5AQFB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 46
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqfB00
3FZFB 3M3ZB 4HWCA 4HWIB 3FZLB 5AQNB 5AQRB 3FZMB 5AQPB 5AQFB 5AQLB 1I6ZA 1UGOA 5AQTB 5AQOB 3A8YC 5AQMB 3LDQB 1HX1B 4HWDA 5AQHB 5AQGB 5AQKB 1UK5A 4HWHA 1M62A 5AQIB 4HWFA 3FZHB 5AQQB 2D9DA 1T7SA 1M7KA 5AQSB 5AQVB 5AQJB 5AQUB 3FZKB
chains in the Genus database with same CATH superfamily
2X9YA 4HWCA 4DO0A 3K8PC 4J2CA 5L4EA 2YU2A 3PUYF 2GK9A 4OYJA 4DV6T 1BR2A 2LSGA 4HTEA 4B6XA 4X64T 2QYWA 5IHYA 4KBMB 4O4JE 4A98A 5ABFB 3DTOA 3K3QC 2KZ7B 2VURA 2D0UA 4HFVA 4AISA 5JDGA 5JR9C 1D0ZA 4MALA 3MACA 2XQAA 4DV1T 3NRYA 3FB2A 1N34T 2WU5A 2A72A 1T98A 2E9XB 3BQLA 3DJBA 4U7IA 3E22E 3QUJA 4GK0E 2LJLA 3EVYA 3HKEE 2VL8A 1KNZA 2NOXA 4U3CA 4QX7B 1VOMA 4ZI7E 4DR5T 2XQ5A 2NW7A 1MIYA 3JC6D 3AEBA 3AVRA 4WBNE 4K0UA 2EHOC 1WFDA 3GMIA 5JR9A 3ZYMA 2QVAA 3FZLB 3ZMSB 5FY0A 4ZI2D 1WCRA 5F3JA 3AAEB 4LFBT 3AE2A 1WR0A 5FYMA 4NXMT 4JV5T 1Y01A 2JQ9A 3L39A 1ZHCA 4UR9A 2X9WA 3CQXC 3CX7B 5AQLB 2CE7A 1XDOA 4ZI2C 5LA6E 1IBMT 4ZZBA 2WQYA 1D1AA 2FUPA 3ZCJA 2V8SV 2LHRA 2DNXA 1S94A 5HEGA 4YTNA 5KXJA 1N36T 2BZBA 2PTFA 1E2AA 3AEFA 4UV8B 4P09A 4JI3T 3GN5B 4AKHA 4DR1T 1XDPA 1JNRA 2NTXA 3UUNA 2EHOA 3N9NA 4QX8B 3G06A 5ABEA 3B57A 4GKJT 4YFSA 5LCYA 3SS1A 5DQWA 5IYZE 1VCTA 1B7TA 5JDNA 1US7B 3RQUA 1QSDA 1ZEEA 2W4XA 2WWUA 4XAXB 3T8OA 3UT5E 3ABVA 2LSYA 4I0UA 2IW5B 3RKOA 1SA0E 4CQIA 1XNQT 3DP7A 2ZM0A 2A9UA 3LBXB 3P4PA 4UXNB 3RPUA 4EOZB 5HEUA 4JUYA 3OYXA 2X9HA 5CA1E 4CZZB 4IT4A 5J0ZA 1U5PA 2D0TA 1MMGA 5BMVE 3RRWA 4PK5A 2BKNA 2W61A 4PJJA 3TLWA 3MZKB 3F31A 3V5SA 3N2KE 5LBMA 2J62A 5AQMB 2DI4A 2V5CA 2LRKA 3JADA 4IDNA 2KWHA 2QA7A 4JBWF 5CJ5A 1HFAA 3Q5WA 1BR4A 3P50A 3VU7H 4LF5T 5J2TE 2WM9A 2X68A 3K1SA 3OBVE 3NKZA 3AA0B 1T8BA 1G73A 3WAKA 4EIWA 2FJAA 2ZLYA 3PJAA 2XAFB 2XQ6A 5ADXL 3O9XA 4TWHA 4CI3B 3AXJA 4IE5A 4Z91A 5HEOA 4DIDB 3CWZB 3UU5A 2XAGB 5L2LA 4H9PC 4K0KT 4H9OC 3ONLC 1BR1A 3C4ZA 4UEMA 1HTJF 2KXPB 3FZMB 3RI5A 4DV0T 1HNZT 3I9WA 3ZMUB 4B3TT 4AKGA 2LSJA 1IAPA 2BG9E 3JCFA 5LMNT 4QXBB 4HKAA 1W0BA 1Y64B 4EB6E 2BS2A 5HYAA 1IJ6A 1MIVA 2W66A 3OVUA 2MAWA 4UV9B 3PDYA 3X1DA 3AECA 2UUAT 1LVFA 2BKOA 3AE4A 2WMOA 3OPCA 1FJGT 2H7VC 1OEDA 5KDMC 4I50E 1HS7A 2R6GF 3NZQA 4NPPA 4IGUA 1IBKT 2BS4A 2XY8B 4P1NA 4PJMA 2CWYA 1UUSA 2LSKA 3OKQA 4AIUA 2HPLA 4CI1B 4GYSA 2FBWA 2EHOD 3TKLB 2HHHT 2VVNA 2RPAA 1QLBA 4IHJE 2KMFA 1SUMB 5LHHB 5HCJA 4HN9A 2LLYA 3OYZA 3R6NA 4ZI3D 2WSSV 3JAFA 1D0YA 1G8XA 2JQKA 4X1IE 4EAHA 4YTPA 3WAJA 3CMLA 4UF0B 3I1AA 3CIRA 5AQRB 2A2FX 3MJXA 3FHNA 3K3OA 2UU9T 4DR4T 5IUXA 5LNKA 2UUCT 3LSVA 3N2GE 3WI3A 5JDLA 2WCAA 4X1YE 2V1DB 4AQFA 1HG5A 3QC9A 2WY2A 4MFRA 2BDEA 2XAQB 2WAUA 2XQ8A 2LKHA 3JC6C 4U31A 3A8YC 2LRLA 2Y6XA 4AQGA 4JYAT 4YTMA 4A56A 4YY3T 4ILAA 4HFDA 4OYKA 5AQKB 4ADZA 2RA1A 3J7Yq 5LMUT 4DR6T 5E0OA 4LF7T 5AQIB 5AQQB 4WZXA 5C3JA 3UU4A 4E7SA 4GIWA 3RQWA 4DBQA 4DUYT 4H63V 5C2TA 3RKGA 1W9RA 2VB6A 2WDQA 3AAIA 3I0QA 3B5MA 2VQFT 4ZZCA 2MYSA 3FZKB 2V7IA 2VKHA 2WZIA 3BK9A 3ONJA 3F57A 2CEAA 1IJ5A 3MKDA 4O4LE 4Q25A 3RC3A 4AKRB 3KDSE 2VQET 2C0SA 4KHZF 3UFGA 5EK3A 5DQVA 5FL0A 3ZSTA 4P0AA 2YDQA 4LF9T 2HN1A 5TAOA 5C8YE 5LGTB 2W67A 4C90A 4AKIA 5JTGA 3EAMA 4EYUA 3AE6A 2OLTA 4A5XA 4H9SE 4I55E 2BBHA 3PE0A 2E5VA 4HFBA 2XAJB 2L8KA 2YOEA 3PUVF 1HX1B 1ZP0A 3AEAA 3PV0F 3VHLA 4TV9E 4EEDA 2V26A 3C51A 4G63A 4JLEA 4NXNT 4FI5A 3LFMA 2DWGA 4ZOLE 1HCIA 1W09A 2A3DA 3VR8A 2LOSA 2BBJA 4N78D 4DVDA 1O3XA 2VVSA 4ZHQE 1MNEA 4IDPA 4ISTA 5JQGE 4JI6T 2YINA 4AXPA 3RIUA 1NAFA 4LF8T 1NEKA 2YKSA 5AQUB 2W0GA 2WBLA 2YN6A 2K3WA 1OEDB 3ZYLA 1NENA 5LHGB 2D2SA 4ILBA 3AXJB 4EGWA 3CPZA 1H7CA 3RGLA 3HR0A 2I0MA 1MIWA 2V7LA 3PUGA 3PUQA 4H9QC 4OHFA 2XJ7A 2BS3A 2I59A 3AE7A 3RYHE 2WS3A 3AEDA 4HE8A 5LJMA 3M65A 5LBQB 2C5IT 1UGOA 2CXFA 2VKJA 2Y48B 1KF6A 3QOFA 4DV2T 3ONXA 2WB5A 2V5DA 2KLQA 4UELA 1LRZA 3AE9A 2LEHA 5FVKA 3ZC1A 4YSYA 4JI4T 3CKDA 2LM9A 3LJCA 4O2AE 5ABGA 5L3DB 3C64A 3PU3A 4MLKA 4LFAT 2CHNA 2X0HA 3PUXF 4HFCA 5ETWA 5HXCA 1D1BA 3PUSA 2N2NA 4KX6A 3RHWA 4UVBB 1Z0PA 2JQQA 3N9MA 2IC9A 4GYRA 4CI2B 2DL1A 4B3ST 2AXDS 4JI7T 2UXBT 5JRCB 4TWFA 1WYBA 2UUBT 1WYCA 1YW0A 2IDOB 3FZFB 3M3ZB 3NRXA 3RLFF 2UXDT 4TNVA 2Q9QB 4UIGA 3ZMZB 4DR7T 5CFBA 3UTKA 3H3MA 4G2AA 5J1GA 5AFUL 4EEBA 1FMVA 1SHZC 1V9DA 5CA0E 1WR6A 1HF8A 2NR4A 4DV3T 2V7JA 4QXCB 4KUMB 2H89A 3K3NA 2E9XD 4I43B 2BKPA 4QWNB 4PFPA 1IBLT 2JIWA 3RC8A 5H6RB 1J5WA 4HWDA 4L5GA 4NIQA 4YSZA 4DMWA 3OTOT 2WU2A 3MXZA 3RH3A 1YXRA 4X66T 1DU2A 2LE8A 2D9DA 2N1GA 4H63H 2K48A 3LBXA 5J2UE 3PUWF 2QRXA 3VR9A 1UX5A 4P0BA 1X9BA 4DR3T 2WMNA 1HNXT 2Y8DA 2XQ9A 3AE3A 3ANWB 3IA3A 3AB3B 1CUNA 3IF8B 3O1HA 3B13A 4KP3C 2YU1A 4U7YA 5L4HA 4YXDA 5L47A 1AJ3A 3RF1A 2IC6A 4TUYE 2XQ3A 5LB7B 3UUXB 5AQPB 2DCFA 1SE7A 5M4YA 2NW8A 4GK5E 3Q9DA 4ILUA 5JDHA 2XPKA 1OEDE 4PJNA 3O1JA 2MTQA 3I0OA 2K5BB 4Z90A 3T1YT 1HR0T 4QHOA 2OV9A 4ZS3A 3HL6A 3UULA 2E2AA 3GA8A 2KT9A 3AEEA 3W15B 2B76A 1ZOYA 2KNDA 4WW0A 2E9XA 2H3RA 2IAKA 1MMDA 3QB5K 5LOVE 4H9RC 4BAYB 3RYFE 2CRBA 3EDVA 3A5XA 2YDSA 2K24A 3P4RA 4HWHA 1EZ3A 2LM2A 4TWDA 3D0TA 4U72A 3H3AA 5DABA 4HFHA 5FXXA 4Z8XA 3U3IA 3UFEA 3ESLA 3ZLIA 4OFZA 5FY1A 5HXEA 4DV7T 4HEAA 3ZC0A 1D1CA 2ES0A 3UUBA 1NWMX 4ZI3C 4IE4A 2XQYA 4F6RC 1CHUA 1FEWA 2P9BA 3HKCE 4HWIB 2VL0A 1OEDC 5AQNB 3U78A 2IHR1 5JR9B 3CX8B 1UCUA 2JPFA 2ZM6T 1VCSA 3CQCB 2PFVA 2NP9A 4PFOA 5LGUB 1D0XA 5CGMA 3P4WA 5LHIB 4O8SA 3LK3B 3N9QA 4TZ4C 4CXYA 5LGNB 3IEEA 2M6IA 3A7MA 2M6BA 4JI1T 3KV5A 5AQOB 1HNWT 2C5JA 1HG2A 1GQEA 3MK7C 4MBQA 4LF6T 5AQHB 1XNRT 3PUAA 1YQ4A 4CN4A 2XUEA 3KBUA 2UXNB 4LFCT 2ZMAA 5EZYE 3N9OA 3BQIA 4UF0A 4X5TA 2X67A 2XSAA 1FIOA 2ZM8A 3MA9A 4ZS2A 1YKEB 4LMKA 5JDQA 3RX6A 2UXXB 1M7KA 3FBLA 4LMJA 4QH5A 2D5UA 3NVOA 5FVLA 4WBOA 2AE9A 4PAGA 2W00A 2PJQA 1BR0A 1QUUA 4PNIA 3NZPA 4TX5A 2XSBA 1MMAA 4DMVA 5HWYA 5FXZA 3UQ7A 5JDMA 4YJ3E 3UU6A 5GONE 1XMQT 3ETVA 4DV5T 5HEHA 5LG3A 2IMLA 3FXEB 2CLYB 3KV6A 1E1HB 2G0UA 2BG9C 4IL4A 4QH1A 4TNWA 4EYYR 2CHOA 1KNPA 2XHEB 4HFEA 2H88A 3S4UA 3KVBA 2V6YA 4TV8E 2OA5A 5JREA 3LG7A 5A1LA 3EUHA 1M62A 2ODVA 3L3PA 5KMGP 3AA7B 3ZMTB 2XM1A 2J1DG 4X20E 5KX5E 3PTRB 2CCQA 3ZT7A 3ZN0B 1J1JA 1MMNA 2VKDA 3H37A 2UXCT 3OJAA 4OX9T 3L8RA 5AQSB 2WZHA 4U2YA 2B1EA 4NUUA 5LP6E 4X65T 3HA4A 3TLTA 5LXTE 2YDRA 2BG9A 3UQ4A 3Q5DA 3UU8A 4KMCA 3ZYKA 3AVSA 3KBTA 2BG9B 2K9AA 2DHRA 2HPJA 3C4XA 3SFDA 3FBZA 2X66A 4XZCA 1WRDA 2HN2A 5JH7E 4L0RA 3AA6B 2MPKA 2ACXA 3KVAA 3VRAA 3GWHA 4TN7B 3UU3A 2VKOA 4ZXLA 3RIUC 2V7MA 3SRZA 3C98B 1FMWA 2DLRA 1YKHB 3R84B 2RP4A 5F8PA 1KK7A 1UK5A 5FKYA 2WWVA 1J5ET 2DWKA 2X0YA 2X9XA 1T72A 2M67A 3BQKA 3FZHB 3N9PA 5H6QB 3KINB 5IWAT 2VASA 3ZEFB 4BA9A 4IREA 5FMNA 4GKKT 2WDRA 3RYIE 1IZNB 3C50A 2XTLA 5AQVB 3TLSA 3E0ZA 1I94T 2CA5A 3ZCIA 4IDQA 2NWBA 3CQGB 4BJMA 2VK9A 3I9YA 2EHOB 4DNDA 5ABHA 4IE7A 4FJOA 2Q9QC 3C4WA 3ZJ2A 2MOZA 3SWHA 1X79A 2FJDA 4CN1A 2E5LT 3RIFA 4KI0F 3SOLA 4EXTA 5FP3A 2Q9QD 3NBXX 4EZ4A 5EK2A 2MBGA 4ISSA 3FXDB 3VRBA 4JI0T 4YHHT 2XM2A 3HI2A 2XASB 2CMRA 3NWIA 4IIJE 3O1IA 2Z6EA 1XWMA 4PW8A 4KHPT 3ZN1B 2LOPA 3ETUA 3ZT5A 3PUZF 3QB5A 4QKNA 1UURA 4JEUB 2Q9QA 5L3BB 1T7SA 1XZYA 5LYJE 3Q5EA 4PJLA 2LHNA 2W62A 1L0VA 2X51A 4AI6A 2LSIA 2JJ9A 3V5UA 3QNUA 5L3EB 4X62T 5L3FB 2BVMA 2V6YB 2XQ7A 5FXWA 3KV9A 3PJAJ 4MHCA 2ACZA 3P8CD 3P7IA 1ZV4X 5AQFB 5DJQC 2CXLA 4B3RT 2WDVA 4V1Av 1N32T 3VKGA 2X0LB 5EK4A 3ZT6A 2CBJA 3CVRA 4YSXA 1UX4A 5L3GB 2IUBA 2JMHA 3EDUA 2PBIA 3AEGA 2QGSA 3O4XE 1I6ZA 4I4TE 4IDOA 3KV4A 5AQTB 3AE5A 1W0AA 2W2UA 3EHZA 5HAXA 3LDQB 4M1PA 4CXXA 3AE1A 1OWAA 4YLHA 5HXRA 4JEHB 2FJEA 5F5WA 4EV6A 4LF4T 3AAAB 2F4VT 2ZM2A 3CX6B 3N2OA 3N9LA 4HGAA 1LKXA 2CM0A 4L9IA 2L3LA 5FY7A 4DV4T 3ZSSA 4DUZT 4BJNA 2NTYA 3HKBE 3KFWX 2JRKA 5FXVA 3ZKRA 3E08A 4YT0A 4IL9A 2JMKA 4E7ZA 2BVLA 2J47A 4LMLA 2HH7A 2E9XC 1R8IA 3ANWA 5BR8T 1Z8UA 2CPTA 4OK0A 4JI5T 5FNVE 2JQHA 4COFA 4O4HE 2I6HA 4ILCA 2L9QA 4XBFB 1S35A 2W63A 3N5LA 4DBRA 5JRCA 1YQ3A 3J9X1 1KNRA 1KEYA 1E7PA 3IHRA 5HXHA 2CXDA 4A97A 3GN5A 5HWXA 2CBIA 2J4GA 3EABA 2LT3A 1LVKA 1VRBA 2PG8A 2KWIB 1MNDA 2WP9A 3HKDE 3TLUA 4CXWA 4EZHA 5AQGB 4WYVA 2ODUA 4O2BE 3JAEA 3EI0A 4ANJA 3ZMVB 1ZKEA 5FL1A 5HXSA 4AQFC 3RYCE 2YEVC 4F8HA 3UUMA 3VKHA 4YJ2E 4B3MT 4U74A 2LKGA 2KINB 2VWAA 5AQJB 4AKLA 5JDFA 4NUVA 5LG4A 4WNKA 2H7OA 5LJNA 2CWOA 3AA1B 3LK42 3P4QA 4UVAB 3LK2B 4JI2T 1U4QA 2SPCA 3Q5XA 2XQ4A 2V7KA 3RRCA 2CLYC 3IBPA 4CN6A 5HEJA 3AE8A 2YK0A 4X1KE 5CB4E 5L3CB 3Q2MA 1HX8A 3P4SA 2NW9A 3T1HT 1KFYA 3CK6A 4PK6A 4QH4A 4ZEYA 3TLVA 4JI8T 2N9DA 1YD8G 4ERRA 4U33A 2V6XA 2IIUA 4IDZA 1XMOT 3PURA 4AQYT 3PU8A 1JNZA 4IE6A 4ASKA 3L09A 4C91A 5ABFA 2C5KT 4IE0A 4HWFA 4PK4A 3F2EA 2E8IA 4GOUA 4YHJA 4O4IE 3ZJ1A 2FJBA 4HFIA 3QK6A 5HCMA 3ZPOA 4U2ZA 3SFEA 2XAHB 5JVDE 2KSRA 4QXHB 4UVCB 2XZEA 1WLXA 4H9NC 1N33T 3RIAA 4DR2T 1OXZA
chains in the Genus database with same CATH topology
3FZFB 3M3ZB 4HWCA 4HWIB 3FZLB 5AQNB 5AQRB 3FZMB 5AQPB 5AQFB 5AQLB 1I6ZA 1UGOA 5AQTB 5AQOB 3A8YC 5AQMB 3LDQB 1HX1B 4HWDA 5AQHB 5AQGB 5AQKB 1UK5A 4HWHA 1M62A 5AQIB 4HWFA 3FZHB 5AQQB 2D9DA 1T7SA 1M7KA 5AQSB 5AQVB 5AQJB 5AQUB 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZF B;  3M3Z B;  4HWC A;  4HWI B;  3FZL B;  5AQN B;  5AQR B;  3FZM B;  5AQP B;  5AQF B;  5AQL B;  1I6Z A;  1UGO A;  5AQT B;  5AQO B;  3A8Y C;  5AQM B;  3LDQ B;  1HX1 B;  4HWD A;  5AQH B;  5AQG B;  5AQK B;  1UK5 A;  4HWH A;  1M62 A;  5AQI B;  4HWF A;  3FZH B;  5AQQ B;  2D9D A;  1T7S A;  1M7K A;  5AQS B;  5AQV B;  5AQJ B;  5AQU B;  3FZK B; 
#chains in the Genus database with same CATH topology
 2X9Y A;  4HWC A;  4DO0 A;  3K8P C;  4J2C A;  5L4E A;  2YU2 A;  3PUY F;  2GK9 A;  4OYJ A;  4DV6 T;  1BR2 A;  2LSG A;  4HTE A;  4B6X A;  4X64 T;  2QYW A;  5IHY A;  4KBM B;  4O4J E;  4A98 A;  5ABF B;  3DTO A;  3K3Q C;  2KZ7 B;  2VUR A;  2D0U A;  4HFV A;  4AIS A;  5JDG A;  5JR9 C;  1D0Z A;  4MAL A;  3MAC A;  2XQA A;  4DV1 T;  3NRY A;  3FB2 A;  1N34 T;  2WU5 A;  2A72 A;  1T98 A;  2E9X B;  3BQL A;  3DJB A;  4U7I A;  3E22 E;  3QUJ A;  4GK0 E;  2LJL A;  3EVY A;  3HKE E;  2VL8 A;  1KNZ A;  2NOX A;  4U3C A;  4QX7 B;  1VOM A;  4ZI7 E;  4DR5 T;  2XQ5 A;  2NW7 A;  1MIY A;  3JC6 D;  3AEB A;  3AVR A;  4WBN E;  4K0U A;  2EHO C;  1WFD A;  3GMI A;  5JR9 A;  3ZYM A;  2QVA A;  3FZL B;  3ZMS B;  5FY0 A;  4ZI2 D;  1WCR A;  5F3J A;  3AAE B;  4LFB T;  3AE2 A;  1WR0 A;  5FYM A;  4NXM T;  4JV5 T;  1Y01 A;  2JQ9 A;  3L39 A;  1ZHC A;  4UR9 A;  2X9W A;  3CQX C;  3CX7 B;  5AQL B;  2CE7 A;  1XDO A;  4ZI2 C;  5LA6 E;  1IBM T;  4ZZB A;  2WQY A;  1D1A A;  2FUP A;  3ZCJ A;  2V8S V;  2LHR A;  2DNX A;  1S94 A;  5HEG A;  4YTN A;  5KXJ A;  1N36 T;  2BZB A;  2PTF A;  1E2A A;  3AEF A;  4UV8 B;  4P09 A;  4JI3 T;  3GN5 B;  4AKH A;  4DR1 T;  1XDP A;  1JNR A;  2NTX A;  3UUN A;  2EHO A;  3N9N A;  4QX8 B;  3G06 A;  5ABE A;  3B57 A;  4GKJ T;  4YFS A;  5LCY A;  3SS1 A;  5DQW A;  5IYZ E;  1VCT A;  1B7T A;  5JDN A;  1US7 B;  3RQU A;  1QSD A;  1ZEE A;  2W4X A;  2WWU A;  4XAX B;  3T8O A;  3UT5 E;  3ABV A;  2LSY A;  4I0U A;  2IW5 B;  3RKO A;  1SA0 E;  4CQI A;  1XNQ T;  3DP7 A;  2ZM0 A;  2A9U A;  3LBX B;  3P4P A;  4UXN B;  3RPU A;  4EOZ B;  5HEU A;  4JUY A;  3OYX A;  2X9H A;  5CA1 E;  4CZZ B;  4IT4 A;  5J0Z A;  1U5P A;  2D0T A;  1MMG A;  5BMV E;  3RRW A;  4PK5 A;  2BKN A;  2W61 A;  4PJJ A;  3TLW A;  3MZK B;  3F31 A;  3V5S A;  3N2K E;  5LBM A;  2J62 A;  5AQM B;  2DI4 A;  2V5C A;  2LRK A;  3JAD A;  4IDN A;  2KWH A;  2QA7 A;  4JBW F;  5CJ5 A;  1HFA A;  3Q5W A;  1BR4 A;  3P50 A;  3VU7 H;  4LF5 T;  5J2T E;  2WM9 A;  2X68 A;  3K1S A;  3OBV E;  3NKZ A;  3AA0 B;  1T8B A;  1G73 A;  3WAK A;  4EIW A;  2FJA A;  2ZLY A;  3PJA A;  2XAF B;  2XQ6 A;  5ADX L;  3O9X A;  4TWH A;  4CI3 B;  3AXJ A;  4IE5 A;  4Z91 A;  5HEO A;  4DID B;  3CWZ B;  3UU5 A;  2XAG B;  5L2L A;  4H9P C;  4K0K T;  4H9O C;  3ONL C;  1BR1 A;  3C4Z A;  4UEM A;  1HTJ F;  2KXP B;  3FZM B;  3RI5 A;  4DV0 T;  1HNZ T;  3I9W A;  3ZMU B;  4B3T T;  4AKG A;  2LSJ A;  1IAP A;  2BG9 E;  3JCF A;  5LMN T;  4QXB B;  4HKA A;  1W0B A;  1Y64 B;  4EB6 E;  2BS2 A;  5HYA A;  1IJ6 A;  1MIV A;  2W66 A;  3OVU A;  2MAW A;  4UV9 B;  3PDY A;  3X1D A;  3AEC A;  2UUA T;  1LVF A;  2BKO A;  3AE4 A;  2WMO A;  3OPC A;  1FJG T;  2H7V C;  1OED A;  5KDM C;  4I50 E;  1HS7 A;  2R6G F;  3NZQ A;  4NPP A;  4IGU A;  1IBK T;  2BS4 A;  2XY8 B;  4P1N A;  4PJM A;  2CWY A;  1UUS A;  2LSK A;  3OKQ A;  4AIU A;  2HPL A;  4CI1 B;  4GYS A;  2FBW A;  2EHO D;  3TKL B;  2HHH T;  2VVN A;  2RPA A;  1QLB A;  4IHJ E;  2KMF A;  1SUM B;  5LHH B;  5HCJ A;  4HN9 A;  2LLY A;  3OYZ A;  3R6N A;  4ZI3 D;  2WSS V;  3JAF A;  1D0Y A;  1G8X A;  2JQK A;  4X1I E;  4EAH A;  4YTP A;  3WAJ A;  3CML A;  4UF0 B;  3I1A A;  3CIR A;  5AQR B;  2A2F X;  3MJX A;  3FHN A;  3K3O A;  2UU9 T;  4DR4 T;  5IUX A;  5LNK A;  2UUC T;  3LSV A;  3N2G E;  3WI3 A;  5JDL A;  2WCA A;  4X1Y E;  2V1D B;  4AQF A;  1HG5 A;  3QC9 A;  2WY2 A;  4MFR A;  2BDE A;  2XAQ B;  2WAU A;  2XQ8 A;  2LKH A;  3JC6 C;  4U31 A;  3A8Y C;  2LRL A;  2Y6X A;  4AQG A;  4JYA T;  4YTM A;  4A56 A;  4YY3 T;  4ILA A;  4HFD A;  4OYK A;  5AQK B;  4ADZ A;  2RA1 A;  3J7Y q;  5LMU T;  4DR6 T;  5E0O A;  4LF7 T;  5AQI B;  5AQQ B;  4WZX A;  5C3J A;  3UU4 A;  4E7S A;  4GIW A;  3RQW A;  4DBQ A;  4DUY T;  4H63 V;  5C2T A;  3RKG A;  1W9R A;  2VB6 A;  2WDQ A;  3AAI A;  3I0Q A;  3B5M A;  2VQF T;  4ZZC A;  2MYS A;  3FZK B;  2V7I A;  2VKH A;  2WZI A;  3BK9 A;  3ONJ A;  3F57 A;  2CEA A;  1IJ5 A;  3MKD A;  4O4L E;  4Q25 A;  3RC3 A;  4AKR B;  3KDS E;  2VQE T;  2C0S A;  4KHZ F;  3UFG A;  5EK3 A;  5DQV A;  5FL0 A;  3ZST A;  4P0A A;  2YDQ A;  4LF9 T;  2HN1 A;  5TAO A;  5C8Y E;  5LGT B;  2W67 A;  4C90 A;  4AKI A;  5JTG A;  3EAM A;  4EYU A;  3AE6 A;  2OLT A;  4A5X A;  4H9S E;  4I55 E;  2BBH A;  3PE0 A;  2E5V A;  4HFB A;  2XAJ B;  2L8K A;  2YOE A;  3PUV F;  1HX1 B;  1ZP0 A;  3AEA A;  3PV0 F;  3VHL A;  4TV9 E;  4EED A;  2V26 A;  3C51 A;  4G63 A;  4JLE A;  4NXN T;  4FI5 A;  3LFM A;  2DWG A;  4ZOL E;  1HCI A;  1W09 A;  2A3D A;  3VR8 A;  2LOS A;  2BBJ A;  4N78 D;  4DVD A;  1O3X A;  2VVS A;  4ZHQ E;  1MNE A;  4IDP A;  4IST A;  5JQG E;  4JI6 T;  2YIN A;  4AXP A;  3RIU A;  1NAF A;  4LF8 T;  1NEK A;  2YKS A;  5AQU B;  2W0G A;  2WBL A;  2YN6 A;  2K3W A;  1OED B;  3ZYL A;  1NEN A;  5LHG B;  2D2S A;  4ILB A;  3AXJ B;  4EGW A;  3CPZ A;  1H7C A;  3RGL A;  3HR0 A;  2I0M A;  1MIW A;  2V7L A;  3PUG A;  3PUQ A;  4H9Q C;  4OHF A;  2XJ7 A;  2BS3 A;  2I59 A;  3AE7 A;  3RYH E;  2WS3 A;  3AED A;  4HE8 A;  5LJM A;  3M65 A;  5LBQ B;  2C5I T;  1UGO A;  2CXF A;  2VKJ A;  2Y48 B;  1KF6 A;  3QOF A;  4DV2 T;  3ONX A;  2WB5 A;  2V5D A;  2KLQ A;  4UEL A;  1LRZ A;  3AE9 A;  2LEH A;  5FVK A;  3ZC1 A;  4YSY A;  4JI4 T;  3CKD A;  2LM9 A;  3LJC A;  4O2A E;  5ABG A;  5L3D B;  3C64 A;  3PU3 A;  4MLK A;  4LFA T;  2CHN A;  2X0H A;  3PUX F;  4HFC A;  5ETW A;  5HXC A;  1D1B A;  3PUS A;  2N2N A;  4KX6 A;  3RHW A;  4UVB B;  1Z0P A;  2JQQ A;  3N9M A;  2IC9 A;  4GYR A;  4CI2 B;  2DL1 A;  4B3S T;  2AXD S;  4JI7 T;  2UXB T;  5JRC B;  4TWF A;  1WYB A;  2UUB T;  1WYC A;  1YW0 A;  2IDO B;  3FZF B;  3M3Z B;  3NRX A;  3RLF F;  2UXD T;  4TNV A;  2Q9Q B;  4UIG A;  3ZMZ B;  4DR7 T;  5CFB A;  3UTK A;  3H3M A;  4G2A A;  5J1G A;  5AFU L;  4EEB A;  1FMV A;  1SHZ C;  1V9D A;  5CA0 E;  1WR6 A;  1HF8 A;  2NR4 A;  4DV3 T;  2V7J A;  4QXC B;  4KUM B;  2H89 A;  3K3N A;  2E9X D;  4I43 B;  2BKP A;  4QWN B;  4PFP A;  1IBL T;  2JIW A;  3RC8 A;  5H6R B;  1J5W A;  4HWD A;  4L5G A;  4NIQ A;  4YSZ A;  4DMW A;  3OTO T;  2WU2 A;  3MXZ A;  3RH3 A;  1YXR A;  4X66 T;  1DU2 A;  2LE8 A;  2D9D A;  2N1G A;  4H63 H;  2K48 A;  3LBX A;  5J2U E;  3PUW F;  2QRX A;  3VR9 A;  1UX5 A;  4P0B A;  1X9B A;  4DR3 T;  2WMN A;  1HNX T;  2Y8D A;  2XQ9 A;  3AE3 A;  3ANW B;  3IA3 A;  3AB3 B;  1CUN A;  3IF8 B;  3O1H A;  3B13 A;  4KP3 C;  2YU1 A;  4U7Y A;  5L4H A;  4YXD A;  5L47 A;  1AJ3 A;  3RF1 A;  2IC6 A;  4TUY E;  2XQ3 A;  5LB7 B;  3UUX B;  5AQP B;  2DCF A;  1SE7 A;  5M4Y A;  2NW8 A;  4GK5 E;  3Q9D A;  4ILU A;  5JDH A;  2XPK A;  1OED E;  4PJN A;  3O1J A;  2MTQ A;  3I0O A;  2K5B B;  4Z90 A;  3T1Y T;  1HR0 T;  4QHO A;  2OV9 A;  4ZS3 A;  3HL6 A;  3UUL A;  2E2A A;  3GA8 A;  2KT9 A;  3AEE A;  3W15 B;  2B76 A;  1ZOY A;  2KND A;  4WW0 A;  2E9X A;  2H3R A;  2IAK A;  1MMD A;  3QB5 K;  5LOV E;  4H9R C;  4BAY B;  3RYF E;  2CRB A;  3EDV A;  3A5X A;  2YDS A;  2K24 A;  3P4R A;  4HWH A;  1EZ3 A;  2LM2 A;  4TWD A;  3D0T A;  4U72 A;  3H3A A;  5DAB A;  4HFH A;  5FXX A;  4Z8X A;  3U3I A;  3UFE A;  3ESL A;  3ZLI A;  4OFZ A;  5FY1 A;  5HXE A;  4DV7 T;  4HEA A;  3ZC0 A;  1D1C A;  2ES0 A;  3UUB A;  1NWM X;  4ZI3 C;  4IE4 A;  2XQY A;  4F6R C;  1CHU A;  1FEW A;  2P9B A;  3HKC E;  4HWI B;  2VL0 A;  1OED C;  5AQN B;  3U78 A;  2IHR 1;  5JR9 B;  3CX8 B;  1UCU A;  2JPF A;  2ZM6 T;  1VCS A;  3CQC B;  2PFV A;  2NP9 A;  4PFO A;  5LGU B;  1D0X A;  5CGM A;  3P4W A;  5LHI B;  4O8S A;  3LK3 B;  3N9Q A;  4TZ4 C;  4CXY A;  5LGN B;  3IEE A;  2M6I A;  3A7M A;  2M6B A;  4JI1 T;  3KV5 A;  5AQO B;  1HNW T;  2C5J A;  1HG2 A;  1GQE A;  3MK7 C;  4MBQ A;  4LF6 T;  5AQH B;  1XNR T;  3PUA A;  1YQ4 A;  4CN4 A;  2XUE A;  3KBU A;  2UXN B;  4LFC T;  2ZMA A;  5EZY E;  3N9O A;  3BQI A;  4UF0 A;  4X5T A;  2X67 A;  2XSA A;  1FIO A;  2ZM8 A;  3MA9 A;  4ZS2 A;  1YKE B;  4LMK A;  5JDQ A;  3RX6 A;  2UXX B;  1M7K A;  3FBL A;  4LMJ A;  4QH5 A;  2D5U A;  3NVO A;  5FVL A;  4WBO A;  2AE9 A;  4PAG A;  2W00 A;  2PJQ A;  1BR0 A;  1QUU A;  4PNI A;  3NZP A;  4TX5 A;  2XSB A;  1MMA A;  4DMV A;  5HWY A;  5FXZ A;  3UQ7 A;  5JDM A;  4YJ3 E;  3UU6 A;  5GON E;  1XMQ T;  3ETV A;  4DV5 T;  5HEH A;  5LG3 A;  2IML A;  3FXE B;  2CLY B;  3KV6 A;  1E1H B;  2G0U A;  2BG9 C;  4IL4 A;  4QH1 A;  4TNW A;  4EYY R;  2CHO A;  1KNP A;  2XHE B;  4HFE A;  2H88 A;  3S4U A;  3KVB A;  2V6Y A;  4TV8 E;  2OA5 A;  5JRE A;  3LG7 A;  5A1L A;  3EUH A;  1M62 A;  2ODV A;  3L3P A;  5KMG P;  3AA7 B;  3ZMT B;  2XM1 A;  2J1D G;  4X20 E;  5KX5 E;  3PTR B;  2CCQ A;  3ZT7 A;  3ZN0 B;  1J1J A;  1MMN A;  2VKD A;  3H37 A;  2UXC T;  3OJA A;  4OX9 T;  3L8R A;  5AQS B;  2WZH A;  4U2Y A;  2B1E A;  4NUU A;  5LP6 E;  4X65 T;  3HA4 A;  3TLT A;  5LXT E;  2YDR A;  2BG9 A;  3UQ4 A;  3Q5D A;  3UU8 A;  4KMC A;  3ZYK A;  3AVS A;  3KBT A;  2BG9 B;  2K9A A;  2DHR A;  2HPJ A;  3C4X A;  3SFD A;  3FBZ A;  2X66 A;  4XZC A;  1WRD A;  2HN2 A;  5JH7 E;  4L0R A;  3AA6 B;  2MPK A;  2ACX A;  3KVA A;  3VRA A;  3GWH A;  4TN7 B;  3UU3 A;  2VKO A;  4ZXL A;  3RIU C;  2V7M A;  3SRZ A;  3C98 B;  1FMW A;  2DLR A;  1YKH B;  3R84 B;  2RP4 A;  5F8P A;  1KK7 A;  1UK5 A;  5FKY A;  2WWV A;  1J5E T;  2DWK A;  2X0Y A;  2X9X A;  1T72 A;  2M67 A;  3BQK A;  3FZH B;  3N9P A;  5H6Q B;  3KIN B;  5IWA T;  2VAS A;  3ZEF B;  4BA9 A;  4IRE A;  5FMN A;  4GKK T;  2WDR A;  3RYI E;  1IZN B;  3C50 A;  2XTL A;  5AQV B;  3TLS A;  3E0Z A;  1I94 T;  2CA5 A;  3ZCI A;  4IDQ A;  2NWB A;  3CQG B;  4BJM A;  2VK9 A;  3I9Y A;  2EHO B;  4DND A;  5ABH A;  4IE7 A;  4FJO A;  2Q9Q C;  3C4W A;  3ZJ2 A;  2MOZ A;  3SWH A;  1X79 A;  2FJD A;  4CN1 A;  2E5L T;  3RIF A;  4KI0 F;  3SOL A;  4EXT A;  5FP3 A;  2Q9Q D;  3NBX X;  4EZ4 A;  5EK2 A;  2MBG A;  4ISS A;  3FXD B;  3VRB A;  4JI0 T;  4YHH T;  2XM2 A;  3HI2 A;  2XAS B;  2CMR A;  3NWI A;  4IIJ E;  3O1I A;  2Z6E A;  1XWM A;  4PW8 A;  4KHP T;  3ZN1 B;  2LOP A;  3ETU A;  3ZT5 A;  3PUZ F;  3QB5 A;  4QKN A;  1UUR A;  4JEU B;  2Q9Q A;  5L3B B;  1T7S A;  1XZY A;  5LYJ E;  3Q5E A;  4PJL A;  2LHN A;  2W62 A;  1L0V A;  2X51 A;  4AI6 A;  2LSI A;  2JJ9 A;  3V5U A;  3QNU A;  5L3E B;  4X62 T;  5L3F B;  2BVM A;  2V6Y B;  2XQ7 A;  5FXW A;  3KV9 A;  3PJA J;  4MHC A;  2ACZ A;  3P8C D;  3P7I A;  1ZV4 X;  5AQF B;  5DJQ C;  2CXL A;  4B3R T;  2WDV A;  4V1A v;  1N32 T;  3VKG A;  2X0L B;  5EK4 A;  3ZT6 A;  2CBJ A;  3CVR A;  4YSX A;  1UX4 A;  5L3G B;  2IUB A;  2JMH A;  3EDU A;  2PBI A;  3AEG A;  2QGS A;  3O4X E;  1I6Z A;  4I4T E;  4IDO A;  3KV4 A;  5AQT B;  3AE5 A;  1W0A A;  2W2U A;  3EHZ A;  5HAX A;  3LDQ B;  4M1P A;  4CXX A;  3AE1 A;  1OWA A;  4YLH A;  5HXR A;  4JEH B;  2FJE A;  5F5W A;  4EV6 A;  4LF4 T;  3AAA B;  2F4V T;  2ZM2 A;  3CX6 B;  3N2O A;  3N9L A;  4HGA A;  1LKX A;  2CM0 A;  4L9I A;  2L3L A;  5FY7 A;  4DV4 T;  3ZSS A;  4DUZ T;  4BJN A;  2NTY A;  3HKB E;  3KFW X;  2JRK A;  5FXV A;  3ZKR A;  3E08 A;  4YT0 A;  4IL9 A;  2JMK A;  4E7Z A;  2BVL A;  2J47 A;  4LML A;  2HH7 A;  2E9X C;  1R8I A;  3ANW A;  5BR8 T;  1Z8U A;  2CPT A;  4OK0 A;  4JI5 T;  5FNV E;  2JQH A;  4COF A;  4O4H E;  2I6H A;  4ILC A;  2L9Q A;  4XBF B;  1S35 A;  2W63 A;  3N5L A;  4DBR A;  5JRC A;  1YQ3 A;  3J9X 1;  1KNR A;  1KEY A;  1E7P A;  3IHR A;  5HXH A;  2CXD A;  4A97 A;  3GN5 A;  5HWX A;  2CBI A;  2J4G A;  3EAB A;  2LT3 A;  1LVK A;  1VRB A;  2PG8 A;  2KWI B;  1MND A;  2WP9 A;  3HKD E;  3TLU A;  4CXW A;  4EZH A;  5AQG B;  4WYV A;  2ODU A;  4O2B E;  3JAE A;  3EI0 A;  4ANJ A;  3ZMV B;  1ZKE A;  5FL1 A;  5HXS A;  4AQF C;  3RYC E;  2YEV C;  4F8H A;  3UUM A;  3VKH A;  4YJ2 E;  4B3M T;  4U74 A;  2LKG A;  2KIN B;  2VWA A;  5AQJ B;  4AKL A;  5JDF A;  4NUV A;  5LG4 A;  4WNK A;  2H7O A;  5LJN A;  2CWO A;  3AA1 B;  3LK4 2;  3P4Q A;  4UVA B;  3LK2 B;  4JI2 T;  1U4Q A;  2SPC A;  3Q5X A;  2XQ4 A;  2V7K A;  3RRC A;  2CLY C;  3IBP A;  4CN6 A;  5HEJ A;  3AE8 A;  2YK0 A;  4X1K E;  5CB4 E;  5L3C B;  3Q2M A;  1HX8 A;  3P4S A;  2NW9 A;  3T1H T;  1KFY A;  3CK6 A;  4PK6 A;  4QH4 A;  4ZEY A;  3TLV A;  4JI8 T;  2N9D A;  1YD8 G;  4ERR A;  4U33 A;  2V6X A;  2IIU A;  4IDZ A;  1XMO T;  3PUR A;  4AQY T;  3PU8 A;  1JNZ A;  4IE6 A;  4ASK A;  3L09 A;  4C91 A;  5ABF A;  2C5K T;  4IE0 A;  4HWF A;  4PK4 A;  3F2E A;  2E8I A;  4GOU A;  4YHJ A;  4O4I E;  3ZJ1 A;  2FJB A;  4HFI A;  3QK6 A;  5HCM A;  3ZPO A;  4U2Z A;  3SFE A;  2XAH B;  5JVD E;  2KSR A;  4QXH B;  4UVC B;  2XZE A;  1WLX A;  4H9N C;  1N33 T;  3RIA A;  4DR2 T;  1OXZ A; 
#chains in the Genus database with same CATH homology
 3FZF B;  3M3Z B;  4HWC A;  4HWI B;  3FZL B;  5AQN B;  5AQR B;  3FZM B;  5AQP B;  5AQF B;  5AQL B;  1I6Z A;  1UGO A;  5AQT B;  5AQO B;  3A8Y C;  5AQM B;  3LDQ B;  1HX1 B;  4HWD A;  5AQH B;  5AQG B;  5AQK B;  1UK5 A;  4HWH A;  1M62 A;  5AQI B;  4HWF A;  3FZH B;  5AQQ B;  2D9D A;  1T7S A;  1M7K A;  5AQS B;  5AQV B;  5AQJ B;  5AQU B;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...