5AQ0A

The structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
SGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOXYPEPTIDASE D
publication title The Structure of the Ttldomain of the Human Carboxypeptidase D
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 5aq0A00
3E8VA 3KCPA 4WI0B 2B59B 1UWYA 4FXTA 5G5DB 4FL4C 5AQ0A 2NSMA 1NKGA 4U3SB 3NJXA 4IYKA 2XHNA 1QMUA 4YOKA 3G3LA 3NJVA 4EIUA 5K39B 3HN5A 1H8LA 3MN8A
chains in the Genus database with same CATH superfamily
1BQRA 4L3EA 4RIRA 4F2ME 2E27H 1GL4B 1XXDC 2D03L 4Z3HA 4XC3L 2NYYD 4XMKH 4MBOA 5C08E 4HCRA 1Z66A 3WENA 4POZD 3IDNB 3VFPA 3GMPA 5D1QA 2H4EA 5CZVH 4YHKL 1EGJH 2HUEA 3ARDB 3MRJB 2VLKB 4EMZA 3OR6B 4R7DB 3O9WD 3IJSA 4PJ5A 3MNDA 1CFQB 5BRZE 2GQHA 2DQUH 3UCRA 1MW2A 5CIPH 1F58H 3BN9D 5LGKA 1P69B 35C8H 5KBMA 3LX9A 1CXKA 3T65B 2VB5A 4WW2C 5DD1L 3VRJB 4M1GL 4UV7L 4YZFE 1DJWA 3QDHA 5HJDA 3QJUB 3O3UN 4EZLA 5DMJB 4Y2LA 5C0CB 4BKTC 5MP6L 3D7PA 4X9FA 1CFNA 1KN4H 3K0YA 3L3OA 4MBRA 2GJJA 1A7PH 4P46D 5AVVB 2HVBA 2VDOL 5LQBL 2H0JA 3N43B 3CHQA 3WY1A 3DI2B 3U25A 3BXNB 3GSQA 2X4SB 4WUUE 4F3FB 1HNFA 1R3HB 1P7BA 4JO1H 4PGEB 4JFZL 1INQB 3HUJF 3QFJE 1P84J 4OCXL 1EXGA 1W72A 3FQNB 1PX8A 4JLRA 4QAWA 3FCSB 1KJ2B 4Y9GA 1Z7JA 4Y4KA 2BS8A 2QSCH 3LRSB 4O2FA 4OIBA 2WUCH 3K6OA 3VYOA 4JMXA 1PJWA 1OK0A 7PAZA 3E3QC 1SFHA 1JBJA 3QZPA 3WFDH 3BSZL 3LQZA 2UX7A 1J05A 4MA1C 43CAA 2CM6A 2X3BA 4EI5C 4FA7B 2Y0SA 1Z3RA 2DD8L 3FU0A 2RFXA 3IMWA 4PJIB 2Y6SC 4PJEB 3EKCA 2R1WB 2EO9A 3EH3B 1CYWA 3SDDB 2TRHA 4FHKA 3K4ZA 4ELME 1H19A 2V7NB 3HMWH 4QTIL 3BKML 1JGUL 4J23A 3NPSB 1IGYA 2EYRA 3UJTL 3EJQA 5IMMA 3B5TA 3B2VL 5DYFA 3HE6A 4NAQA 4IKLA 1O7SA 3GS0A 3PQYB 3NA4A 2VR5A 2YPVH 3GDBA 4WTXA 3IMBA 3CCHB 1C5BL 3MROB 4TNGA 3ATFA 4E2OA 1D5ZA 4L0PB 2CLRB 4DFIA 4OM1L 2YPLD 5A7EA 5FOJA 3LPFA 2ZCLH 3AXLA 3GUFA 4OZHF 4PJFB 1R5IB 5KYXA 1JV5B 4HJTA 2JV6A 1OCZB 5D6CA 2UY7B 3N41B 4ZYKA 3UGEA 3C6SB 5EPMA 4PGCB 1Q0EA 1NGXA 1P5UC 2CIKB 2X0WA 2O5ZH 3L5JA 3LDBB 4K23H 4K7PL 4RGMB 5EEZA 1L7IL 5BCAA 1JZ2A 4N0UB 1DJZA 4IW4C 3VTTA 4U05A 5E8DL 4NSKA 5I0YA 3HLAB 4JDZB 1NWPA 3BISA 3T2NL 2GJPA 1I1AA 2X9XA 1AKPA 3FQ4A 3WDJA 4J4PD 4AQ1C 3KPQB 3F01A 1BZOA 4M7KL 1N5AA 3IJEA 2W9EL 1XGRA 3WDIA 2UZYA 2R8SH 1I8MB 2P5WE 4YSUA 2WWNA 4WEEA 1IT9L 3JWOH 4FYSA 3BUBA 2H41A 3L4YA 5CU5A 1MZYA 1RH8A 3N06B 1YMHB 4YDIH 4AL8L 2XX1A 3WTWA 3CU1A 1S46A 4AK2A 5IWLA 4WENB 1OLZA 3HZMA 4X0NA 5ICXA 4J2XA 4M43L 4TSAH 4BQ8A 5JPNB 5IVOA 3BRDA 3PFQA 2A9BA 4JM2B 5C07A 3MRNA 3ARUA 3EGSA 1KBKA 3P4LA 4HUMB 3HRZB 5BRPA 5KJ7E 1S8DA 2W0PA 3ISRA 2FGZA 1IZJA 4ZAKB 3OPUA 4C57C 4MD0B 2G60H 2NW2B 4ZQTA 1I7TA 3NK3A 4LQFL 5E00A 1G7HA 3HS8A 1WC7A 4NC1E 3HC3L 2VDPL 3LZOA 2X42A 1YUHB 3L9BA 1PG7X 3KPNB 1E67A 1I9IH 4PRHB 4GKNA 4W6XB 3ILEA 4UILL 5T5FA 1XGUA 2BSSB 3IDXL 1IEAA 1G7JB 5KTEL 4N9GB 5E8EA 4PRAA 5E9DD 4LCUA 4QRBA 4FLOA 4UDTB 5BV7C 4M93B 4P5TB 5H35B 5I2IB 2P49B 5FGBC 5F6HJ 3CXFA 2IMMA 3CZGA 3L08A 2Q6WA 4GG6B 4X80H 3GQFA 3MNWA 4MHHI 4R3SA 3CLFL 2DQHL 4QJ5B 2ZP9A 4Z7OF 3ARPA 1PQZA 3QDGA 4NBZB 1EHXA 1QBMH 4BQ9A 2D3NA 1BAGA 1DL7H 4XCFH 2ICEA 1XTLA 4Y8DC 1BM7A 1G9HA 1T22A 1T0OA 2WQVA 2DLHA 4F8TA 5HDOA 2NZIA 1BP3B 3VWKC 1EPFA 3FU8A 3VFNB 1MHPH 3GSVA 3MJWA 4K3JH 4C56E 1HZKA 3OVUB 4OUUB 2NY3C 4HWZB 4MSWB 3PWPE 4PJXA 2QADD 3SPHA 4CADB 4KHTH 4BM7A 3OAYH 4QXUL 4U6XB 1XBRA 3O4LD 1TJHH 1NSNL 3CG8A 3LKNB 4QF1B 3RY5A 1N3NA 2HT3D 3Q43A 5T1KD 1FZKB 2XG4A 1VDGA 2XJLA 5E4IA 3K6SA 3A22A 1E3XA 2ZUWA 3UXFA 4NKOA 2J8UE 3MRGA 5KVEE 1GR7A 4AC4A 5DR5H 4NKQB 3X1BA 1D7BA 3RVVC 4WI4A 3D30A 4NZ8A 5JNYA 1OAZH 3HB3D 3ISYA 4HP5A 4ZXBB 1OALA 2VXSL 4PJDA 2ZOLA 1MOEA 1XH1A 5DJ6A 5GZND 5JPMB 1FNEA 4BV1A 4AEIH 3MA7B 1WUZA 3AQDA 1IAKA 1P7HL 1AXSA 2DQEH 1L5GA 1NOFA 1J8SA 3QDMA 4Z76B 3VFOA 1FSKC 3H42L 1ODUA 4B41A 4RGNE 3CQFA 2EE6A 2NR6A 3B43A 3L17A 2YJQA 4WGKA 1Q9OB 3FSVA 3C5ZC 4ZJ9A 3U0WL 3FSZA 3IDNA 3K46A 3O2DA 4OGYH 4BK5C 3FB5B 4UT6A 1B4JH 3NSDA 4B3EA 3GF8A 3KPRD 1I3RB 3IDJB 3ARDA 2VLKA 5F1SA 2DLIA 3OR6A 3N9GL 4R7DA 1MCJA 1P2CB 3MLZL 1CFQA 2JIXB 4OGAC 1G4RA 3QBTB 5E4OA 4E9XA 1G6RB 3R7RA 1NIEA 2HFTA 3QIBC 1ID5I 3H7LA 3T65A 3VRJA 2CUHA 4RSVA 1YCSA 5I1JH 4XNMB 1CT8B 3UG5A 1RK0B 3N50A 4Z6AT 1QP1A 5C0CA 3TFBA 2WO3B 1KXTB 1UCBL 3D39B 4QHKJ 7CGTA 1CWVA 4RCAA 4O9HL 3ZQXA 5TK2A 1V8HA 4NO0B 1O9ZA 4IGBD 4OFDA 4U4BA 3KCPB 2ADFL 5J6SA 4XBGB 3B2XA 3NDZE 2IBBA 3B9KB 4WLCA 2FWSA 2X4SA 5FYLH 5A16B 1K3ZA 2CBPA 3ESPA 1JGLH 1SGKA 2BERA 3AMKA 4Y16B 1XR8B 4FA8A 4PGEA 3QDJB 1INQA 3GIVB 1QRND 4W93A 4HOXA 2YK1L 3FQNA 4JUSA 1GYWA 2IH3B 1CDGA 1U30A 2OS7A 4WHYH 1CVRA 3CHXA 3FCSA 4TVPL 2YRLA 1KCRH 1KJ2A 4O00A 1UH3A 5GRWA 2DLFH 5LB1A 3UBXI 4Q0XH 3RZCD 4GSUA 4NKIH 4W6WB 3BAEL 3LRSA 1U9KA 1L9NA 2VLRB 1BLNB 2QVMA 2YD1A 1LL1A 3ARVA 4MJ6B 1A9BB 3G04B 2IALB 1JZEA 3VYPA 5D8JL 1Q4NX 1R46A 1K8IB 2GSIB 3KPPB 4HS8H 4J3VA 2NZ9C 2J44A 1NCCH 5LXGL 1WAAF 1YNKH 4X7CC 1SDAB 4PJIA 3RVUD 4PJEA 4MGXA 4EBQL 5AYTA 4FQJL 2R1WA 2GFBB 2AMGA 3S35L 3SDDA 2P28B 1EERB 3PHSA 1SVCP 3SDCC 4KKZA 1TQUA 3HJ0A 2V7NA 5A2IH 3QPXL 5DD3L 1E8ZA 3RX5A 4PRPD 1ZTMA 2GYSA 4ZUWA 5KVEH 2APFA 3KWWB 1N0XH 4F2EA 3U1PA 3PQYA 1YEIL 2CHDA 3CCHA 4N5UA 3MROA 2MCPL 2CLRA 5J7CC 1DSYA 4PJFA 1R5IA 1JV5A 1ILUA 2WXQA 4BSJA 2DWYA 2UY7A 2KDGA 3ZDZB 4KTDH 4PGCA 5GJTL 2BXZA 2CIKA 5TE6L 3VXTB 4S0TD 5LLIC 4IU2B 4PJHA 3K5SA 5FUCE 3VGBA 5D4QA 2BIHA 4N0UA 1M2OA 1G0XA 3HLAA 1SMOA 4JDZA 3Q5YA 1KEMH 3QUZD 2MKWA 3KPQA 1XB3A 4KXCA 4ZOAA 3ZLQC 2XWEA 3EHBC 1NAMH 3KXFB 3LN9A 4NM4H 2ZP0T 1MAJA 1QTPA 2BNUB 1I8MA 4MZIA 2ZTBA 4W9LC 3SJVD 3I6SA 2BIQA 3D3VB 3ARFD 3MRRB 1F02I 2H2PD 3RPBA 2R0ZH 1M71B 1YMHA 4R4FL 4N85A 1VSCA 5EEYA 1BA9A 4AUUA 3OXSB 1BVNP 3IGFA 2GKIA 1YPZE 3A23A 5JPNA 2A73B 4HAKA 4JM2A 1YYMH 3ESOA 5AYQA 3HRZA 1DVQA 3RE0A 1NGWB 2W59A 4XN1A 3DTUB 2V3EA 1M7XA 4ZAKA 4MD0A 2JCCA 2NW2A 1FE8H 1I8LC 3QJZA 3WFBH 1ACYH 4WW2B 1V7NH 5TQ2L 1YMMD 4M6ML 1VRSA 4DGYH 2YPLE 1YUHA 3KPNA 3EFOB 4PRHA 3CFUA 3K3QA 2BY1A 4PB9H 4IYKA 5GGTA 3MLYL 2BSSA 1GZQB 1G7JA 3FSWA 4N9GA 4UDUB 2ZT9C 4UDTA 4TQIA 3M8OH 3JSSA 4Y9BA 1B3IA 4P5TA 5H35A 2XQBH 1GJUA 3AREC 2NTFB 3TBTB 1KC5L 2EDTA 4GG6A 1E6OL 2VZ1A 3VI4B 1TMQA 1AJ7L 4O2EB 5L4MA 1E4WL 1GC1H 2W07B 3Q5OA 2OJZH 4XBMA 1AI1H 2R9HD 4U1GC 4DW2L 1MJUL 3A67L 3STBA 5IBTH 4N26A 2X3AA 5D7JB 3CSGA 4JVWA 5F7DB 5FCSH 3ZT7A 4C8XA 5BUAA 3CX2A 3W2DL 2LHAA 4CILA 1K6QH 3E80A 4XVUC 3FNKA 5BO1L 1I3GH 3VFNA 3PWNB 4CVZB 1WFUA 4RZKA 3F62A 4QJ4B 2BSEA 4XPGL 2I9TB 2HFGH 2QL1A 5HYQB 4UOW0 5C71A 3S8GB 4MSWA 4HWZA 4CADA 5CJQH 5FFOA 3X3GH 3MCLH 4U6XA 1HXYA 3LKNA 3LH9A 4MD5B 1B88A 3LNDA 4QF1A 3Q05A 3LH2H 1FZKA 3IDGA 3T4AB 4JREB 1HCYA 2E27L 4LKXB 3NCWA 3WU1A 1NKOA 1MCIA 4XMKL 5KOMC 4ODTL 3ULAB 4FCHA 4BXVA 1DEDA 1WHPA 4LPYA 3GXPA 3UTTD 2ODHA 5CZVL 2J6EH 4ZXBA 1EGJL 4QTFA 5JPMA 3KVQA 4WNSA 1OW0C 5E9DE 5D4IA 1WWAX 5CGMA 3MA7A 4CSPA 1U3NA 3I6LD 1F58L 4DWHA 1UKQA 35C8L 5KSAD 4P9HH 2DY2A 1YUKB 1ZK9A 4JFDD 3FPXA 1NUNB 4Z76A 1SPDA 2XU9A 2CMRH 2X4RB 1OAUH 4HV8B 12E8H 1I75A 2JCCF 4GG8B 1Q9OA 4LSVL 5ECGA 1UXSB 3QHTC 3L2NA 3I74A 2OMNA 3FB5A 4NFDA 1A7PL 1I3RA 3IDJA 2H0PA 2J7LA 3ZE0B 3T0VA 3A6CL 4BQBA 2XWJB 1P2CA 4R5TA 4AV0A 2WQUA 1R3JB 4L2LA 2R2BB 4R7NA 2JIXA 4OV5B 1XB8A 4MRCA 3C60C 4ZG1A 1NCGA 1G6RA 1Z6JT 4ACPA 4KKAD 2MSPA 2W9LA 2WQWA 1WT5A 1NIDA 4RRPG 4WFHD 3O4LE 2KZ1B 5JXAH 4JO1L 4X5PA 4XNMA 1CT8A 1RK0A 5E4EB 2D0GA 2WNGA 1F86A 4YHMH 5ESVB 2IBGA 4JFXB 4AQ1B 1LJMA 1FIEA 1FGVH 3B2PA 1KXTA 2Q3AA 3BZ4B 4UNUA 3K72B 5JIMA 3V10A 5I15H 2DS4A 2OMWB 2KHAA 4NO0A 3KCPA 1RZKC 2QSCL 1HTYA 1JNHB 4XBGA 4DESA 1TQSA 3B9KA 2WUCL 3FTZA 4L23A 1T5WB 4L18A 4XNXH 5A16A 4O5LH 1M05B 3WFDL 3AG2B 3FF8A 5E1GA 1IX2A 3HG1B 1T4WA 1J12A 1ASPA 1CE6B 1XR8A 4U1KB 4XHJD 4Y16A 1CDYA 3QDJA 3RFZC 1NOLA 3GIVA 3D85D 4MJHA 3ZRSA 4S1SH 3HS0B 1MFAH 1JHTB 2ATKB 4I0PC 3TWYA 2IH3A 3GK8H 4HZLB 5D7LB 5IT2L 1QUPA 4WRLA 3O4OC 1BFTA 3S97C 5IUCA 2CK0H 2VM4A 3MUUA 1OY3B 5D7IE 3H9HB 1L3NA 3HMWL 3KPRE 2PNDA 2VLRA 4HULB 1BLNA 1EJ6A 5BV7B 1Y7VA 4MJ6A 1A9BA 2P5ED 3RVWD 2YPVL 1MN4A 3G04A 2IALA 4KZCA 3VRLF 2AAAA 2MQCA 1K8IA 2ZYRA 2GSIA 1C1EH 4PJ7B 3KPPA 4M5TA 3T9WA 2ZCLL 2W1NA 4FULA 2GFBA 3B2MA 1X5GA 3DX2A 2F5AH 3FU7B 4QT5B 4J3UA 3C8HA 5CCKH 2F8XC 1A47A 1FZOB 2O5ZL 4K23L 3VWKB 2WXJA 2MQ3A 5ISZB 3EXLA 3WOVA 1JF1B 2WLYA 4OFYA 3KWWA 4I2XB 2DLTA 1JHKH 4PCTA 1CGUA 2B7DT 4P2RB 3N44B 4L1HA 1HOEA 3WSQH 4NQTA 4JM0A 2HT4C 4QWWD 3CGTA 3KL5A 1V05A 3TWCH 1ZT4B 1SLUA 4JY5H 1QW9A 3JWOL 5DJDB 1KJVB 3CN2A 4XNBA 5JQHC 1QRNE 4RA3A 5I9QC 4HMCA 2FTAA 4NN7C 4P5MB 2P9RA 3VXTA 4M61B 4YDIL 5DWUH 1CICD 1Y1DA 2JTYA 4IU2A 3GS7A 4PW4A 1OO2A 3WEBA 4TSAL 5IHLB 4Q9RH 4P2OB 3B3BA 3VGHA 2YUZA 3O6KH 4NQDE 4YDNA 4K8RC 2X4UB 4ZMQA 3TVMD 4OGZA 3VD7A 5EZPA 3QS2A 4XN9A 4JQXA 2UWEE 3FTGB 2WINB 4F91B 3KXFA 2XN9B 2BNUA 3AGWA 3QCVH 1I9IL 1F45A 1WA0X 3D3VA 3MRRA 1WD9A 4RETB 1RIUH 4PI2A 1Q38A 3LVTA 4HEMA 2CO1A 3GHBH 2J21A 1CXHA 3OXSA 4ZS6C 3PGFH 1KB9J 4HH8A 1OK8A 4MZRA 4GRWE 2A73A 3THMH 2BHZA 4X80L 3AU0A 4I3RH 3FFDB 4PRPE 1NGWA 4NO3B 4W9HC 3NCXA 1O9WA 1RZJH 1QBML 3IJYA 4H4NA 4N0RA 5GXBB 3VVWA 4V2BA 1DL7L 2BPBA 4MJ5B 1YHPA 4XCFL 4WW2A 3MUGB 4KKPA 2VDNH 2UYLB 3EFOA 1J0IA 3BIBX 1UGNA 1F1GA 1GZQA 2X9YA 1MHPL 1URIA 2CJ3A 4UDUA 2ZKYA 3OZKA 4JJOA 4K3JL 3DMMC 2DI9A 4UOW1 3O6LH 5I1KH 3N42F 1B90A 1F11B 1QRKA 3C6EA 5CP3H 2NTFA 4KHTL 3TBTA 4OZGB 5DMIH 3VI4A 4CVUA 2K1MA 3BSGA 1TJHL 3QAZC 5GS0D 4O2EA 2HLAB 3T8XB 4DKEL 5D1XD 2ZXGA 1WZKA 2F15A 4Z0XB 1JPFB 4YBLC 2YD7A 4ZO6A 5D7JA 3APDA 2W94A 2P8MB 3I9PA 5F7DA 2EO1A 2DMCA 4ANUA 3B37A 2AJVH 5DR5L 3MLVH 4P2CG 4PJCB 1WIOA 2XOTA 4CVZA 1ODAA 1JGVH 1OAZL 3SJVE 2I9TA 1J9CT 3EH2A 4K5PA 2EC8A 5HYQA 1WV7T 1FFNB 2E59A 2J4WH 5I8KH 4FABH 5D2NE 1HNYA 2J72A 4AEIL 2DB8A 5DK0B 3QIUC 3RUGE 5T1JA 4MD5A 2E9WA 5C8JB 5T33H 1U8KB 2DQEL 1NC2D 4FF9A 5EULV 3T1FB 2ZXDA 3T4AA 1P6FA 2Q7NA 5E2WH 3QEUB 3SO3C 2A74B 3CZUB 25C8H 4LKXA 3X14B 2AQ1A 1A02N 2OI9C 1ZWIB 4LOUD 1TTRA 1DR9A 3QJQB 3QG7H 5TDOB 4DGUA 4IKNA 5HHOB 2NPLX 5IMOB 3GMRB 1ZLSH 1YMME 3ME0B 4OGYL 1CBJA 1B4JL 4NHUB 4MAYD 4EIGB 2DWXA 3ULUH 3MXVH 4L3ED 3T2OA 3Q3GB 1CD8A 2VQ1B 4HYTB 1DQTA 1JXDA 3QNXB 5IEKB 5FOBB 1ASQA 5E99H 3R0NA 5I1JL 4F2FA 2X4RA 4BH7B 32C2B 4HV8A 3ZT6A 4AQZA 4GG8A 4ECNA 1UXSA 2CU9A 4Z7VB 1IAOB 3UJIH 2R1XB 3KGUA 2Z7YA 3NABH 4IRJB 2YZ1A 4MAZA 2WHVA 1UWGH 1OCCB 4AGPA 1H8OA 3B1UA 3NOIA 2LFEA 1QBLH 2CUAA 5DWPA 5TFSL 1HL5A 3NZ8B 2OXGB 2M1KA 2XWJA 3VB8A 1E5ZA 1R3JA 2WANA 3FN0H 4OV5A 5FYLL 4K3HA 5EORH 2J43A 4H40A 1JGLL 4LVNC 4K07A 4Y2OB 2Q20A 3U2IA 2X4NB 3QVAA 1VAHA 4F24A 3NJLA 1W15A 5GSVB 4FMKA 5HHXH 4WZ9A 5ESVA 4BZ1A 4JFXA 4AQ1A 4GRWH 4APXB 3BZ4A 1TTUA 1BEYH 3K72A 1OV8A 3EHBB 3FFOA 4ZMXA 2OMWA 1KCRL 5LUMA 4S0HA 3GRWA 1EXUB 2DLFL 1H3UA 3MNMA 3QPKA 4NKIL 3QGVA 2AV7B 1JNHA 1BDYA 4FD0A 2V2WB 3UTTE 4KZEH 1T5WA 1ROWA 4PB0H 2XSKA 2B3RA 1KYFA 2J3SA 2ALAA 3LNGA 4MVBD 2VSDA 1M05A 2OL3L 4KK5C 2YPKB 5C0AB 2A0LC 4QEGA 4KITB 3HG1A 2PPCA 2J56A 1CE6A 1FC1A 3I6LE 3QZNA 1EFQA 4Y4KD 2ISDA 3OAZH 3OGOE 4HS8L 5BO0D 3F8UB 4JFDE 1GY1A 3HS0A 1NCCL 1BHGA 4ZFOL 1YNKL 1JHTA 2ATKA 2Z4TA 4HZLA 5D7LA 4OCMC 2NNFA 4H8QA 2EEFA 4YHZH 1MIEL 2XIBA 2AAVA 3N1PC 2VC2B 3H9HA 1KFAH 1G9NH 3PXLA 4U0RC 2XT1B 4RAVB 5KVEL 1X5MA 4BBWA 4J6RH 3ZE1F 1N0XL 4PLOB 5J1SC 1BLIA 4BD4A 5FGBA 3P11H 3OZ9H 5SWQB 1R3KB 3SE8H 1A3ZA 4W4OC 1RK1B 4PJ7A 3RJOA 3MBED 4WFHE 3CZKA 4U1GB 5FAAA 4FFVC 2ZYHA 4MX7B 3HE6D 5KAQG 1ZLDA 3FU7A 1MFNA 2NY6D 4KTDL 1VEPA 2ZXBA 1HZHH 3ILQD 1GKEA 4GKZB 4QT5A 4L37B 4ERSH 1FZOA 1TQCB 4YQXH 3VWKA 1ORQB 1OTTD 1JF1A 2YN5A 2YKKA 2GIXA 3OAYK 4ZFFB 1RZIA 1IM3B 4I2XA 3BP7B 5DC0A 1NCJA 5K1NA 4G6FB 2H9GB 1KEML 2CGYA 4P2RA 3E6FB 2B9AA 3VD3A 1NAML 3HEIB 1ZT4A 2ZKWA 4NM4L 1XIWC 5IBLD 2KBGA 2CCLA 3GZOA 1KJVA 1JXKA 1ZJBA 1OOAA 4P5MA 2R0ZL 1I1AD 1WUNT 4M61A 4PVLA 5FYLE 1NCBH 1O0VA 1EJFA 4BUQA 4HIQA 4PLJC 4A6YB 1EQWA 4P2OA 2O6DA 2BDNH 1QHQA 1YYML 1T04B 4QRSB 2X4UA 1MWAB 4X9GA 4RMRA 1FHNA 1JZ3A 2EIDA 5DEZA 2P5EE 2C5DC 3F7YB 3NIDB 3FTGA 3WFBL 1ACYL 2WINA 1V7NL 2XN9A 3TEZA 4CMMB 4DGYL 5C07D 1UH4A 2VM3A 4PB9L 3L4WA 3NRFA 3FUKA 3I9AA 4KVCH 5DEFB 3VX0A 5C0BB 5HYSG 4H0HB 2K78A 4RMBA 4BYHA 1DVFC 2JKXA 3M8OL 1AR1C 1A4CA 1NC4B 4BK5A 2XQBL 2J1ZA 1VA9A 1JZ4A 3LPPA 2V9UA 4WI7A 1IB5A 1T6BX 2C9AA 3BT2H 3FFDA 4KKBC 3RDTC 3ZDXE 1GC1L 1M9SA 3BJ91 4FP8H 1A22B 2OJZL 4NO3A 1AI1L 2WLKA 4X6CF 1PFCA 2AQTA 3DROB 4C54A 5DMKB 3C60B 5IBTL 3NSFA 1T3FB 4MJ5A 5EEWA 3IS0X 1PZSA 3MUGA 3VXSB 2UYLA 5TGBB 4YXHL 4ZK8A 1IO4C 1I3GL 1JNLH 2JKJA 3IAPA 5HJ3B 3VRIA 1AQMA 4WJG3 1PTZA 2HFGL 3QDGD 1NEZG 3MC0A 1CLOH 1F11A 1A4KB 5DFTA 3U4KA 5CJQL 2DQDH 4OZGA 4BWUA 3X3GL 2WYZA 1EAJA 3MCLL 3QWOB 4QO1A 3UMTA 2XVLA 5D6DC 5E1AB 3T8XA 1OP3H 1PCXA 1WP6A 2Y06H 3LH2L 1S78C 5FB8B 4Z0XA 3S98A 1JPFA 4GW5B 7TAAA 2XNAB 4E9RA 3UDWC 4JN1H 2P8MA 2H47C 4A04A 1UOVA 4KK6D 3RFZB 3M17B 5DFAA 1AS8A 3SPVB 3X1FA 3GTVA 4I0PB 5GRZA 3NJGA 2J6EL 3FTSA 2ZWLT 1A3LH 2XV6B 1FFNA 1IGCL 5E2TH 2JCWA 3P3YA 3MQIA 3ARWA 5CS7A 2HJKB 1FAKT 5DK0A 4JO3H 5DVNA 1DJGA 5C8JA 1JV2B 1U3JA 1A1NB 1BM3H 1U8KA 1BIIA 4P9HL 3T1FA 4OCLC 3FOLB 3DTXA 3QEUA 2CMRL 2A74A 3VXRB 3X14A 4CN1A 1DZBA 1OAUL 1ZWIA 12E8L 1LQBC 1WWBX 5TDOA 4DGWC 3BJLA 3ARXA 5HHOA 2XWCA 5IMOA 3GMRA 3W5MA 2PCXA 4LFHG 4FYRA 3LQAH 3ME0A 2F2HA 4OFQA 5F21B 4NHUA 1D9KC 1QBBA 4R2GB 3QDMD 1J5IA 1BOYA 4OBRA 4R84A 3HI1A 3Q3GA 2VQ1A 1NFDE 4JO5A 5IKCA 2RBLA 1KMGA 4XO8A 2NR6D 3AM8A 4CC0A 1S4IA 3QNXA 4UTAA 5FOBA 1KIUB 2WKOA 3II2A 4ZOBA 3UABA 1IQWH 4UYPA 4Q74A 5JXAL 3ARDD 2VLKD 5HI4C 1BF8A 2F8IA 3EJSA 5D1XE 32C2A 2N3JA 3Q8AA 3IWVA 4NNPH 4ZODA 4BH7A 4YHML 1FGVL 2QV4A 2BOCB 2ESVB 2H3XC 1QSZA 3MPCA 2D4FA 3BDYH 4E42B 4Z7VA 1IAOA 5EZIH 2R1XA 4IRJA 2XUWA 3A6BH 4MNGB 5E5MB 5CLWA 5I15L 3NYKA 4N0YL 3UEZA 1NLBH 4EKJA 3NZ8A 2OXGA 2WLMA 3OF6A 5I9QB 3X1GA 1M9WA 3BZDA 4FNRA 4QGTA 4XB7A 4EZMA 2O6FA 1JCVA 1KB5B 5C0CD 5FA3B 1G4MA 1AY1H 2IOIA 4L4TB 2VW6A 4QRAA 3U9WA 2ROXA 4O5LL 2IAAC 3W11D 3UP1A 2ZXAA 5E6RB 4Y2OA 1TJMA 4UM9B 4Z7QB 1OF2B 2QHLA 5HHVH 1OTSD 5GSVA 3VDBA 4S1SL 5GRXG 1MFAL 1PZ2A 2P8PB 4APXA 3RIFF 1TFHA 3GK8L 2BWQA 5DC9B 4ZUUB 1JWSB 4WEMB 5CGYC 5AW9B 1EXUA 4ZMWA 4Y5YC 2YMOA 5CZRA 5CCGE 2CK0L 1IMHC 2QZ5A 3TEYA 5HYJD 2YLHA 3BAKA 1UXMA 2J5WA 2V2WA 4EN3D 1ZJAA 1U8JB 3NTCH 4L3EE 1E2VA 1S7XB 4LEXH 2CQVA 2XV2A 1U3HB 2O5YH 2YPKA 3HE7B 4U1MB 5FW7A 5HHPB 5C0AA 1V3JA 1L9SA 3D50A 2CPCA 3L6FB 2WD0A 1C1EL 1UURA 1QBAA 1UM5H 2ZX5A 1DLHB 3SKNB 4NQXB 2DKMA 5BZWB 4BHUA 4OLEA 3M86A 4A2LA 2UXVA 4RX4D 3MRDB 5AW3B 3RVXD 3VG0H 2F5AL 4NLAA 3NZUA 3Q2LA 1WDAA 3GI9H 3TBYB 3U2JA 5CCKL 4KRPC 5CBAB 3FTYA 1IGIH 3D0LB 4ZTOH 4YR6B 2Z7UA 3ARQA 4RAVA 3AY2A 1M1XB 3DMMB 1IKNA 1N18A 4XPBH 1JHKL 4UNTA 2DL9A 3AREA 3POCA 3SDDD 5SWQA 1X44A 4DO6A 4OF7A 3ROLA 3WSQL 1RK1A 3T0BA 1BFVH 4OD2B 2P48B 2CAKA 3TWCL 4B95C 4BK4A 4JY5L 3ATDA 2NQDA 4MX7A 5F7EH 3N2JA 3KPOB 1DDHB 3WJJA 2VM9A 4GKZA 3TH4T 4L37A 5LHDA 5DWUL 4GNKB 2JWYA 2E5EA 4YLBA 3GXIA 1ORQA 1AYRA 3ZSSA 2WTOA 4Q9RL 3GSNB 4TVSa 4IBZA 4ZFFA 1IM3A 3BP7A 3G5XB 2EUWA 2H9GA 1Y6KR 1E5BA 1PDKB 2P5PA 2Y2YA 1NFIB 3E6FA 2ZZUT 3D4CA 4IIZA 1OSEA 2GY5A 3QIUB 3GJEB 4YHOH 4UNVA 5IBUG 1M53A 1HWGB 1ZLUH 3QCVL 3SO3B 1MKFA 1IBHA 4N2IA 1QSFD 2QQQA 2OI9B 3P3SA 1RIUL 4H5SB 3NFSH 3DHUA 4FFWC 5GS0H 3HRPA 3GHBL 1MHCB 4HKXB 2EINB 1MIML 3H2WA 4M6NH 1SQMA 3PGFL 5EZJA 1X5HA 2FVNA 2AERT 4X2UA 3THML 4A6YA 1EK3A 1T04A 3KGSA 4I3RL 3SE6A 1OW0A 2CO4A 4QRSA 2G5BB 4DKDC 1MWAA 1C7SA 4IOFC 2WWKT 2DBJA 5ELIA 3MJGX 1RZJL 3MKKA 3F7YA 4MCMA 3G9AB 4QOKE 2Y3NA 5DS1A 4CMMA 2VDNL 4JM2D 4WFED 5I5JA 4FMFA 4M48H 5DEFA 3TNMB 5C0BA 1BECA 4PJAF 4Z7OE 5I1KL 4ZAKD 3O6LL 3GLEA 1NC4A 4N2MA 5DMIL 3OC5A 3KR3H 1B6DA 4D0CB 2GK2A 3BCFA 4G7QB 4QI3A 4LDLB 4KI5F 3NFPB 3DROA 5DMKA 1NUDA 3C60A 3H55A 5DC2A 3X1EA 1CDCA 1T3FA 2X0UA 1ZPLA 3H54A 4ZTPH 5C97A 2AJVL 4JCLA 3H7BB 4N20A 4Y0GA 5EO1B 5TGBA 3VXSA 1UD4A 3MLVL 1KGXA 3V95A 4OI9A 1E40A 2COVD 5HJ3A 1AC6A 1JGVL 5K93A 6PAZA 4N5EC 1LO2H 5GGRB 2F7RA 4HCRH 4BWTA 3V6OA 4ZNEE 1DVSA 2MHAB 4LVEA 1KXVA 1A4KA 3PWUB 5F7YC 2EVHA 4LVOC 3E0GA 4B9GA 5I8KL 4FABL 4KXAA 3IPEA 1ASOA 3QWOA 4WTQA 2W38A 1UASA 5DYOB 1WQVT 2FQGA 2H5UA 5EU6B 4KKNA 5T33L 2XDHA 3B7YA 4PAZA 3Q13A 4UTBA 5IJKA 2BSED 4YC2C 3TM6A 5DA0B 4GW5A 5E2WL 3CAFA 1IIIA 2AI0H 25C8L 2GTQA 1OHZA 2PPAA 5JHDB 1I1YB 4LGRB 1JG9A 1BVKB 3AADB 5HI3C 3QG7L 3RFZA 3M17A 3SPVA 1ZLSL 2KI6A 3NIGB 4W9GC 2WKLA 2XQYK 5C07E 4I0PA 2H0FA 2LLGA 4FLHA 4YDKL 2NSXA 1TETH 1N5YH 3ULUL 3MXVL 4G8GB 1ETB1 3O11B 4K9EC 3W9DB 5I73C 3KHOA 3JVGC 3CFJB 5KSBB 2FYYA 2HJKA 1UFGA 5DUMH 3X3FH 4U0RB 5E99L 2LTQB 1JV2A 1RHHB 1A1NA 5FDWB 3FOLA 1DCLA 4ZXBD 2EDFA 4MAUH 3VXRA 1JGDB 5HBBA 5BZZA 1ADWA 3W9EB 2EQDA 1NCWL 1QNIA 3ZKXC 3ZRFC 4NZUH 3UJIL 1LDSA 2UZXB 3NABL 3LS4H 1UWGL 1W72H 5MEPB 1QBLL 2KKQA 3KM2A 4FJZA 4CSZA 1A9EB 3D2UD 4W9EC 3QDGE 3FN0L 4Z3FA 1KIUA 2CDEA 4PTUB 2VYRE 5EORL 2EIBA 1QO3B 3M6DA 2EYTB 1CF8L 4TKWA 4QKXB 3HFFA 5D2LF 2GUOB 2Q76B 3QNFA 5HHXL 2C9PA 3MLWH 3EBGA 5E24E 2ESVA 4Z23A 2HMIC 1BEYL 4E42A 1JE6A 4PJXE 4MNGA 5E5MA 1DCEA 5F96H 4WTZG 1IC1A 3BP4B 3FTUA 1VESA 3VFVB 4YSQA 1U6AH 1OQXA 1HILB 2VXVL 2IWFA 2YD3A 4KZEL 1KB5A 4I5BB 4RRPA 5I1LB 5FA3A 4PB0L 5IG7B 4L4TA 2DQCH 3REVB 2F7OA 5IB3B 2R0LH 3CN1A 1NEUA 1OL0A 4UM9A 4JKPH 1AQHA 4JKWA 1OF2A 5I74B 4LLMB 3QXTA 4HUVB 3B9KD 2P8PA 1PNDA 4D9LH 2C9UA 4ZUUA 1JWSA 3BKYH 5I1IH 2IC2A 5CD3B 1T7ZA 4YHZL 4IRSC 1P7QB 5IREA 3SE4A 3QDJD 4KRMB 1KFAL 5EEVA 4W9JC 2BRQA 1G9NL 4F8LA 1U8JA 2EE2A 2ITFA 4J6RL 4U1JB 5CKAA 1BD2E 1S7XA 3SQRA 2NX5B 3HE7A 1U3HA 3OZ9L 3P11L 2ZX6A 2I9LB 4JE4B 3GWJA 4U1MA 4X7FC 4AEHH 5HHPA 3OAWA 1I8AA 2YUVA 3L6FA 2EXWD 3SE8L 3JTBA 4KV5E 4YDVB 4HCIA 1I9RH 4Y1TA 3PHAA 2WZPA 1DLHA 2CNZA 3SKNA 4NQXA 2VLRD 5BZWA 5CLYA 3H56A 2VLKE 4JJ5B 4I0KA 3IN0A 1Q1JH 2B0SH 1HZHL 1SXCA 3TBYA 4N2DA 4PJGF 4YQXL 5CBAA 2FO4A 4JO8A 2LFGA 3D0LA 4YR6A 3ESMA 1M1XA 3DMMA 1A64A 1WS7A 1ZE3C 4UT7H 1RFDL 4X6DB 1N8ZB 3CFDB 1FCGA 5C0CE 4Y2DC 4AYMC 1G0DA 4OD2A 3T0AA 3L5WB 4YDLC 4XP5H 4OFYD 5I82A 2FR4B 3KPOA 5E56A 1DDHA 3SE3C 3FU3A 1NCBL 3DJZA 5T5FH 5IHUH 1QWNA 2CHNA 5CCJA 2BNQB 3GSNA 1IBBA 4LOEA 4X9IA 2BDNL 1CYGA 2B59B 4XP6H 3ZE2F 5HYJE 3G5XA 2VZUA 1AP2B 4F9PC 1PDKA 2VDLB 4XOBA 3H1ZA 1ULVA 1NFIA 1VEOA 1F18A 5IQ9B 3QQXA 3SCMC 2DICA 3QIUA 3GJEA 3ULVC 3AT0A 3M46A 1DVYA 1TEFA 5AW6B 4ZMTA 3OG6B 3UX9B 2BOLA 3BSHA 4N2OA 2YXVA 3CHOA 3FT4B 3T08A 4KVCL 3MLPA 4KY2A 4H5SA 3QIWC 1A7QH 1HAUA 3ZTCC 4LDEB 1MHCA 2ZYSA 4HKXA 5FYJU 5IMLB 1D9KB 5GISH 3GFUA 3BPNB 3KXFD 1E5CA 2VDQH 5FGCB 5AB0A 3PV7A 3BT2L 2G5BA 2QELA 4FP8L 4LDOB 3OLDA 3V9CA 2GC7C 4PJEE 2DIEA 4NN6B 1MNUH 5HYSB 2WQ8A 3HPLB 3TGXA 3TNMA 3HNSH 1JNLL 3WEMA 4GSQA 5HYIA 3FTWA 4HIPA 4AYDC 1OQOA 1W2KT 2QDWA 2L8AA 5E8PB 3T4YB 1CLOL 1XF5B 1PCSA 2AMUA 2DQDL 4B7LA 3H3BC 1ILSA 2XY1A 5L0QC 4D0CA 2Y2TA 4PJFE 4WJ5B 1SZNA 1GAFH 1JZ6A 2ZD0A 2A5UA 3NFPA 2VITB 3DVFA 2X1WL 4OLYH 4JN1L 3RWHB 4HXBH 3UBGA 1JXFA 2AEPH 3NGBC 3MR9B 3H7BA 5EO1A 1QEXA 4PJHE 2PTVA 2XKNB 5GS3A 3MMEB 3TA3C 1NEZB 4D3CH 4N0UE 5GGRA 1MH5B 3KYOB 2MHAA 1QSFE 3O2DH 1A3LL 3APNA 5D7JD 3CFMA 3PWUA 4UT6H 4JQIA 4Y5YB 5E2TL 1F41A 3QK0A 4KOBA 3SGKA 4POYA 5DYOA 4JO3L 2AJXH 2F08A 3LKOB 1RL1A 2EO7A 4IOSA 5EU6A 1DBAH 1BM3L 1J88A 2JB5H 4J1UB 3OAZK 1NGQH 3D09A 3ETSA 4OM0H 1XAUA 1I1YA 4FG6C 3WE1A 1N8OE 1BVKA 2WV3A 4D9QD 5FO8B 3ZKMC 3D4ZA 1GTFA 1KCBA 3LQAL 3BWAB 4TLKA 1MNNA 3S3JA 4PVBA 4JCMA 2MCG1 1VEMA 1QTYT 1DDTA 2ZICA 4G8GA 3QHZH 3O11A 3IE9A 2QGDA 4ZUTB 3W9DA 3OB0K 3QUYC 1NDMB 4FTVB 4YSRA 3CFJA 2MIZA 5KSBA 4KRPB 2R7EB 1ZXQA 2JCCE 1KYAA 4DVRH 1AQDB 3LKPB 3GEWB 1YNTA 1RHHA 5FDWA 1IQWL 2AQRA 1QLRB 2YD5A 1K2DB 3QB7C 4JX0A 3T71A 2AV1B 2Y6SD 3TN0B 3QUKB 4BH8B 1JGDA 1KPRA 2V9TA 4NNPL 4BFKA 3W9EA 3F84A 1H8NA 1IAIM 4NP4L 3U0TB 4W4OA 3BDYL 3NK4A 5DK3A 4PY8J 5EZIL 3A6BL 1M2VB 5ADPH 5BUGA 4JZOB 5MEPA 5FF6B 1NLBL 2EICA 4AYFB 1A9EA 4Y5XC 1KJ2H 1FG2B 4XMLH 4G9DA 1I1CA 5T3XH 4J3OC 1AY1L 3FUFA 4PTUA 3TIEB 5F6HI 1LWRA 3T6VA 4L4JA 1QO3A 5BRQA 1EFXB 2EYTA 3TT3H 4L9LB 3BX7C 2GUOA 2Q76A 4HKBB 5HHVL 2Z1KA 3P30H 2WXMA 4HUXB 1V54B 4OJFH 4URTB 3VFVA 3CX5K 3KEDA 1TVHB 2ITCA 5B3JE 2YBGA 4KTEH 1HILA 4M3HA 4AIEA 4I5BA 5I1LA 5J4MA 5IG7A 4I77H 5TE7H 3REVA 4LEXL 2HKFH 5IB3A 3Q5TA 3GEFA 3K5RA 4BDVB 1UZ6F 1F3JB 2K8QA 1E4HA 2K3HA 1T7WA 4AM0Q 4OQTA 3FT3B 4LLMA 2FD6H 4HUVA 1UM5L 1CFMA 4JPWH 3RWGB 4G9FE 5IM7B 3VG0L 1WITA 1BJ1J 5CN3A 3HAEG 4P2YA 1QACA 1LHZA 2AC0A 5CD3A 4QYOB 4D0DB 2VGLM 1Z2KA 3GI9L 3LOWA 2CGZA 3HG1D 3IB4A 5HGHB 3SDAC 1P7QA 1CGSH 2HLFC 3N0AA 1M6OB 2BIOA 5IOKA 1IGIL 2BC4B 2IFGA 4ZTOL 4Z1PA 3MODH 4KVNH 1NDTA 4U1JA 3LNEA 4XPBL 1XCTB 4OIIL 2WPGA 5D7LD 2NX5A 4HIEB 4J3WA 2I9LA 5CHNA 2WO2B 2VQ4A 1A3RH 1YNTF 4YDVA 1BFVL 1V3KA 2PWFA 3AUVA 2YD8A 4HWEH 2A2QT 5C0IB 3QUXC 4YS4A 1UA3A 1WCQA 3CC1A 2DJUA 5F7EL 2J1XA 4JJ5A 5IK3B 1BZQK 3AS3A 3TESA 1OOWA 2F5BH 3LNHA 3I75B 2F19H 1HKLH 1WFMA 3DNKA 1E8WA 3SKUD 2PW1B 4LP4A 4MB3A 2IGLA 4QRRA 2CZNA 1HCVA 1DBKH 1N8ZA 1OP3K 3CFDA 4BUHA 4F5CE 4OKVA 3CUPB 4YHOL 3VWKD 4BGDA 3WO4C 1UG9A 4YC2B 3G3LA 3L5WA 4F2MB 3F05A 3ZZSA 2FR4A 2NY3D 1CXIA 1ZHBB 2H6UA 4QHKI 5C08B 1BMWA 1LP9F 4IS6B 4P2RD 5GS0L 5IHZA 5GGTH 4M8QB 1TYJA 2CE6A 1FYTB 1X6NA 3KMDA 1IRAY 4M6NL 2ADIB 2UZIL 4WU7B 2B59A 3C5XA 1AP2A 3NCYS 4A7QA 4Z3IA 2JKSA 5I73B 2P8LB 3KPMB 5IBUB 2ARWA 5IQ9A 5BRZB 5DZAA 3RJDA 2ENJA 4AK1A 1NUFA 2DI8A 3RVVD 4PGDB 1G7IB 4YX2H 3BZEA 4MDRA 3DPBB 4M48L 3RIFK 1AG0A 3FT4A 1EIBA 1HEHC 4GYBA 2VLRE 5IMLA 5D1ZI 3S96B 3Q8CA 4LASL 1UA6H 3AUWB 1D9KA 4Q6KA 4N2LA 3D34A 1WIUA 3KR3L 2QGEA 1MCCA 1MCLA 1ML0A 2APWA 3IJHB 5EBLB 2COQA 4HMEA 4F20A 1P6WA 2Q0ZX 3C5ZD 2EUZA 2I32A 4AITA 1CFSB 5HYSA 4ZTPL 5E51A 2IVFC 3W82A 3HPLA 1PKOA 3JZ7A 5CGTA 4MKMA 1LO2L 2WK2A 4HCRL 5E6ZA 4OGAD 4TSCH 2ICCA 2YWYA 1R3LB 3T4YA 5E8PA 3RFRA 2KERA 1XF5A 2D7OA 1KG0B 4MRBA 3VXPB 4M9PA 5EUOB 4Z7AA 3T09A 3L3IB 1WE5A 5EOTB 4CRPA 4HLJA 2VITA 5J6HB 3QJOA 2L3BA 1BSIA 2BOBB 4F1ZA 2MNWA 3KBHE 2AI0L 3RWHA 1W8EA 2MQ0A 3Q7JA 2HTLC 1SN2A 1Y07A 1LWHA 3MR9A 4GUQA 4EOWH 1A7RH 1K3IA 5E9NA 2L04A 1AHWC 2XKNA 3MMEA 1NEZA 2ZKMX 2JQAA 4FQ1H 3RILA 2B08A 2IDUA 1MH5A 2E4TA 3KYOA 1BFOB 3HN8A 1QYGH 1TETL 1N5YL 1G9MH 1FNGB 4PWGA 3O6FB 5DRWB 5IY5B 4Y5YA 2QLYA 3TT1H 1WZAA 4ELMB 2GT9B 4AVHA 5DUML 3LKOA 1FHGA 3VM5A 3X3FL 3KXFE 3CTTA 3P9WB 3LIUA 3BWUC 1G6RH 1I3UA 4J1UA 4E0RB 4P0DA 1HU8A 1MHEB 4MAUL 2ZUQC 5JW4M 4TMPA 2BSBA 1CXFA 2FO1A 1V7MH 3GDCA 2ORBH 4NZUL 4UT9A 4BSVB 3MV9B 3BWAA 3LS4L 3T8MA 1YEKH 1W72L 3H9SB 1X5XA 1OCWH 4X4ME 2YC1B 4ZUTA 4FG2A 3DPDA 1NDMA 4FTVA 5L8JB 2R7EA 4Z77B 5DJXB 4GKSB 1AQDA 4Y4FC 3C87A 5HHOD 1U2YA 3LKPA 4W9IC 2JSFA 5EF1A 2NZ9D 1QLRA 2I25N 1K2DA 4LCWB 5FYJH 2AV1A 3TN0A 2PYEB 3AT8A 3PAZA 3QUKA 1KTBA 4BH8A 3UTSB 2ZWSA 5AW4B 4Y2DB 4NM8H 4XP1L 1DJXA 2FE0A 3MLWL 1Z5YD 3ARYA 4A7SA 3U0TA 1ZOXA 4U31A 4KZDH 4XE0A 5C70A 1M2VA 3B6SB 4XX5A 4JZOA 3ZTJH 1PZ3A 2P5WB 5F96L 3TCLB 2EZ0C 2F7QA 3F7PC 5GRUH 3VI4E 4YDLB 4AYFA 1U6AL 2XN0A 1P4BL 1FVDB 2VRKA 1FG2A 4GW1B 2B39A 1FPTH 1Z9LA 2CBTA 2DQCL 3TIEA 2YQBA 1P84K 2R0LL 4IRJD 4JHUA 2ERJC 1EFXA 4R9HA 4TUKH 2O26U 4L9LA 4JKPL 3LHAA 1ZD6A 2X2HA 3OF6D 2EABA 1ZLUK 4QHLB 3SCMB 1TCMA 1WA2X 4D9LL 2BY3A 2OMTB 4DKTA 4HUXA 4DP0X 3HC2A 5AAMC 5I1IL 4D9QE 1JCKA 4WI6A 1TVHA 5BW7C 4X4YB 4IHBA 2FK9A 3QIWB 2YAMA 2AF2A 3HNVH 3E3QE 5I8OH 3IVKB 2QSVA 3VAEA 5INCA 4FQPA 4ZFQA 3EHBD 4AEHL 5B3SB 4BDVA 3V0GA 2XPZA 1D5RA 1F3JA 2ZYIA 4QRQB 4ZMLA 2PWEA 1B3JA 1U42A 3FT3A 1I9RL 4KKQA 4XZ4A 4H88H 5D7SH 3REWB 3K74B 3RWGA 3KPSB 3ZE1E 3RURA 2A3TA 5IM7A 2L0DA 3IMSA 1J8KA 3DHMA 5E70A 3HPJB 1Q1JL 2B0SL 1H3PH 2DTMH 4QYOA 5C0AD 4D0DA 1J18A 5HGHA 4N2EA 1J5HA 4KDWA 1XF4B 4OV6F 1M6OA 4EDWL 2FZ3B 4PS3A 3VI3B 4M29A 4UT7L 1XCTA 1S5HB 3PWPB 4HIEA 3WXWH 4PBXA 2I7OA 1EO5A 1FNAA 1MVFA 3FAXA 2RCSH 3IRPX 5C0IA 1JN6B 2H45A 3ZE0E 5IK3A 1KCSH 5B1KA 1SF3A 1AXTH 3ARED 5E5UB 3NGBB 3PJSB 4ALAH 4H0LC 3I75A 3UZEA 5I66A 2OYKA 5T5FL 3TA3B 1AYOA 2PW1A 4FRWA 5HVGB 4EPSA 5IHUL 1E3FA 3WTXA 4XP6L 2ID5A 5FKAB 3QC6X 2W9DL 2NT1A 2HFFB 2QVFB 4I87A 3CJJA 3CUPA 4PN6A 4XOAA 5E2VL 2VWEC 4XVUD 5CR8A 1KENH 1AE6H 1XF1A 4F2MA 2OJ1A 4FZ8H 2IQ9H 4G6FD 1ZHBA 2R0WH 5C08A 4IS6A 1A7QL 3MNVB 4OQ1A 2NSMA 1FYTA 5IB4B 2ADIA 5GISL 3HG1E 4X83A 3U82B 3EYSH 3O0LA 2YAQA 4WU7A 4XP9H 3WD5H 1ECZA 3ZBMA 3WEAA 3KPMA 5BRZA 4FYQA 3ZHLA 1CQKA 1KTJA 5D7LE 5GRJH 1MNUL 3EJUA 4PGDA 1G7IA 1KDIA 2W60B 5FC9A 3W56A 3FYIB 3CVBA 3DPBA 5FIEA 3HNSL 4X6CE 5B3NA 2X53A 4WI9A 3KS0H 3TCXA 4Q2ZB 4UNIA 5AVWB 4W70A 3WUZA 3EAKA 4Y5VB 4WEUD 4RAHA 4Z7UF 2JKTM 3FQ2A 4N8VG 2DEWX 5IUSA 4H26B 4Y5XB 4AL8C 3LZPA 1GAFL 2UUDH 3IJHA 5EBLA 5C0BD 1N0LB 4FNPA 4M5SA 4YDMA 2E46A 4OLYL 2HYMA 4P4RB 1FAIH 3RBSA 3L4XA 1NC4D 4HXBL 3RB7A 3TASA 1CFSA 2AEPL 2HH0L 1CS6A 3RRQA 3LEYH 1UFUA 4FNUA 2IIJA 2F53B 1A2YB 4D3CL 1FH2A 1U91B 2HN7B 4QRTB 3C8KB 5HDQH 2WM0A 4I2XE 3C60D 1R3LA 4JL2A 3ZYZA 4UT6L 1KG0A 5KSUB 2YAOA 4KI1A 3VXPA 5EUOA 3VXSD 2VLLB 3L3IA 3V79C 2AJXL 2P1YA 2RALA 3L3JB 5IW1B 2HVJB 5KBLA 5J6HA 4HT1H 1GGCH 2BOBA 1KLGB 2JB5L 1SBSH 2HB0A 4QNPF 1NGQL 4OJAA 4OM0L 3STLB 4TUUA 3KLDA 1H6UA 3OPZH 5I1CL 3DYOA 3WKPA 3L4ZA 2WAHA 1BJMA 1BFOA 4YE4H 1TZIB 1UOLA 2L4OA 1FNGA 1JMZA 2K70A 3QHZL 4KGJA 5DRWA 4ELMA 3SDAB 4HA1A 2GT9A 3TL5A 4DVRL 3KHQA 4NDMB 4Y7OC 4P46B 3ZO9A 2VN7A 2CDGA 4LRIA 2XVKA 4I0PD 3K81A 2XTJC 1MFUA 3MDJA 1SDYA 4E0RA 1MHEA 4JDEB 1VFAB 5E2JA 4HG4J 5CSZA 3RTQC 1ZLEA 4CMHB 4ZW6A 3BUIA 4BSVA 4OZIB 5ADPL 3MV9A 1GGIH 1NCUA 2ETWA 2YWZA 4N2BA 3H9SA 1WO2A 3IPFA 3S37H 1AKJB 3K0WA 4M02A 4NQCD 2YC1A 2IH1B 4ZT1A 3ILPB 4Q9CA 1CDIA 3VXRD 1KJ2L 3GRWH 1MQ8A 3IGAB 4XMLL 4PHZA 3QR2A 4N22A 4Z77A 4HSQA 5DJXA 4GKSA 1E4KC 2J5LC 2ATPB 1BWWA 3B9DA 5T3XL 5TD4A 4X50A 1GIGH 3LQMA 4LCWA 4K9JA 5FLVA 3TT3L 2PYEA 1I9JH 4R2GD 2EXYC 1GYUA 3BEVB 4O58H 4OF5A 3UTSA 1BGXH 4Y2DA 3PF2A 1T0PB 2V8LA 4ORGB 3P30L 1JI2A 3OR7B 2RAMA 4YSDA 2FQEA 1CXEA 4NI3A 1U93A 1II4E 3B6SA 4OJFL 4OZGE 3WO4B 3VXUB 2W0FB 1KB3A 5F9AC 1GW6A 3TCLA 2XQ0A 3BAWA 4JW3A 2D7QA 4KTEL 1FVDA 4GW1A 2FSEB 1M1SA 1TJXA 2AEWA 4ODWB 4PWKA 2ESVD 5ABAA 4YSEA 4I77L 2G2RB 5TE7L 5F93C 2HKFL 3VD1A 1PLAA 1YPZB 4C83B 4B9CA 1T89C 4IBQA 2E86A 2KQNA 3IRCA 5BV7H 4MCNA 4PP2B 1WFJA 3PCYA 2G75B 2APTA 2FD6L 1JZ7A 4QHLA 4JPWL 3SCMA 3EH1A 4FXGC 4WTZA 5IROC 2OMTA 1KTRL 4L4TD 5JXEA 4GXUM 3TBBA 4XP4H 2KLTA 1HDMB 1H8SA 4A67A 1UGKA 1CGSL 4UM9D 4ES8A 4X4YA 4K8RD 1AO7B 3OTTA 3QIWA 3UYRH 3MODL 2GITA 4KVNL 3IVKA 1JRHH 1GXEA 4K7PY 3V0IA 1A6UL 1KWGA 1FGNH 1UJ3B 2OSXA 5HHOE 4QRQA 4KZ0A 1A3RL 3WJMB 3KWUA 4UBDC 4M3KB 4HWEL 3REWA 1P9MA 4GAGH 3HAEB 2OYLA 4MHHG 2M26A 2OJEB 2WLLB 4B9PA 1CL7H 3KPSA 3QYCA 2E75C 4HWNA 4N90D 5F7WC 3C9NB 3OV6A 2BW4A 1UD8A 2XIDA 3HE7D 2F5BL 3HPJA 3V2AR 4MD4B 4AW7A 5DJ0B 1E28B 2F19L 4KO7A 4ZBJA 1XF4A 1HKLL 2FECI 2Q8AH 2RB8A 5JYMA 4LNRB 1ZT7B 2FZ3A 2WZPD 1QHPA 4NQEB 3VI3A 4B6ZA 5IW3A 2BM3A 3TO4C 3PWPA 1S5HA 1DBKL 2VR9A 4ZO7A 5KVDH 5SX4H 2XZAH 1RJYB 2BHYA 4AIZB 4Z5RB 2VMDA 1OKEA 3D0VB 4Y89A 3LS5H 1TLKA 2X1OA 2C3HA 2WXHA 1JN6A 1V5JA 2FNBA 3NPZB 2AK4B 3DMMD 4GJTB 4YMPA 4DPCX 3PJSA 3U0PB 3MLRH 2D73A 3EJYC 3AS0A 4W4NA 5GGTL 2ARJB 1AHWB 2ITDB 3TA3A 1M3JA 1YEJH 2XXCB 3ZYOA 9PCYA 5FKAA 5ITFB 4PJ9C 5DZJA 4GQ9H 2HFFA 4DKAA 2WXNA 3VGGA 2BINA 5ETUB 1OPOA 3ZUCA 1X7TA 2DDQH 4PMEA 5FA4B 5LGHH 3GMLB 4GXFA 4AGLA 4HU8A 1XSOA 2DZEA 2OA9A 2W81C 2WCGA 4M5ZH 4YX2L 1P5VB 1R0AH 1ZDSA 3PE9A 4YK4B 5ALBH 5KZCB 4GY4A 2ZUQB 3QEGH 2WTPA 3ULVF 2FAUA 4PRDB 5DHXB 3MNVA 2BSDA 1KCVH 3QIUD 2OTWB 3EDKA 5IB4A 4LLYB 1UA6L 4FNLH 4YGVB 3WUWG 1NMBH 2O61B 2FWLB 3L5IA 4Z8FH 1JGEB 1CD9B 1KY7A 3FXIC 5ABDE 1DHKA 4NWUH 2QADB 2JKLA 5JOEA 2F9BT 5LDSA 1MLBB 3N1QC 2OM5A 4LPCA 4WEBH 2W60A 4DCQB 1UUSA 3RKPA 1UHVA 3WNLA 2DMGA 2C26A 2F7PA 4TSCL 1YEFH 2J2ZB 4Q2ZA 4IBVA 4OF8A 4CKQA 4AT6B 3C8DA 4Y5VA 2MCAA 4PS4H 4L0ZA 4MZ3A 2YRZA 4BA8A 4H26A 4Y5XA 2FNWA 1TQWA 2KL6A 3QO0B 4G7YH 3TJHC 1N0LA 3AWFA 4IKIA 5E6SB 5FS5A 1F6LL 3O0RH 4P4RA 4ABWA 4KNQA 3FSAA 3OWEA 1BXAA 1A8ZA 2EXTA 1QI4A 5CSGA 4EOWL 1A7RL 5LBVA 2HFEB 3LXAA 2F53A 1A2YA 4CGTA 4FQ1L 1LO4H 1U91A 2HN7A 2WGNB 3BH8B 4QRTA 3RG1C 3C8KA 3II1A 3FH5A 1QYGL 3RX9A 2W95A 1G9ML 4JFTA 5KSUA 4NRZB 1LK3H 2EDRA 2VE6B 2C4FT 3TT1L 3ZK0A 1OAJA 1UB6B 2FWOA 4UQAA 2F8OA 4L3CB 5D7IB 2VLLA 1ZGLB 4YNYB 3T3MF 3L3JA 5IW1A 2HVJA 1N19A 1QW8A 4UTAH 1KLGA 3BGFB 3A4DA 1G6RL 3D9AL 4AZ8B 3BVVA 4KJQC 4FLQA 3STLA 3FW6A 1EVUA 4XNUL 4OCNC 4TM9A 4LHUD 3QZWG 5I6XB 1V7ML 3JYBA 3OKLB 4ETQB 2ORBL 1E42A 3LB6C 4GI6A 4XCCL 5EU6D 1IGJB 1OCWL 4PJCF 1X6LA 1TZIA 3AQYA 5T1LB 3P9MB 5ABZA 2ZOOA 4KK5D 4XBPB 2A0LD 2IAMB 3FQTA 3SDAA 2QLVB 4G5ZH 3JUYA 1PX3A 1TEGA 3NIDE 3TF4A 1JVOA 3DBXB 1QEWB 4IGBB 5AZEH 3ML8A 3UAEA 4PJ8C 1KULA 5FYJL 3J27A 4M8UA 4BCZA 1JZ5A 4HJSA 4G8GD 5C0BE 4JDEA 1VFAA 4NM8L 4UB0H 2LT9A 1N70A 1PIFA 2YHGA 5J12B 3Q01A 4ZS7H 2QVKA 2DRUA 1E5AA 2P44B 3L7EB 2PUQT 4OZIA 1SY6A 1RMFH 5GRUL 1CGXA 1AKJA 2ZUXA 1RIHH 1KWKA 4Z3JA 2APVA 2YBRB 2IH1A 1QRNB 1T21B 3O3EB 4F57H 3IGAA 1FPTL 4A2FA 2ATPA 3J07A 1T66C 1F4AA 2Z9TA 4TUKL 5LJYH 3VXSE 5DUBB 4NQDB 4FFVD 3UTOA 1OP9A 3DXAD 4XE5B 3BEVA 3W3BA 1IC5H 1X7QB 4XNQB 2OMVB 3ARZA 4HHWA 4J3OF 3E2HC 4ORGA 3ZL1A 3VACA 4PJBF 3OR7A 4DQAA 2ZAGA 2UWEB 1ECYA 1ZT1B 3VXUA 2W0FA 4JHVA 1USQA 4WGWB 4Q8BA 1NCTA 5F7BA 5FV2A 4UCFA 4HUCA 2RH0A 5C2UB 4JDTH 2FSEA 1MZZA 3B8SA 1N7MH 3MFFB 2CBMA 3HNVL 4ODWA 5I8OL 2VL5B 3DJRA 2VC2H 2G2RA 4MQSB 4XMXA 2VJ8A 4C83A 3K2MC 5KYNA 1SOQA 2B8OT 4MTMA 2OR8A 4L1DA 4PP2A 4JKMA 4PRPB 2V4LA 2X6MA 2G75A 2FECL 4H88L 1QQDB 5D7SL 2DMHA 1M6UA 4KROC 2VTFA 4ZMOA 2EIEA 2DYSB 5HHMD 1ZVHA 1H3PL 2DTML 2F7IA 2R27A 2RJMA 1WA1X 1HDMA 4LXFA 1AGFA 2Y5EA 2R23B 2TRYA 3NJVA 2YEVB 2WYHA 4FXKC 1DUYB 2BP3A 3NJHA 1AO7A 1QR4A 3RHWF 4AG4H 5I19H 1DSFH 4NQCE 5ALCH 3VXRE 5JW3H 4XNYH 3MOQA 3WXWL 1UJ3A 3PNRB 4ICXA 3U7YH 1P7QD 1S7VB 1RSFA 2VMCA 4KU1A 4F27A 4PP1D 2RCSL 1OT4A 1JRHI 3HAEA 3ZQWA 3MYZA 2OJEA 2WLLA 2LU3A 4U3SB 1G9EA 1DVFD 4MQTB 3C9NA 1AR1D 1KCSL 1BMGA 4J4PA 1AXTL 2NX5D 4WO4C 4ALAL 3ATAA 2VQUA 4MD4A 4XXCC 5DJ0A 1E28A 5K1JA 2ILLA 4KKBD 4LNRA 3RDTD 1ZT7A 4K94C 4B9JA 1CL7I 3SJVB 4NQEA 5IMKB 4N28A 3SO5A 3AG3B 4HUUB 4H0GA 4A6YH 3T0EC 1RJYA 2WN3A 3QEQB 4RBPH 3WNIA 4AIZA 1WVZA 4Z5RA 3D0VA 3K2UH 4MNGE 3D08A 3PDGA 4BXSV 1MWAH 1KENL 5E08H 1AE6L 4HZ1A 4QRRD 2AK4A 4F93B 4Z9KB 1A21A 1CVSC 1ZMYA 1PG7W 4FZ8L 5SX4I 1PVHA 2IQ9L 4IRZA 3U0PA 2AXHA 1C16B 1U3ZA 4L4TE 1AHWA 1HWHB 2ITDA 5F70A 5IJVB 2EDMA 2PCYA 5IB2B 3E9TA 4NO2B 1TSHA 2WXIA 3EYSL 5IQLA 3WD5L 2NSQA 4XP9L 4Z7QE 5ITFA 1PS3A 2BK8A 2E4FA 4MCYB 5JIKA 4AENB 3HKZA 3MUJA 5ETUA 5F9OH 4W1TA 5FA4A 5B1JA 3GMLA 1LE9B 5GRJL 2Q5BA 1E2ZA 3AB0B 2R2HB 3CZFB 1P5VA 4M62L 3P1VA 3NQKA 5DZVA 4JS7A 1AZZC 2EKSA 4Y1AB 1KB9K 4N90E 3KWVA 4PRDA 4IMLB 4ZQKB 4GBXB 2OTWA 4GT7A 2ZXWB 4LLYA 5AW7B 3JWOC 4YGVA 3HS9A 2OCJA 4BSWB 1AGDB 4ODSH 4HJUA 2O61A 1JGEA 4RFNC 4GINA 4Y4FA 1L6ZA 1FAIL 1MLBA 4FDWA 4UTBH 5CFAA 1D9KD 4DCQA 3DUUB 3EDDA 3LEYL 3ARRA 4KUCD 1DSWA 2QPDB 3KCWA 1WAPA 3E1ZA 5HDQL 4OF6A 3BE1H 2J2ZA 3M1BB 4N8VB 4Z3EA 4MJ2A 4AT6A 3G08B 5HXMA 4WY7H 5E23A 5HI4D 2A77H 3NCJH 1AH1A 3KG5A 4HT1L 1GGCL 1WTLA 1PEZA 3CV5A 3FQ1A 3G6JA 2AITA 3IMVA 4PIRF 1GOHA 1KACB 4U1HB 9CGTA 3FQRB 4IEFB 5IOPB 4PQXA 1J5OH 4P49A 2NNXA 1MFBH 2HFEA 5C7XH 3OPZL 4N87A 2V3DA 4JFDB 3RPKA 3TZVC 3F00A 2RIKA 3VFUB 2X7LB 1KV3A 3BH8A 4YE4L 5AAMA 3QR1A 3FC8A 3SYPA 4NRZA 2GC4C 3ES6B 2VE6A 4L5FE 3JV5A 2ODIA 1HHGB 2W88A 1UB6A 3JWDH 3TYFA 4L3CA 4UQ2B 5D7IA 2A9NL 4JUTA 4YNYA 2Y2WA 5JZ7D 3GXTA 1TTGA 3T6QC 1UZ8B 5CGYD 3AFLA 4HJIA 4U6TA 1H6TA 2QEJA 4TLUA 3OKLA 4ETQA 4HJGB 3TEWA 4FKKA 5HDBF 1GGIL 5IESH 3BWUF 3MBXL 5IVXF 5E95B 5T1LA 3S37L 5KEZA 1QFUH 3P9MA 1J8HE 4XBPA 2EC9T 2IAMA 3GRWL 2AZAA 3LHPH 3SYAA 3KBPA 2C3XA 3DBXA 4AZUA 7PCYA 4NJ9H 5IIEB 1Q8MA 1GIGL 4C4UA 1KB5H 2VDRB 1OSYA 3MRBB 1CCZA 4MS6A 3TO4B 1FDLH 4OFIA 4WNQB 1RI8A 3FZUC 1BGXL 1JSYA 4B9IA 4MS8D 1MFVA 4FTVD 4KRPD 4B0MB 3ZUNC 1K4DB 4K8RH 4KK9C 5KSVB 3H9ZA 4F8OA 2BMKB 3L7EA 5LNDA 5F7AA 1BVZA 2WXGA 4YZWA 1N67A 3VWJC 2YBRA 3BSZA 1T21A 3US0A 5FKPB 3O3EA 4ODBD 2MOGA 2DM3A 4LFHD 1HSBB 2AQ3A 3RWCB 4DP4X 3C2SA 5EU4B 2CA3A 2QJDA 1F4WH 3MOAH 5DUBA 4NQDA 2K9UA 4AM0B 4D7PA 5BV7L 4PJ9B 3OKKB 3GYRA 4E9VA 5TPWL 1DZ0A 1X7QA 3CHSA 2OMVA 4JRFA 4XNQA 3VA2C 4A7GF 1R5WB 2HUHA 4OIAA 3Q8EA 2UWEA 1FRGH 3PUCA 2Z7WA 1ZT1A 4XP4L 1EFXD 2GBUA 2FLBT 5B4MD 1UZ6E 2C9QA 1U58B 1N59B 3LD8C 5EU6E 3JTTB 3MFFA 1JHLH 1SEBB 4M1CC 3UYRL 1M57B 4CA4A 1JRHL 1VZGA 3LZFH 3TFKC 4CN6A 3K71B 1X5AA 4FYTA 4BHUI 4U6HB 2P47B 3JVFC 3UAJC 1XEDA 4CUCA 4PRPA 2DEYX 1VFUA 3NIGE 1U41A 1QQDA 4GAGL 5HYEA 4Z18A 4FFWD 2WBXA 1CL7L 4MASA 4G8GE 4KTYA 1GGBH 4AQ8A 4IDJH 1QZNA 1DJHA 3ISWA 2NDGA 3HG5A 1AOHA 5KSBE 4YHNB 2Y1VA 2R23A 2Q8AL 4A2GA 3EOAB 3G6DH 4DPRA 1DUYA 4WI3A 5DLML 3GBLA 4ODVH 1T7XA 4IOFD 1R47A 5BVJB 4ANVA 1HL8A 2DTSA 2XBZA 3S0PA 7FABH 2QMKA 4FQHB 1IZKA 2UUDK 5KVDL 2XZAL 1UVQB 1CICB 3GSNH 3KD4A 1GYAA 1WZMA 2WKGA 4ZSOE 5DJ2B 1E8YA 1UADC 5LBSA 2ZPKH 1S7VA 3LS5L 1MPAH 4G72B 4LOFA 4L5FH 3K6FA 5B8CB 3DXAE 4POUB 4U3SA 4AQAB 1D2OA 1A7NH 2Z31C 3Q8BA 3C5JB 4K5LA 3TVMB 1VPOH 3MLRL 4M4PA 4CVWA 2FHFA 1GJWA 4H0IA 4MB4A 5AKVA 4PTTB 5DHVB 5JIHA 1YG9A 1YEJL 3CHPA 3PREA 5AQ0A 4OSUL 4B3VA 3OQRA 1WZ1H 5IMKA 1E30A 4HEPG 1N2RA 4HUUA 4OR1A 3QEQA 1E7VA 3SGJC 1Y18B 3CFIC 2DDQL 5LGHL 4JE0A 4YFLI 3OSKA 3GBDA 2DJSA 4KQ4L 4PS7A 1PMYA 4FL4B 4OJDH 2DIBA 2CJTA 4U7KA 1R0AL 5ALBL 2XZCH 1CB4A 2VUYA 1YSOA 4R0LB 3QEGL 3P2BA 1ACCA 2CHXA 1C16A 4GIOA 4P23C 5IJVA 1RU9L 1KCVL 5HHME 3RL1B 1E2WA 1MEXL 5IB2A 3E8UH 4NO2A 1HYSD 4FNLL 4A39A 3BOVA 4OW6A 4GQRA 1WS8A 4TVUA 1NMBL 4Z8FL 3V7AG 2E7LA 4MCYA 4AENA 5HI3D 3G9VA 1XTMA 3MLUH 4IHOB 4MLIA 4NWUL 4EQ3A 4Q4EA 1LE9A 4MJJA 1UT1A 4MJ4A 5LDUA 1BJ1H 1FYTD 1OWWA 3H4FA 1AZUA 2R2HA 4N8CH 4PJ8B 2JI3A 4X8JB 1UM6H 4WEBL 3QT2A 3QNYB 4NQUA 4IDLA 4RLDA 3ZMRA 3DSNB 3I9IA 4Y1AA 5EF2A 4CBZA 5DHYB 4BFGA 5EUKB 4IMLA 2EE3A 1JZFA 2KMWA 4ZQKA 4GBXA 1YEFL 2XBTA 3LPOA 2NX5E 4N0CC 3K4AA 3MA9H 3Q2NA 1MCRA 4BSWA 1AGDA 5B1CA 2BRRH 3HUJB 5FCUH 4MMZB 1LMIA 3M7FB 2N7SA 2JMRA 5BQ7B 4N2HA 1J9SA 3O0RL 2WZ5A 2XHNA 3F83A 1TTAA 4G8IB 5JDJA 3K8MA 4IBWA 3DUUA 3WIHA 3WMSA 4KPHH 1LO0H 5AD0B 2P43B 4QRRE 4BELD 1LO4L 3E2HB 5BOZG 1DO5A 5KVFE 3OB8A 5HYFA 3M1BA 4N8VA 3LIZA 1LK3L 3G08A 4GI9A 5FM8A 3HHRB 4V33A 5H2BB 5I28A 3BCDA 3CH1B 1B2YA 4KNSA 5EIQA 3ZO0A 4F1SA 4UTAL 2HMID 5TE4H 1CMOA 1NAKH 4WWKC 4U1HA 1T89A 4UOZA 3FQRA 4IEFA 2BSRB 5IOPA 1G1KA 1ZIBA 2FT8A 4FI8A 3GNMH 2BH0A 1GC1C 4A1RA 3WV0A 4JFDA 1TJGH 2GBTA 2HP4A 3VFUA 2X7LA 3X12B 5AYUH 4KROB 4JANB 3TTYA 1JFQH 2R1YA 3DX0A 2OQJB 1F00I 4G42B 1ZK5A 4MYPA 3RY6A 4XMWA 3ES6A 4LU5H 4DP6X 3WIFB 4G5ZL 4UQ2A 2VR8A 4WIQA 4FXKB 5D72H 4OZHB 5T5NF 4F37F 4PMFA 4BRJA 5AZEL 1IBZA 1B2WH 3DX4A 3WN6A 1A6ZB 1J9TA 2AXGB 4FE9A 1QTSA 3T8VA 3QZWB 4U1SB 3IF1B 4UB0L 3D4YA 2QVIA 3U6RB 1IUZA 1NCOA 2XQYG 2P46B 4ZS7L 4GUOA 2VXQA 2D7MA 2Y1AA 2ZCKH 3EOTH 3VSTA 1RMFL 1XXFC 5FGCE 1RIHL 2C7UB 2V33A 3S5ZA 2WBWB 4WO4B 1YEDB 4F57L 3NVQA 1SN0A 4XR8C 3GHPA 4G82A 5EZOH 3MV01 2YMTA 5TTRA 4RWHA 4QXGH 4GO9A 5IIEA 1NH6A 1BMZA 1GSKA 4XH2B 3MV9D 3VMOA 3H9SD 3MRBA 4PG2C 4YVNA 3TO4A 1JPSH 1RZGB 4WNQA 3TU6A 1MREH 1IC5L 4ZDHB 4RFEB 5ANMB 2NY1C 2GI7A 4JFUA 4MXWH 1OP5H 3WKYA 2R29A 3D18B 5KSVA 1FZJB 4OQTH 4OCSH 1UWYA 2BMKA 2X89A 4JY4B 4DPBX 4N9OB 5SX5H 2XFXB 4LCWD 4J8RB 4YBHA 2PYED 4QCIB 4JFVA 2V37A 5FKPA 4YJZL 4PGJA 1HS6A 3U79A 3UTSD 3FUIA 4Y2DD 1HSBA 3ORJA 3FH7A 3RWCA 2EDLA 2NXYC 2VC2L 4WSJA 1NUGA 5A6IA 1EJOH 3GZKA 4AM0A 5JQ6H 3AABA 4PJ9A 2PKDA 1UZGA 1MW1A 4XMZA 4RWYH 2DAVA 4Y8AA 3OKKA 3SBWC 1ITCA 3O45B 5KWYC 1JZDC 1BBDH 1TYEB 1R5WA 5CJOH 4X5WB 4YHYC 1E6JH 3ARSA 4QR7A 4X42A 3RIKA 1XF2B 5C92A 4QOKB 3UTPD 3QO1B 2DL2A 4JHZA 1B9ZA 1U58A 2R59A 3PGDB 1N59A 3MBEB 4TNWK 5CKGA 5ACMA 1RXLA 3JTTA 2IANB 2MTPA 3P40A 1DANU 2XICA 4KXDA 1R6VA 3S3CB 4AG4L 4Z7OB 2GSGB 1SEBA 1DSFL 5I19L 3OMIB 2VIRB 3IFNH 3SCMD 3ULVD 2NY6B 3WKNA 5ALCL 4S1RL 3AMLA 5JW3L 4XNYL 4DF9A 4CU6A 1WH0A 4U6HA 2JNZA 1D5ZB 1Y0LB 2VUOA 4KFZC 3CZJA 3NJKA 3V8CA 5D7KD 3U7YL 5KVFH 3HCVB 3VU2A 5IFJB 3QIWD 3GIZH 4RFNB 2ZOKB 2IPKB 3U30C 1SOKA 1DQVA 5DD5H 5GSRB 1OE3A 4FTVE 1N12A 1NGXB 2FWUA 5FPIA 3SBPA 4YHNA 3L54A 3EOAA 4GMSH 4DT2A 4K7FB 3LN5A 4NCC1 3GBMH 5BVJA 4PYHA 3KPSD 2F1BA 3X11B 1IEHA 4FQHA 3UH8A 3BAXA 1UVQA 4F9LC 1CICA 4XB8A 2ZX7A 2B15A 5DJ2A 2G9HB 3K2UL 5EF3A 2EACA 2VDLH 3QJTB 5AOLA 5BZDB 1MWAL 2YIHA 5E08L 4N4YB 4JGUA 5B8CA 4W9ZA 4AQAA 3TVMA 3C5JA 1SXBA 1QASA 3ARBB 5CJ8A 5LN8A 1YY8B 4TV3A 4PTTA 4PY8I 5DHVA 3TZVB 1JWMB 3H9YA 5F9WC 2MNJB 3NIFF 4XI5C 5JHMA 1WISA 4NKMB 4W9FC 3UTZB 4N2FA 4HD9A 5T3ZD 1HKFA 2QMJA 5F6IC 1X5LA 4HCFA 5F9OL 1JPTH 1Y18A 1NPUA 1NBYB 2Q10A 3TA3D 2J6WA 3RY4A 1QWHA 1A1OB 1NL0L 1HJBC 2WSDA 3OLGA 1T6VN 3LZRA 3EF7A 3I3DA 3MCKB 3WN5B 4R0LA 2PTUA 1NBVH 5ACLA 3W5NA 2A83B 5I6PA 3RL1A 4CJ1A 2EDHA 5A6MA 1NKRA 2WCSA 5F3FA 3PJNA 3QQDB 4UAOC 2GIMA 2E8YA 3GUTB 3GKWH 4OB5H 4ODSL 4UYQA 1KF9B 2R0KH 4NS0A 3D07A 3ML9A 4BFRA 4FG6D 4IHOA 2X6BA 3ZKMD 2C1OB 4YLQT 2FIRT 4JHWH 1H3VA 4PJ8A 1GSMA 2HRHA 4X8JA 3WDHA 3CSYB 4DEWA 4Z7UE 3QNYA 2Y72A 3ZKND 3U1SH 3DSNA 1PZUB 3QUYD 1NGPH 4UOQA 5DHYA 5LBGA 1EZVY 2VDQB 5EUKA 1GOFA 4NNXB 5EO0B 3VQ2C 3CFCH 3BE1L 4KXBA 3WUWA 3ZHFA 3IGLA 1YECH 3V9EA 3HUJA 4I18C 4WV1B 2A77L 2PO6B 1ROCA 4MMZA 4TTDC 3NCJL 4B5ZA 3MOBH 1G1OA 3PPEA 5BQ7A 5IP4A 1RUAH 4G8IA 4R7VA 5AVSB 4CNIB 2OP4H 2D7TH 3HFMH 1J5OL 1MFEH 1MFBL 3WAKA 5C7XL 2YA1A 3K7UA 3KYKH 5AD0A 2DPKA 4HGWB 1D5MB 1RZJC 4CW1B 1OGAD 4JNXA 5EIIG 4LSSH 4J3OD 3HB3C 4QNPE 4UT9H 3CN4A 5CILH 1PD6A 1ZA3B 5GZNC 2J57A 3JWDL 3SODB 5H2BA 1WIPA 3CH1A 2F53D 4ZW7A 2FEDC 1BD2B 3ALPA 4UIKH 2Z91B 3U83A 1W9XA 1BV8A 4X7EC 4KH9A 1CE1H 2BSRA 4UQEA 4ZZKA 4HETA 1O6SB 1FYTE 3CBRA 3M07A 3V0VB 4BFBD 5IESL 3X12A 4JANA 2C7FA 4G42A 2OQJA 3VSQA 3BLKA 1QFUL 2B1OA 3KYNB 3MCG1 2Y7SA 3S36L 4XPHH 3MXWH 4AJYV 4LCYB 1EO8H 3LHPL 5HY9B 3WIFA 2CKBB 4FXKA 4W9CC 1BCIA 2VN5A 4OZHA 4D7BA 1W91A 4NJ9L 4XXWC 1OGTB 1KB5L 3Q9QA 3CZEA 1XWVA 1A6ZA 2AXGA 2LAGB 1FDLL 2EDQA 3QZWA 2VW7A 4U1SA 4YSPA 2XA8H 3IF1A 4ABUA 5LNEA 5DXWA 3IAQA 2VSCA 3U6RA 3K91A 3SDAD 2HLFD 5MENE 4K8RL 2WZ6A 2UV3A 1DFXA 1I7UB 5E6IC 2QSQA 4FFYA 2QKIC 2OL3B 2C7UA 1BIHA 3EF4A 2K6ZA 4E36A 1Q9WB 4UANA 1YEDA 3NEXA 4WO4A 4XMVA 3O2WH 4B27A 2BNRB 1H6EA 4GEJA 4ONGH 1QNZH 4OLVH 3ZN6A 4XNZC 5BVPH 4XH2A 1F4WL 3QUXD 4RBPK 3UPRA 3V5KB 2X40A 3FUHA 4X9YA 5HYJB 1GPOH 3ULUC 1AKJD 1RZGA 3MSPA 4EN3B 1S3RA 3PP3H 5D4JA 4ZDHA 4RFEA 5IV2B 1AVAA 3P3TA 5ANMA 1UD5A 2CJSA 3T3PF 3EJJX 4R4BB 1Z32X 2ED7A 2PMZA 2EH8H 3D18A 4NYLB 4RDQG 1FZJA 4QAMB 1FRGL 3BAIA 4JY4A 1KGJA 3GMOB 3MZGB 2XFGB 4PRNB 2XFXA 5EUOE 5LGJB 4J8RA 5EEUA 1BZ9B 1DQIA 4QCIA 3L2LA 2AJYH 3RZCC 4F58L 2WLIB 4P23B 4V2CB 3KZ8A 3NACH 4WVRA 3F58H 1SHMA 4OCYH 3LZFL 4TOYH 5B1BB 1FFOB 1H8LA 2YXMA 3OKYA 2IOOA 1X9LA 3VXUD 3ALXA 1BAFH 4MFHA 2AQ2A 3J7HA 4JG1H 4BCXA 3O45A 1NCAH 4X5WA 2A6DB 3EZ8A 4PS8A 1GGBL 1XF2A 4IDJL 2OW7A 4QOKA 5KYYA 3QO1A 4YWGH 1NKGA 4FEMA 2B77A 1L9RA 3PGDA 3MBEA 4NN5B 3TBSA 5LG1A 4KRNA 3G6DL 2IANA 4ODVL 4ZUWB 2GSGA 1MVYA 1TMCB 2VIRA 1VERA 7FABL 5E0QA 3N04A 3UPAA 1MQKH 3GSNL 1QATA 4FQXC 1Y0LA 1ZPUA 1JIBA 2XCMC 3HBGA 3Q48A 2BIPA 2ZPKL 3D2TA 1MPAL 2WVVB 3MV9E 4KJWC 3HCVA 1DJIA 5IFJA 1AO7D 3H9SE 3JWNG 4L5FL 5AUMB 4FOMA 3PAUA 2ZOKA 4OCRH 2IPKA 1A7NL 1K5NB 5GSRA 3X2QB 2QZQA 1VPOL 3BQVA 3L1EA 4V1DB 2NOYA 3CXHJ 1JD9A 4L8SB 4UQIM 5FEBA 4PJHB 5KJ4A 3S37X 3MLXL 4K7FA 2XA3A 4LSUL 5KUKA 4LCWE 4ZNEA 2PYEE 3QNZB 1NMCC 4LCIH 3X11A 1QSFB 3UTSE 5L2KB 3KW7A 1M3IA 1WZ1L 1HCZA 4NOBA 5AL8A 3LMJH 5K59F 4IIQB 1G9NC 2G9HA 1FG9C 4G6JH 4K9EH 5BZDA 3OXRA 4GAAA 4KGLA 2FHCA 4KX7A 4NQED 2Q7AA 5CJXC 2XZCL 1Z1WA 2ZWYA 4WWKB 1MFDH 1KY6A 3ARBA 4RDBA 3BYYA 3UOAB 3ARFC 1YY8A 4KWUA 4HOWA 2VDMB 5KJRH 1S7SB 1S6NA 2WB1A 1JWMA 3TZVA 3UTPE 3E8UL 3NRQA 3UBFA 2IG2H 4NKMA 1MRFH 1OTUC 2AK4D 3UTZA 3JT0A 2YA2A 2OK0H 3ROOB 3UEQA 5AENA 4BQCA 2HTLD 4JKNA 3HBPA 2VABB 3ULVE 2FQDA 1JNNH 2JCCB 3MLUL 1AS6A 4Z95H 1UKSA 1NBYA 3UZVB 2XWRA 3LZNA 1UM6L 1A1OA 2B14A 4UZSA 5D7KE 4KKLD 2OKMA 3BUPA 3MCKA 3WN5A 1EDQA 5GGSA 2YGOA 5D71H 4NWTH 4YSTA 2A83A 3EBHA 5F0MB 2JJTC 1X5KA 3MA9L 4R5VA 1J1PH 2JFCA 3QQDA 1PLBA 1PEWA 4PH8A 5JIPA 3GUTA 3S34H 1PZAA 4AGQA 1YEGH 2CD0A 1QLFB 2BRRL 2XIIA 4PV1C 5F2FA 3MBWB 5DZPA 3C6LC 5FCUL 5KZCD 2WBJB 3KPSE 2UXGA 4JO2H 1ZRUA 3MRKB 2C1OA 1H9VA 3GI8H 3IETB 2G4GA 1EBPA 4XO4A 1DBBH 3CSYA 2VMJA 2VZ3A 3DUHA 4MNQB 2ZUSA 1L7TL 2C9RA 1XBDA 4NO5B 4L4VB 4KPHL 1LO0L 4YZFF 2A99A 5DO2D 4X6EB 5AFAA 5JIDA 3VI3E 4NI6A 3ZHKA 4WHDA 4NNXA 5EO0A 4Y4FD 5A3IC 3AROA 2A9AA 4HSCX 3ZGIA 2HAZA 3IEAA 4C47A 3S8WA 2H1LM 1HXYB 3JWNC 3ARGC 4WV1A 5TQ0H 2PO6A 1UT9A 2QHRH 3IDGB 3RKDC 3BN3B 1JTOA 3R1GH 5HDLA 5T3ZE 5TE4L 1TO4A 2GTWB 3HVDA 1NAKL 4AY0A 1X4YA 3GJFB 4CNIA 4JMNA 1EZLA 2E7MA 2EZ0D 4LGSB 5SWZA 4JKKA 3GNML 4OKDA 2DQJH 1PY4A 3FF7A 5I1HH 5KG9B 1XF3B 4HGWA 4KVPA 1D5MA 4CW1A 3WTYA 5AYUL 4G9FB 1G7LB 1KCWA 4EI6B 1JFQL 5DTFB 1JZ8A 1E9QB 1GGTA 3ABLB 4X7DC 1LXMA 4YGAB 1G94A 4JB9H 1ZA3A 4QDGA