5AQFB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqfB00
5AQIB 1HX1B 3LDQB 3FZFB 5AQMB 5AQKB 5AQUB 1T7SA 1UGOA 5AQTB 3FZKB 1UK5A 2D9DA 3A8YC 4HWCA 5AQGB 5AQQB 1I6ZA 3M3ZB 1M7KA 5AQJB 5AQVB 3FZLB 3FZHB 5AQHB 5AQFB 5AQNB 5AQSB 5AQPB 5AQRB 1M62A 4HWIB 3FZMB 4HWFA 4HWDA 5AQLB 5AQOB 4HWHA
chains in the Genus database with same CATH superfamily
4O4IE 3R84B 2K48A 2B76A 4ZI7E 2LSKA 2X9HA 5HXSA 2CBJA 3JADA 1L0VA 3AEGA 1NWMX 1BR2A 3ZPOA 4O4HE 1FMVA 2XSAA 3PV0F 2DHRA 5C8YE 5C2TA 2RA1A 3Q2MA 2EHOA 2LM9A 2XQ9A 3ZLIA 1LRZA 3KFWX 3DJBA 3JCFA 3QNUA 3PUAA 3PUYF 4JI2T 2XQ8A 1WR0A 4NUUA 4YT0A 2W62A 3P7IA 2PFVA 5HXRA 5CFBA 5FL1A 4Q25A 3I9YA 3UUBA 1XNQT 3RRCA 2P9BA 5HEGA 5FVKA 3OPCA 4QKNA 4HWDA 1BR1A 1D0XA 2XZEA 3B5MA 2LT3A 2SPCA 3JAFA 3X1DA 2D0UA 2CPTA 5LJMA 2RP4A 4COFA 4U72A 3K3OA 4QX7B 4ZS2A 3C4ZA 4C90A 2V7IA 2V5DA 4HFIA 5LNKA 3AE9A 1SUMB 4WZXA 2YINA 4JEUB 1S94A 4ANJA 4V1Av 2VQFT 2V7JA 5AQQB 2Q9QC 4WBNE 5CGMA 1LVFA 2DWGA 4DMVA 3NZPA 1T8BA 2V5CA 4X65T 2XAJB 2XY8B 3DP7A 5HEHA 2IUBA 5JDNA 3AA7B 1WYBA 3UUMA 4A98A 4LFCT 4B3MT 3OJAA 4B6XA 3C4WA 4B3ST 1M62A 4XBFB 2X0LB 4IDOA 3VKHA 4B3TT 1U5PA 3QUJA 4LF8T 1OEDE 3LG7A 2XHEB 3FZFB 2BVLA 3EVYA 2BG9C 2WZHA 3I0OA 1HS7A 2FJBA 2JQ9A 3ZYKA 2ZM6T 4HWHA 3EDVA 1IJ6A 1T7SA 3VR8A 3Q5DA 3VR9A 4H9NC 2MOZA 3P8CD 1W0AA 4DR7T 3RIUA 1XNRT 5AQHB 4PW8A 3W15B 3EDUA 4WBOA 4U7IA 3TLUA 2LKGA 1XDPA 3ZMTB 4ZHQE 5CB4E 5HEJA 4GOUA 3C98B 4DBRA 5LMUT 4PK6A 3EI0A 1WCRA 3AAIA 4DV7T 3P4RA 2E9XD 5LBMA 3P4QA 5AQGB 4J2CA 4FI5A 2VVSA 1HNXT 2DLRA 2ACZA 2ZM8A 3MA9A 5LBQB 4CXYA 5L4HA 3ONJA 5CJ5A 3N9NA 4G63A 2W2UA 4QH5A 2C5JA 2WP9A 3U78A 3AE7A 4HWCA 1D0YA 4DV2T 1M7KA 2XQ4A 1UX4A 4PJMA 3CX6B 3KVBA 2JMHA 2JRKA 4YSXA 1MMAA 4JLEA 3ZCJA 1NENA 2OA5A 2A72A 3NKZA 4TN7B 1OWAA 3ZSTA 2NOXA 1Y01A 5ABFB 5FVLA 4GIWA 3PURA 5A1LA 3PUXF 3CWZB 2WAUA 4QX8B 2D0TA 1KNPA 2XM1A 5EK2A 4GYRA 1Z0PA 2PBIA 3NZQA 3RC3A 4HFVA 5J1GA 3ANWA 3K1SA 5LXTE 4JI6T 5DQVA 4PJLA 3O1JA 1YD8G 3AXJA 5J0ZA 4I43B 2VQET 4IL4A 3N9OA 4E7ZA 2UXDT 2CEAA 3TLVA 2XQ7A 5L47A 4ZZCA 3AEEA 2IDOB 1IAPA 2OLTA 2PTFA 3VHLA 2XQ3A 3B57A 1W0BA 5HXHA 3N2KE 2IMLA 3LBXB 2A9UA 2I6HA 3M3ZB 2IW5B 2LEHA 4PK5A 5AQRB 5LA6E 5JREA 4HGAA 5KX5E 1XMOT 3B13A 2WMNA 3TLSA 2F4VT 4ZI3D 4NPPA 4O4JE 2WSSV 2JQQA 2Y8DA 2BKPA 3ESLA 3NWIA 3AE5A 2D2SA 3L8RA 4AISA 1N33T 4LFBT 2J1DG 2K3WA 3RKGA 4B3RT 2I0MA 3A7MA 4I55E 5FXZA 3FBZA 1HR0T 4YSZA 5EK3A 5LGUB 2H7OA 4HWIB 2CHOA 1I94T 5LGTB 2LLYA 2CXFA 3RIUC 1WR6A 2Y6XA 2CMRA 4IREA 1E7PA 4MALA 1B7TA 1MIWA 1UURA 2HHHT 4KI0F 2YU1A 2E9XA 2ZM2A 2X0YA 3PUVF 4UV8B 3T1YT 2YDRA 3N9QA 2MYSA 3LBXA 4JI4T 2XUEA 2BKNA 5LCYA 4P1NA 1VCTA 4JI8T 4A97A 1ZP0A 4I0UA 3SFDA 3K3QC 1BR4A 2YN6A 5JR9B 4QXHB 2CHNA 3MXZA 5FY0A 3RYFE 2DL1A 2ACXA 3M65A 2FBWA 2GK9A 5GONE 4ZEYA 3D0TA 3MK7C 3ZT5A 2LRLA 4LMJA 3PUSA 4DUZT 5L2LA 2CBIA 3ZEFB 3RC8A 3IHRA 3N9LA 4TWHA 3O4XE 4P0AA 4X1IE 4BAYB 3PE0A 3N5LA 4ZS3A 2WBLA 3KVAA 5IWAT 5AQUB 3HKBE 3HI2A 2UXXB 2DWKA 5C3JA 2V6YB 2UXBT 3RKOA 3FXEB 4JV5T 4M1PA 4O2AE 3OYZA 3RLFF 4LMLA 3CX7B 4ASKA 3QC9A 4PAGA 3CX8B 2CLYB 4ILAA 2KXPB 4LF9T 4EYUA 5F5WA 3RX6A 5KDMC 4IDQA 5LGNB 3T8OA 1JNZA 4ZXLA 4DR2T 2A2FX 4UVBB 1VRBA 2LSYA 3RH3A 5ABGA 5CA0E 3UQ4A 4TNVA 3PU3A 2NW9A 5FXWA 2ZLYA 4IDZA 3FZLB 2KSRA 1MMDA 4AKRB 3ZT6A 3ZJ1A 4DMWA 4EZ4A 4BJNA 5DQWA 1KF6A 3SRZA 4YFSA 1MMGA 1LVKA 3GMIA 4TZ4C 4UVAB 3HKDE 2XASB 3ONLC 2X0HA 5ABEA 2E5VA 4LF5T 2Y48B 2X67A 4PFOA 4DV6T 4CXXA 4G2AA 2FUPA 1HF8A 4IIJE 1Z8UA 1KNZA 3JAEA 2YEVC 2W00A 3RYIE 2V6YA 1OEDA 3PUGA 2I59A 3R6NA 3KV6A 3I1AA 4NXMT 3KV4A 2LOPA 5HYAA 2L8KA 4BJMA 3CQCB 4JI3T 5J2UE 5FY7A 2FJAA 3UTKA 3OKQA 2LSJA 5FL0A 2UUCT 4DV1T 1CHUA 2MTQA 2E9XC 4KX6A 2VKDA 4DR6T 2FJDA 2N2NA 4X66T 4DNDA 4L5GA 2HPLA 2L9QA 1NEKA 2BDEA 4AQGA 2NP9A 5FP3A 1Y64B 5H6QB 2CXDA 3P4SA 2CM0A 4Z91A 2JPFA 2QA7A 2VWAA 3F2EA 2XAGB 5AQSB 3CMLA 3PU8A 4P09A 2WS3A 4LF7T 4CXWA 3KINB 2VKHA 3FB2A 4TNWA 4EAHA 2XPKA 2J4GA 4U2YA 3EHZA 3Q5XA 4OX9T 4K0UA 5M4YA 1T98A 4TV9E 3LK42 1YQ3A 2VB6A 2WMOA 2ES0A 2XQ6A 4YJ2E 2BBHA 4IL9A 2NW8A 3H37A 3VRBA 2WB5A 4DO0A 1HNWT 4KMCA 1BR0A 5AFUL 5LHIB 4DR3T 3HR0A 1YKEB 3ZMUB 4H63H 3ONXA 4QXCB 3Q9DA 4IDPA 3AE4A 4KHPT 3RQWA 3J7Yq 2A3DA 4TWDA 1WFDA 5FXXA 1YXRA 1D1CA 5FYMA 2YK0A 5LB7B 2FJEA 3FZMB 1OXZA 3E22E 4YHHT 3RIAA 5AQIB 2WU5A 2HH7A 4LFAT 3H3MA 3QB5K 2WM9A 2AE9A 2ZM0A 4QXBB 4HFDA 2VURA 1MMNA 3FZHB 4ZI3C 2XAQB 1FMWA 5LG4A 3KDSE 3RF1A 1CUNA 2VK9A 4BA9A 2CWOA 1SA0E 3AA6B 3OVUA 2YDQA 1MIYA 1ZV4X 4ZI2D 3PDYA 4I50E 2HPJA 1S35A 3WAJA 2N9DA 1IJ5A 4DR5T 4L9IA 4TWFA 5TAOA 3N2GE 1D0ZA 5JDHA 3NVOA 4N78D 1OEDC 2CRBA 2NTYA 5J2TE 3EAMA 1U4QA 5JDFA 3L3PA 3ZYLA 2ZMAA 2IHR1 4F6RC 1EZ3A 4A5XA 4JI7T 3HL6A 4PJJA 3F57A 1R8IA 2KLQA 2Z6EA 3L09A 3WI3A 4KBMB 2IC9A 2H88A 4KUMB 3UU3A 3MJXA 4WNKA 3UU5A 1J5WA 2V7MA 3RRWA 3FXDB 3ZN0B 2Q9QB 4PNIA 2DNXA 3WAKA 5DJQC 3O9XA 3A5XA 1V9DA 2E5LT 3ZMSB 5JQGE 5ABFA 4UVCB 4Z90A 4AQYT 2X68A 2C5IT 3RYCE 1AJ3A 1ZOYA 3LSVA 3AA1B 4IE4A 3IEEA 2XAFB 2E2AA 3VRAA 3C64A 3ZMZB 4GYSA 2XAHB 4UF0B 4H9OC 2W4XA 5LJNA 3K8PC 5L3DB 4EV6A 3CKDA 3AEAA 2VL8A 4O2BE 2LOSA 2LHRA 2IAKA 1W9RA 1HG5A 2UU9T 5L3EB 2G0UA 1XWMA 1WLXA 3GA8A 1T72A 1WYCA 4H63V 4DUYT 5LOVE 4QWNB 5EK4A 5IUXA 2ODUA 3UU8A 3BQKA 2X9YA 2C5KT 3C51A 4O4LE 4IT4A 2V7KA 3AE1A 4CN6A 4UV9B 3OBVE 2WZIA 2WY2A 4JUYA 3KV5A 3ZKRA 4L0RA 4YJ3E 1N36T 4XAXB 2WWUA 5HXEA 3V5SA 4H9SE 5LMNT 1VCSA 2N1GA 2H89A 4UIGA 2LRKA 2JJ9A 1YQ4A 4YY3T 2JMKA 4YHJA 3RPUA 3T1HT 3SFEA 4YLHA 2VASA 5AQKB 1FIOA 2EHOB 3L39A 3FZKB 1YKHB 4GK0E 4TUYE 1KK7A 4NUVA 2UXCT 4AKLA 5AQVB 4AQFA 3TKLB 4WW0A 5JDQA 2UUAT 1X79A 5BR8T 1N34T 3DTOA 4LF6T 3GWHA 4KP3C 3KV9A 3I9WA 3UULA 5AQMB 2ODVA 5JDLA 1D1BA 2DI4A 2X9XA 3GN5B 4U33A 1IBKT 3LK3B 4CI3B 5KMGP 4OFZA 5AQPB 4X1KE 2KT9A 5HCJA 2JQKA 2NTXA 1LKXA 3UUXB 5FKYA 4HEAA 1UK5A 5JDMA 3TLWA 4MHCA 4HN9A 3RGLA 5F3JA 4NXNT 1US7B 4C91A 5JTGA 5HCMA 4H9PC 4ISTA 2BS2A 2BG9E 2PG8A 4AI6A 5JR9A 1QLBA 3BQLA 4A56A 4U2ZA 1IZNB 4U31A 3AEFA 3HKEE 1WRDA 1UX5A 3KBUA 4P0BA 4HWFA 3LFMA 2IC6A 4EGWA 1IBMT 3SOLA 2JQHA 2X9WA 4U74A 1E2AA 4IE7A 4UR9A 5L4EA 5LHHB 2V1DB 3RQUA 4GK5E 3AE2A 3HKCE 3Q5WA 4O8SA 2C0SA 1SE7A 2YKSA 4IE5A 3ZN1B 4ADZA 2AXDS 4QH1A 4EB6E 4AKHA 2BBJA 3NRXA 4OYJA 3O1IA 3JC6D 1HX1B 3C50A 1KFYA 3RI5A 3LJCA 2RPAA 2XSBA 2YDSA 5F8PA 4JBWF 5L3CB 3OYXA 3GN5A 3EUHA 4YTNA 2NW7A 3IA3A 2VKJA 3PJAA 2WWVA 3CPZA 2NR4A 5ABHA 4GKJT 4DVDA 5BMVE 3UUNA 4JEHB 2YOEA 1MNDA 1MNEA 2LE8A 2CXLA 3PTRB 2J62A 4DV0T 4U3CA 2BS4A 4K0KT 5EZYE 1N32T 1FEWA 2VKOA 4IE0A 3UFGA 1XZYA 3ZC1A 2IIUA 1HCIA 1DU2A 4YSYA 4HTEA 4QHOA 4UEMA 3E08A 2WDVA 3ABVA 4MLKA 5FMNA 1J1JA 3LDQB 2KWIB 4ILCA 4X1YE 2D9DA 2W0GA 1NAFA 4ILUA 5L3BB 3P50A 4YTPA 5AQLB 3IF8B 4WYVA 1YW0A 4AQFC 3MZKB 5LP6E 4ZI2C 1X9BA 3AE3A 3H3AA 3FBLA 4IE6A 3P4WA 2QVAA 5LYJE 3UQ7A 2KINB 4H9RC 5DABA 2DCFA 2M6BA 3TLTA 3I0QA 4AXPA 2V26A 5HXCA 4FJOA 4X20E 4ZOLE 4DV5T 3UU4A 3V5UA 1HFAA 4UXNB 3ANWB 2M67A 3O1HA 2WDRA 2L3LA 4KHZF 4LF4T 1ZEEA 3KBTA 2LKHA 2PJQA 2Q9QD 2LHNA 3E0ZA 3HA4A 4CQIA 3AB3B 5KXJA 3AXJB 4ISSA 5HWYA 2HN2A 4XZCA 1QSDA 5JR9C 4HKAA 2LJLA 3BQIA 4UELA 3CIRA 4U7YA 1ZKEA 3OTOT 2HN1A 2UXNB 3ZYMA 2H3RA 2K24A 2R6GF 3NBXX 2EHOC 3P4PA 3AAEB 2W61A 5FY1A 3VU7H 4JI1T 5L3GB 2UUBT 4LMKA 2NWBA 5HWXA 2KNDA 4DV4T 1E1HB 4HFCA 3ZJ2A 2WU2A 4TV8E 5AQNB 4I4TE 4X62T 4EYYR 2VL0A 3SS1A 4TX5A 3CQGB 4EOZB 3AECA 2B1EA 4F8HA 2XQYA 1HNZT 1I6ZA 2OV9A 2VVNA 5HEUA 5IHYA 5JRCB 4DIDB 5AQFB 1G8XA 4JI0T 4ERRA 4E7SA 3UFEA 4PFPA 3AEDA 3ZMVB 4EXTA 2CLYC 4EEBA 4AKIA 1XDOA 4X5TA 2BZBA 3N9PA 5HAXA 3RIFA 5L3FB 3K3NA 2KZ7B 3PUZF 4OYKA 4CI2B 1D1AA 2MBGA 2E9XB 5AQOB 4EIWA 2X51A 5ADXL 2CWYA 2BVMA 4ZZBA 3CQXC 1XMQT 3MACA 3ZCIA 5CA1E 2EHOD 5AQJB 1HG2A 3AE8A 3NRYA 5JVDE 4CI1B 2CA5A 1KEYA 4Z8XA 2XJ7A 3PJAJ 5H6RB 2X66A 2J47A 3ETVA 4EZHA 4DR4T 4IGUA 2V8SV 5E0OA 1GQEA 2KWHA 4DV3T 3ZC0A 2BG9B 3AVRA 3CVRA 4DBQA 1HTJF 3SWHA 3U3IA 4CN4A 4QH4A 1SHZC 3IBPA 4AKGA 5LG3A 3UU6A 3Q5EA 3CK6A 2LSGA 5JRCA 2XTLA 4HFHA 3MKDA 2K5BB 5FXVA 3N9MA 3N2OA 3LK2B 3ZT7A 4MFRA 3F31A 4GKKT 3EABA 4AIUA 2W66A 3VKGA 2Q9QA 4PJNA 1UGOA 2YU2A 4EEDA 3A8YC 4H9QC 1HX8A 1UCUA 4YTMA 2M6IA 3AVSA 3QB5A 3QOFA 1UUSA 1KNRA 3G06A 4IHJE 1VOMA 3FHNA 4HFEA 5IYZE 3UT5E 4IDNA 1FJGT 1G73A 4X64T 3QK6A 2MPKA 4JYAT 5HEOA 4UF0A 4ILBA 3BK9A 2LSIA 2V6XA 2BG9A 1IBLT 1W09A 2LM2A 3ZSSA 3S4UA 4JI5T 4HFBA 2XM2A 1ZHCA 2BKOA 3AA0B 3RHWA 2QYWA 1JNRA 1QUUA 3AEBA 2W67A 2KMFA 3C4XA 3JC6C 4DR1T 2WCAA 3PUQA 2BS3A 4NIQA 4YXDA 3AAAB 3ETUA 2JIWA 2K9AA 5LHGB 2CE7A 2H7VC 4CN1A 4PK4A 5JH7E 1MIVA 3AE6A 1H7CA 2W63A 5JDGA 5AQTB 5ETWA 2QGSA 2XQ5A 3PUWF 2MAWA 4MBQA 5FNVE 3J9X1 4OHFA 1OEDB 2CCQA 2E8IA 3RYHE 2QRXA 2D5UA 2XQAA 4OK0A 2WDQA 4HE8A 1O3XA 2V7LA 4CZZB 1J5ET 2WQYA
chains in the Genus database with same CATH topology
5AQIB 1HX1B 3LDQB 3FZFB 5AQMB 5AQKB 5AQUB 1T7SA 1UGOA 5AQTB 3FZKB 1UK5A 2D9DA 3A8YC 4HWCA 5AQGB 5AQQB 1I6ZA 3M3ZB 1M7KA 5AQJB 5AQVB 3FZLB 3FZHB 5AQHB 5AQFB 5AQNB 5AQSB 5AQPB 5AQRB 1M62A 4HWIB 3FZMB 4HWFA 4HWDA 5AQLB 5AQOB 4HWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQI B;  1HX1 B;  3LDQ B;  3FZF B;  5AQM B;  5AQK B;  5AQU B;  1T7S A;  1UGO A;  5AQT B;  3FZK B;  1UK5 A;  2D9D A;  3A8Y C;  4HWC A;  5AQG B;  5AQQ B;  1I6Z A;  3M3Z B;  1M7K A;  5AQJ B;  5AQV B;  3FZL B;  3FZH B;  5AQH B;  5AQF B;  5AQN B;  5AQS B;  5AQP B;  5AQR B;  1M62 A;  4HWI B;  3FZM B;  4HWF A;  4HWD A;  5AQL B;  5AQO B;  4HWH A; 
#chains in the Genus database with same CATH topology
 4O4I E;  3R84 B;  2K48 A;  2B76 A;  4ZI7 E;  2LSK A;  2X9H A;  5HXS A;  2CBJ A;  3JAD A;  1L0V A;  3AEG A;  1NWM X;  1BR2 A;  3ZPO A;  4O4H E;  1FMV A;  2XSA A;  3PV0 F;  2DHR A;  5C8Y E;  5C2T A;  2RA1 A;  3Q2M A;  2EHO A;  2LM9 A;  2XQ9 A;  3ZLI A;  1LRZ A;  3KFW X;  3DJB A;  3JCF A;  3QNU A;  3PUA A;  3PUY F;  4JI2 T;  2XQ8 A;  1WR0 A;  4NUU A;  4YT0 A;  2W62 A;  3P7I A;  2PFV A;  5HXR A;  5CFB A;  5FL1 A;  4Q25 A;  3I9Y A;  3UUB A;  1XNQ T;  3RRC A;  2P9B A;  5HEG A;  5FVK A;  3OPC A;  4QKN A;  4HWD A;  1BR1 A;  1D0X A;  2XZE A;  3B5M A;  2LT3 A;  2SPC A;  3JAF A;  3X1D A;  2D0U A;  2CPT A;  5LJM A;  2RP4 A;  4COF A;  4U72 A;  3K3O A;  4QX7 B;  4ZS2 A;  3C4Z A;  4C90 A;  2V7I A;  2V5D A;  4HFI A;  5LNK A;  3AE9 A;  1SUM B;  4WZX A;  2YIN A;  4JEU B;  1S94 A;  4ANJ A;  4V1A v;  2VQF T;  2V7J A;  5AQQ B;  2Q9Q C;  4WBN E;  5CGM A;  1LVF A;  2DWG A;  4DMV A;  3NZP A;  1T8B A;  2V5C A;  4X65 T;  2XAJ B;  2XY8 B;  3DP7 A;  5HEH A;  2IUB A;  5JDN A;  3AA7 B;  1WYB A;  3UUM A;  4A98 A;  4LFC T;  4B3M T;  3OJA A;  4B6X A;  3C4W A;  4B3S T;  1M62 A;  4XBF B;  2X0L B;  4IDO A;  3VKH A;  4B3T T;  1U5P A;  3QUJ A;  4LF8 T;  1OED E;  3LG7 A;  2XHE B;  3FZF B;  2BVL A;  3EVY A;  2BG9 C;  2WZH A;  3I0O A;  1HS7 A;  2FJB A;  2JQ9 A;  3ZYK A;  2ZM6 T;  4HWH A;  3EDV A;  1IJ6 A;  1T7S A;  3VR8 A;  3Q5D A;  3VR9 A;  4H9N C;  2MOZ A;  3P8C D;  1W0A A;  4DR7 T;  3RIU A;  1XNR T;  5AQH B;  4PW8 A;  3W15 B;  3EDU A;  4WBO A;  4U7I A;  3TLU A;  2LKG A;  1XDP A;  3ZMT B;  4ZHQ E;  5CB4 E;  5HEJ A;  4GOU A;  3C98 B;  4DBR A;  5LMU T;  4PK6 A;  3EI0 A;  1WCR A;  3AAI A;  4DV7 T;  3P4R A;  2E9X D;  5LBM A;  3P4Q A;  5AQG B;  4J2C A;  4FI5 A;  2VVS A;  1HNX T;  2DLR A;  2ACZ A;  2ZM8 A;  3MA9 A;  5LBQ B;  4CXY A;  5L4H A;  3ONJ A;  5CJ5 A;  3N9N A;  4G63 A;  2W2U A;  4QH5 A;  2C5J A;  2WP9 A;  3U78 A;  3AE7 A;  4HWC A;  1D0Y A;  4DV2 T;  1M7K A;  2XQ4 A;  1UX4 A;  4PJM A;  3CX6 B;  3KVB A;  2JMH A;  2JRK A;  4YSX A;  1MMA A;  4JLE A;  3ZCJ A;  1NEN A;  2OA5 A;  2A72 A;  3NKZ A;  4TN7 B;  1OWA A;  3ZST A;  2NOX A;  1Y01 A;  5ABF B;  5FVL A;  4GIW A;  3PUR A;  5A1L A;  3PUX F;  3CWZ B;  2WAU A;  4QX8 B;  2D0T A;  1KNP A;  2XM1 A;  5EK2 A;  4GYR A;  1Z0P A;  2PBI A;  3NZQ A;  3RC3 A;  4HFV A;  5J1G A;  3ANW A;  3K1S A;  5LXT E;  4JI6 T;  5DQV A;  4PJL A;  3O1J A;  1YD8 G;  3AXJ A;  5J0Z A;  4I43 B;  2VQE T;  4IL4 A;  3N9O A;  4E7Z A;  2UXD T;  2CEA A;  3TLV A;  2XQ7 A;  5L47 A;  4ZZC A;  3AEE A;  2IDO B;  1IAP A;  2OLT A;  2PTF A;  3VHL A;  2XQ3 A;  3B57 A;  1W0B A;  5HXH A;  3N2K E;  2IML A;  3LBX B;  2A9U A;  2I6H A;  3M3Z B;  2IW5 B;  2LEH A;  4PK5 A;  5AQR B;  5LA6 E;  5JRE A;  4HGA A;  5KX5 E;  1XMO T;  3B13 A;  2WMN A;  3TLS A;  2F4V T;  4ZI3 D;  4NPP A;  4O4J E;  2WSS V;  2JQQ A;  2Y8D A;  2BKP A;  3ESL A;  3NWI A;  3AE5 A;  2D2S A;  3L8R A;  4AIS A;  1N33 T;  4LFB T;  2J1D G;  2K3W A;  3RKG A;  4B3R T;  2I0M A;  3A7M A;  4I55 E;  5FXZ A;  3FBZ A;  1HR0 T;  4YSZ A;  5EK3 A;  5LGU B;  2H7O A;  4HWI B;  2CHO A;  1I94 T;  5LGT B;  2LLY A;  2CXF A;  3RIU C;  1WR6 A;  2Y6X A;  2CMR A;  4IRE A;  1E7P A;  4MAL A;  1B7T A;  1MIW A;  1UUR A;  2HHH T;  4KI0 F;  2YU1 A;  2E9X A;  2ZM2 A;  2X0Y A;  3PUV F;  4UV8 B;  3T1Y T;  2YDR A;  3N9Q A;  2MYS A;  3LBX A;  4JI4 T;  2XUE A;  2BKN A;  5LCY A;  4P1N A;  1VCT A;  4JI8 T;  4A97 A;  1ZP0 A;  4I0U A;  3SFD A;  3K3Q C;  1BR4 A;  2YN6 A;  5JR9 B;  4QXH B;  2CHN A;  3MXZ A;  5FY0 A;  3RYF E;  2DL1 A;  2ACX A;  3M65 A;  2FBW A;  2GK9 A;  5GON E;  4ZEY A;  3D0T A;  3MK7 C;  3ZT5 A;  2LRL A;  4LMJ A;  3PUS A;  4DUZ T;  5L2L A;  2CBI A;  3ZEF B;  3RC8 A;  3IHR A;  3N9L A;  4TWH A;  3O4X E;  4P0A A;  4X1I E;  4BAY B;  3PE0 A;  3N5L A;  4ZS3 A;  2WBL A;  3KVA A;  5IWA T;  5AQU B;  3HKB E;  3HI2 A;  2UXX B;  2DWK A;  5C3J A;  2V6Y B;  2UXB T;  3RKO A;  3FXE B;  4JV5 T;  4M1P A;  4O2A E;  3OYZ A;  3RLF F;  4LML A;  3CX7 B;  4ASK A;  3QC9 A;  4PAG A;  3CX8 B;  2CLY B;  4ILA A;  2KXP B;  4LF9 T;  4EYU A;  5F5W A;  3RX6 A;  5KDM C;  4IDQ A;  5LGN B;  3T8O A;  1JNZ A;  4ZXL A;  4DR2 T;  2A2F X;  4UVB B;  1VRB A;  2LSY A;  3RH3 A;  5ABG A;  5CA0 E;  3UQ4 A;  4TNV A;  3PU3 A;  2NW9 A;  5FXW A;  2ZLY A;  4IDZ A;  3FZL B;  2KSR A;  1MMD A;  4AKR B;  3ZT6 A;  3ZJ1 A;  4DMW A;  4EZ4 A;  4BJN A;  5DQW A;  1KF6 A;  3SRZ A;  4YFS A;  1MMG A;  1LVK A;  3GMI A;  4TZ4 C;  4UVA B;  3HKD E;  2XAS B;  3ONL C;  2X0H A;  5ABE A;  2E5V A;  4LF5 T;  2Y48 B;  2X67 A;  4PFO A;  4DV6 T;  4CXX A;  4G2A A;  2FUP A;  1HF8 A;  4IIJ E;  1Z8U A;  1KNZ A;  3JAE A;  2YEV C;  2W00 A;  3RYI E;  2V6Y A;  1OED A;  3PUG A;  2I59 A;  3R6N A;  3KV6 A;  3I1A A;  4NXM T;  3KV4 A;  2LOP A;  5HYA A;  2L8K A;  4BJM A;  3CQC B;  4JI3 T;  5J2U E;  5FY7 A;  2FJA A;  3UTK A;  3OKQ A;  2LSJ A;  5FL0 A;  2UUC T;  4DV1 T;  1CHU A;  2MTQ A;  2E9X C;  4KX6 A;  2VKD A;  4DR6 T;  2FJD A;  2N2N A;  4X66 T;  4DND A;  4L5G A;  2HPL A;  2L9Q A;  1NEK A;  2BDE A;  4AQG A;  2NP9 A;  5FP3 A;  1Y64 B;  5H6Q B;  2CXD A;  3P4S A;  2CM0 A;  4Z91 A;  2JPF A;  2QA7 A;  2VWA A;  3F2E A;  2XAG B;  5AQS B;  3CML A;  3PU8 A;  4P09 A;  2WS3 A;  4LF7 T;  4CXW A;  3KIN B;  2VKH A;  3FB2 A;  4TNW A;  4EAH A;  2XPK A;  2J4G A;  4U2Y A;  3EHZ A;  3Q5X A;  4OX9 T;  4K0U A;  5M4Y A;  1T98 A;  4TV9 E;  3LK4 2;  1YQ3 A;  2VB6 A;  2WMO A;  2ES0 A;  2XQ6 A;  4YJ2 E;  2BBH A;  4IL9 A;  2NW8 A;  3H37 A;  3VRB A;  2WB5 A;  4DO0 A;  1HNW T;  4KMC A;  1BR0 A;  5AFU L;  5LHI B;  4DR3 T;  3HR0 A;  1YKE B;  3ZMU B;  4H63 H;  3ONX A;  4QXC B;  3Q9D A;  4IDP A;  3AE4 A;  4KHP T;  3RQW A;  3J7Y q;  2A3D A;  4TWD A;  1WFD A;  5FXX A;  1YXR A;  1D1C A;  5FYM A;  2YK0 A;  5LB7 B;  2FJE A;  3FZM B;  1OXZ A;  3E22 E;  4YHH T;  3RIA A;  5AQI B;  2WU5 A;  2HH7 A;  4LFA T;  3H3M A;  3QB5 K;  2WM9 A;  2AE9 A;  2ZM0 A;  4QXB B;  4HFD A;  2VUR A;  1MMN A;  3FZH B;  4ZI3 C;  2XAQ B;  1FMW A;  5LG4 A;  3KDS E;  3RF1 A;  1CUN A;  2VK9 A;  4BA9 A;  2CWO A;  1SA0 E;  3AA6 B;  3OVU A;  2YDQ A;  1MIY A;  1ZV4 X;  4ZI2 D;  3PDY A;  4I50 E;  2HPJ A;  1S35 A;  3WAJ A;  2N9D A;  1IJ5 A;  4DR5 T;  4L9I A;  4TWF A;  5TAO A;  3N2G E;  1D0Z A;  5JDH A;  3NVO A;  4N78 D;  1OED C;  2CRB A;  2NTY A;  5J2T E;  3EAM A;  1U4Q A;  5JDF A;  3L3P A;  3ZYL A;  2ZMA A;  2IHR 1;  4F6R C;  1EZ3 A;  4A5X A;  4JI7 T;  3HL6 A;  4PJJ A;  3F57 A;  1R8I A;  2KLQ A;  2Z6E A;  3L09 A;  3WI3 A;  4KBM B;  2IC9 A;  2H88 A;  4KUM B;  3UU3 A;  3MJX A;  4WNK A;  3UU5 A;  1J5W A;  2V7M A;  3RRW A;  3FXD B;  3ZN0 B;  2Q9Q B;  4PNI A;  2DNX A;  3WAK A;  5DJQ C;  3O9X A;  3A5X A;  1V9D A;  2E5L T;  3ZMS B;  5JQG E;  5ABF A;  4UVC B;  4Z90 A;  4AQY T;  2X68 A;  2C5I T;  3RYC E;  1AJ3 A;  1ZOY A;  3LSV A;  3AA1 B;  4IE4 A;  3IEE A;  2XAF B;  2E2A A;  3VRA A;  3C64 A;  3ZMZ B;  4GYS A;  2XAH B;  4UF0 B;  4H9O C;  2W4X A;  5LJN A;  3K8P C;  5L3D B;  4EV6 A;  3CKD A;  3AEA A;  2VL8 A;  4O2B E;  2LOS A;  2LHR A;  2IAK A;  1W9R A;  1HG5 A;  2UU9 T;  5L3E B;  2G0U A;  1XWM A;  1WLX A;  3GA8 A;  1T72 A;  1WYC A;  4H63 V;  4DUY T;  5LOV E;  4QWN B;  5EK4 A;  5IUX A;  2ODU A;  3UU8 A;  3BQK A;  2X9Y A;  2C5K T;  3C51 A;  4O4L E;  4IT4 A;  2V7K A;  3AE1 A;  4CN6 A;  4UV9 B;  3OBV E;  2WZI A;  2WY2 A;  4JUY A;  3KV5 A;  3ZKR A;  4L0R A;  4YJ3 E;  1N36 T;  4XAX B;  2WWU A;  5HXE A;  3V5S A;  4H9S E;  5LMN T;  1VCS A;  2N1G A;  2H89 A;  4UIG A;  2LRK A;  2JJ9 A;  1YQ4 A;  4YY3 T;  2JMK A;  4YHJ A;  3RPU A;  3T1H T;  3SFE A;  4YLH A;  2VAS A;  5AQK B;  1FIO A;  2EHO B;  3L39 A;  3FZK B;  1YKH B;  4GK0 E;  4TUY E;  1KK7 A;  4NUV A;  2UXC T;  4AKL A;  5AQV B;  4AQF A;  3TKL B;  4WW0 A;  5JDQ A;  2UUA T;  1X79 A;  5BR8 T;  1N34 T;  3DTO A;  4LF6 T;  3GWH A;  4KP3 C;  3KV9 A;  3I9W A;  3UUL A;  5AQM B;  2ODV A;  5JDL A;  1D1B A;  2DI4 A;  2X9X A;  3GN5 B;  4U33 A;  1IBK T;  3LK3 B;  4CI3 B;  5KMG P;  4OFZ A;  5AQP B;  4X1K E;  2KT9 A;  5HCJ A;  2JQK A;  2NTX A;  1LKX A;  3UUX B;  5FKY A;  4HEA A;  1UK5 A;  5JDM A;  3TLW A;  4MHC A;  4HN9 A;  3RGL A;  5F3J A;  4NXN T;  1US7 B;  4C91 A;  5JTG A;  5HCM A;  4H9P C;  4IST A;  2BS2 A;  2BG9 E;  2PG8 A;  4AI6 A;  5JR9 A;  1QLB A;  3BQL A;  4A56 A;  4U2Z A;  1IZN B;  4U31 A;  3AEF A;  3HKE E;  1WRD A;  1UX5 A;  3KBU A;  4P0B A;  4HWF A;  3LFM A;  2IC6 A;  4EGW A;  1IBM T;  3SOL A;  2JQH A;  2X9W A;  4U74 A;  1E2A A;  4IE7 A;  4UR9 A;  5L4E A;  5LHH B;  2V1D B;  3RQU A;  4GK5 E;  3AE2 A;  3HKC E;  3Q5W A;  4O8S A;  2C0S A;  1SE7 A;  2YKS A;  4IE5 A;  3ZN1 B;  4ADZ A;  2AXD S;  4QH1 A;  4EB6 E;  4AKH A;  2BBJ A;  3NRX A;  4OYJ A;  3O1I A;  3JC6 D;  1HX1 B;  3C50 A;  1KFY A;  3RI5 A;  3LJC A;  2RPA A;  2XSB A;  2YDS A;  5F8P A;  4JBW F;  5L3C B;  3OYX A;  3GN5 A;  3EUH A;  4YTN A;  2NW7 A;  3IA3 A;  2VKJ A;  3PJA A;  2WWV A;  3CPZ A;  2NR4 A;  5ABH A;  4GKJ T;  4DVD A;  5BMV E;  3UUN A;  4JEH B;  2YOE A;  1MND A;  1MNE A;  2LE8 A;  2CXL A;  3PTR B;  2J62 A;  4DV0 T;  4U3C A;  2BS4 A;  4K0K T;  5EZY E;  1N32 T;  1FEW A;  2VKO A;  4IE0 A;  3UFG A;  1XZY A;  3ZC1 A;  2IIU A;  1HCI A;  1DU2 A;  4YSY A;  4HTE A;  4QHO A;  4UEM A;  3E08 A;  2WDV A;  3ABV A;  4MLK A;  5FMN A;  1J1J A;  3LDQ B;  2KWI B;  4ILC A;  4X1Y E;  2D9D A;  2W0G A;  1NAF A;  4ILU A;  5L3B B;  3P50 A;  4YTP A;  5AQL B;  3IF8 B;  4WYV A;  1YW0 A;  4AQF C;  3MZK B;  5LP6 E;  4ZI2 C;  1X9B A;  3AE3 A;  3H3A A;  3FBL A;  4IE6 A;  3P4W A;  2QVA A;  5LYJ E;  3UQ7 A;  2KIN B;  4H9R C;  5DAB A;  2DCF A;  2M6B A;  3TLT A;  3I0Q A;  4AXP A;  2V26 A;  5HXC A;  4FJO A;  4X20 E;  4ZOL E;  4DV5 T;  3UU4 A;  3V5U A;  1HFA A;  4UXN B;  3ANW B;  2M67 A;  3O1H A;  2WDR A;  2L3L A;  4KHZ F;  4LF4 T;  1ZEE A;  3KBT A;  2LKH A;  2PJQ A;  2Q9Q D;  2LHN A;  3E0Z A;  3HA4 A;  4CQI A;  3AB3 B;  5KXJ A;  3AXJ B;  4ISS A;  5HWY A;  2HN2 A;  4XZC A;  1QSD A;  5JR9 C;  4HKA A;  2LJL A;  3BQI A;  4UEL A;  3CIR A;  4U7Y A;  1ZKE A;  3OTO T;  2HN1 A;  2UXN B;  3ZYM A;  2H3R A;  2K24 A;  2R6G F;  3NBX X;  2EHO C;  3P4P A;  3AAE B;  2W61 A;  5FY1 A;  3VU7 H;  4JI1 T;  5L3G B;  2UUB T;  4LMK A;  2NWB A;  5HWX A;  2KND A;  4DV4 T;  1E1H B;  4HFC A;  3ZJ2 A;  2WU2 A;  4TV8 E;  5AQN B;  4I4T E;  4X62 T;  4EYY R;  2VL0 A;  3SS1 A;  4TX5 A;  3CQG B;  4EOZ B;  3AEC A;  2B1E A;  4F8H A;  2XQY A;  1HNZ T;  1I6Z A;  2OV9 A;  2VVN A;  5HEU A;  5IHY A;  5JRC B;  4DID B;  5AQF B;  1G8X A;  4JI0 T;  4ERR A;  4E7S A;  3UFE A;  4PFP A;  3AED A;  3ZMV B;  4EXT A;  2CLY C;  4EEB A;  4AKI A;  1XDO A;  4X5T A;  2BZB A;  3N9P A;  5HAX A;  3RIF A;  5L3F B;  3K3N A;  2KZ7 B;  3PUZ F;  4OYK A;  4CI2 B;  1D1A A;  2MBG A;  2E9X B;  5AQO B;  4EIW A;  2X51 A;  5ADX L;  2CWY A;  2BVM A;  4ZZB A;  3CQX C;  1XMQ T;  3MAC A;  3ZCI A;  5CA1 E;  2EHO D;  5AQJ B;  1HG2 A;  3AE8 A;  3NRY A;  5JVD E;  4CI1 B;  2CA5 A;  1KEY A;  4Z8X A;  2XJ7 A;  3PJA J;  5H6R B;  2X66 A;  2J47 A;  3ETV A;  4EZH A;  4DR4 T;  4IGU A;  2V8S V;  5E0O A;  1GQE A;  2KWH A;  4DV3 T;  3ZC0 A;  2BG9 B;  3AVR A;  3CVR A;  4DBQ A;  1HTJ F;  3SWH A;  3U3I A;  4CN4 A;  4QH4 A;  1SHZ C;  3IBP A;  4AKG A;  5LG3 A;  3UU6 A;  3Q5E A;  3CK6 A;  2LSG A;  5JRC A;  2XTL A;  4HFH A;  3MKD A;  2K5B B;  5FXV A;  3N9M A;  3N2O A;  3LK2 B;  3ZT7 A;  4MFR A;  3F31 A;  4GKK T;  3EAB A;  4AIU A;  2W66 A;  3VKG A;  2Q9Q A;  4PJN A;  1UGO A;  2YU2 A;  4EED A;  3A8Y C;  4H9Q C;  1HX8 A;  1UCU A;  4YTM A;  2M6I A;  3AVS A;  3QB5 A;  3QOF A;  1UUS A;  1KNR A;  3G06 A;  4IHJ E;  1VOM A;  3FHN A;  4HFE A;  5IYZ E;  3UT5 E;  4IDN A;  1FJG T;  1G73 A;  4X64 T;  3QK6 A;  2MPK A;  4JYA T;  5HEO A;  4UF0 A;  4ILB A;  3BK9 A;  2LSI A;  2V6X A;  2BG9 A;  1IBL T;  1W09 A;  2LM2 A;  3ZSS A;  3S4U A;  4JI5 T;  4HFB A;  2XM2 A;  1ZHC A;  2BKO A;  3AA0 B;  3RHW A;  2QYW A;  1JNR A;  1QUU A;  3AEB A;  2W67 A;  2KMF A;  3C4X A;  3JC6 C;  4DR1 T;  2WCA A;  3PUQ A;  2BS3 A;  4NIQ A;  4YXD A;  3AAA B;  3ETU A;  2JIW A;  2K9A A;  5LHG B;  2CE7 A;  2H7V C;  4CN1 A;  4PK4 A;  5JH7 E;  1MIV A;  3AE6 A;  1H7C A;  2W63 A;  5JDG A;  5AQT B;  5ETW A;  2QGS A;  2XQ5 A;  3PUW F;  2MAW A;  4MBQ A;  5FNV E;  3J9X 1;  4OHF A;  1OED B;  2CCQ A;  2E8I A;  3RYH E;  2QRX A;  2D5U A;  2XQA A;  4OK0 A;  2WDQ A;  4HE8 A;  1O3X A;  2V7L A;  4CZZ B;  1J5E T;  2WQY A; 
#chains in the Genus database with same CATH homology
 5AQI B;  1HX1 B;  3LDQ B;  3FZF B;  5AQM B;  5AQK B;  5AQU B;  1T7S A;  1UGO A;  5AQT B;  3FZK B;  1UK5 A;  2D9D A;  3A8Y C;  4HWC A;  5AQG B;  5AQQ B;  1I6Z A;  3M3Z B;  1M7K A;  5AQJ B;  5AQV B;  3FZL B;  3FZH B;  5AQH B;  5AQF B;  5AQN B;  5AQS B;  5AQP B;  5AQR B;  1M62 A;  4HWI B;  3FZM B;  4HWF A;  4HWD A;  5AQL B;  5AQO B;  4HWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...