL 3PS6A 1IAKA 3BH9A 4PJ5B 5MERB 5BOZG 4AK1A 3NIDF 1F2QA 4GJTB 5LNDA 4AQ1B 1DQQA 3FUMA 3DBSA 2IBZX 3AMLA 4RMWA 1C12A 4JO5A 1EAQA 1KCBA 4KXAA 2X6CA 2J6EL 4D7PA 5J13B 2V7HB 2WZPA 1BECA 1WGVA 5D93C 2GABA 5F7WC 3WS3B 3BWAA 2P28B 3OAZK 3VGHA 4I87A 1JNNL 3MXWL 1DVZA 4IHBA 3MLUL 1JGVH 4X0NA 1BVLA 1JRHH 1Z5HA 4XXCA 5K59F 5C0BE 4YXLH 1INQA 1EH9A 3REWB 3N85H 3NZSA 4DUXA 4YFEA 2GFBA 4PD4K 1XGYH 1ILUA 1CJYA 1CDJA 1JGUH 2XNAB 5CR1A 3VI3E 2CKBB 4Z0BH 1UWXH 5AVUB 3S36H 1XBRA 3EFDH 1MHEA 3FOMA 4M4RB 4O02B 1M6UA 4Y4HC 1AGCA 1BWWA 2CA3A 3MA7A 5HJ3B 3CFCL 4S0SD 5DZJA 2B4CL 3GMLA 3ZTEA 4J7RA 4Y4KD 3AABA 1CR9H 3FQTB 3RZCA 3PWJB 4FNTA 4QRUA 1D5ZB 4JL2A 3VGFA 3BE1L 1ITBB 4DIXA 3UOAB 3WELA 4QJ4B 1SBSL 1CYGA 3C9NA 3ARDD 4GBXD 2WGNB 3O3EA 5CNHA 3IETB 5CKGA 1P4UA 4LLMB 1FUNA 4YK4B 3T8MA 4F7PB 2UXTA 2NY7L 2XPGA 2P7TA 4RBPK 5C0EA 5ID0A 5IHZB 5C3LD 1EEUA 2IG2H 3LKPA 1RJLA 3VD5A 3DTXB 1ZLWH 3UBXI 1A6VL 2YEQA 2J20A 3ARGC 3JV6A 3GZOA 1E6OL 2AANA 1R33A 2ESVD 3ZIMA 3CHPA 5E94B 2EDNA 3HMWH 1L6PA 3CNKA 1M57B 2FGZA 2RGSA 2X9XA 5CP7A 3WY4A 3MJ9L 3P9LA 1OD9A 4ZXBB 1LO0H 4DOHE 1CR9L 4Y9EA 3S5YA 1KTRL 1AQ8A 2YA0A 1GVIA 2VIRA