5AQ0A

The structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'SGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOXYPEPTIDASE D
molecule tags Hydrolase
source organism Homo sapiens
publication title The Structure of the Ttldomain of the Human Carboxypeptidase D
rcsb
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 5aq0A00
1H8LA 1NKGA 3HN5A 1QMUA 4YOKA 3E8VA 5AQ0A 3MN8A 3G3LA 5G5DB 2XHNA 4FXTA 5K39B 1UWYA 4IYKA 4U3SB 3NJVA 3KCPA 2NSMA 3NJXA 2B59B 4WI0B 4EIUA 4FL4C
chains in the Genus database with same CATH superfamily
3VFRB 2F7RA 1B9ZA 3MYJB 1KEGL 4DK3A 2H32B 3ZMNA 5DZOA 2XPGB 3QYNA 5J57B 2UUDK 2MRYA 1N4XH 4OFYA 1KN4L 5AD0B 4TLTA 5TQ0H 5GRYA 2IWGA 2WCPA 5IR1A 1OKEA 5D70L 3LH9A 3NJMA 5ISZA 2G75A 3H54A 3CDFA 2NXYD 4B9IA 1YPZF 3HR5B 3S3BB 4AENA 1T89A 4QGYA 5FECB 2X4SA 3JZ7A 4GY4A 1F6FB 3BZEB 4KZEH 3QJOA 1CLYH 1IFGA 3KH3A 4POUB 4BA0A 2UUDH 4YDJA 2DBJA 5T1DH 1JWMA 4TSBH 1GJWA 3S96B 4MYWB 3C6LC 4LBAA 2BOCB 4U1SA 1FBIH 4LO9A 4UDUA 5F9OL 4QHMA 1U8CB 1ZY9A 4LQFH 1UACL 5ERWB 3MLSH 1KELL 1SRDA 3D3VA 4GQZA 1VKXB 1NCIA 2BJMH 2XT1B 5CBEA 5BOJA 2V9UA 3AS1A 2OL3L 3EOBB 4MZIA 2A4ZA 1OTTC 4ZD3H 1JL8A 4Q8BA 2ZNXA 2LTQC 5F71A 4I77H 4UOZA 3GINA 3LZLA 4HEME 4TLUA 2IALA 3P0GB 5IOPB 3IJHA 1WK0A 1ROCA 3S4SB 5BZXA 2J8UB 3GSOB 1IL1B 2X40A 1KXHA 1MAJA 2EICA 1KV3A 1ZLWK 3DGDA 1DDTA 3GZOA 3S8GB 5I71C 4NQCE 3FN9A 3I6SA 3H9HB 1AY1H 4I5BB 5DTFB 5TK4A 3W82A 3RWCB 2O5XL 1CE6A 3KGRA 2W9LA 3PAYA 1J5OH 3UAEA 4KGLA 5IEKB 3C8KB 4PJGF 1D9KA 3PJLA 2WQAA 4HS8L 3T0EE 3ZSTA 1A22B 3ABLB 4GMSL 1LTXA 1EH9A 2X0UA 2ICWA 3X1BA 4QHLB 2ZXCA 5MEQB 3P4LA 4X4ZA 4X4KA 2VZVA 3FO1A 1JZHA 1N6VA 4DP1X 1ZLUH 2HZHA 4JO4H 1A02N 1LWRA 1RUPL 5F7WC 4D7BA 2VXQL 1WYJA 1ED3B 4DP5X 2Z64C 4YHOH 3UC2A 1RHHB 2H32H 3DYPA 4O02H 1UT9A 3C09B 4K8RC 4HK3J 1ZGLA 2C4FU 4PGDA 1Y6NR 1P6AB 1HL8A 1JDCA 2NZIA 3OB8A 3TEYA 2AAAA 4YHIB 5J12C 4HU2A 3SIKA 4X7FC 4Z7NF 3CE1A 2B0SL 2H3KA 5AW3B 1OHZA 3Q6FA 1EFQA 1NC2A 2R15A 4G1MA 2HLEB 5CU9A 5A2JH 1GPOL 4YH6A 4L8BA 3U1SL 2YXMA 2GT9B 5DA4A 1KLUA 1NM4A 3TIDB 4WRLA 4FXKA 1T5XA 4MNQA 4U1KB 4DEWA 3FFDB 1O7SA 5FB8A 1A9EA 3PP4L 5F9WB 5E8PA 2Z91A 5CJQL 2IADB 4AEHL 3S5LA 1SM3H 3V7AG 1T0MA 2JELL 3LPPA 3KM1A 1KLFB 4XMLL 1KPRA 3KPSB 3BC9A 5J06A 3B1TA 3RKPA 3OB0H 3CHXA 1MI5D 4GXUN 4YN3A 4Z78A 1WO2A 1JWSB 3HPJB 1E28B 2L7EA 1EDYA 1FFNB 1LD9B 1X9UA 2ZOLB 4LZKA 4X7TA 2HRPH 4HD9A 4JHWH 1RKRA 3QIBD 4TNEA 1FP5A 1SJVA 43CAA 1A7RH 1E5AA 1SZNA 4KTDH 5DMJB 2ICWI 4KC3B 2X70B 1IGIH 3WIIL 3PL6C 1T2QL 1T3FA 1NANI 1LO2L 4HK3N 4PY8J 5IM7A 1J8KA 3HS0C 1J1XL 2MNJB 3SGEH 2ITDB 4PB9H 3IFNL 1XGYL 3GJFK 4J4PD 5I8OH 2WQWA 4JR9H 4P2RB 2W81C 2A4EA 3T3MB 3UO1L 1Z9NA 4XPFH 5E8OB 4CN4A 4XMLH 2EH7H 1AD9B 4JY5H 1HNGA 5KVGL 3OXSA 1P4UA 4PJ7A 1QI5A 2PABA 2CGZA 3KR3H 2MQ3A 4HGWA 3GXTA 1TKWA 3VTTA 1TMQA 2LFEA 1IEBA 1YMHB 5LCVA 1FH5L 1MF2L 3HAEB 3L08A 2X0VA 4N6QA 2DI8A 1P7KB 3BO8A 4ODUB 3U1PA 3RGBA 2YPVL 3VJ6B 3OGCB 4XP5H 3V6FB 4LL1A 2Z7WA 5I16B 2KI6A 4QXTA 4RVBA 4XTRD 5T3ZH 5T3ZD 4ZT1A 3BAXA 1L3WA 3P3UA 4IIZA 5HGAA 1XGQB 2D4FA 3ULVF 3GUTB 1G0DA 3EZ8A 3GXFA 2X4OB 1OHQA 4U1JB 1X6LA 1X4YA 1XGYH 3HG3A 4GBXD 4GT0A 1KJ3L 4L4TB 4ZOBA 4K0OA 3FQTB 5E8NB 3FB5A 3GK8H 1OB1A 2L7UA 3BH8B 2BIPA 2DF3A 4KAQH 3GYRA 3WFEH 1ZT7A 1NTDA 2OZNA 2OMWA 3LH2H 3VXPA 2PO6A 5D1QA 1Y1DA 1OQOA 4KZ0A 2JKRM 1BPVA 4JO2L 4NO0B 4M9PA 4ZX3A 3WUWG 1ZOXA 3BPLC 3PHAA 3IKCB 4WUUA 2FJGA 1ZPUA 1CFQB 5DRXA 2X6AA 4JDZA 2IH3A 3QR0A 1EAPB 4A7GF 1P0SE 1E6OH 4V2BA 1AG6A 4YSUA 1WHOA 2HFEB 4PWIA 1EEQA 3DVFA 1AACA 1GW6A 4OZHE 4BSJA 3AUWB 5CGYC 4ECNA 3S88H 2KS0A 1LMKA 2VMCA 3TBCA 5J0BA 2Q3AA 4AVKA 4DZBB 3PWPA 1V27A 5EUOB 2DPKA 4BRVA 4HWNA 1KXQE 2V2WB 3L4YA 3RUGA 3ZT6A 3D5OF 1AQDA 3RWHB 3V6OE 4P2AA 1BQRA 1UH3A 4XCEA 3UTSA 4I1PA 1BX2B 4ZX4A 1QFUL 3QNXA 4DP9X 2E6JA 2ZX9A 4S0SD 1K8DB 3VSTA 4M61A 3NTCL 1N19A 4YE4L 5ID1A 4YHPA 1KEMH 1EDQA 1RZ7H 3E38A 2HAZA 2G5RA 4LSUL 4LEXL 4OGYH 3NAAL 2JCCA 5CZKA 3EDKA 4ODVH 5T1MA 3ARGD 2E27H 5FO8A 4UQ3A 3OKKA 4ZPTB 3S48A 1QI3A 2Q7AA 4GW1B 4QRRB 1JZ7A 3MLXH 2HLFC 1EHXA 3TVMD 4PRIE 3WJLC 4A2DA 4PVBA 4K8RH 4K8RD 3RDTB 4BFIB 3C6LD 3HG0A 5KVFE 1BZ9B 2OXHA 2OI9B 4L0PB 3VXMA 4CU7A 1MIEL 4X6DB 5A43C 2VABA 4XMTA 4UILL 4AK1A 3BPCB 1AO7E 3B9KC 1OAUL 3BUYB 5HHVL 3ML9A 1E50A 2OTUA 2WAHA 1ZLVH 5FUZH 1INQA 3UYRL 3CD4A 5T5FL 1BZEA 1MJUH 3WY2A 4AQAA 1A65A 3U48A 1IM9D 4H0LC 2XETA 4XMPH 3MLXL 1U8CA 2GY7B 5A2IH 1UZ8B 4B7LA 1LP9A 1X7QB 3GD1C 3O45A 2DWXA 2FLRT 1U9KA 2E3VA 4LVNC 3DDGA 3NCWA 1MAML 1UJ3B 1XB3A 4FCHA 5GGTA 4E42A 2D7OA 4FQXD 5CJXA 2AJUH 4UDTA 1USZA 3X13B 1BOGB 2C34A 4M7LT 4HUVB 4M5YH 4AMXA 3DXAB 3CK0L 3VWKD 1JV2B 1MIEH 5EU3B 3WNMA 1LO5A 4DWHA 4EDWL 2V37A 3EH2A 4CGUB 2DLFH 3ZDZF 2CHZA 2YRPA 1NLDL 3TA3A 5BV7H 4L48A 4GUPB 4RZCB 3V5DB 2EVGA 4FNSA 4TQ8A 2D2OA 4HJTA 2WO4A 3GRGA 3WN5C 4FAAB 3KXFB 4L1TA 5M95B 3IDJA 3FT1A 3P3SA 5T5FH 1ZXQA 3HNVL 3LOWA 2CBPA 1NGPH 2XXCB 4L0ZA 1OARL 5ABDE 4XRCA 1LWHA 3WFZA 2CLZB 4URTB 3Q5TA 4M48L 4LOVA 3SPVA 3WNJA 1FO0L 3MZTA 4BZYA 1HCVA 2OX5B 4J3OH 4J3OD 2Y07H 5C0RL 1HEZB 1MAMH 5LCVL 4OQTL 4EN2A 4MA1B 1OE1A 1K2DA 4OF8A 3BWAA 2ZAHA 1UYWH 3B3BA 1IGJA 3QI9A 4XVJH 1WBXB 4J8RB 2G5UA 2YS4A 3T6VA 2P5EB 2ZOKA 2PP8A 1VKXA 1BD2E 5SX5K 2R0WH 4HG4J 4OT1L 4JFVA 5L2KE 2VW7A 2YEZB 1B2WL 1KUMA 2DMBA 4FS0A 3LMJH 4P3CH 2P4AB 3LPWA 5CCKL 2LW3A 5KYYB 4AGOA 4JFYB 4NERA 4FRWA 4PJDA 1ZHNB 3SBWA 3VW3H 1OAKL 4ODWB 2VE6B 3AM8A 3CFJA 1BECA 4KK5D 2EO1A 2OCJA 2W88A 2Z31B 1TU2A 1MKFA 5FS5A 4CGTA 5JDJA 3SGJA 4WDIB 4NUGL 2A6JB 3U4KA 1T6VN 1U33A 1I7UA 4ICWA 2B4CL 4UYQA 1BWMA 2EVFA 2QSTA 4W9KC 4P4KA 3OC5A 1HXKA 2MIZA 2BP3A 1QVOA 2YA1A 1WC7A 5DVKA 4I7ZC 3QP3A 5C07B 5I1AA 1NICA 4R0LB 4L4VA 2BHFA 1VF5C 4ZPTA 3RKDC 5T3XE 2EINB 3QIWB 4LLQA 4X4MA 1WZAA 3D8MA 1XH1A 4LOFA 1I8KB 5DJ2B 4CBPA 1DBBH 2V2TB 2NXYB 4BWTA 4NFDA 1NFDE 3U6XA 5DHYA 2MNUA 2QTVA 4LKXA 5DK2B 4D2NA 1T2XA 3D3VE 4X6CB 3FNKA 1LDPH 4IBZA 4BZ1A 4HC1A 1LE5A 2R9HC 1B4TA 1Q9KA 5SWSA 3R1GL 1SQ2N 1HN1A 1QYGL 3QGVA 5JYMA 3P2DA 2SEBA 1QACA 3BFOA 1UKQA 4N0UB 2D7NA 1NH6A 1BQHA 4RSVA 4JFFA 5AOMA 5FO9B 2PW2A 2VDRB 4XPGH 3O4LE 1KBVA 1A7QL 3X12B 3TL5A 1IAIL 4KQ3H 4X0KA 2ADFH 4TOYH 3E8UH 4HWZB 4ZMAT 4XTRC 2R2BB 1U3HB 4TLSA 3L4TA 3D33A 5LBSA 4ATWA 4JPWL 4A7TA 2B2XH 2BSRA 3JV5A 2LHAA 5E6YA 1MLCA 4J28A 2KPNA 3I9GH 2BSCA 2CAKA 4JFQA 4Z0XA 4XNYL 4HPHA 5JIMA 5IVOA 4BIKA 3CZKA 1TQVA 1NGQH 1S78C 4IRSC 1PZDA 2OXGB 1XL6A 1D5ZB 5LAXB 2VLKB 2EYTB 1BD2D 3FB6A 5EORL 4JRYE 1T7XA 1MCKA 1KB5A 1NGXA 4LLDA 2W9EH 3O3EA 5D2NA 3BPOB 4FI6A 4K3GA 32C2A 1WF5A 4YQXL 4FFYL 1FIGH 1RMFH 1UFGA 4R26H 4UT7L 4QT5A 3VU1A 1A7PH 5I5JA 2K9UA 3X1EA 2AEOA 4DOHB 1C08A 2XG4A 3MLZH 1I31A 5E56A 1A4BA 2P5WE 4YNYA 1U8LA 4FI7A 3FAWA 1X5GA 1HNYA 4OLXL 1U8IA 4B0MM 1KELH 1FJ1A 1KNOB 1LQSR 3CXDH 3WXWH 3NZSA 2YLHA 3DGGA 4H44C 4ZMPA 1DZBA 1AP2B 3IPFA 4KJWD 1CGSL 5G4NA 2TAAA 5IJDC 3S4SG 3BFWA 2EJ1A 4JE0A 1LILA 2X4RA 4MRCA 4HZAA 1S7QA 1CE1H 2JKTM 2VDQB 2XN9E 4M43L 4B6ZA 2A2QT 1O5PA 3VRLF 1UWGL 2ARJQ 3EFDL 3V5KA 4MD0B 1XD1A 3DOSB 3HE6D 3OZ9L 4G43B 4X5XA 3T0ED 1AXTH 1XGRA 3VNYA 4ZO7A 1OB0A 1S6NA 2H45A 1OEZW 4HH8A 2CALA 4F2FA 4M1DH 1WZMA 4L4VB 1NEZB 4XHJD 5E8NA 1BM7A 4PEEA 4XNQA 3VM7A 1SXBA 4NQCD 5ID0A 1KBKA 1U8OA 1HKFA 1JPGB 4LMQI 4TKWA 5HGBB 1KYDA 3RURA 2XPZA 1PU0A 3GJFA 2WLIA 4OIAA 3I6LE 1GZHC 3MCKA 4XP1H 4UTAL 4BWWA 1CFNA 4FJZA 5E6ID 4RA3A 4MAUL 5TGBB 2ID5A 2H26A 5AVVB 3RHWK 1VA9A 3IETA 3I75A 3DKHA 3E3QC 2WUCL 4PREA 1AIFB 2KPWA 1T0NA 4DZ8A 3BUBA 2WXNA 3IJSB 4N2OA 1XDTT 2A74C 5HGAB 3HZVB 3SE9L 5KSVA 2XN0A 4P46A 2FYVA 3T4AA 5I5MA 2DD8L 2PW2B 1LEIB 1JHTA 2BP5M 4ZUVB 3QT2A 2VDOB 2PPCA 3O6KL 3RL1B 2GI0A 1G1YA 2X4PB 4K5PA 2EYRB 3L5XL 4KFZC 5LN4A 2OTUB 2NY1D 4JRFA 4FFVC 5KS9A 4G1EA 4XC1H 3F8UB 3MRMB 5ICUA 2NY6B 3K4ZA 5CUSH 2VLKE 5DEGB 4MA7L 1JUFA 1DJIA 5I1EH 3SCMD 3TF4A 3EO9H 5F9WC 5EF2A 3QVAA 1BIIA 2WQ8A 3TNMB 1SY6A 1E9OA 1DQLH 2BP0B 1C5DA 2AQRA 1MCRA 1PG7X 5ICXB 5L2KA 4NO3A 1NAMA 1FZKA 1A6PA 4O9HL 3WE6B 3O6FD 4DO6A 2HMIC 1JF6A 2G60H 1RJCA 3WBDA 5D72L 1YNLH 2EDJA 3SQBB 1D5BA 4YX2H 5GZOA 2UZXB 3GTNA 4IU2B 4OCYH 4ABQA 3TA3B 1UOKA 1PD6A 3LKOB 5AWNH 5HI4D 4KKNA 4W4OA 5LKNA 2WW8A 1CD9B 1PG7H 5FK9B 3PWVA 2BCKB 2E5EA 2IFGA 1WD9A 2AI0H 4JM2D 4NJ9H 2HJLB 2WZAA 1BLNB 5IKCA 2XZAH 3UZVA 4GEJA 4B53A 2Y6SD 3VFPA 4Y16A 5CZRA 3UJTL 4AC2A 4BSVA 1JGUH 2AJVL 4HBCL 2PWFA 2O72A 2L7QA 1SF3A 3IFNH 4JHBA 1OCZB 1EEZB 4GIPD 4JO1H 4YLBA 4QO1A 3PP3K 4F7TA 2AK4B 8FABB 4TSCH 3D09A 1MEXH 4L8SA 3QUZD 3L6FB 5FM4A 2YPLA 3ZO0A 4EN3A 3T3PF 4AYSA 4LSVL 3A3YB 2JLPA 2JQMA 4WGKA 5AWNL 2GSIB 4KDWA 4U4BA 3OWEA 2A0LD 4F92B 3GJEA 2HRGA 5D7JA 25C8L 3KPRA 2IBZX 3FF8A 4JJ5B 3M1CA 3MNWA 4R3SA 1DQVA 2B1OA 3UADA 3AREA 5C6PB 5E03A 1JI2A 4LCWE 3HE7D 4P05A 1VFUA 1CCZA 1ESOA 1KTCA 4LDOB 3UIYA 1ZA3A 3VSVA 1U8JB 3O8XC 1QFPA 5I8KH 1KCSH 4WHCA 4JFXB 5CEYB 5JOPE 2ZUQC 1IM3D 5FHAH 1CGWA 1LK3H 4S1QL 5ALBH 2BVQA 4DCQA 4ZAKC 1TJGL 2FHFA 1EXHA 5ICZA 4NO5A 1YQVH 2IO5A 3GXMA 3QB7C 4PB0L 5CJ8A 3L2MA 3QUKB 2DIEA 3RGVD 4DETA 2YMXH 2C9VA 5AOIA 3QJHB 3RHWF 5TGBA 1QSEA 3FTUA 2ZXWB 1JPTH 3DHUA 2H2SD 3MRHB 4XX1G 3P77B 5I0WA 4QRPB 3ARDB 1PSKL 3AJ7A 5IMKB 5KSAD 1M42A 1NQBA 2YGNA 3C6EA 4NQXB 3QBTB 3VG9C 1JFQL 2FYYA 3ZW3A 3QWRA 5EN2B 4ZFZA 2MOQA 3UABA 4HX1B 4PJ7F 4MCZB 2XQYA 4ZS7L 1LP9E 3I2CL 5F1NA 1L3NA 3VI4E 1RJLB 3H6AA 5I6MA 2F8XC 4BK5A 1KGXA 2CCVA 5CHNA 3K0YA 3T1FB 4OFIA 4G2AA 2ZCKH 3CFDA 4Z7IA 1JZ2A 3N3EA 4TULH 4JRYD 2RGSA 4MJIA 3MHZA 2QKIC 3TYFB 1T1XB 4OD2A 2HWZL 5CAYB 1B4LA 3TH4T 4KHTH 5HHOB 2F1EA 2BNRD 2RMNA 1HILA 2FNWA 3ATDA 1XHHA 3PF2A 4G7RB 3CZUB 2YARA 4XHQA 5EEVA 2W9DH 1O9WA 4K5OA 4ES8A 3BUIA 3HZYB 3N44F 4HXAL 1VRSA 3OTTA 4U3HA 1NBYB 2H0FA 3QEUB 1YEHL 4Z95H 4YVUA 1AGEA 3B8SA 3CU7A 3G6DL 5I8EB 2DTSA 2B9BA 2KLRA 2EDOA 4QHPA 1CWVA 1EA9C 5SWZA 1PFCA 2QDWA 3OJDB 4GO6B 1ZLSH 4Y4FC 4DAGH 3N50A 2DQFA 3F7VB 3BYTA 3UFIA 2J73A 4EZLA 3RVXC 3SE4C 3SQOL 3O2VH 5I73B 3IDMA 2FH8A 5BZWA 1X5IA 1IQWH 4JFWA 1FDLH 3DMMA 4GKOA 2K4WA 3AQXA 3NFPA 4OBRA 1EDHA 1Q9WA 4CADB 5EUOE 3V4VA 5DDHB 5FA4B 5LNEA 3AU0A 5HJBA 1XEDA 4ZW5A 1ZHKA 5I8CB 3UTSE 3ARXA 5HYIA 4FA7B 5BNXD 1GGCH 2G3MA 5EUOA 5FCUL 5KANI 4U31A 1OOWA 2RH0A 2X7LB 5L88H 1IM3B 3QZLA 2YD7A 1UXMA 3DX7A 2W07A 2YMTA 1BW8A 2YPLB 3MDJA 1HSBB 2XXGA 1C08B 1HAUA 2DLHA 3O2WL 4HSAC 4FLHA 2Z65C 3WIFB 1P84J 3MJ7A 4JFSA 2VJXA 5KWYC 3O6FC 4MMXC 3K2UL 1C16A 1C5CL 4QNPF 5D1XB 2XA8L 1S9XA 4M5ZL 4BH8B 3SBRA 5D93B 4BH7B 5TDNA 3PAVA 2XUWA 3DX6A 5C7XL 5KYUA 2OP4H 3EJUA 5GRUH 4APQA 4GH7B 3TA3D 4UTBA 2Z35A 2GPZA 4ZMOA 3HZ3A 4N5ED 2OYPA 2R29A 4JLRB 3SKNB 4EI6B 4JN2B 3U6XS 2FGWL 4XCCH 1OAYH 1XR9B 3N0AA 3NK3A 3QUXA 4NZRH 5CEYA 3MLRL 4KY1L 3REWB 4FADA 1NCBH 4FG0A 5EIIG 3TX4A 3PDGA 1FZJA 2UXFA 3MRJB 1D9KD 4LLAA 4PS4H 4PHZA 3MRCB 4CJ1A 5EZIH 4UZGA 3GI8L 3TEWA 3C09C 4N9OB 3Q2CA 4C56A 1N0XH 4G6KH 5AOZA 1IFRA 1DVFD 4LVHB 3K6IA 4RMUA 3PGDB 2FQFA 3ARFA 2N7SA 2IPTH 1AFVH 4LDCA 2D31B 4ALAH 2WMPA 7CGTA 1OP9A 4OLWH 3VFNA 3C12A 4RRPA 1DUYB 2A74B 2ZWYA 3IM1A 3MJ8A 4AQAB 1GOGA 5IBLD 1KTDB 4WV1A 2M2DA 3NJHA 1K8IA 3PHQA 1JZGA 2PR9A 4Z0XB 1XEUA 4P2OB 3CZGA 2GTWA 4UNIA 1NCBL 1NBVH 1IL1A 4JL1A 5F7DB 4LHJB 5DJCA 2NX5A 4WU5B 2VXVL 5E9AA 5HHME 3RI5K 5JO5A 1T0NB 4PJCE 3WUWB 4ABUA 2DKSA 2VUKA 5D2NC 3S97C 1XCXA 2HT2D 2OQJA 3PRZA 5C8JB 2ESVB 2LVCA 4Y1AE 3W5NA 1TSRA 2YRLA 3F7YB 1GGTA 3MAWA 4JKMA 5HGDB 3GSRB 3IBOA 2PLTA 3VRIA 4A7VA 4Z3TA 1NCHA 5A2LH 4M1DL 2V3DA 1AO7B 2VRAA 3B83A 3RX7A 5IFHH 3D85B 5JIDA 2QGEA 4R0LC 4XXWA 4QRUA 1R17A 2LR4A 3EGSB 2FEDC 4L4VD 3ARYA 2DOCA 5L8JB 3VU2A 1XF3B 3ZDYF 1GJIA 3FN3A 5CBEB 3NDYE 4UF7C 1AGEB 5E23A 3EXLA 2VYRE 3NFSH 3IFPB 2BJML 5KG9B 1ZGLM 4DFHA 2WLZA 1E9OB 2B1AL 5I30H 3NCXA 4UM8A 3K4DA 3U30B 1A6TA 2X6BA 5I6LA 4QHNB 2GEQA 2FJUB 5HYQB 2FIRT 4ZX5A 3WN6A 1ZGLP 2YPLE 5FYKU 5AG8A 2A3TA 3UZEC 2P28B 2CUHA 1Q9OA 1V8HA 1AYOA 1ACCA 3B9EA 2ZICA 1PAMA 4WWOA 4EKJA 3KZ8A 4CAGA 5KYXB 3EJCA 5A2FA 3PXLA 4LSPH 2D3JA 1V3LA 3TCLB 5KSVB 1S7UB 4AMKL 5J7CC 4Q4EA 4UOJA 2A6DB 1OCCB 3BMWA 5HHOD 5KTEH 1CTOA 5I0YA 1RY7B 5C0GA 4U1KA 3QDJE 5FB8B 1EX0A 4AH2A 1HFUA 4BZ2A 2Z91B 4LHUA 1EEZA 5HVFB 3H8NA 4PRID 4N2CA 1HL4A 4ENZA 4QRTA 4FHKA 1GH7A 3MOQA 3OWRA 1RUAL 3FO1B 5EDSA 1MH5A 4Y9EA 4AGLA 3U2SB 4KXBA 4WJKB 1JYVA 1DQQA 3AAZA 2ITCB 2R0ZH 3AMLA 4KMTL 5JXEC 1PIFA 2P8PB 1WP6A 1RUPH 1WFUA 3KGTA 1NGQL 4GS7B 2R56L 2YD2A 4PGDB 1JNLH 3ZVVA 3SDAD 5GGQH 1TYEB 2W1NA 4OZHF 5D1XC 2AAVA 2P8MA 3LRSB 1E4XL 3V4PH 1NC4A 3ZE0B 1D7CA 1GXEA 1PZ5B 2CDEB 2WXHA 4Q9RL 2E9WA 5B1BB 5I75C 1L0PA 5CLXA 5E6IC 4AIOA 3PGDA 3ROOA 2BNQA 3OR6B 3I74A 4JZJA 2IAND 1OALA 3D2UB 4EJ1C 1RJYA 1RIHH 1T2JA 2J4WL 2XQBH 3I02A 4LKCA 4AYDC 3WJMA 1AD0B 3IE4A 3KJ4B 3GO1H 5DMIL 1CDGA 5EH1A 5JYLA 4O4YL 3M8OL 1VESA 5EO9B 5CJQH 5C09D 4HWBL 1BMZA 1IBDA 2EDLA 3VI3E 1DQJB 2W59A 2ZWNA 4G59C 3UAAA 1JNNL 4HT1H 4YDKL 2JF1A 4FEIA 4FLSA 2EE2A 4AV4A 1V55B 2IMNA 2VZTA 3RKDD 2J6EA 4J3TA 3V4PL 4XPGL 2EQDA 3EG9B 1DVSA 1ACYL 3MRIB 3NABL 4HIJA 4N8CL 4R7DB 2OSXA 1B4RA 4Y4HC 3H0TB 4TOYL 5DO2C 4L9LB 1CGYA 3K8KA 1H5BA 1BFTA 3HE6A 4KKPA 4PJ6A 3ZL1A 4ELDA 3T0EA 2YA2A 3D39E 1TOXA 1OY3B 1XZ0B 4JZOA 5DO8A 3MSPA 3MV8D 4OLVH 4H8PA 1YEJL 4K94H 1NBZB 3B7RL 3MRKA 5HVGB 2M26A 4NZTH 5GRXG 2OZ4L 3LNHA 2LABA 5AZEL 2OMUA 2XIIA 2Y7MA 3G5ZB 3O6FB 4N2LA 1ZE3C 2JQAA 4PCSA 4XPAL 4JR9L 1ZPLA 4PRBA 2GAZA 3NH7H 2NNXA 4Y2DC 2IH3B 4OCWH 5MHSE 1A5FL 1IAII 4M00A 5EPMB 3UC0H 1SYVB 3DUUB 3MKKA 4GXVH 1KCUL 3LNFA 1IC7H 3P0YH 1SDYA 4N25A 2R0LH 1BQSA 2R7EB 4ZFOL 1ASQA 3QIUC 1KCRL 4NZFA 4ZYKA 3HNTL 1Y6MR 1S9VA 3D25B 4BFJA 4WW1B 2IFFL 1QR1B 4OJYA 5IBTH 1WFMA 5I73C 1KCKA 2Z6FA 2FRGP 4DKFL 2A6DA 3WXWL 3L3KB 4DJMA 3FU8A 2VDNB 1G9ML 1R0AH 3P54A 5C97A 3QUZB 4UDUB 3VM5A 3BQVA 4TQEL 4MCYB 2IOMA 2N0KA 4NJAL 2UWEB 4PJAF 3QHZL 5MENA 3QNYA 4KAQL 1U8KB 5DEZA 2BPBA 1T1ZB 2YPVA 4DEUA 3F84A 1D3CA 3QR2A 1R9FA 4F8TA 4JMXA 1RFDL 5HYEA 3EO9L 3S5ZA 4TVUA 2UY7A 1LEGB 3GS7A 3MNDA 1IU1A 1RZFL 2R0LL 1QR4A 3EDJA 4ZPVB 1UWGH 4HCRA 4HH9A 4OGAC 4WKZB 1JPGA 3VDBA 2HFEA 2PXYA 5C0EA 2B1HH 5FXCH 2B08A 2FATL 3KPMA 3QFGA 3IPBA 4JFDA 4DKFH 3U6RB 5K5YA 4L05A 2XTSA 2GIMA 1FG9C 5D7LA 1DBKL 4Z7VF 3UTTB 1FFTB 3SEPA 2MTAA 2LFGA 1IAMA 1YNTA 2C3HA 4NNXB 4D9QE 3QUXB 2RTTA 4XR8C 1S3KH 4Z8FL 2WNWA 2F5AL 3DI2B 2N7AA 3F7KA 2GSMB 4YOKA 3GHEH 1RCYA 1MIMH 1M9WA 3R0NA 3SGDH 5B3JE 1SDDA 4L9DA 1J0KA 4OGQC 4UUJA 3OLGA 2JI1A 1UZ8A 2AJVH 3HJEA 4HBCH 3E80A 2CNYA 3HS8A 4E42B 2E7LA 4GUOA 1EHNA 4HGKC 1JZJA 4PJ5B 3ZE2B 1JNJA 4FCAA 4EN3D 3H53A 3L48A 5I1HH 4PTTB 2XICA 2G30A 3ZK0A 5EU3A 5DS2A 3L5JA 1VEPA 1I9JH 1NFDA 4HWEL 3MV9B 3IFOA 2DMHA 2HPTA 1VGKA 4F15C 4U6TA 3VI3A 4IGBB 4OV6F 2B39A 1ZLDA 5FV2A 2J1WA 4FQHB 5INCA 3KBEA 3DV6B 4X6DA 2IDQA 2F74B 3ARED 4MB5A 1UA3A 4IRSB 4OZIF 4LCVA 5EZOH 4KMQA 5DJCB 3UGEA 1GL4B 2FNBA 4AEIH 3VXMD 2VXUL 2H8PA 3IB4A 5EC1B 1TZ8A 2GJPA 5DZLA 3EYQD 4JN1H 3UG5A 1JVKA 3G5ZA 4OH2A 2NY6C 1NFIB 3GSNH 4UOW0 1PKQE 2PO6C 2X7LA 4O02L 4MAYC 1N64L 3SDDC 4ZSOA 1JXDA 2CD0A 3TONA 3U9UB 2V5RA 4MDIA 1BZ7A 2ZYRA 2AXFA 4B9GA 4FXKB 5E9DD 2ZX7A 5TDPA 4OFPA 1IM9A 5DD1L 1BOGA 1SFDA 4EDXB 1HHGA 5BVJA 2WLHA 1F3DH 5TDNB 3V0IA 5D6CB 1CICD 2APXA 3KPNB 2VW4A 3DC0A 4M5YL 1CBVL 3STLA 4Y4HD 3V4VL 1WIOA 3P1VA 1AZNA 1JE6A 3IE9A 4PWEA 4U6XA 4Y9FA 5JR1H 4HEPG 1OV8A 2EEXA 4N85A 3BSHA 3DLQR 1QZ1A 3BLPX 1XIWB 4G8EA 5C07E 4RIRB 3GIZL 1KFGA 3G08B 3GSXA 3MLUL 5IZ7A 2A9BA 4PJAA 2BINA 4P3WA 2J1ZA 2FO1A 1JGIA 2EDQA 2YRZA 2QADC 4YZFE 2G2PA 1BQHG 2V5SA 4YK4B 3BSZL 4XN5A 4A67A 5IJKC 4ZNEA 5T5FA 2IDUA 3O3UN 1EFXB 2FUTA 1A66A 3IDXL 5JXED 1P5UB 3WSQH 3FL7A 1XCWA 3QIWC 5CFAA 1N7MH 5I75B 2BNRA 1FVEB 3L1EA 4OF6A 2AQNA 4PJDE 4Z9KB 1B4JL 5C0FA 4YSOA 3LRGA 4AIXA 3QEGH 4I85A 1I7RB 1M1XB 2ADGB 2ODIA 5EO1A 2CMRL 2P5EE 1QD0A 1WFOA 4NYLB 3G6DH 3IFPA 1AHWA 5KG9A 3VTAA 1FNFA 4LFHG 5GZNA 3IJEA 1BD2A 4X6CA 4RWYH 1HT6A 3AAZB 2RBLA 3RVVD 2VLJB 1TTRA 4S1QH 3WTWA 5B4MC 4CILA 3BWUF 4DVRL 3MUHL 2QHLA 1W91A 3GNMH 4PMEA 2VZSA 4MA8H 3EDEA 2XWTA 1LM8V 2XYCA 4BHUI 4ENED 1QA9A 1FDLL 1AOZA 4XOEA 1PLBA 5DJYB 3BH8A 3H3BC 4YBQD 1PY4A 1OP3K 4PJBE 4FNLL 4ZUTB 1OB1B 3MRPB 4MRBA 2WM0A 4DVBA 1QFHA 3D9AL 5JQ6H 3GEFA 5JW3H 4X4XA 5D1QC 1T0OA 4WFGD 2RA1A 4YXLH 4P2OD 3UBXB 3VI3F 5L7XH 1RIVH 1W8NA 4YPJA 4R7NA 2YBRA 3LZQA 1NL0H 1AS8A 5IMLB 3L9YA 4JDZB 4RWYL 3MLTA 4LCWD 1INDL 1CFQA 2ROYA 2JB5H 3B2XA 3AU1B 4QYAA 4QRTB 1RUKL 4TTGA 3ZTEA 4HJGA 4PJXA 4GBXC 4TYUA 2CO3A 2J1YA 1A1NA 3GGWB 4CRPA 1AQHA 4O5LH 2XX1A 1ZVNA 2DEWX 2GBVA 1UVQA 1WEJH 5BZDA 4OZFB 2G2NA 3EG9A 4R7DA 2CR3A 1QKZH 4NENB 3ARTA 2DB8A 1V54B 3BEVB 1NCAH 2B14A 2N1TE 2I69A 2JKSA 1XF5B 2F1BA 3CN1A 4IU3A 4OD1H 2HN7A 3B2VH 3U9UA 1YY9D 4PTUB 5SX4I 2HKAA 1UJ3C 1T04A 1KXQA 1P53A 3LZPA 3V4UH 4N0YL 2HKHL 3EIFA 5J8OA 1DVFA 3F05A 3Q1EA 4JPKH 4W81A 3DO4A 2CJUH 1D2OA 3ZSSA 2HPOA 4FNUA 1KLGB 4PJFA 5B7MA 1IT9L 2BIMA 2A6IA 3T3PB 4OV5A 1WFJA 5GGVY 3MNZB 2CLVB 1IQWL 3K6OA 5JIQA 3MJ9A 4NN6B 3LEYL 4FNPA 1BAFL 4I0PC 5EUOF 2YN5A 3BDYH 2CJSA 4CN6A 2FX7H 4GW1A 3PWNA 1N10A 1C5BL 4YDIL 4PV1C 5E95B 3TT3L 2DM7A 2Y2YA 4ONHA 5KN5A 2X3AA 3CFKB 2WO3B 4N87A 1BEXA 4YDLC 5C0IA 1DQJA 4P46D 4LRNH 1SN5A 4KTYA 3VAEA 3BH9A 1IILE 3L81A 4JUTA 3QULA 3BAIA 4P07A 1EHLL 3U82B 1SQMA 1BREA 1T4KB 1ILUA 5DJZA 1A1MA 2VIRA 1CF8L 3KNBA 1MFEH 3QDGA 4WFHD 3FTSA 1URLA 3NSYA 2CH8A 4XWGH 2WVVA 3D0VB 3D30A 2AV7B 3HFFA 3X1NA 5B38A 5AALA 1IEAA 2BNQB 4MS8D 5FKPA 1RIUL 3ZTDC 1T83A 4JZJB 2VQTA 3NIFE 4AUUA 1HL9A 2NXZB 5F7KC 1NWOA 4H26A 5T1LB 3LRLA 3LN5A 2AQPA 2IQ9H 2HVJB 5JORA 2FX7L 5J11B 2IAMA 5CMAA 2ZUSA 4CC4A 2I60L 1UM4L 3O6FA 5AYQA 3RL2A 3G9AB 3S8FB 1OM9A 4NZRL 1ZAGA 3CZLA 3EGXA 3DTXA 3S7GA 4PI0A 1YSOA 3E6FB 4WNSA 5K9JL 4EXPX 5HI4C 1PLCA 3BUTA 3FCTA 2ZOKB 5TH2A 1O0VA 2ILLA 3QORA 2FIKB 4RGOH 3QJTB 4QWWC 3DGCR 5C0CB 1M6OB 4PSPA 1X9LA 1YJDC 4JM2A 1VLXA 3CXHK 2X6MA 3VE0B 1VFOA 3H0TA 3HG1E 4PGCB 2CO6B 4HZLA 4XWGL 3S6CA 4UZSA 3DOSA 5D1ZA 4XO3A 5KBPA 1CGTA 1P7KA 2DBLH 5DJ8A 4WK2B 1KGCE 4IDJH 4BBWA 1YY8B 2ZSWB 3QEHB 5KS9B 1A9VA 5FKAA 3TTSA 3T09A 3TPUB 1O6TA 4AMKH 1SYSA 5BV7L 2O4EA 3FB8A 4D0CB 3LVEA 4NQCB 1BMGA 4R7NB 5FM5O 3QUZA 4NDMB 1G7HB 3PWJB 2X4OA 2N3JA 4MD4A 2OTPA 1FNSL 1OT1A 2VLMD 5EO0B 1Z6JT 2P80D 2B15A 3D85A 4OZFG 3DX9B 1OZTG 1RQ5A 4PRHA 3QRFM 4AXWB 2I7SA 3BCFA 4L0YA 1JWUA 3CXHJ 3M86A 2YK1H 3U9PL 5F7EH 2XV2A 3KPRD 1JZDC 1HC1A 4KO9A 2DRUA 1ES0A 3SQRA 2YEZA 1E7UA 5DJ2A 1UXWB 3BAJA 3RVUC 4MBOA 4ANUA 3SDAA 3EJZC 4JRXB 3B9DA 2R4RH 2WUCH 3U6RA 4D3CH 1KMGA 1VFBA 2B59B 3WIHL 4C8XA 3WFHB 5BW7A 3RU8L 5DSCA 1FFOA 1E4XH 1SOKA 2YJQA 1M05A 1S7SA 5E2UH 2AGJL 4NM8H 1FRGH 1QRNB 3S9DB 2B1AH 1I7UB 3IKKA 4NQVA 4DN4L 2LU5A 1UGNA 1MLBB 4GKSB 3MX0B 2WYZA 2YFOA 3BLKA 3GMPB 4WO0A 5J56B 4N1CA 3GMQA 3WO4B 4ZMWA 1QQDB 4U1LA 1EVTC 4BFBD 4DH2A 5DGQA 5F8RC 5IP4A 2A9DA 1TJHL 4WHDA 4P9HL 5DT1H 2OJEA 1TENA 5C0GB 4PCTA 1J5HA 2R0KH 1AGBB 3MV9D 1MELA 3KLHC 3Q2WA 5JA9A 2IGTA 5I1LB 4AOFA 3SQBA 3EF4A 4QOKA 4PGEB 4AW7A 1B88A 4YEFA 3TBVB 3UZEA 2D7TL 2ADJA 2WB7A 1JRHI 2QQNL 3FXIC 4FQJL 3PIQB 5DHVH 4CMMB 1BLIA 5E5MA 5KSAB 4XB8A 4R6UA 2ZCHL 1YEGH 2VOTA 1KN2L 3IDYC 3FONA 4MJID 4U1MB 1QEWA 5I0DA 4KI5D 1MFNA 5D4IA 5DMGD 4PY7B 3JQOB 3DSNB 2OXHB 4GAJL 4PP2A 4AV5A 1F3JB 2GI7A 2EVIA 1QUNA 3K6NA 3QCTL 1ZV2A 5C70A 1SBSL 3HG2A 4P9HH 5DT1L 1EFXD 1L9PA 1CK0L 1HXMB 5CCHE 1ZDSA 1QSFE 1WAAA 2BVUA 1LE9A 1K3IA 5EWIL 1NEUA 1A6AA 2ATKB 4OW6A 4JO1L 1DUZA 1IUZA 3P4MB 1EGJH 4N2EA 2UX7A 3NH7L 4TUUA 4WIQA 3LN9A 1WUNT 2CUIA 2JKLA 5GHWH 2C7UA 2HCZX 3B7SA 2WVTA 4LSVH 4Y2DD 1T1YA 4YS4A 3FU0A 3LQAC 4S2SA 3B3IA 4Y7OC 1U95A 1CICB 3FTWA 4K5MA 3LSOB 1U8HA 1F4XL 4OKDA 5T1KD 4DO4A 3QQ9C 5H2BA 1IGYA 2VLKA 1VFAA 3DA0A 4IK6A 2HVKB 2GABA 5E2TL 1FV1A 3X3FL 1CO1A 1SVBA 2R2HB 1RK1A 1VCAA 1LYQA 4BE5A 3RA7H 1J9RA 2GTQA 4Z7WA 3U83A 4Z7QB 5JPMC 4IKNA 1NINA 1M4KA 5EWIH 1MOEA 2X5PA 2VLRB 2Y7NA 3ABGA 5EC2B 1IX2A 1UH4A 3BZ4A 3MRGB 3M1BB 4ANXA 1HCYA 2UVEA 3NPSB 3KW7A 2WN3A 1XZ0A 3OAYK 4JZOB 4GP4B 4DTGH 4OUOA 3SYPA 4PWKA 4M8QB 5HYSB 4OFQA 1AI1H 3L54A 2F53D 5HP5A 4Y0GA 1BPLB 1ZCRA 4LASH 5IQNA 1J05B 4APQD 2VJ0A 1DBAL 1RPKA 4AGQA 3LEVH 1OCWH 1WZKA 3H7LA 2DDQL 5E4EB 1N8ZA 2R29H 5EZJA 5A2AA 3W1ZA 1JN6A 3GJFB 4ZFGH 3V0GA 3VYNA 3LXCA 1ZSDA 2EDDA 2XXMB 5EU6B 5D7LD 3RIAF 2CKBA 5IJCC 1BA9A 3LJ3A 5AYUL 3MV9E 1XSOA 1QWNA 3FQWA 2I07B 1J9SA 5I8CA 2JI3A 5EB9A 4L37B 3F62A 2YD3A 4NC1E 3GMPA 4BQ9A 1J9CT 4XXDB 4BGLA 5FX3A 3H9SA 1IQDA 5B1JC 3CFJB 1LEKA 2CBQA 4LASL 4GW4B 2FEJA 4OVVA 1D9KB 5FIEA 3V95A 1F3DJ 2QFPA 4WTZA 1Z7JA 2L4OA 4KHXH 5BMFL 1RURH 3EYSL 1U8KA 3GF8A 1EMTH 43C9B 2O5ZL 4JJOA 4NIYE 3WIHA 4AVIA 4Z76A 3L7EB 1CT8A 1QLRB 5L4JA 3ULUL 1ZTXE 4KU1A 3RY6A 2EIDA 1I1FB 3BI9X 2JVUA 3QWQB 5D7JC 5E5UB 1QSFB 5FM8A 2HT2C 4IBSA 4QRRE 1OOAA 1MCLA 3OZKA 1TITA 2WXIA 4G7QB 3C5SB 2K45A 4LT7A 2MPVA 2XRAH 4NGHL 1Y6KR 4XP1L 2CHDA 5MENE 4DPAX 3VGFA 5AEAA 1LEIA 1WAAF 4LNRA 4GIAA 3PS6A 1SEBA 3M17A 4Z7VA 3CVHH 1S7TA 3NCYP 4GI9A 4Q6KA 4CSPA 3LNGA 1GGCL 3S3DB 4M8VA 4AE0A 1NIDA 2FL5B 4YGVB 4PLKD 3SBQA 2ISDA 3NJJA 4Z77B 5E8PB 3RILA 2QQKL 3DSFH 5DFVC 2P5ED 1MPAH 3T0BA 2C9RA 2F53B 3KPQB 3Q01A 3IDIA 1J1OH 3LSOA 2MKLC 1SGKA 2IPKA 3IGAA 4GFXA 4M5ZH 3FW6A 2IVFC 4OFDA 3QAZB 2ZOLA 2VR4A 5LWYH 1BGXH 4QXWA 2V7NA 5F6HJ 3ET9F 4HIEB 3KPPA 5D4QA 2QBWA 4EVNB 1U2CA 4J7RA 2MSPA 2N01B 2C9QA 1CZ8L 5FOBA 5JIIA 1FL5A 2NYZA 2VLRA 3KXFE 3MRJA 4R4BA 5L2JA 2DMKA 3N42F 2WINB 4H40A 3MUZ1 1WAEA 3OG4B 2HN7B 4I13B 4NB7A 1YY8A 1CDBA 1A9EB 4X6DF 3BP5B 4QMEA 1CLZL 4OZIA 2KQNA 2NNRA 3D39A 4JRYB 4NLHA 2X3BA 4KOCA 4D9RE 4NRYB 1J05A 2LAGB 1PG7L 5HY9A 5F9JA 4D9LL 3Q1SL 2H0EA 3IMBA 3ABKB 3DJRA 4HLZH 4TTDC 5G55A 2A6IB 1JYXA 4U1GB 1S9WB 3C5JB 3HC2A 1U6AH 2AERT 2C1OA 5EBMB 3W3BA 1FHNA 1EHKB 4EDWH 3M6DA 3C8HA 1GZQA 1JF5A 2AXFB 2XV0A 1OE2A 3BZFB 1R3HB 1X5HA 4J39A 1J11A 4MMZC 4IRZH 4CDHA 5DR5L 3H9YA 5HI3C 3RVTD 5EBLA 3K8MA 1WDAA 3JTTB 3Q44A 2CKBL 1G1OA 4MQSB 1YEKL 1Z9PA 4BK8A 2IBZY 3ZTNH 2L3BA 3QHFH 1PTZA 1CQYA 4HMDA 1G9MC 4HIPA 4C59B 1BAWA 2G0KA 5IK3B 4F8LA 3HLAB 4OM0H 3O4LA 3QJFB 4WK0B 3R7QA 5JZ7C 2Z7ZA 2XY1A 2AV7A 5J3HC 3U4BH 3IU3B 4OF3A 3QXUA 1TQWA 4WGVB 5F9OH 3WTVA 1OIOA 4HIIA 4P5TC 1UA7A 5ENWA 2Q86A 4RQQB 3BPNC 3V2AR 5C09A 3EJJX 1QNZL 1EO7A 3ARGB 3SGKA 1UASA 1TIUA 4LAQL 4U2ZA 3WFCL 1DQQB 1U0QA 2V17H 2VDPH 1HILB 1LK3L 1NGWA 1NMCB 2WWOA 4MJ5A 2HRHA 4NQDB 4TQPA 3RWGB 3QQDB 3ZE1E 2O5YH 5EO1B 4LP4A 1RUML 5I15H 1JGLL 2UXTA 3CFNA 5DQ9A 3ATBA 2ZG3A 2KDYA 2JKXA 3KDMA 1XTMA 5ITFB 2DIAA 3DHPA 3QS2A 3IWVA 4PJ9A 2ADJB 4LRIA 5E6IB 4LP8A 1I9IL 3NMEA 1KBPA 3VXPB 4MHHI 1BYPA 5GGUA 2FD6L 3BXNA 2DQFB 3SODB 1R34A 4GUQA 1IZKA 2ED8A 1CGVA 1A3LL 1CYWA 3A5VA 2JV6A 1OCRB 4Y5YC 5DC9B 3GZKA 1OTTD 3MROB 4DPBX 1H8OA 4NXSA 1GYVA 2OR8A 4M61B 4N0YH 4DQOL 4K9EL 1J10A 5I28A 1RZPA 5KTEL 4IMKA 1AQ8A 2HSIA 3ARFC 5DQDH 5HHOA 1AR1D 4AGPA 2HT4D 4F7KA 1DQDH 4XP9H 2CU9A 5CSGA 2BZ7A 4KXZI 5IHZB 2O6FA 1CU4H 1S4IA 3WFBL 4PRIA 1RUQL 5SWZB 2WBKA 4KJYA 3N40F 2RQEA 2HWZH 1XBDA 2W80C 3CC5A 4JDTL 3RDTA 4BFIA 3VD9A 4I48B 4PV9A 4A2GA 1N5YL 4Y7MA 5SV3A 4FFTA 3PJSA 5I0XA 3EBIA 3E8VA 4X80H 1FPTL 3SE4A 3QI9C 3KPSA 1PD1A 1QYGH 1TQBC 3QDGD 3TXAA 4PG9B 4NKIL 3AXHA 2HLAA 3BUYA 5BRZB 2P7TA 1M2VB 3KM2A 2HFGL 1INDH 2E6QA 4NRZA 1J12A 1E6JL 3VXUA 4G6JH 1RUKH 4GAFB 5K9QI 1HH9A 3VWJB 3E8UL 4HDIA 2W0LA 1HZHH 2GT9A 3RLSA 4LOUD 3D2UA 4G1MB 3V5HA 2WZ6A 4HCRH 4E5XB 1R3IL 2YMOA 1LP9B 1C16B 1X7QA 5D1XA 4RX4A 4M8QA 3N5AA 4FXGA 3MJ7B 3CHPA 4R8WL 3ARBD 4NO2A 2JE8A 5E99H 3CUPA 2AK4D 2F0CA 4HWBH 2EE9A 4TMPA 3S35X 4HJIA 4FQIL 4N28A 3IXTB 2DQEL 2DL2A 4JLRA 3HLAA 2R69H 4YE0A 4W4OC 4FKHA 5I1JH 2JWYA 1S5IL 4M7JH 4XAKD 2MQCA 2EE0A 2VO5A 1R5VA 1AGFB 2VR9A 4MJJA 4QTIL 1IT9H 3OJ2C 4NHCH 4J5VA 4XMVA 4J4PC 1DJYA 3RAJL 5GRUL 4UT6H 2HT4C 2CPUA 5DEFA 4B9PA 2F7IA 4ERSH 2XWZA 2O6EA 1MFBH 5I8OL 4Y88A 1HKLL 4CMHB 2XV3A 1PDKB 2ITDA 3BZ4B 3LXUX 4A6YA 3MXVH 1OVZA 3NOIA 1LO5B 2J1XA 1EHAA 4MVBC 4AG4H 2ZUVA 3ILEA 3KLSA 5FKPB 1G7IA 2APBA 3FBQA 3KR3L 4WV1B 3IRPX 4DT2A 2O61B 3RB5A 1E5ZA 1UZ6F 4HZ1A 5C0EB 1FYTE 1S2EA 5I18H 1U3YA 4WI6A 4KROD 4JO3H 1NPNA 1WVZA 3L3OA 5ICYB 4GXVL 5D4HA 2F6AA 4FNRA 2HT3D 5BPPA 2P47B 4DIXA 4QF1B 4BQBA 2IPTL 3CH1A 4MFHA 3FTGB 2K7QA 4U7SA 5IG7B 4Y19D 1YJDL 4ZOAA 1KJ2L 2NSMA 3GXNA 2NNCA 1MQKH 2EIEA 1S9YB 2Y4SA 7FABL 1BVLA 2FZ3A 3GSNA 3CAFA 1XR8B 5B7FA 5E4AA 2ZXQA 3GK8L 1DSWA 5KUKA 1GC1L 2H9GB 3FQYA 2C8NA 4HSQA 3TESA 2ZUYA 1SEBB 4PW4A 2G3ZA 2VXVH 1I8MB 4O58L 4O00A 3VI4A 3KPLA 1DQKA 4FC3E 1BX2A 2JH2A 5I6XB 4KK8C 4NO0A 1NUGA 3V4LA 3APNA 4Z77A 4MB3A 1VGKB 1J0HA 4OD2B 3HUJF 1MI5B 1NBQA 2VE6A 2WWKT 4CSTA 5JHDE 1BIHA 4NQEB 4QXVA 5LGHH 4LIQH 3MLYH 1B3IA 2J44A 2QQNH 4FQJH 1ZS8A 2R1XB 4JFDD 1DANU 1QZNA 3H7BA 4G8IA 2VXSH 2D0GA 4HDIB 1E40A 2JSFA 2APSA 3O9WD 4U1HA 1F4WH 2K7PA 3ZHFA 4PN6A 4XE0A 5I66B 2J72A 1PZ5A 4YE4H 1GKEA 2GJJA 3GBMH 2YHGA 1ETA1 3P9LA 4UOW1 3DETD 1P1VA 3UJIH 4YJZL 5AW2B 4K4KA 4KROC 3MN8A 2JKJA 2X05A 5E8EB 3WIAA 4LSPL 1UADC 3UG4A 4F37K 2EE6A 2FL5A 4ODVL 4P9HC 3HN8A 5IMOB 1QLEB 2XV6B 3IJ8A 3QWOB 1QPKA 5C92A 3GLZA 3IPEA 1WWBX 2G60L 2NQDA 1F1GA 2D73A 1XIWC 2HFTA 4I3RH 2VMEA 4PJXE 4WI9A 1I9JL 3ESMA 4X7CC 4UCFA 3FTVA 1R3HA 5HDQL 2VITB 4W9GC 4FYTA 3NCJL 2YUVA 3RJOA 1H3UA 4JREC 1PMYA 5D1XE 5JHLH 3UAFA 3FH8A 5CP3A 1CXKA 4HP5A 5LJYH 4XOAA 3DMMC 1ORQB 4Y2OA 4Y1AD 2R2BA 2ZKMX 2R0ZL 4LLMA 4PVNA 3UBGA 2BY0A 1FQ9C 4GBXA 5FA3A 5FDYA 1IAOA 1JPSL 4P9ML 2BRQA 4P4KC 3GLAA 4Y4FD 3C60B 4OF5A 3HG5A 4HV8B 1I3RB 2QSCH 4JO5A 1MRCH 4YO0B 4P5TB 1OTSD 2ADGA 2ZPKL 4ACPA 4HIIB 3GFUA 1ILSA 1A4KA 2F7PA 3JWNG 4IHBA 4PS3A 3F2LA 3CMGA 1AD0A 3O4OC 3FOLB 3L3OB 2ZCHH 3O45B 1SXZA 1HOEA 4HHWA 4PLOB 3BDXA 1T21B 3V7MA 3U2IA 4PRDB 5K39B 3MR9B 1NGWB 1NLDH 5KBDA 5EPMA 1AR1B 2ED9A 1UD2A 1WRFA 2P48B 2X4NB 4M6AA 4Q6IB 1MNUL 4CA4A 3QFJA 4F33A 1CBVH 1OSPH 4Y9GA 2W38A 4NZUL 4Y4HA 1QI4A 4KK9C 3CZJA 4YPGA 3AY4C 4DUVA 5KVEE 2B5IB 4AVHA 1KCSL 4IRJC 1JXKA 3II1A 4GRLD 2XG4B 5KS9E 2WINA 1CXEA 5FHAL 5C0AD 3BXNB 4EN3C 1PX3A 1JRHL 1UWXK 5EEUA 1JV5B 5MP6L 1JPFB 3GDBA 1IGYB 2KLTA 3L3OC 1T66C 3GSWA 2BSTA 1OSZB 4OCNC 3ZR5A 3ZDXB 3QUYA 1RSYA 1Q1JL 3HR6A 3N2JA 5C8JA 3D4YA 1MF2H 2DLIA 4XVJL 3QAQA 1H6EA 3NACL 3QAZC 1ZK5A 4H8QA 3STZA 4ANWA 1P4LB 3CN4A 5IIEA 5KVEH 5BMFH 3H3KA 5DJAB 5ILTH 4IM8A 3ZIMA 3TM6A 4WI5A 3SSGA 4JFZH 4EEEA 3WNIA 1FSKB 4Z5RA 1BWWA 2O6CA 2VJ8A 3V0WL 3LTVA 5EBWA 1YRKA 3V55A 3W11D 4EMZA 1R3LB 1WWWX 4AZ8B 4F7PB 1ASPA 4NCC1 4DQAA 4AY0A 1ASOA 2PMZA 3TZVB 5I6PA 1T7VA 5EIVA 1X5KA 3SYCA 3RTQA 5E4OA 4ODWA 1CXHA 4RWHA 1OL0A 1JDAA 1TPXB 1TU2B 2B4CH 2ICWB 3GKZA 2J8UF 2VZOA 2P7TB 4JY6B 3FO9A 2DKMA 2DJSA 2IAMD 4PG2C 4NKOB 4ZFFB 4ZFGL 4R0LA 4XXWC 1LWJA 3WNPA 1TZIA 3ECWA 1OQXA 2I27N 4FXTA 4PWGA 4X9FA 4JDEB 5FW7A 5A6MA 5CGBA 5FV1L 4Z18A 5CWSA 3VWKB 3FSZA 4IJ3C 3U36B 5K1JA 1IFHH 1OAJA 2DJUA 4HH9B 1SMDA 4X6CF 1F00I 3ULUC 4KX9A 2DWTA 4I2XB 3WS3A 2AZAA 3O3AA 2E6PA 3CDZA 1MHHA 3DXAE 3UPAA 2DL9A 3GHBL 1SVZA 1ZT4B 4WTZG 4GRWH 1GY2A 2IANE 1WEJL 2Y5TB 4RAUA 3SBPA 1FI8C 1MW2A 4P4RB 2HP4A 3MVSA 2V7HA 1SJEB 4N2KA 2V9QA 4H8WL 2AMUA 2VDNL 3N06B 3P0VL 1DVUA 4ZUWA 3KS0H 1S5HB 5FUCC 4AX3A 4WNQA 1NEZG 3L1OH 3E1ZA 4HKXA 5GRJH 4OD1L 1PCSA 3WXVL 2PTTA 3G5WA 2P80A 2BNUB 3D85D 4LBEA 4QRQB 2VISB 4R7XA 2E8ZA 4DPRA 3OHXB 2KZ1B 3BW9B 3RZCC 4QO1B 1HH9B 2J3SA 3D18B 3BKYH 3ZGHA 2M8XA 3US1A 1MW1A 1UUSA 3FT3A 4BK5C 2CCLA 2Z1PA 1U3HD 2H6PB 1G43A 3F7RA 5G4OA 2Y7QB 2XJLA 3ZU8A 4WHYG 1HJCA 1IM9B 1N8OE 1O6SB 2QKIA 2GHZA 3S37H 2H32A 4NN7C 4RDQG 5BRQA 1UM5H 3PDOB 5EOCL 7PCYA 1AHMA 1KPVA 1T3FB 3IMVA 3MACH 1D5ZA 2VM9A 4ONGL 4P57A 1ZEAH 3EDDA 1U8JA 2VLLA 4EO5A 2Y36H 2VRKA 4NC2B 4FE9A 4YBLC 4NI6A 4UV7L 4U6YA 2K1MA 2RALA 5TTRA 2X4SB 1T1WB 3KPPB 3ETSA 4NQED 5JPMA 1ODAA 1AKJB 1SXAA 4QT5B 3K3QA 4IOFC 5BJTB 4PJ8C 1QSVA 2HJFA 35C8L 1N0XL 32C2B 3QUKA 3IF1B 4G6KL 1H5BB 5LBGA 3WS6C 5LDSA 4QRFA 4AC4A 3TJPA 1XXFC 4PJFF 3KGUA 2D8KA 4HQQL 1J9TA 4YDVB 5GRWA 2EXWD 1BZ7B 3UPCA 4YLQT 4KKBC 3S37L 4FI8A 5CZXC 1GCFA 4F1ZA 2J43A 1DQMH 1JTPA 1P4IH 1QSZA 1KC5H 4JQXC 4QEGA 4U6XB 1MI5A 3BSZA 3NQIA 4XO5A 4K5LA 3D87B 4XNMB 3Q3GB 3RBGA 4Z3EA 2FCBA 3C5JA 2WIMA 4OLYH 4X6EB 3RTQB 4ZX6A 5DYFA 3FCUB 3ZIYA 1BEYL 1T22B 3QEQA 3Q13A 3ZT7A 4X5PA 2PWDA 3IMTA 3MUUA 3K6FA 2VDQH 1PYWA 5KYWB 1QRND 2FD6H 5B1AB 1QP1A 3ARBC 4N0UE 2DICA 2XTJE 4L3EE 2MFNA 3SDXB 2BZCA 3P30L 3RY4A 3P9MA 1I1RA 2EDHA 2Q76B 2MEJB 3FUEA 4FG4A 4NHUA 4R4ND 3LKNB 5LG1A 1YN7B 4Y16C 3WJJC 3T4AB 5JW5B 5L4MA 1CE6B 2IG2H 3OC8A 2COQA 1X5MA 4CSZA 4D9QD 3TBWB 2N56A 3R19A 2EUWA 2O30A 1E9PB 1FFPB 3VXTB 1AGCB 5JHDD 3LZFH 4OM1L 4IMLB 3V7AE 3QHFL 5LBSH 1DN2A 4KVCL 2IH9A 2IWEA 3WHE0 1NKOA 4ZI8A 5FYKH 5FYKD 1W9XA 3QXTA 3MCKB 4BFGA 3V52L 1A3ZA 2GUOB 1UD3A 4RISH 2GC7C 2Z1KA 3S3PA 4G7VL 4ELKA 4B9ZA 1KYAA 4NC0B 1EJOL 3MRDA 3B34A 4FZ8H 1FNLA 3DJTA 1XXDC 3H9HA 4OLZL 1A1NB 3GGWA 2EIJB 4HCIA 1RP9A 3UJJL 3PFQA 4CU6A 2P5WD 2J55A 1IKFH 2BP8A 1Y7VA 3BPLB 2I5YL 3KLAB 3QARA 4FFZH 2RR3A 3U7AA 4F58L 3VD0A 1QNZH 1J8HA 1JF1B 4NP4L 4JFDB 5HGGS 1L7IH 3LCYA 1BAGA 1JTOA 4XCNA 1JP5A 2NY7L 5KW9L 3FZUC 5DMKA 2AGJH 3ARQA 5ITBH 5CM1A 5DZAA 1QABA 4AQ1B 4J2QA 2OCCB 4X4XB 2NY1B 1FVDA 4X99B 1RUMH 5D7SH 3WENA 4G1EB 5AOJA 1F56A 2O5NA 4X98B 3T0VA 3MLTB 4J12A 4KK6D 3WE1A 2DM2A 3OKOB 3HI1A 5EBGA 1DANT 4M1CC 4EUPH 4JM0A 4XC3L 4DN3H 1AXSA 3MRQB 5AB2A 4P57B 2RJMA 1FZKB 4YSEA 2JMRA 4MASA 3DX1A 3RZCB 3MRFB 2OMXB 3D4GA 2I5YH 3FSAA 4MTMA 2F18A 3KLDA 3PWPD 3ULVC 1WA1X 4BSWA 2WCSA 5KW9H 3QHTC 4Y1AB 5I1KH 2FR4A 3WKQA 1EJ6A 2AF2A 1ET5A 2VMFA 2ZUXA 3G6JF 1KLUB 3RX8A 3UAJA 4CW1B 4LVHC 2D7QA 1KTLA 2BSSA 1TJXA 1I3GL 1KZQA 4U3SB 5F7NC 4CDGC 1D6VL 5B3JF 1AH1A 3NESA 4XN1A 3O6LL 4FF9A 5IGXH 4XMUA 4HPYH 2FWLB 1AQMA 3FFCD 5F0MB 4AEHH 1ZHBB 1M53A 1GCYA 4OFKA 7PAZA 1ZVSA 4P2RA 1HTYA 1Z5YD 4Z7UF 5E8EA 1MCWW 3V79C 4QHKI 1KG0B 3M8OH 4HFUH 1G84A 3DBXA 4UMSA 2BOCA 3TVMA 3LN5B 5JORB 2GTWB 5LXVA 1ZANL 4JKWA 4KTEH 3UGXA 3UBHA 3RWIA 4ODUA 4OR1A 3VJ6A 4JFHD 1LO0L 2LQRA 2XTJC 3ZBMA 3GXUB 3ETTA 2IIJA 1BDYA 4IYKA 3NABH 2DQUH 2WBJC 3KPRB 4MS6A 5AKVA 3WKMH 3MR9A 4G6JL 5JPNC 1IC5L 1PZ3A 5H2BB 1YEIH 3GM0A 3O9WB 4YQXH 4FFYH 1T2QH 1NAML 1KJ2H 4UOQA 3VXNB 2G75B 4QKXB 5JO5B 1JERA 2EVHA 3FTZA 1T4WA 4C57C 1A1OA 2WIIB 3A4AA 3G9VA 3QG7L 4LSRH 4AQ8C 1GS6X 1PZCA 1C5BH 5LBVA 4JFXA 1FG2B 2DWEA 4TNGA 5A1AA 3AMKA 4L9LC 1XIWD 4NRXB 3AXLB 3RA7L 6PAZA 3QDGE 3MPCA 4ZQTA 3NIDF 2ARWA 3J8F7 5DRZA 4FXLA 1WCBA 2V2XA 1QFOA 5A16B 2VR3A 3CPUA 3RJDA 1ZANH 3CVHB 2A9AA 5AL8A 3SCMA 1MCQA 4N22A 1X4ZA 2J56A 1JHLH 3E6HA 4AM0A 2X2YA 4J6RL 3SJVD 4F93B 3MA7A 3EJYC 3NIFF 5CKAA 3G6AB 4WWKC 1NAMH 2UY6A 2WC7A 3ROLB 5E4IA 1G7IB 3FUKA 3K46A 4R2GC 2BHYA 3CHOA 4PVLA 2MOVA 3KLAA 3MMEA 3VQ1C 4YBLB 3FB5B 1AZRA 1AANA 4RMWA 3TT1L 1T5KA 2DH2A 4YPGB 3T8XA 1QUPA 1RZGB 4MXQD 5D1ZC 4H8UA 3A6CL 4AG4L 4ZODA 4QF1A 3FBKA 4YZFF 1W0WA 3TCLA 1ZHLB 2WTRB 4KJWC 4EQ3A 5L6YL 2ED6A 4RNRB 4NZ8A 3UTSB 1T1XA 1ZE3H 3HS0A 2FJSA 3IKCA 2ZX5A 1DBJH 1ECYA 4HHAB 2X2HA 2X10A 3ZYJA 2AEQL 5HHXH 4Q9QL 4I3GA 2XQYK 3LV3A 1CB4A 1XVSA 2Q7YA 3QQ3B 2PR4H 4YSSA 2NLJB 5IJVB 1MLBA 1FVCA 2W95A 2EC9U 5DJDB 1QAWA 1E2VA 3DPBA 2VDMH 3EYOA 5LQBH 3VVVA 1A47A 4FLRA 2ZONA 4FTVE 5SWSB 4WEUD 3CHRA 1NBYA 4PRAB 4NC1C 1SJHB 2WNGA 4KITB 4FA6A 4K73A 3V9FA 1ZLSL 3NQKA 3V6ZA 4V11A 1CDHA 1IC0A 4PJIA 4Y5XA 5FGBC 2WVSA 3EOTL 3WNKA 5LXGL 3TFKD 2FT7A 5KYUB 1MHHB 4O58H 2VKXA 1II4E 4NWTH 2V5YA 4U1IA 1ZT4A 3U9PH 4W68A 2CNZA 1MIML 5E5MB 4LHUB 3VXUE 2NR6C 2QTEA 3HUJE 2QELA 1JWSA 3PABA 2AV1A 4F20A 4N8VG 1TCRA 4ODXA 1AKJD 4AJVA 5MI0C 3DX7B 1QASA 4DP8X 3JTSB 2BS9A 5EIIA 2PYEB 1JK9B 5IESL 2BS71 2YSSA 2N4IA 5KBKA 1TZIB 4K15A 1F3JA 2ITCA 3QZWG 4GXFA 4PJEB 3S35H 3N1FC 4L18A 3WTTA 4UNTA 3DECA 5IF0A 3HG1B 3M88A 3K2MC 3P9LB 5TE7L 2J7LA 3GS4A 1L9QA 2DLTA 3U7WL 2UYLA 4BQCA 5IBUB 4MD5A 4MXQC 4FL4B 5FYJE 4CMMA 5KSAA 3QUMH 4G70B 5GISL 4PJ7B 1L5GA 1ZTXH 3I6KA 4M56A 4F7CA 4TVPH 4TVPD 5IHWA 4G8GB 1MDTA 4HALA 5MERA 4POZC 1W8EA 1VGEL 3HNSL 3HPJA 1YAIA 5HDBB 1MCCA 3BGMA 1OSPL 3LKSB 5T1JA 2QGCA 2ZOWA 1ND0A 2OMTB 1H8LA 2QSQA 1DLFL 1HWGB 2VXUH 3LQZA 3QPXL 4Q14A 4JQIH 4OJCA 3LNEA 1HDMB 4S1SL 4J4PA 2FAUA 1A7NH 3I3BA 4CN1A 2OMUB 2YUXA 5MP6H 1N64H 3CDCA 1CGXA 3VDAA 4LCIH 3IDNB 4ZTPH 4F8NA 5C0BE 1GAFL 2XWXA 3H3PL 4P5MA 3E6HB 1TO5A 3CK0H 1JV2A 4TF4A 1P7QA 4KKAC 2FBOJ 2HG5A 1F90L 2VDPB 3LD8C 3BZDA 4N90E 2F19L 4HUCA 2HTLC 3VXTA 1A7RL 4GSQA 1CC3A 4MJ5B 5GRVK 3LYRA 4GAJH 4Z1PA 2BOLA 4GRWE 4LCWB 3GEWB 2H1XA 4XMWA 4L9LA 2XBDA 4ZW8A 2WWMC 3MV7D 4Y1SA 3T2LA 3ZYIA 3QQXA 1TLMA 2XG5A 3V0WH 3HC3L 1NGYA 1OM3H 5B39G 2WUBL 3PG2A 1JAEA 2QT6A 1JN6B 1A7NL 1MRCL 1NBZA 1JYNA 3PL6B 5IHUL 1TJGH 4BK4A 4Z7WB 1VFAB 1LLAA 4F7MB 5IV2A 3GPEA 1T22A 3QEQB 4W9CC 1RK1B 4HHAA 3O41A 2Y3NA 4DGYL 2J5LC 2CE6A 1JIBA 3IU3A 4MMZB 4PU2A 2F54D 4L3EA 1FH5H 5ADOH 4Z3FA 2MQ0A 4XCNB 2VKWA 3CV5A 3P3RA 2OSYA 4ABVA 1MFCH 1QFWI 3MV11 3MXWL 3QH3B 1M56B 2WZPA 2W60B 4DGVH 1H15A 3IXAB 3JUYA 4BFKA 3ZTJH 3SDXF 3L5WA 3TPUA 4WFFE 3W0WA 4HEPA 3LNIA 1B2WH 4HWBA 1M57B 3FO2A 4NUPA 1CN4A 1U93B 2XOTA 2GBUA 4UNUA 5EV7A 4F2MA 3OR7A 5ID1B 5DFWH 1DEEB 1N8ZB 5EZJB 2X4QB 1MXDA 3KPOA 1YEEH 3HN3A 3NPSC 1MAKA 4OY9A 3FUJA 2ATPB 4RFEB 1H3WM 3ARPA 3FU3A 3HTLX 3EYFB 4WO4D 1HU8A 1L0XA 3IDGB 4PJ8B 1D5XB 1M9SA 3BDBA 1M71B 3MLVL 4D94A 4WFFD 2A9MH 4K3JL 2NSXA 1JGDB 1FSKC 3C5SA 3QRGH 1QNIA 2AVGA 3VMNA 1RK0B 2KMWA 2P9RA 1GHFL 4KJQC 4N0UA 4WK4B 1CGUA 4NO3B 4LGPB 2H4EA 3WFHA 2WK2A 1KULA 5L7XL 1PAZA 3LQAL 2YQGA 4LPYA 1TLKA 2MPAH 3T0WA 1U3HA 3PUUA 5D6DC 4ELMA 3WNLA 4PRPD 4MQXD 3BVTA 4GXUM 1EO8H 1J18A 5KSUB 5CZVL 4X98A 4KJYB 4C4BA 4YFEA 1OAZH 4DGIH 1YEFL 1TXKA 1YMMA 2FQEA 3VI3B 2OA9A 2JXMB 1QQDA 1OXYA 1RUQH 4JQVC 1XGPA 4QXUH 2F53E 3MV7E 3ULSB 5I26A 1DDHB 4JDTH 5AAWC 1TQUA 2DQGL 1HDMA 1ZIBA 3HRPA 3RDTD 2OMXA 1KEML 5I1LA 3DIDA 4Y8DC 2BP8B 1R3JA 3WTYA 1N5AA 3H4FA 1A7QH 1UD5A 1SLVA 1GYAA 2RCSH 3L4CA 1F4YH 1RVFH 4X6BB 4Z7VB 2X89A 4ZFOB 3IJYB 4RAUB 2DTMH 1OGAD 4P5MB 3FFCB 2J8OA 1EPFA 3ARGC 4YUEH 5GGTH 4U1MA 1CLOH 2BMKB 3P3TA 2ZKHH 3KL0A 3QWNA 3P4OB 4JKPL 3DRQA 4HQQH 4HPOL 3STBA 5CU5A 4UWQB 2VDLH 1FL3A 5D71L 2QZ5A 4UILH 5KAQF 3RP1A 4QRQA 5AZUA 5AD0A 3GB7B 3QDMA 5D1XD 5IHLB 1OAYL 1AR2A 2LT9A 3SY0B 1NOFA 3M07A 1EEYA 1AXSB 5FR3A 1AP2A 3CLEH 3BSGA 3D69A 4J8RA 2Z4TA 1KIRA 4K2UH 3RJQB 3KLLA 1ITBB 2DQHH 4JDVB 4LAJH 3MO1B 2DQEH 4Y5YB 4G83A 1O7DE 1Q0EA 3T77A 2DQJH 1AR1C 4E41D 1BG1A 3AY2A 3H42L 4DOHE 4U6VL 3S3CB 4XVSL 1U8HB 4JO8A 1MCJA 4UT6L 3VI4B 1U8OB 4IOSD 4UT6A 4D0BA 2IG2L 2WKLA 3BAEH 3ZDZB 5MEPA 4XPAH 1U93A 1KN4H 1KGCD 4LHUD 1I7RA 1M1XA 4W1TA 2NLJA 3LZFL 4OM1H 4LSTL 2EDWA 3I50L 4R83A 5DJDA 4DP0X 3GMNA 2C1OB 3UMTA 5FYKL 1EXUA 1UH2A 3NP4A 4MZRA 2Y7SA 5E0FA 3CN0A 4LB8A 3U46A 4BGDA 1BFSA 4J27A 4NQSA 1YC7A 3NCYS 3CH1B 2MTPA 3QCVH 3F6LA 3H4HA 1I9EA 1T83C 2WJ5A 3N41F 4FTVD 3HE7A 1MCOH 3ALPA 5IBTL 2NXYC 1N6QL 1U2HA 3KBFA 2EXYC 4LCUA 2PCPA 3QE5A 2WQSA 1SUHA 1U6AL 1TFPA 2A77L 4NPYA 3CFEB 3L3KA 4WI3A 3WU1A 4KQ0A 1NCWL 1W72H 4OIBA 4NN6C 2AXHA 3AXLA 2NY7H 4A7GA 1J5CA 3A6BL 3LS5H 2YLKA 1FNGB 3QHZH 3PAUA 3GRWL 3CZSA 1E67A 2WLLB 2DWYA 5AB0A 4POZD 4J3OF 1JS4A 5DEGA 2IANA 4G8FA 4TVPE 1QSED 3DBSA 5ABAA 1SDDB 5JIKA 3B5HA 1UWYA 2XBZA 2UY7B 4E68A 3X12A 4KKQA 2C9AA 1LO4L 3AU1A 4XN9A 5HBBA 3QFJD 3N41B 4M93B 2C3WA 4R84A 4UQAA 1U30A 3US0A 3MBEB 3VVWA 4P46B 3PQYD 4IKKA 4FL4C 4XNZC 2BXYA 3U2JA 1X9RA 3UTTA 4D3CL 1XMEB 4WTWA 5MEOA 3OGOE 1HWWA 3R8BB 2A6KA 4NBXB 5HGHB 1NANH 1Y1UA 3CZFA 3E3QE 2OSLA 1XCTA 2LU7A 1P1ZA 3BEVA 4N9GB 3SGEI 1ND0B 2OMTA 3PJSB 4L8BB 1TJMA 3O6ML 4XMZA 1HH6B 1JUFB 2BH0A 2OMZA 4JFFE 1DVFB 4UQCA 5JQIB 4UNVA 5D93C 4EI5A 3ES6B 2WB1A 1TQTA 5F9DC 3DETC 4GKNB 4HA1A 4GO9A 3QCUL 3WEMA 3B2MA 1FCCA 5CGYD 3LB6D 4E41E 5E24E 1LO4H 2AW2A 1D7DA 2CM6A 3KWXA 3B56A 1KF9B 1WD8A 3UJJH 5DFTA 5GGQL 1XSJA 4FDWA 2VQUA 2GYSA 4MX7B 2D7PA 3QUYC 1L9MA 4RGMC 5A6LA 2KDGA 1KNOA 4KROB 1RLBA 2PWEA 4I3SH 3K72A 4I48A 2J20A 4PV9B 3BEWA 2D0HA 3DK2A 3MV01 4X4ME 1FUNA 4X7SL 4AYID 1J88A 3GMLB 4AYBA 5FPIA 1MRDL 4YHZL 2FWSA 4JJ5A 3L2NA 3DMMD 3NCJH 3VWKC 3FULA 3Q05A 4U1IB 4ZZFA 2HLAB 4AEIL 5E2VH 5JHLA 3PP4H 4N8VA 3K71B 3NRFA 3ARFB 2W0FA 2WGNB 2IGFL 4HYTB 4PG9A 5DUBB 4XP6H 5E8OA 2XQBL 4LARL 3DROB 5DC4B 2EDEA 3OXSB 5DJ0A 3BISA 3ASWA 5JNYB 4Q9CA 4XPHH 1PL3A 2UWEF 4PJAB 1GMEA 1LNUA 1OTSC 1W72B 3FQNA 3RWFB 2DQTH 2PYEA 5DJ6B 2V8MA 1NGZA 5H94B 1R3KB 4YNYB 2DWDA 4S1DD 1WBYA 2A4CA 4LDLB 1AQKH 1CTNA 5IVXA 1U8IB 2C9UA 2D4DA 4E5XA 3OGCA 1ETJA 5DU7A 1F11B 4XVOA 3L5WB 3W0WB 1BHGA 3RWEA 3MOBL 1IC4L 4NZDA 2WANA 1FVEA 3FT0A 5E6SB 1AC0A 3HBZA 4G3YL 5DK0B 5J6GA 1HHGB 2NW3A 2OQJB 4WQOA 4KKCC 2YZ1A 1V5JA 1CL7H 3F7YA 2ZCLL 5BUAA 1U58A 3RRQA 2CLRB 4BELD 4RZKA 4DKEH 4JPIB 1F86A 3GIZH 4Q58C 3IXTA 3ABMB 3ECBB 3PUCA 5DMGC 1GGBH 3FO0L 4LARH 5I24A 1TDQA 2YAOA 1UWFA 3VGDA 4PJHE 1MFVA 1GR7A 3G08A 3GSXB 4MQXC 3WAKA 2P8LA 3PL6D 4F2EA 2CO4A 4I5BA 5DTFA 4X8JA 1J7VR 1QBLH 1BVLB 2IAMB 3I9IA 5CMAB 3CSFA 2IBGA 4LPCA 3UTQB 1P5UA 5E0QA 3NZUA 4P04A 1DVFC 3Q43A 5BUGA 2FX9L 2VO8A 4TNFA 5C0ND 4YZWA 1S5IH 3HKZA 4KXZH 4M7JL 4Z7QF 3HUJB 5IVZB 4M43H 3QUYD 3T4AC 3LEVL 4ISVB 5IQOA 4AIEA 2VDKB 3SKJL 3IRCA 1U21A 5EULV 4AQZA 2QR0B 2B8OT 1VJSA 3AVEA 3VH8B 4TNWK 1SUJA 3HHMA 1FE8L 3OJDA 4QRAA 3RQ3A 4MJ2A 1ED3A 1SBBA 2M83A 1L6XA 1RHHA 2BC4A 4GAYB 1F97A 2QFRA 2VDRH 2XWBB 3EJTA 5C2BH 1WZ1L 3MA7B 3U0PB 3FU6A 3FTGA 5K59F 2C3VA 1IBYA 4TULL 1E3FA 2QPDB 1I1CA 1A21A 1LO3L 5T3XH 1Q9WB 5T3XD 3ROLA 2QADB 3TASA 4P2QA 5FA4A 4AQ8A 2CHXA 1XGZA 4H13C 4MSWB 4PJGA 4HCFA 4JO3L 5EZLA 3VXSA 4PWHA 3B6SB 1I8IB 1JHLL 4N26A 4J6RH 2G4EA 5AENA 5GJSL 3S34L 2JCCB 3RUGE 4AT6A 6PCYA 1SY6H 3OKKB 4KKBD 3NSCA 1MQKL 2XN9B 4Y4FB 3MV7B 4IU3B 1PGRB 4WUKH 3ZX1A 5I19L 2RB8A 1NIFA 1UEYA 5GS0C 5IROC 3ZE0F 1MZZA 5DD0L 1SEQH 3CFCL 2G5BB 4JREB 4QOKB 2E7HA 3H55A 3PQYB 1A7OL 2AJ3A 3BP6A 3LXBA 2ZWLT 3NJXA 3L3HB 1VCBC 1F02I 1FC2D 1Q0YH 2CLVA 5GISH 4J3OG 4CADA 5CLTA 3WNOA 3GXDA 2Z7YA 3QUGA 4YWGL 4BQ6A 1FLRL 4JQIA 3CN3A 3EJYD 5FUOL 1T1WA 5FCUH 4RGMB 2E56A 1YYLH 4OGAD 4ZFQA 4OAWA 2AEPL 3LAFA 1NFKA 4OCRH 4WUKL 5I19H 1A4JA 1NZRA 4GG8A 5AKSA 3MLYL 1G1KA 2OJEB 2X41A 1D5RA 3K2UH 5HHNA 3DURB 3GQFA 2YQ3A 1NCCL 3IU4H 4HKJA 1DFXA 4G5ZL 4N0RA 6FABH 2JKWA 4ADGA 1DUYA 1E2WA 2A74A 3JYCA 4AUYA 2D7MA 1UQSB 3TH3T 3WLWD 4GW5A 4H8VA 5HYFA 5D5ME 1IEBB 1YMHA 1HEHC 5HDBF 5EZOL 5I74C 4NO5B 4HGWB 2DN7A 4YDNA 4BFEA 4OB5L 5IF0B 4FULA 4KJQD 3LY6A 5HYJA 3A21A 3I9PA 4HCGA 4KDVA 5FUZL 2P49B 2X4TA 3ERXA 2NX5B 1DFBL 3IMRA 4PJ7E 4B3EA 3FU7A 3E6FA 5HHOE 3QZNA 4W93A 4ZAKB 1RH8A 3DHJA 1XGQA 1PZAA 2OKMA 1NDGA 5ALCH 4F24A 2X6UA 4L5FL 1HS6A 4ZUSB 1MEXL 4MNGB 4YSAA 4NIKB 5FYLL 1TZHA 1RL1A 1ZA3B 2Q76A 4NHUB 3BWAB 2F54A 4L3ED 2D3LA 5B38G 3BZEA 5K1VA 1ZVYA 3WN5B 5IMMA 3GSRA 3VRIB 3RGVC 3OB0K 2KC0A 1CUOA 2C4XA 2OV0A 5EZPA 2AZUA 35C8H 5CHNB 3DYOA 1ZT7B 3HBPA 3AS0A 3OM3B 2EDBA 3GKWL 3SZKC 4NSKB 5E1QA 2WJ7A 2H2PC 4TV3A 1KIPA 2ZJSL 4BUHA 1YNKH 5EN3A 5JR1L 2X1OA 2FSEB 2NUPA 1FBIL 3MJ9L 4JFEB 3O0RL 3WMSA 3ILPB 1ZLWH 1NGPL 2BHZA 5EU6A 3OKNB 3ZDWA 2R2HA 3LRMA 3OBAA 2H1PL 1CIDA 1S8DB 1C8QA 2OL3H 3ARDD 4Y4HB 1P2CA 1RPUA 3MGTA 4HS3A 1YA5A 3BSZH 3WEOA 1WHPA 3ZXAC 1SJMA 1U2YA 5MHSD 3DV4B 3KWUA 1PYWB 5DS8B 1GOFA 3IDUA 1A0QH 2ICCA 4WWID 5CKGA 5ICYA 3CZFB 1BBDH 2AABH 1RD6A 3TV8A 4L37A 2ZYSA 5CJOH 1AQDB 3RWHA 1CICC 2CKNA 4KUZH 2VLJD 4RDBA 3NSJA 1GTNA 4TSAH 3VXRA 4LLVB 5KSBF 1M7DA 3BT0A 4M8RA 1S7VA 1X9QA 5C08A 3P2BA 1G7HA 2WCGA 3DX0A 3OMZA 1KENH 4YHPB 5MEPB 4AL8H 1PD0A 4YHNB 1IMHC 3APCA 1SN0A 1QPPA 2DD8H 4P3DB 1JZIA 2CA3A 3EHBD 5DUMH 3STZB 2GUYA 3K5SA 2E7CA 4WEBH 5CR1A 1IEHA 4X6CE 1EO8L 3L3HA 3HCVB 1X44A 1YMMD 3GNML 3SDCA 3KL5A 2YJLA 4XAWH 4IRJB 2E7DA 1TJIH 2FK9A 4I4WB 1JZEA 4JKKA 3UOAB 3PWPB 4QXUL 3WIFA 4FP8L 5H37G 5EBWB 3NACH 4P5RA 1HJBC 3WL9B 5E7FA 1DEEA 2P5WB 1NC4B 5LNDA 3GBNL 3DJSA 5JQ6L 2COVD 5JW3L 1A6UH 5FFOA 1CG9B 5L4FA 2JKIS 3AWFA 5DEJA 4MMYA 4JFZL 3UTPE 1KENL 3CLFL 4AL8L 2X2UA 3F12A 3IDGA 2W0KA 4PJ8A 5F7YC 1D5IH 4DQOH 1SJEA 4MYPA 3ZKQD 5IFAH 1J8HE 1NDTA 1E5CA 4FNQA 2PN5A 4ZNCD 1NUNB 2NQCA 3ILDA 4YUEL 5ACMA 4E9VA 2APVA 2UZPA 1A14L 1MH5B 3BKML 3CFUA 4YL4A 5F44A 3RIFF 2E9IA 1WV7T 2R1YB 2XKUA 5KJRH 5CCGE 2R0KL 5I1CH 4M1CD 2ICEB 4UTBH 5F3HB 5KEZA 3GMMB 4I1NB 4A1RA 2PXYD 2V4LA 3U36A 2XZAL 5GS2D 5ESVA 5GS2H 1FL6A 2ATKA 3KL3A 2CXGA 4PGEA 1JVLA 1YDPB 4EUPA 2EH8L 4MNGA 3PU7A 2MJWA 5F72S 4HIEA 2WIIA 1U58B 2D3VA 1BXVA 3UBFA 1C12B 1OSEA 3SKOB 5C0DB 4JM4L 4Q74A 3BVDB 1M3IA 1XB8A 4N4YB 2KH2B 2WXFA 4WFGE 2J6WA 4JPWH 2ZD0A 2F15A 4Z0BL 1U8LB 4OZIB 3FONB 4N2BA 2R23A 1MG2C 3K0WA 4Y4KB 1H6FA 2X70A 3G3LA 1EIBA 4W9DC 1RIHL 2J4WH 2CIKB 2OX5A 3GHBH 4GKNA 5CGMA 4G80B 2G0LA 5KJRL 2VLRE 3T3ME 3UAJD 2YXVA 1WS7A 5I1CL 1JK8A 3C5ZA 3FU9A 1SJXA 2OMYA 1MWAA 3PGFH 4X6BA 3T0XA 3G6JB 4YDIH 1DL7H 1DUZB 1KG0A 4JFUA 4LPWA 5DRNA 4BUQA 3ULVE 4GBXB 5FA3B 1XCQB 1ZD6A 2DQGH 4HOXA 1NGZB 3M1BA 3QXAA 4PRBB 1WIPA 1NCDL 2J2ZA 3QPQD 4GAGL 4PJEF 5GRJL 4GKZB 2QKIB 2VDKH 2QVMA 4XPFL 2A83B 4NP9A 5D8JH 5DLLA 4RESB 2NX5D 4KTEL 5EOQL 3V5KB 5LGKA 1MFEL 5DVOA 1U8NA 1XGRB 2J88H 3FN0L