5AQFB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
molecule tags Chaperone
source organism Homo sapiens
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
total genus 46
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqfB00
5AQPB 5AQRB 5AQMB 5AQVB 3FZFB 5AQGB 3LDQB 1HX1B 1M62A 5AQNB 1UK5A 3FZMB 5AQHB 3A8YC 5AQOB 5AQIB 4HWIB 4HWCA 3FZHB 3FZLB 3M3ZB 1UGOA 1I6ZA 2D9DA 1T7SA 4HWHA 1M7KA 5AQJB 5AQSB 5AQUB 4HWDA 3FZKB 5AQKB 5AQLB 5AQQB 4HWFA 5AQTB 5AQFB
chains in the Genus database with same CATH superfamily
3UU6A 2WCAA 5JRCB 4ZS2A 2ZM0A 4HFCA 2UXNB 2LM2A 5ABFB 4DR2T 3W15B 4HFIA 4I0UA 2M67A 3F57A 2D2SA 4E7ZA 3PDYA 2WDVA 3PE0A 4TX5A 3N9OA 2N9DA 2J1DG 2KWIB 5AQHB 2XQ7A 2BVMA 4HFDA 2CBIA 3T1YT 5GONE 2UUBT 5DQVA 4EIWA 5HCJA 1H7CA 2IC9A 1Z8UA 2IAKA 4NUVA 3H3MA 1D0XA 3SWHA 4O2BE 3ZEFB 2JMKA 3AA0B 1O3XA 4YHJA 4ADZA 2K9AA 3RYCE 2HPJA 1UURA 1WR0A 1YKHB 3A7MA 3PUVF 4QXBB 3T8OA 4X1YE 5FXZA 3EI0A 2NW9A 1W0AA 4EEDA 1WCRA 4PW8A 5HXHA 3FBZA 3O9XA 5ABGA 2FBWA 4EYYR 3BQLA 4QH1A 2K48A 2V7JA 4MHCA 3AECA 2K5BB 4YFSA 4TV8E 1B7TA 4AXPA 3QOFA 3Q9DA 3N9PA 4FI5A 1UK5A 2JPFA 2VKJA 3VR9A 3K3QC 3P4RA 1KF6A 4JI6T 3EABA 4IIJE 3TLTA 3MJXA 3PUXF 4TUYE 4GKJT 1AJ3A 4H9OC 5KXJA 3EHZA 4HE8A 3ZT6A 5CB4E 3WAJA 3ZSTA 3Q5DA 3OTOT 3EAMA 1M7KA 4PK5A 2LKGA 3P4QA 2XSAA 2NW8A 1D1BA 3AE5A 3LK2B 3UU8A 3ZYKA 5A1LA 4YY3T 3AVRA 2L9QA 4IE0A 5AQQB 4LMJA 5AQTB 2Y6XA 2BS4A 2PTFA 4U2YA 4YJ2E 1MMNA 5AFUL 1ZOYA 2VL8A 1NWMX 4OYJA 4CI3B 4PFOA 2JQHA 2CA5A 2YDRA 4IREA 4COFA 2XM2A 3UUMA 3K3NA 3RRCA 4KMCA 5HCMA 2CE7A 1IAPA 2JQQA 1S94A 3AE3A 3Q5WA 1SHZC 2DLRA 2QGSA 5EK3A 4DR4T 3N2OA 1XZYA 4QWNB 3RKGA 1XNRT 2BKOA 4YLHA 3NWIA 4X62T 2A2FX 3C98B 5LCYA 5C3JA 5LG3A 3PJAA 4KHZF 1L0VA 4JI8T 1ZV4X 2LJLA 2WY2A 3PUQA 2XQYA 4MLKA 4O2AE 5LOVE 3R6NA 3HKBE 3JAFA 3RQUA 4BJNA 2JRKA 4WZXA 2XQAA 3KVBA 4QXHB 2W62A 1HR0T 3B57A 2WM9A 4JV5T 2CCQA 4DNDA 2E9XD 4KI0F 5FP3A 4ASKA 5KX5E 3ETUA 5J2UE 3F31A 5M4YA 2EHOA 1KNZA 5HXRA 1T8BA 1CUNA 3CIRA 5LG4A 5AQPB 4IE6A 2HHHT 2A3DA 2ODVA 3AE6A 4LFCT 3AB3B 3MKDA 4IL4A 4ZI3D 3FZFB 1FMWA 2LKHA 2XASB 2YDQA 4F8HA 4JLEA 5L3DB 4H9QC 2BBJA 3GA8A 3JC6C 1HNXT 4DUYT 3MACA 4P1NA 4WBOA 5JR9B 5LJNA 2X9HA 2CPTA 2XAFB 3AVSA 3F2EA 5AQOB 2WS3A 4HWCA 4KX6A 1JNZA 1HX8A 1WRDA 1QSDA 3EVYA 3M3ZB 2WSSV 3DP7A 3OJAA 1IBMT 4JYAT 2X0HA 3LK3B 2C5JA 1BR2A 2V7MA 2WBLA 4UVAB 2V5CA 3UQ7A 2VQFT 5LB7B 2NWBA 2VL0A 2WU2A 1J5ET 1IJ6A 2CXLA 4H9NC 5AQLB 2XM1A 3VHLA 4U7YA 4WBNE 2LSGA 4PJMA 5JDHA 1D1AA 4H63H 1KNPA 2WAUA 5JR9C 3QB5K 3AEAA 2XAHB 3CWZB 2BG9E 4UV9B 2LSIA 2XHEB 4CN6A 4GYRA 2CHNA 4EEBA 2PBIA 3ZN0B 4CXXA 5CJ5A 4LF4T 3L09A 4NPPA 1MMAA 5AQGB 2E5LT 1HG2A 4UR9A 5IYZE 3FXEB 1Y64B 4U2ZA 4HGAA 3GWHA 4HFBA 2BG9C 3UFEA 4QHOA 5AQIB 1E7PA 1GQEA 2V6YA 1W0BA 3BQKA 5LGNB 2IW5B 5BR8T 1D0ZA 2W67A 3QC9A 2JIWA 1U5PA 3ABVA 2W0GA 2E9XB 2KZ7B 3IEEA 1X79A 3AE9A 3SRZA 3QUJA 2JMHA 3CK6A 4ANJA 3TKLB 1NEKA 2LE8A 3P50A 4CXWA 2BS2A 1HTJF 3PUAA 4BA9A 3PTRB 3FZKB 4EB6E 2CHOA 4X5TA 2OV9A 2ZM2A 3EDUA 4ILUA 5KMGP 4AI6A 1ZEEA 1WR6A 1HNWT 4I50E 2V1DB 1N32T 3KFWX 1HS7A 2YU1A 4TV9E 3HR0A 2VK9A 4OK0A 1JNRA 3RIUC 4DR1T 4JI7T 5C8YE 5HXCA 1OEDA 2WMNA 3VU7H 2B1EA 2IUBA 2A72A 4ZZBA 1D0YA 4NXMT 4L9IA 2ODUA 3PURA 4EGWA 4DR6T 3VKHA 3AA7B 3NZPA 3P4SA 4U3CA 3SOLA 2DHRA 2PJQA 4UVCB 2H88A 3AAEB 4GK5E 2FJEA 3LJCA 4XAXB 3C4XA 4B3TT 3PV0F 3MZKB 3ANWA 3ZMTB 1YW0A 2MTQA 2NW7A 3N9MA 3HKEE 3O1IA 3RKOA 4CN1A 2WDRA 3O1HA 1N34T 4GKKT 2BG9A 4DMVA 5ABFA 5CFBA 2UUCT 2CXDA 3TLVA 2BKPA 3MA9A 3O1JA 2YKSA 2H89A 3AEBA 3ZYMA 2LEHA 3NVOA 3AA1B 1G73A 4ZOLE 2IIUA 5L3EB 2YU2A 1FJGT 2H7VC 2W63A 3U3IA 2FJDA 3KV9A 3G06A 5AQVB 3AE2A 2YDSA 1WLXA 4AQYT 5DABA 4O4HE 3ESLA 4IHJE 4A98A 4XBFB 1FMVA 2WZHA 3DJBA 3GMIA 1LVFA 2XJ7A 3NRYA 3N9LA 2J62A 4TN7B 3RIUA 1G8XA 3CQXC 5HEUA 5LBMA 2Y8DA 5E0OA 3AEGA 4QXCB 3ZN1B 5JREA 4DUZT 4DV5T 2VVNA 1XMQT 5CGMA 5JDQA 2CLYC 5L4HA 4LF6T 3NRXA 4JI0T 3R84B 2W00A 3B13A 2D9DA 1T7SA 2ACXA 1X9BA 2V5DA 3ZT7A 5FVKA 2UXBT 2OLTA 3SS1A 4U33A 2W66A 4IL9A 1UUSA 2KXPB 3RF1A 2VB6A 3JADA 3K1SA 3PUGA 3VRAA 4GK0E 3I9YA 1MMGA 4Q25A 4U7IA 4X65T 4P0AA 2QYWA 1S35A 5FVLA 2HH7A 3N2GE 1MNEA 1R8IA 2CWYA 2K24A 3ZCJA 2I59A 2NTYA 1D1CA 1N36T 1I94T 2CWOA 4ZI7E 2EHOD 1M62A 3CQCB 4I4TE 1VOMA 4YTMA 2XAGB 3UU3A 1HNZT 1LVKA 3I1AA 4ZI2C 4DV2T 3ONLC 3TLUA 5JR9A 4DV7T 4KBMB 3FZHB 5IHYA 2LOSA 2V6YB 2Z6EA 1I6ZA 3N5LA 2V6XA 4TWDA 2YINA 3FB2A 2F4VT 4B6XA 2A9UA 4CI2B 2XQ6A 4G63A 3CX8B 3L3PA 2Q9QB 3KV5A 3M65A 5LBQB 4GIWA 3IBPA 4EV6A 1V9DA 5HWXA 4M1PA 5JRCA 5ETWA 3KV4A 4NXNT 2UUAT 4HN9A 2MBGA 4F6RC 2WDQA 2X0YA 3JC6D 1XNQT 5AQRB 3JAEA 2VKHA 4UEMA 4TZ4C 3RX6A 3UQ4A 3RI5A 3WI3A 3J7Yq 2J4GA 2JQKA 4YTPA 2RA1A 5JDNA 4IDZA 4K0KT 4MFRA 3UT5E 5J2TE 1VCTA 2CRBA 2XY8B 1HF8A 3AAAB 3A8YC 3AXJB 1MIWA 4G2AA 4UIGA 5L2LA 2EHOC 2XQ8A 3MXZA 3AEEA 4HWIB 1Y01A 1UGOA 2E9XA 2D5UA 3V5SA 4ZI2D 1KFYA 2VKOA 1ZP0A 1DU2A 1WYCA 3C4ZA 2OA5A 4H9PC 1BR0A 4HEAA 1KK7A 2RP4A 4HFVA 5CA1E 3SFEA 2K3WA 1E2AA 4PJJA 4TWFA 4AISA 2LSKA 3H3AA 4HWDA 4TWHA 4XZCA 4ZEYA 5FXXA 5HXSA 4IDOA 3DTOA 2X67A 3CKDA 4FJOA 4KHPT 3ANWB 2R6GF 3I0OA 3ZMUB 2XZEA 3I0QA 5TAOA 3LBXA 2ACZA 1NENA 2YN6A 3ZMZB 3KINB 3P7IA 4NIQA 3PUZF 1EZ3A 4J2CA 5HAXA 3UUBA 3ZMVB 4DBQA 2BBHA 3LDQB 4DBRA 5EK2A 4JI3T 2XUEA 4C90A 4V1Av 2X0LB 3FXDB 4IDPA 2XSBA 3ZCIA 3ONJA 2HN2A 2LLYA 1Z0PA 4ZXLA 4KP3C 4IDNA 2DWKA 2FJAA 5H6QB 4IT4A 2M6BA 4PJLA 3KVAA 1FEWA 3BQIA 3UTKA 3P8CD 2QRXA 3ETVA 1XMOT 3TLWA 4IE5A 5FL1A 1WYBA 2YK0A 3OBVE 4OYKA 4IDQA 2NP9A 1MIYA 2V7IA 5AQUB 4A56A 1MMDA 4YSZA 2ES0A 2ZLYA 3K3OA 2E8IA 3N2KE 1OEDC 4HKAA 4HWFA 2N2NA 3KBUA 2VURA 4QKNA 3ZLIA 1HCIA 2MYSA 1VCSA 2V8SV 3PUWF 5F5WA 3RLFF 4H9RC 1MNDA 2KT9A 3ZJ2A 4YTNA 2KLQA 5LHHB 3EUHA 1YQ3A 3IHRA 3OYXA 4ILAA 3ZKRA 5BMVE 3Q5XA 5FKYA 2IHR1 3LFMA 3HKCE 4EZ4A 1J5WA 3LSVA 2MAWA 5DQWA 5JH7E 5AQNB 1IJ5A 1T72A 4AIUA 3FZMB 4YT0A 4O4LE 3FBLA 4P09A 4AQFA 3RQWA 2WQYA 4HFHA 3RC3A 3KBTA 2LRLA 3OPCA 3FZLB 5C2TA 2DCFA 2NOXA 1NAFA 2VQET 4LF5T 3ONXA 4QX8B 3PJAJ 4DR7T 1KEYA 3AE1A 2CM0A 3CX7B 3EDVA 1VRBA 3C64A 5FY0A 3RIAA 2ZM6T 3E0ZA 3AE4A 4DR3T 3ZYLA 4I43B 3VR8A 5CA0E 3RYIE 3ZSSA 2IC6A 4HTEA 1KNRA 2X9WA 2XTLA 5FXVA 3QK6A 3U78A 2Q9QC 5L3GB 2N1GA 5JDGA 2WU5A 3SFDA 4QH5A 5FMNA 1UX4A 5HWYA 3V5UA 4JI4T 3E08A 2QA7A 2WB5A 2I6HA 2H7OA 3BK9A 1UX5A 5L4EA 4O8SA 4IE7A 1U4QA 4JBWF 4AKLA 4ILBA 3E22E 5LYJE 2W2UA 3TLSA 4IGUA 4TNWA 2WWUA 4PFPA 3QNUA 2XAQB 3LBXB 4DMWA 2MPKA 3C51A 4PJNA 3RGLA 3VRBA 5JQGE 3IA3A 4DV0T 1IZNB 2EHOB 3HI2A 4EOZB 4X66T 5FL0A 3AE8A 4CI1B 2LRKA 2XQ4A 4PK4A 4JI1T 4LFBT 2AE9A 2KSRA 3FHNA 4LMLA 3ZPOA 4N78D 4A97A 3X1DA 4GYSA 4UF0B 3L8RA 1ZKEA 5HEGA 3T1HT 2BDEA 5JDMA 4JEUB 3HKDE 2LSJA 2BKNA 2P9BA 1E1HB 1LRZA 2BS3A 3QB5A 1WFDA 3B5MA 3N9QA 2AXDS 4H63V 4YSYA 3RC8A 2Q9QD 3P4PA 4U72A 3CVRA 4A5XA 4AQFC 4C91A 5LGUB 5LHGB 4PNIA 4LF8T 4JI2T 3P4WA 4DR5T 4KUMB 1SE7A 5EZYE 2X9XA 3Q5EA 3RIFA 4EYUA 3VKGA 1YD8G 1US7B 2JJ9A 4E7SA 4DVDA 2KNDA 4P0BA 2CEAA 3RHWA 5LXTE 2XAJB 3L39A 4ILCA 4O4IE 4OHFA 5FY7A 4UF0A 4CXYA 5ABHA 2WP9A 4DV1T 2DI4A 4PK6A 2X66A 4AKGA 4ZHQE 4CQIA 5ABEA 2HN1A 4AKIA 1SUMB 4ISSA 2H3RA 4OX9T 4JEHB 5FYMA 5DJQC 2FUPA 2QVAA 2X9YA 3CX6B 2UXCT 3CPZA 3PU3A 4LF9T 4LFAT 3ZC1A 1XDOA 1MIVA 1OEDB 2CMRA 2SPCA 2WZIA 3RRWA 3ZJ1A 4CN4A 2IMLA 3KV6A 4WW0A 4H9SE 2DWGA 3PUSA 1J1JA 3C50A 4DV3T 2VASA 2X51A 3AE7A 2E5VA 2XQ5A 3D0TA 3IF8B 2GK9A 3O4XE 2X68A 3NKZA 4U31A 2HPLA 1HG5A 4WNKA 5JVDE 2C5KT 1W09A 2IDOB 4Z8XA 3UUNA 1T98A 4YXDA 3PUYF 5HEOA 3S4UA 4CZZB 4ERRA 3HL6A 4B3RT 2J47A 2BZBA 5LGTB 4EXTA 1W9RA 4MALA 2LSYA 2BG9B 3PU8A 3Q2MA 4MBQA 4O4JE 3RPUA 1XDPA 2D0TA 2G0UA 3ZMSB 2C0SA 2E2AA 4TNVA 5H6RB 2I0MA 2KMFA 3AEDA 2PFVA 5F8PA 3J9X1 5L3CB 5KDMC 1CHUA 1IBKT 5AQKB 4ISTA 4LF7T 2BVLA 2L3LA 2V26A 3LG7A 4K0UA 4X1IE 4ZS3A 4AQGA 5IWAT 4AKHA 2E9XC 2KINB 3LK42 3C4WA 3NBXX 4UV8B 3RYHE 5JDLA 2V7LA 4Z91A 2CBJA 2PG8A 4PAGA 2LOPA 5J1GA 3UULA 5JTGA 3KDSE 5EK4A 5HEHA 5L47A 4QX7B 5J0ZA 4EAHA 3GN5A 1HFAA 4I55E 2WMOA 3N9NA 4ZI3C 5LP6E 4BAYB 4DIDB 2W61A 3AEFA 2YOEA 4X1KE 5LHIB 5LMNT 3ZT5A 4IE4A 2MOZA 4UVBB 2B76A 4JUYA 4YJ3E 3UFGA 5ADXL 1IBLT 2XPKA 3AAIA 3JCFA 1OEDE 2VVSA 3HA4A 1FIOA 4NUUA 1YQ4A 3WAKA 4AKRB 5L3BB 4X64T 4YSXA 5AQSB 1UCUA 2VKDA 1YXRA 4L5GA 3RH3A 3UUXB 2DL1A 3ZC0A 2LHRA 3AXJA 5LA6E 2FJBA 2LT3A 3MK7C 2D0UA 2WWVA 5HYAA 5IUXA 1N33T 2KWHA 4DO0A 3GN5B 1OXZA 4YHHT 5HXEA 4HFEA 5AQFB 5L3FB 1SA0E 2LM9A 2XQ3A 1BR1A 4DV6T 1LKXA 2UXXB 3I9WA 2CXFA 3RYFE 1QLBA 5AQMB 4BJMA 2Q9QA 3OVUA 4DV4T 5LMUT 4GOUA 1HX1B 3UU5A 1YKEB 4LMKA 3OYZA 4QH4A 4WYVA 4EZHA 5HEJA 3A5XA 2V7KA 2JQ9A 1QUUA 4ZZCA 3UU4A 5LNKA 2UXDT 5FXWA 2VWAA 2XQ9A 5JDFA 2YEVC 1OWAA 2L8KA 4L0RA 5FY1A 2C5IT 3AA6B 1XWMA 3H37A 3NZQA 2UU9T 3CMLA 2W4XA 4OFZA 4X20E 2CLYB 1BR4A 2DNXA 4HWHA 4JI5T 5AQJB 4B3ST 4B3MT 3K8PC 2Y48B 4UXNB 2NTXA 2RPAA 4Z90A 5F3JA 5LJMA 4UELA 3CQGB 5FNVE 4U74A 2M6IA 2NR4A 2LHNA 3OKQA 2ZMAA 1ZHCA 2ZM8A
chains in the Genus database with same CATH topology
5AQPB 5AQRB 5AQMB 5AQVB 3FZFB 5AQGB 3LDQB 1HX1B 1M62A 5AQNB 1UK5A 3FZMB 5AQHB 3A8YC 5AQOB 5AQIB 4HWIB 4HWCA 3FZHB 3FZLB 3M3ZB 1UGOA 1I6ZA 2D9DA 1T7SA 4HWHA 1M7KA 5AQJB 5AQSB 5AQUB 4HWDA 3FZKB 5AQKB 5AQLB 5AQQB 4HWFA 5AQTB 5AQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQP B;  5AQR B;  5AQM B;  5AQV B;  3FZF B;  5AQG B;  3LDQ B;  1HX1 B;  1M62 A;  5AQN B;  1UK5 A;  3FZM B;  5AQH B;  3A8Y C;  5AQO B;  5AQI B;  4HWI B;  4HWC A;  3FZH B;  3FZL B;  3M3Z B;  1UGO A;  1I6Z A;  2D9D A;  1T7S A;  4HWH A;  1M7K A;  5AQJ B;  5AQS B;  5AQU B;  4HWD A;  3FZK B;  5AQK B;  5AQL B;  5AQQ B;  4HWF A;  5AQT B;  5AQF B; 
#chains in the Genus database with same CATH topology
 3UU6 A;  2WCA A;  5JRC B;  4ZS2 A;  2ZM0 A;  4HFC A;  2UXN B;  2LM2 A;  5ABF B;  4DR2 T;  3W15 B;  4HFI A;  4I0U A;  2M67 A;  3F57 A;  2D2S A;  4E7Z A;  3PDY A;  2WDV A;  3PE0 A;  4TX5 A;  3N9O A;  2N9D A;  2J1D G;  2KWI B;  5AQH B;  2XQ7 A;  2BVM A;  4HFD A;  2CBI A;  3T1Y T;  5GON E;  2UUB T;  5DQV A;  4EIW A;  5HCJ A;  1H7C A;  2IC9 A;  1Z8U A;  2IAK A;  4NUV A;  3H3M A;  1D0X A;  3SWH A;  4O2B E;  3ZEF B;  2JMK A;  3AA0 B;  1O3X A;  4YHJ A;  4ADZ A;  2K9A A;  3RYC E;  2HPJ A;  1UUR A;  1WR0 A;  1YKH B;  3A7M A;  3PUV F;  4QXB B;  3T8O A;  4X1Y E;  5FXZ A;  3EI0 A;  2NW9 A;  1W0A A;  4EED A;  1WCR A;  4PW8 A;  5HXH A;  3FBZ A;  3O9X A;  5ABG A;  2FBW A;  4EYY R;  3BQL A;  4QH1 A;  2K48 A;  2V7J A;  4MHC A;  3AEC A;  2K5B B;  4YFS A;  4TV8 E;  1B7T A;  4AXP A;  3QOF A;  3Q9D A;  3N9P A;  4FI5 A;  1UK5 A;  2JPF A;  2VKJ A;  3VR9 A;  3K3Q C;  3P4R A;  1KF6 A;  4JI6 T;  3EAB A;  4IIJ E;  3TLT A;  3MJX A;  3PUX F;  4TUY E;  4GKJ T;  1AJ3 A;  4H9O C;  5KXJ A;  3EHZ A;  4HE8 A;  3ZT6 A;  5CB4 E;  3WAJ A;  3ZST A;  3Q5D A;  3OTO T;  3EAM A;  1M7K A;  4PK5 A;  2LKG A;  3P4Q A;  2XSA A;  2NW8 A;  1D1B A;  3AE5 A;  3LK2 B;  3UU8 A;  3ZYK A;  5A1L A;  4YY3 T;  3AVR A;  2L9Q A;  4IE0 A;  5AQQ B;  4LMJ A;  5AQT B;  2Y6X A;  2BS4 A;  2PTF A;  4U2Y A;  4YJ2 E;  1MMN A;  5AFU L;  1ZOY A;  2VL8 A;  1NWM X;  4OYJ A;  4CI3 B;  4PFO A;  2JQH A;  2CA5 A;  2YDR A;  4IRE A;  4COF A;  2XM2 A;  3UUM A;  3K3N A;  3RRC A;  4KMC A;  5HCM A;  2CE7 A;  1IAP A;  2JQQ A;  1S94 A;  3AE3 A;  3Q5W A;  1SHZ C;  2DLR A;  2QGS A;  5EK3 A;  4DR4 T;  3N2O A;  1XZY A;  4QWN B;  3RKG A;  1XNR T;  2BKO A;  4YLH A;  3NWI A;  4X62 T;  2A2F X;  3C98 B;  5LCY A;  5C3J A;  5LG3 A;  3PJA A;  4KHZ F;  1L0V A;  4JI8 T;  1ZV4 X;  2LJL A;  2WY2 A;  3PUQ A;  2XQY A;  4MLK A;  4O2A E;  5LOV E;  3R6N A;  3HKB E;  3JAF A;  3RQU A;  4BJN A;  2JRK A;  4WZX A;  2XQA A;  3KVB A;  4QXH B;  2W62 A;  1HR0 T;  3B57 A;  2WM9 A;  4JV5 T;  2CCQ A;  4DND A;  2E9X D;  4KI0 F;  5FP3 A;  4ASK A;  5KX5 E;  3ETU A;  5J2U E;  3F31 A;  5M4Y A;  2EHO A;  1KNZ A;  5HXR A;  1T8B A;  1CUN A;  3CIR A;  5LG4 A;  5AQP B;  4IE6 A;  2HHH T;  2A3D A;  2ODV A;  3AE6 A;  4LFC T;  3AB3 B;  3MKD A;  4IL4 A;  4ZI3 D;  3FZF B;  1FMW A;  2LKH A;  2XAS B;  2YDQ A;  4F8H A;  4JLE A;  5L3D B;  4H9Q C;  2BBJ A;  3GA8 A;  3JC6 C;  1HNX T;  4DUY T;  3MAC A;  4P1N A;  4WBO A;  5JR9 B;  5LJN A;  2X9H A;  2CPT A;  2XAF B;  3AVS A;  3F2E A;  5AQO B;  2WS3 A;  4HWC A;  4KX6 A;  1JNZ A;  1HX8 A;  1WRD A;  1QSD A;  3EVY A;  3M3Z B;  2WSS V;  3DP7 A;  3OJA A;  1IBM T;  4JYA T;  2X0H A;  3LK3 B;  2C5J A;  1BR2 A;  2V7M A;  2WBL A;  4UVA B;  2V5C A;  3UQ7 A;  2VQF T;  5LB7 B;  2NWB A;  2VL0 A;  2WU2 A;  1J5E T;  1IJ6 A;  2CXL A;  4H9N C;  5AQL B;  2XM1 A;  3VHL A;  4U7Y A;  4WBN E;  2LSG A;  4PJM A;  5JDH A;  1D1A A;  4H63 H;  1KNP A;  2WAU A;  5JR9 C;  3QB5 K;  3AEA A;  2XAH B;  3CWZ B;  2BG9 E;  4UV9 B;  2LSI A;  2XHE B;  4CN6 A;  4GYR A;  2CHN A;  4EEB A;  2PBI A;  3ZN0 B;  4CXX A;  5CJ5 A;  4LF4 T;  3L09 A;  4NPP A;  1MMA A;  5AQG B;  2E5L T;  1HG2 A;  4UR9 A;  5IYZ E;  3FXE B;  1Y64 B;  4U2Z A;  4HGA A;  3GWH A;  4HFB A;  2BG9 C;  3UFE A;  4QHO A;  5AQI B;  1E7P A;  1GQE A;  2V6Y A;  1W0B A;  3BQK A;  5LGN B;  2IW5 B;  5BR8 T;  1D0Z A;  2W67 A;  3QC9 A;  2JIW A;  1U5P A;  3ABV A;  2W0G A;  2E9X B;  2KZ7 B;  3IEE A;  1X79 A;  3AE9 A;  3SRZ A;  3QUJ A;  2JMH A;  3CK6 A;  4ANJ A;  3TKL B;  1NEK A;  2LE8 A;  3P50 A;  4CXW A;  2BS2 A;  1HTJ F;  3PUA A;  4BA9 A;  3PTR B;  3FZK B;  4EB6 E;  2CHO A;  4X5T A;  2OV9 A;  2ZM2 A;  3EDU A;  4ILU A;  5KMG P;  4AI6 A;  1ZEE A;  1WR6 A;  1HNW T;  4I50 E;  2V1D B;  1N32 T;  3KFW X;  1HS7 A;  2YU1 A;  4TV9 E;  3HR0 A;  2VK9 A;  4OK0 A;  1JNR A;  3RIU C;  4DR1 T;  4JI7 T;  5C8Y E;  5HXC A;  1OED A;  2WMN A;  3VU7 H;  2B1E A;  2IUB A;  2A72 A;  4ZZB A;  1D0Y A;  4NXM T;  4L9I A;  2ODU A;  3PUR A;  4EGW A;  4DR6 T;  3VKH A;  3AA7 B;  3NZP A;  3P4S A;  4U3C A;  3SOL A;  2DHR A;  2PJQ A;  4UVC B;  2H88 A;  3AAE B;  4GK5 E;  2FJE A;  3LJC A;  4XAX B;  3C4X A;  4B3T T;  3PV0 F;  3MZK B;  3ANW A;  3ZMT B;  1YW0 A;  2MTQ A;  2NW7 A;  3N9M A;  3HKE E;  3O1I A;  3RKO A;  4CN1 A;  2WDR A;  3O1H A;  1N34 T;  4GKK T;  2BG9 A;  4DMV A;  5ABF A;  5CFB A;  2UUC T;  2CXD A;  3TLV A;  2BKP A;  3MA9 A;  3O1J A;  2YKS A;  2H89 A;  3AEB A;  3ZYM A;  2LEH A;  3NVO A;  3AA1 B;  1G73 A;  4ZOL E;  2IIU A;  5L3E B;  2YU2 A;  1FJG T;  2H7V C;  2W63 A;  3U3I A;  2FJD A;  3KV9 A;  3G06 A;  5AQV B;  3AE2 A;  2YDS A;  1WLX A;  4AQY T;  5DAB A;  4O4H E;  3ESL A;  4IHJ E;  4A98 A;  4XBF B;  1FMV A;  2WZH A;  3DJB A;  3GMI A;  1LVF A;  2XJ7 A;  3NRY A;  3N9L A;  2J62 A;  4TN7 B;  3RIU A;  1G8X A;  3CQX C;  5HEU A;  5LBM A;  2Y8D A;  5E0O A;  3AEG A;  4QXC B;  3ZN1 B;  5JRE A;  4DUZ T;  4DV5 T;  2VVN A;  1XMQ T;  5CGM A;  5JDQ A;  2CLY C;  5L4H A;  4LF6 T;  3NRX A;  4JI0 T;  3R84 B;  2W00 A;  3B13 A;  2D9D A;  1T7S A;  2ACX A;  1X9B A;  2V5D A;  3ZT7 A;  5FVK A;  2UXB T;  2OLT A;  3SS1 A;  4U33 A;  2W66 A;  4IL9 A;  1UUS A;  2KXP B;  3RF1 A;  2VB6 A;  3JAD A;  3K1S A;  3PUG A;  3VRA A;  4GK0 E;  3I9Y A;  1MMG A;  4Q25 A;  4U7I A;  4X65 T;  4P0A A;  2QYW A;  1S35 A;  5FVL A;  2HH7 A;  3N2G E;  1MNE A;  1R8I A;  2CWY A;  2K24 A;  3ZCJ A;  2I59 A;  2NTY A;  1D1C A;  1N36 T;  1I94 T;  2CWO A;  4ZI7 E;  2EHO D;  1M62 A;  3CQC B;  4I4T E;  1VOM A;  4YTM A;  2XAG B;  3UU3 A;  1HNZ T;  1LVK A;  3I1A A;  4ZI2 C;  4DV2 T;  3ONL C;  3TLU A;  5JR9 A;  4DV7 T;  4KBM B;  3FZH B;  5IHY A;  2LOS A;  2V6Y B;  2Z6E A;  1I6Z A;  3N5L A;  2V6X A;  4TWD A;  2YIN A;  3FB2 A;  2F4V T;  4B6X A;  2A9U A;  4CI2 B;  2XQ6 A;  4G63 A;  3CX8 B;  3L3P A;  2Q9Q B;  3KV5 A;  3M65 A;  5LBQ B;  4GIW A;  3IBP A;  4EV6 A;  1V9D A;  5HWX A;  4M1P A;  5JRC A;  5ETW A;  3KV4 A;  4NXN T;  2UUA T;  4HN9 A;  2MBG A;  4F6R C;  2WDQ A;  2X0Y A;  3JC6 D;  1XNQ T;  5AQR B;  3JAE A;  2VKH A;  4UEM A;  4TZ4 C;  3RX6 A;  3UQ4 A;  3RI5 A;  3WI3 A;  3J7Y q;  2J4G A;  2JQK A;  4YTP A;  2RA1 A;  5JDN A;  4IDZ A;  4K0K T;  4MFR A;  3UT5 E;  5J2T E;  1VCT A;  2CRB A;  2XY8 B;  1HF8 A;  3AAA B;  3A8Y C;  3AXJ B;  1MIW A;  4G2A A;  4UIG A;  5L2L A;  2EHO C;  2XQ8 A;  3MXZ A;  3AEE A;  4HWI B;  1Y01 A;  1UGO A;  2E9X A;  2D5U A;  3V5S A;  4ZI2 D;  1KFY A;  2VKO A;  1ZP0 A;  1DU2 A;  1WYC A;  3C4Z A;  2OA5 A;  4H9P C;  1BR0 A;  4HEA A;  1KK7 A;  2RP4 A;  4HFV A;  5CA1 E;  3SFE A;  2K3W A;  1E2A A;  4PJJ A;  4TWF A;  4AIS A;  2LSK A;  3H3A A;  4HWD A;  4TWH A;  4XZC A;  4ZEY A;  5FXX A;  5HXS A;  4IDO A;  3DTO A;  2X67 A;  3CKD A;  4FJO A;  4KHP T;  3ANW B;  2R6G F;  3I0O A;  3ZMU B;  2XZE A;  3I0Q A;  5TAO A;  3LBX A;  2ACZ A;  1NEN A;  2YN6 A;  3ZMZ B;  3KIN B;  3P7I A;  4NIQ A;  3PUZ F;  1EZ3 A;  4J2C A;  5HAX A;  3UUB A;  3ZMV B;  4DBQ A;  2BBH A;  3LDQ B;  4DBR A;  5EK2 A;  4JI3 T;  2XUE A;  4C90 A;  4V1A v;  2X0L B;  3FXD B;  4IDP A;  2XSB A;  3ZCI A;  3ONJ A;  2HN2 A;  2LLY A;  1Z0P A;  4ZXL A;  4KP3 C;  4IDN A;  2DWK A;  2FJA A;  5H6Q B;  4IT4 A;  2M6B A;  4PJL A;  3KVA A;  1FEW A;  3BQI A;  3UTK A;  3P8C D;  2QRX A;  3ETV A;  1XMO T;  3TLW A;  4IE5 A;  5FL1 A;  1WYB A;  2YK0 A;  3OBV E;  4OYK A;  4IDQ A;  2NP9 A;  1MIY A;  2V7I A;  5AQU B;  4A56 A;  1MMD A;  4YSZ A;  2ES0 A;  2ZLY A;  3K3O A;  2E8I A;  3N2K E;  1OED C;  4HKA A;  4HWF A;  2N2N A;  3KBU A;  2VUR A;  4QKN A;  3ZLI A;  1HCI A;  2MYS A;  1VCS A;  2V8S V;  3PUW F;  5F5W A;  3RLF F;  4H9R C;  1MND A;  2KT9 A;  3ZJ2 A;  4YTN A;  2KLQ A;  5LHH B;  3EUH A;  1YQ3 A;  3IHR A;  3OYX A;  4ILA A;  3ZKR A;  5BMV E;  3Q5X A;  5FKY A;  2IHR 1;  3LFM A;  3HKC E;  4EZ4 A;  1J5W A;  3LSV A;  2MAW A;  5DQW A;  5JH7 E;  5AQN B;  1IJ5 A;  1T72 A;  4AIU A;  3FZM B;  4YT0 A;  4O4L E;  3FBL A;  4P09 A;  4AQF A;  3RQW A;  2WQY A;  4HFH A;  3RC3 A;  3KBT A;  2LRL A;  3OPC A;  3FZL B;  5C2T A;  2DCF A;  2NOX A;  1NAF A;  2VQE T;  4LF5 T;  3ONX A;  4QX8 B;  3PJA J;  4DR7 T;  1KEY A;  3AE1 A;  2CM0 A;  3CX7 B;  3EDV A;  1VRB A;  3C64 A;  5FY0 A;  3RIA A;  2ZM6 T;  3E0Z A;  3AE4 A;  4DR3 T;  3ZYL A;  4I43 B;  3VR8 A;  5CA0 E;  3RYI E;  3ZSS A;  2IC6 A;  4HTE A;  1KNR A;  2X9W A;  2XTL A;  5FXV A;  3QK6 A;  3U78 A;  2Q9Q C;  5L3G B;  2N1G A;  5JDG A;  2WU5 A;  3SFD A;  4QH5 A;  5FMN A;  1UX4 A;  5HWY A;  3V5U A;  4JI4 T;  3E08 A;  2QA7 A;  2WB5 A;  2I6H A;  2H7O A;  3BK9 A;  1UX5 A;  5L4E A;  4O8S A;  4IE7 A;  1U4Q A;  4JBW F;  4AKL A;  4ILB A;  3E22 E;  5LYJ E;  2W2U A;  3TLS A;  4IGU A;  4TNW A;  2WWU A;  4PFP A;  3QNU A;  2XAQ B;  3LBX B;  4DMW A;  2MPK A;  3C51 A;  4PJN A;  3RGL A;  3VRB A;  5JQG E;  3IA3 A;  4DV0 T;  1IZN B;  2EHO B;  3HI2 A;  4EOZ B;  4X66 T;  5FL0 A;  3AE8 A;  4CI1 B;  2LRK A;  2XQ4 A;  4PK4 A;  4JI1 T;  4LFB T;  2AE9 A;  2KSR A;  3FHN A;  4LML A;  3ZPO A;  4N78 D;  4A97 A;  3X1D A;  4GYS A;  4UF0 B;  3L8R A;  1ZKE A;  5HEG A;  3T1H T;  2BDE A;  5JDM A;  4JEU B;  3HKD E;  2LSJ A;  2BKN A;  2P9B A;  1E1H B;  1LRZ A;  2BS3 A;  3QB5 A;  1WFD A;  3B5M A;  3N9Q A;  2AXD S;  4H63 V;  4YSY A;  3RC8 A;  2Q9Q D;  3P4P A;  4U72 A;  3CVR A;  4A5X A;  4AQF C;  4C91 A;  5LGU B;  5LHG B;  4PNI A;  4LF8 T;  4JI2 T;  3P4W A;  4DR5 T;  4KUM B;  1SE7 A;  5EZY E;  2X9X A;  3Q5E A;  3RIF A;  4EYU A;  3VKG A;  1YD8 G;  1US7 B;  2JJ9 A;  4E7S A;  4DVD A;  2KND A;  4P0B A;  2CEA A;  3RHW A;  5LXT E;  2XAJ B;  3L39 A;  4ILC A;  4O4I E;  4OHF A;  5FY7 A;  4UF0 A;  4CXY A;  5ABH A;  2WP9 A;  4DV1 T;  2DI4 A;  4PK6 A;  2X66 A;  4AKG A;  4ZHQ E;  4CQI A;  5ABE A;  2HN1 A;  4AKI A;  1SUM B;  4ISS A;  2H3R A;  4OX9 T;  4JEH B;  5FYM A;  5DJQ C;  2FUP A;  2QVA A;  2X9Y A;  3CX6 B;  2UXC T;  3CPZ A;  3PU3 A;  4LF9 T;  4LFA T;  3ZC1 A;  1XDO A;  1MIV A;  1OED B;  2CMR A;  2SPC A;  2WZI A;  3RRW A;  3ZJ1 A;  4CN4 A;  2IML A;  3KV6 A;  4WW0 A;  4H9S E;  2DWG A;  3PUS A;  1J1J A;  3C50 A;  4DV3 T;  2VAS A;  2X51 A;  3AE7 A;  2E5V A;  2XQ5 A;  3D0T A;  3IF8 B;  2GK9 A;  3O4X E;  2X68 A;  3NKZ A;  4U31 A;  2HPL A;  1HG5 A;  4WNK A;  5JVD E;  2C5K T;  1W09 A;  2IDO B;  4Z8X A;  3UUN A;  1T98 A;  4YXD A;  3PUY F;  5HEO A;  3S4U A;  4CZZ B;  4ERR A;  3HL6 A;  4B3R T;  2J47 A;  2BZB A;  5LGT B;  4EXT A;  1W9R A;  4MAL A;  2LSY A;  2BG9 B;  3PU8 A;  3Q2M A;  4MBQ A;  4O4J E;  3RPU A;  1XDP A;  2D0T A;  2G0U A;  3ZMS B;  2C0S A;  2E2A A;  4TNV A;  5H6R B;  2I0M A;  2KMF A;  3AED A;  2PFV A;  5F8P A;  3J9X 1;  5L3C B;  5KDM C;  1CHU A;  1IBK T;  5AQK B;  4IST A;  4LF7 T;  2BVL A;  2L3L A;  2V26 A;  3LG7 A;  4K0U A;  4X1I E;  4ZS3 A;  4AQG A;  5IWA T;  4AKH A;  2E9X C;  2KIN B;  3LK4 2;  3C4W A;  3NBX X;  4UV8 B;  3RYH E;  5JDL A;  2V7L A;  4Z91 A;  2CBJ A;  2PG8 A;  4PAG A;  2LOP A;  5J1G A;  3UUL A;  5JTG A;  3KDS E;  5EK4 A;  5HEH A;  5L47 A;  4QX7 B;  5J0Z A;  4EAH A;  3GN5 A;  1HFA A;  4I55 E;  2WMO A;  3N9N A;  4ZI3 C;  5LP6 E;  4BAY B;  4DID B;  2W61 A;  3AEF A;  2YOE A;  4X1K E;  5LHI B;  5LMN T;  3ZT5 A;  4IE4 A;  2MOZ A;  4UVB B;  2B76 A;  4JUY A;  4YJ3 E;  3UFG A;  5ADX L;  1IBL T;  2XPK A;  3AAI A;  3JCF A;  1OED E;  2VVS A;  3HA4 A;  1FIO A;  4NUU A;  1YQ4 A;  3WAK A;  4AKR B;  5L3B B;  4X64 T;  4YSX A;  5AQS B;  1UCU A;  2VKD A;  1YXR A;  4L5G A;  3RH3 A;  3UUX B;  2DL1 A;  3ZC0 A;  2LHR A;  3AXJ A;  5LA6 E;  2FJB A;  2LT3 A;  3MK7 C;  2D0U A;  2WWV A;  5HYA A;  5IUX A;  1N33 T;  2KWH A;  4DO0 A;  3GN5 B;  1OXZ A;  4YHH T;  5HXE A;  4HFE A;  5AQF B;  5L3F B;  1SA0 E;  2LM9 A;  2XQ3 A;  1BR1 A;  4DV6 T;  1LKX A;  2UXX B;  3I9W A;  2CXF A;  3RYF E;  1QLB A;  5AQM B;  4BJM A;  2Q9Q A;  3OVU A;  4DV4 T;  5LMU T;  4GOU A;  1HX1 B;  3UU5 A;  1YKE B;  4LMK A;  3OYZ A;  4QH4 A;  4WYV A;  4EZH A;  5HEJ A;  3A5X A;  2V7K A;  2JQ9 A;  1QUU A;  4ZZC A;  3UU4 A;  5LNK A;  2UXD T;  5FXW A;  2VWA A;  2XQ9 A;  5JDF A;  2YEV C;  1OWA A;  2L8K A;  4L0R A;  5FY1 A;  2C5I T;  3AA6 B;  1XWM A;  3H37 A;  3NZQ A;  2UU9 T;  3CML A;  2W4X A;  4OFZ A;  4X20 E;  2CLY B;  1BR4 A;  2DNX A;  4HWH A;  4JI5 T;  5AQJ B;  4B3S T;  4B3M T;  3K8P C;  2Y48 B;  4UXN B;  2NTX A;  2RPA A;  4Z90 A;  5F3J A;  5LJM A;  4UEL A;  3CQG B;  5FNV E;  4U74 A;  2M6I A;  2NR4 A;  2LHN A;  3OKQ A;  2ZMA A;  1ZHC A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 5AQP B;  5AQR B;  5AQM B;  5AQV B;  3FZF B;  5AQG B;  3LDQ B;  1HX1 B;  1M62 A;  5AQN B;  1UK5 A;  3FZM B;  5AQH B;  3A8Y C;  5AQO B;  5AQI B;  4HWI B;  4HWC A;  3FZH B;  3FZL B;  3M3Z B;  1UGO A;  1I6Z A;  2D9D A;  1T7S A;  4HWH A;  1M7K A;  5AQJ B;  5AQS B;  5AQU B;  4HWD A;  3FZK B;  5AQK B;  5AQL B;  5AQQ B;  4HWF A;  5AQT B;  5AQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...