5AQFB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqfB00
5AQRB 3LDQB 5AQSB 3FZHB 5AQFB 5AQOB 5AQPB 1UK5A 1M62A 3FZKB 4HWHA 5AQKB 5AQIB 1UGOA 3FZFB 5AQVB 4HWIB 5AQGB 4HWDA 4HWFA 3A8YC 5AQMB 3FZMB 4HWCA 5AQLB 5AQHB 1M7KA 5AQJB 3M3ZB 5AQNB 1T7SA 5AQQB 2D9DA 5AQTB 1HX1B 5AQUB 1I6ZA 3FZLB
chains in the Genus database with same CATH superfamily
2Q9QA 2XZEA 1HX8A 4PK5A 2YU2A 5HXRA 3RC3A 2KWIB 3AE6A 3QB5K 5J0ZA 3IHRA 3Q2MA 3AEEA 2K9AA 4ISSA 2E9XA 3VU7H 4G2AA 4LFCT 4CXXA 3AE1A 3LK2B 1S35A 1BR1A 3LDQB 2V6YA 2Q9QC 1JNRA 4IREA 3W15B 2ZM0A 2Q9QD 3PU8A 4PJJA 5JR9A 4ZI7E 5AQMB 2PFVA 4IL9A 4CI3B 3PUAA 5FY0A 1HG5A 3JC6D 2VL8A 5IWAT 4CI1B 2Q9QB 4DIDB 4TX5A 1M62A 1Z8UA 3NWIA 2VURA 3OYZA 4YTPA 3JCFA 2X0LB 3AE5A 5JR9C 4L9IA 3LK42 4U74A 5LGTB 4ILCA 2ZM8A 1YW0A 2V6YB 4LFBT 4UR9A 3SFDA 4HGAA 4ZZCA 4LFAT 2WWUA 3PJAJ 3QK6A 5JR9B 4C91A 4JI0T 2V7LA 3J9X1 5HAXA 4DV3T 2AXDS 4H9QC 5LG4A 3GA8A 3HI2A 1N36T 4AKIA 2CMRA 2WB5A 2CXDA 5HYAA 1LKXA 4MALA 3E0ZA 4ZI3C 5LCYA 3M65A 1QUUA 4CI2B 3ZCIA 5AQNB 1NENA 5M4YA 2HHHT 2YOEA 4DR4T 2DHRA 5AQPB 4LMJA 1CUNA 3L39A 5KX5E 1N34T 4H9PC 5FXWA 4AIUA 2L9QA 4DV0T 3PV0F 5HCJA 2W63A 5L3CB 3UUXB 2WMNA 3EAMA 1XWMA 3A7MA 3I0OA 3VHLA 3TLUA 2BG9A 1DU2A 3U3IA 5TAOA 1FMVA 5LXTE 3KV9A 1WCRA 4HWDA 3LG7A 3ZSSA 2XQ4A 2CEAA 3A5XA 4A5XA 4LMLA 5AQRB 4PAGA 3VR9A 3AEAA 3OKQA 2CLYC 2KXPB 4A98A 3HKDE 1XMQT 1MIWA 4O2BE 3CIRA 3AE7A 5FYMA 2W0GA 3JADA 2JQKA 5FVKA 1AJ3A 4PW8A 2X9WA 1KFYA 2VKHA 3QB5A 2CLYB 4P0BA 4DO0A 3R6NA 4HWCA 4EIWA 2Z6EA 2W62A 4HFVA 2K3WA 1IBLT 4K0KT 5L3FB 2WDVA 1XMOT 5L3BB 4J2CA 2CA5A 2L8KA 3ETUA 4CXWA 4DR3T 4X1YE 3T8OA 5L3EB 2PJQA 2WU2A 3LSVA 2X9XA 2FJBA 2BVLA 2F4VT 1IBKT 1HFAA 2C5KT 3KVBA 5HWYA 2CWOA 4QHOA 2XQAA 2LE8A 3BQLA 2AE9A 2IIUA 3KV6A 1HR0T 2DNXA 2IMLA 2YDSA 2JQHA 3WI3A 3ZMZB 4XAXB 4KMCA 2WDRA 2NTYA 4IE7A 2XJ7A 3TKLB 4EV6A 4MLKA 3RYHE 5LNKA 3ZMVB 1T7SA 2LSJA 3RKOA 4PK4A 4HEAA 1N32T 4IHJE 4TV9E 5BR8T 1E7PA 2E5LT 2PG8A 4ANJA 2WCAA 5FXVA 2Y8DA 4EB6E 4L5GA 3IEEA 4JV5T 1I6ZA 5LYJE 3RQUA 3BQKA 2NW8A 3K1SA 3QUJA 1KF6A 2E5VA 2MYSA 4HWIB 4DMVA 3H3AA 3O9XA 2XQ8A 1KNPA 1U4QA 3AEFA 1FMWA 3PUVF 2P9BA 3UULA 1NWMX 3IBPA 3RRCA 3UUMA 4U72A 3K3NA 2XSAA 5IHYA 4KI0F 2CHNA 3UU8A 1WLXA 2QGSA 2IC9A 3RLFF 4JEUB 5C2TA 4QKNA 3AXJA 4WW0A 1I94T 2LHRA 2VB6A 5KDMC 2K5BB 3JAFA 3CQXC 5FY7A 4ZI2C 4P1NA 4ZZBA 1SE7A 5F5WA 2M67A 2RPAA 5IUXA 1T72A 4X1KE 4CZZB 4ZI2D 3PUSA 1IAPA 2D2SA 3FHNA 2W66A 2LOPA 4B3ST 5AQLB 1V9DA 4HTEA 5JDNA 3AEDA 3UU6A 2V7JA 3LJCA 2XQ6A 4JBWF 2WY2A 4KP3C 4LF7T 2FJEA 3CPZA 3P8CD 1W9RA 1W09A 2X9YA 5EK3A 3AA0B 1LVFA 1LVKA 3V5UA 3Q9DA 3Q5EA 3C4ZA 2VKOA 3VRBA 3PUWF 4DV7T 3KBTA 5CA0E 1Y64B 2WU5A 1HG2A 2JMKA 3UTKA 4DR6T 3RX6A 1YXRA 5L47A 2C0SA 3IF8B 1VCTA 2V7MA 2BDEA 2X0HA 4F6RC 2EHOA 5LHIB 5BMVE 1ZOYA 5CA1E 1D1AA 3HKEE 2JQ9A 1Z0PA 5J2UE 3N9PA 3ZMUB 4EYYR 2YDRA 4YSXA 3GWHA 2PTFA 2D0UA 3RI5A 2XQ9A 5FL1A 2IAKA 3RC8A 4K0UA 1QLBA 2LRLA 2BBJA 2EHOC 4JYAT 2ZM6T 5LP6E 4IDPA 5JDLA 4LF8T 3BQIA 3RQWA 2EHOD 4AQFA 4DBQA 4EZ4A 5F3JA 2LEHA 1XNRT 2WZIA 2ODUA 2EHOB 2NW9A 3P4RA 4LF4T 4XBFB 4DV5T 4YSZA 3RYCE 2LHNA 4AQFC 2VASA 4ZEYA 2WS3A 3EDUA 5LB7B 2V5DA 3UUNA 4EOZB 2UXCT 2CM0A 1XNQT 5EK2A 3MXZA 3RGLA 3FZMB 3AA1B 3G06A 4EZHA 2WBLA 3VKHA 4YHHT 4B3MT 3ANWA 5FKYA 3PDYA 1UGOA 1S94A 2XY8B 1X9BA 4QWNB 5FP3A 5AQHB 2BZBA 4Q25A 1T98A 4IE0A 4BA9A 3OYXA 4NXNT 1KNZA 2D0TA 4OHFA 3AE8A 1JNZA 1UUSA 2J62A 2VQFT 3ZT6A 4H9RC 3PJAA 4CXYA 2UXXB 5FNVE 3ZEFB 3H37A 5ABFA 4IDNA 4WYVA 2V1DB 4ILAA 5LBQB 3RKGA 2MPKA 4Z91A 2VKDA 4AXPA 2XAFB 4TUYE 2V8SV 3AEBA 5H6QB 3ANWB 3DJBA 3JAEA 4PK6A 2E8IA 3ZT5A 5C3JA 3S4UA 2W00A 5JTGA 5J1GA 4H63V 4YTNA 4ZI3D 2A9UA 2V26A 4OFZA 2WM9A 4YXDA 4YLHA 3VRAA 5LJNA 2HH7A 4YT0A 4CN6A 4UVCB 5LA6E 4X64T 2N1GA 4PJNA 4O8SA 3KFWX 1EZ3A 3AAIA 5ABFB 2KLQA 4LF9T 5ADXL 2CWYA 3N9QA 5LOVE 3PUZF 5JDFA 2JQQA 4JLEA 2LSGA 1MNEA 3LBXB 2RP4A 2XM2A 5AQFB 4B3TT 4HFEA 4ASKA 4HFDA 2W4XA 3PUYF 3P4PA 3Q5WA 5JQGE 1XZYA 2CXFA 3OPCA 4UELA 3AE4A 2A72A 4GYSA 3UU3A 4XZCA 2X51A 2ACXA 1IJ5A 3B5MA 4KHPT 5HXSA 4C90A 3T1HT 4KBMB 2UUBT 3FBZA 4PJMA 2XAJB 3EI0A 1YQ3A 4X66T 3E22E 2BS3A 4G63A 4LMKA 2RA1A 2XQ7A 2YINA 2X68A 2Y6XA 3V5SA 5DQVA 4EAHA 1HX1B 1B7TA 2CBIA 5JVDE 2DI4A 3ONLC 4UF0B 5FXXA 1MIVA 3LFMA 1CHUA 3P4SA 4H9NC 4TNVA 4GIWA 2V7IA 4HN9A 2YDQA 3AE9A 1HTJF 4U31A 3GN5B 4DR5T 2XAQB 4IGUA 4DMWA 2KZ7B 3I1AA 4TZ4C 1ZEEA 4JUYA 2YKSA 4H9SE 5CFBA 4DV6T 2A3DA 2QRXA 2ZLYA 4QH4A 3SOLA 4OYKA 2WAUA 3ZYLA 2XUEA 3FB2A 2C5IT 3Q5DA 1E1HB 2WWVA 4I50E 1N33T 2UXNB 3MK7C 1UURA 4V1Av 3HKCE 2MOZA 5FXZA 4QH5A 4HWHA 1BR2A 3RH3A 5J2TE 4P0AA 4E7ZA 2JIWA 2M6IA 3M3ZB 3SS1A 1E2AA 2B76A 3I9YA 1W0BA 3LK3B 3FZKB 1IZNB 2WMOA 3KVAA 4JI7T 1BR0A 5KXJA 3SRZA 2HN2A 3OBVE 5EK4A 2BS2A 4IT4A 2MBGA 2KWHA 3HL6A 3ZPOA 2UUCT 3AAAB 2X67A 3X1DA 3PUXF 2CCQA 3ZT7A 5JDQA 4LF6T 2BVMA 2IW5B 1WFDA 2DWGA 2K48A 2HN1A 3O1HA 4ISTA 4O4LE 4TWHA 3RRWA 3MZKB 4X1IE 2BBHA 4ILUA 2VQET 4EEBA 2W67A 2KINB 4TV8E 3R84B 5JDGA 3O1IA 3UFGA 2X9HA 2D9DA 5AQUB 1L0VA 4JI4T 4IE5A 5LHHB 2YK0A 1OEDE 2CRBA 1UK5A 3ONXA 3ZMSB 4DV4T 4ZS2A 3CX6B 2VKJA 2BKNA 5LG3A 2QYWA 4YFSA 5E0OA 1ZV4X 3U78A 1FJGT 2I0MA 4JI3T 2JRKA 4U7IA 3TLTA 3ONJA 2YEVC 3NZQA 3CQCB 1LRZA 2NTXA 4P09A 3ZSTA 2J4GA 1D1CA 3N2OA 4WBOA 4F8HA 5L2LA 4BJMA 1NAFA 3CKDA 2JMHA 3F2EA 3ZLIA 2NR4A 4U33A 2H89A 4IDZA 5CJ5A 2I59A 3MA9A 1UX4A 3P7IA 4QXBB 4MFRA 3J7Yq 5DJQC 5ABHA 2XQ5A 2ZM2A 3K8PC 4MBQA 4NXMT 2NW7A 5AQKB 3B13A 1MIYA 5AQVB 2UU9T 3NRYA 3O1JA 2CXLA 2R6GF 2XSBA 1VRBA 4AKHA 3PUQA 4DR2T 1YKHB 3WAKA 4X20E 4O4IE 5A1LA 2X66A 1OEDA 1XDPA 3RYFE 3P4WA 3ZYKA 3ZC1A 2OV9A 1KNRA 3B57A 4KUMB 5HEHA 4QXCB 3C4WA 4NUUA 2CBJA 5L4EA 1QSDA 5AQJB 4FJOA 2V6XA 4AKRB 5ETWA 3Q5XA 2DWKA 3RPUA 3FXEB 4QH1A 1VOMA 3C50A 5LJMA 1MMAA 4GK0E 1OEDC 3F57A 5IYZE 3AAEB 2IC6A 2G0UA 3D0TA 2LSYA 1ZKEA 3N9OA 4A97A 5CGMA 3MJXA 5AQTB 4YY3T 4L0RA 2BS4A 1G73A 1YD8G 2J1DG 2MAWA 1OEDB 2ES0A 5AQIB 4FI5A 3ESLA 4DBRA 2LLYA 3EHZA 3RF1A 3DTOA 3PURA 1SHZC 3A8YC 3ZC0A 3AA6B 2JPFA 4EYUA 1WYCA 2X0YA 1MNDA 4HKAA 2XPKA 3RIFA 3AB3B 5LGNB 2XTLA 2H7VC 2Y48B 3N9LA 4IDOA 1SA0E 3AA7B 3JC6C 2WDQA 1ZP0A 3CWZB 2E9XC 1M7KA 3WAJA 2BG9E 4GYRA 2E2AA 1MMNA 2E9XD 4OX9T 4I55E 5HEGA 4X65T 4I43B 3C98B 1D0ZA 2ODVA 4TN7B 2E9XB 4U3CA 4GOUA 5HXCA 4TWDA 4LF5T 1OXZA 4WNKA 1J5WA 2LKGA 3N2KE 4IL4A 2OLTA 4WZXA 5JH7E 4DUZT 4JI6T 3T1YT 2CHOA 5AQGB 4DV1T 2GK9A 3L3PA 2LM9A 3H3MA 3CX7B 5JRCA 2LKHA 4AI6A 1J5ET 4X62T 3DP7A 4U2YA 5AQQB 3LBXA 4KX6A 2XQ3A 5JREA 4HFIA 4COFA 3N9NA 4GK5E 1FIOA 4CN1A 2D5UA 2IHR1 2IUBA 1OWAA 5L3GB 5LGUB 3I0QA 3OVUA 5HEJA 3NZPA 5F8PA 5FL0A 4NPPA 4ADZA 2KMFA 4UIGA 3UUBA 1X79A 4YHJA 3ZKRA 2WQYA 1YKEB 3ZN1B 1KEYA 2ACZA 3AE2A 2OA5A 4QXHB 2HPLA 5JRCB 2VL0A 2LSIA 3PUGA 4CN4A 4AQYT 3N9MA 1U5PA 3IA3A 2V7KA 1D0XA 2VWAA 4EEDA 4UF0A 2QVAA 2KNDA 2HPJA 1YQ4A 2CPTA 2WP9A 4UEMA 4E7SA 2BKPA 3ZYMA 1WYBA 4QX8B 1T8BA 4PJLA 3TLWA 4OK0A 1KK7A 4NUVA 1XDOA 2N2NA 3FXDB 2BG9C 5AQSB 3GN5A 1US7B 2H3RA 3SFEA 3KBUA 3NRXA 4ERRA 3TLVA 2XQYA 3HA4A 3CQGB 1O3XA 3BK9A 1UX5A 3P4QA 2BKOA 2C5JA 5AFUL 4DR1T 2PBIA 4H9OC 2BG9B 1J1JA 3ZCJA 5HWXA 3ZJ1A 3HKBE 1HNWT 2VVSA 1VCSA 3C4XA 4QX7B 5GONE 4UXNB 4YSYA 1Y01A 1H7CA 1IJ6A 4PNIA 2DL1A 1R8IA 5L4HA 5HXEA 2LOSA 3EDVA 4PFPA 2NOXA 3QNUA 5DQWA 4MHCA 5JDMA 3KINB 4DUYT 3AVRA 3O4XE 2KSRA 4IE6A 1W0AA 4YJ2E 2KT9A 2VK9A 5FVLA 3ZMTB 3CVRA 2YN6A 2M6BA 3AECA 3HR0A 4UVBB 2XASB 2J47A 3C51A 1HF8A 2XHEB 1WR6A 3FZFB 1HNZT 4AQGA 4O4HE 2UXDT 2NWBA 4DV2T 4YTMA 2YU1A 3CMLA 4WBNE 3ETVA 1HNXT 4I0UA 3AEGA 1SUMB 3EABA 2UUAT 3NKZA 3QC9A 4NIQA 2LSKA 4DR7T 3NBXX 1FEWA 4U7YA 4ZXLA 4AISA 3FZHB 3K3QC 3L8RA 3QOFA 2W61A 2K24A 2NP9A 4EXTA 3P50A 4M1PA 2H88A 1D0YA 2XAHB 2FJDA 2XM1A 3N5LA 2CE7A 3PTRB 2QA7A 3KDSE 5DABA 2H7OA 2L3LA 5HXHA 2N9DA 4JEHB 3EVYA 1HCIA 5EZYE 2WSSV 5C8YE 3KV4A 5LMUT 4JI5T 2W2UA 1MMDA 3E08A 3RYIE 3NVOA 2DCFA 4KHZF 3GMIA 5CB4E 4N78D 2FBWA 4I4TE 1IBMT 3RIUA 5H6RB 1D1BA 4Z8XA 2B1EA 4H63H 4EGWA 5LBMA 1WR0A 4O2AE 4Z90A 3UU5A 3ZN0B 3MKDA 4HE8A 5LHGB 2ZMAA 3VR8A 3CK6A 5JDHA 2LT3A 4HFCA 2DLRA 4BAYB 1HS7A 4O4JE 3RIUC 3FZLB 5ABEA 4JI1T 2WZHA 4TNWA 5HEUA 4PFOA 3UFEA 4GKJT 4U2ZA 3SWHA 1GQEA 4TWFA 4GKKT 1ZHCA 4IIJE 1NEKA 4B3RT 3N2GE 5FY1A 2V5CA 3AXJB 4AKGA 4HFHA 4ZOLE 3OTOT 3UQ7A 4X5TA 3FBLA 4BJNA 2A2FX 5HEOA 4OYJA 5HCMA 4DVDA 4A56A 2VVNA 4ZHQE 3TLSA 4YJ3E 1BR4A 4UV8B 4AKLA 4B6XA 2SPCA 2UXBT 3L09A 3C64A 3UU4A 3AVSA 4IDQA 3OJAA 3KV5A 5KMGP 3AE3A 4HFBA 5ABGA 1WRDA 3F31A 3I9WA 3MACA 2FJAA 4CQIA 5L3DB 3UQ4A 2MTQA 5AQOB 3K3OA 4DNDA 4ZS3A 5LMNT 3ABVA 2LRKA 3UT5E 3RIAA 4UV9B 2IDOB 1MMGA 2JJ9A 1G8XA 4IE4A 3CX8B 4ILBA 2FUPA 3PE0A 2LJLA 3PU3A 2XAGB 3EUHA 2LM2A 5FMNA 1UCUA 4HWFA 3ZJ2A 3VKGA 2I6HA 4UVAB 3RHWA 4JI2T 4JI8T
chains in the Genus database with same CATH topology
5AQRB 3LDQB 5AQSB 3FZHB 5AQFB 5AQOB 5AQPB 1UK5A 1M62A 3FZKB 4HWHA 5AQKB 5AQIB 1UGOA 3FZFB 5AQVB 4HWIB 5AQGB 4HWDA 4HWFA 3A8YC 5AQMB 3FZMB 4HWCA 5AQLB 5AQHB 1M7KA 5AQJB 3M3ZB 5AQNB 1T7SA 5AQQB 2D9DA 5AQTB 1HX1B 5AQUB 1I6ZA 3FZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQR B;  3LDQ B;  5AQS B;  3FZH B;  5AQF B;  5AQO B;  5AQP B;  1UK5 A;  1M62 A;  3FZK B;  4HWH A;  5AQK B;  5AQI B;  1UGO A;  3FZF B;  5AQV B;  4HWI B;  5AQG B;  4HWD A;  4HWF A;  3A8Y C;  5AQM B;  3FZM B;  4HWC A;  5AQL B;  5AQH B;  1M7K A;  5AQJ B;  3M3Z B;  5AQN B;  1T7S A;  5AQQ B;  2D9D A;  5AQT B;  1HX1 B;  5AQU B;  1I6Z A;  3FZL B; 
#chains in the Genus database with same CATH topology
 2Q9Q A;  2XZE A;  1HX8 A;  4PK5 A;  2YU2 A;  5HXR A;  3RC3 A;  2KWI B;  3AE6 A;  3QB5 K;  5J0Z A;  3IHR A;  3Q2M A;  3AEE A;  2K9A A;  4ISS A;  2E9X A;  3VU7 H;  4G2A A;  4LFC T;  4CXX A;  3AE1 A;  3LK2 B;  1S35 A;  1BR1 A;  3LDQ B;  2V6Y A;  2Q9Q C;  1JNR A;  4IRE A;  3W15 B;  2ZM0 A;  2Q9Q D;  3PU8 A;  4PJJ A;  5JR9 A;  4ZI7 E;  5AQM B;  2PFV A;  4IL9 A;  4CI3 B;  3PUA A;  5FY0 A;  1HG5 A;  3JC6 D;  2VL8 A;  5IWA T;  4CI1 B;  2Q9Q B;  4DID B;  4TX5 A;  1M62 A;  1Z8U A;  3NWI A;  2VUR A;  3OYZ A;  4YTP A;  3JCF A;  2X0L B;  3AE5 A;  5JR9 C;  4L9I A;  3LK4 2;  4U74 A;  5LGT B;  4ILC A;  2ZM8 A;  1YW0 A;  2V6Y B;  4LFB T;  4UR9 A;  3SFD A;  4HGA A;  4ZZC A;  4LFA T;  2WWU A;  3PJA J;  3QK6 A;  5JR9 B;  4C91 A;  4JI0 T;  2V7L A;  3J9X 1;  5HAX A;  4DV3 T;  2AXD S;  4H9Q C;  5LG4 A;  3GA8 A;  3HI2 A;  1N36 T;  4AKI A;  2CMR A;  2WB5 A;  2CXD A;  5HYA A;  1LKX A;  4MAL A;  3E0Z A;  4ZI3 C;  5LCY A;  3M65 A;  1QUU A;  4CI2 B;  3ZCI A;  5AQN B;  1NEN A;  5M4Y A;  2HHH T;  2YOE A;  4DR4 T;  2DHR A;  5AQP B;  4LMJ A;  1CUN A;  3L39 A;  5KX5 E;  1N34 T;  4H9P C;  5FXW A;  4AIU A;  2L9Q A;  4DV0 T;  3PV0 F;  5HCJ A;  2W63 A;  5L3C B;  3UUX B;  2WMN A;  3EAM A;  1XWM A;  3A7M A;  3I0O A;  3VHL A;  3TLU A;  2BG9 A;  1DU2 A;  3U3I A;  5TAO A;  1FMV A;  5LXT E;  3KV9 A;  1WCR A;  4HWD A;  3LG7 A;  3ZSS A;  2XQ4 A;  2CEA A;  3A5X A;  4A5X A;  4LML A;  5AQR B;  4PAG A;  3VR9 A;  3AEA A;  3OKQ A;  2CLY C;  2KXP B;  4A98 A;  3HKD E;  1XMQ T;  1MIW A;  4O2B E;  3CIR A;  3AE7 A;  5FYM A;  2W0G A;  3JAD A;  2JQK A;  5FVK A;  1AJ3 A;  4PW8 A;  2X9W A;  1KFY A;  2VKH A;  3QB5 A;  2CLY B;  4P0B A;  4DO0 A;  3R6N A;  4HWC A;  4EIW A;  2Z6E A;  2W62 A;  4HFV A;  2K3W A;  1IBL T;  4K0K T;  5L3F B;  2WDV A;  1XMO T;  5L3B B;  4J2C A;  2CA5 A;  2L8K A;  3ETU A;  4CXW A;  4DR3 T;  4X1Y E;  3T8O A;  5L3E B;  2PJQ A;  2WU2 A;  3LSV A;  2X9X A;  2FJB A;  2BVL A;  2F4V T;  1IBK T;  1HFA A;  2C5K T;  3KVB A;  5HWY A;  2CWO A;  4QHO A;  2XQA A;  2LE8 A;  3BQL A;  2AE9 A;  2IIU A;  3KV6 A;  1HR0 T;  2DNX A;  2IML A;  2YDS A;  2JQH A;  3WI3 A;  3ZMZ B;  4XAX B;  4KMC A;  2WDR A;  2NTY A;  4IE7 A;  2XJ7 A;  3TKL B;  4EV6 A;  4MLK A;  3RYH E;  5LNK A;  3ZMV B;  1T7S A;  2LSJ A;  3RKO A;  4PK4 A;  4HEA A;  1N32 T;  4IHJ E;  4TV9 E;  5BR8 T;  1E7P A;  2E5L T;  2PG8 A;  4ANJ A;  2WCA A;  5FXV A;  2Y8D A;  4EB6 E;  4L5G A;  3IEE A;  4JV5 T;  1I6Z A;  5LYJ E;  3RQU A;  3BQK A;  2NW8 A;  3K1S A;  3QUJ A;  1KF6 A;  2E5V A;  2MYS A;  4HWI B;  4DMV A;  3H3A A;  3O9X A;  2XQ8 A;  1KNP A;  1U4Q A;  3AEF A;  1FMW A;  3PUV F;  2P9B A;  3UUL A;  1NWM X;  3IBP A;  3RRC A;  3UUM A;  4U72 A;  3K3N A;  2XSA A;  5IHY A;  4KI0 F;  2CHN A;  3UU8 A;  1WLX A;  2QGS A;  2IC9 A;  3RLF F;  4JEU B;  5C2T A;  4QKN A;  3AXJ A;  4WW0 A;  1I94 T;  2LHR A;  2VB6 A;  5KDM C;  2K5B B;  3JAF A;  3CQX C;  5FY7 A;  4ZI2 C;  4P1N A;  4ZZB A;  1SE7 A;  5F5W A;  2M67 A;  2RPA A;  5IUX A;  1T72 A;  4X1K E;  4CZZ B;  4ZI2 D;  3PUS A;  1IAP A;  2D2S A;  3FHN A;  2W66 A;  2LOP A;  4B3S T;  5AQL B;  1V9D A;  4HTE A;  5JDN A;  3AED A;  3UU6 A;  2V7J A;  3LJC A;  2XQ6 A;  4JBW F;  2WY2 A;  4KP3 C;  4LF7 T;  2FJE A;  3CPZ A;  3P8C D;  1W9R A;  1W09 A;  2X9Y A;  5EK3 A;  3AA0 B;  1LVF A;  1LVK A;  3V5U A;  3Q9D A;  3Q5E A;  3C4Z A;  2VKO A;  3VRB A;  3PUW F;  4DV7 T;  3KBT A;  5CA0 E;  1Y64 B;  2WU5 A;  1HG2 A;  2JMK A;  3UTK A;  4DR6 T;  3RX6 A;  1YXR A;  5L47 A;  2C0S A;  3IF8 B;  1VCT A;  2V7M A;  2BDE A;  2X0H A;  4F6R C;  2EHO A;  5LHI B;  5BMV E;  1ZOY A;  5CA1 E;  1D1A A;  3HKE E;  2JQ9 A;  1Z0P A;  5J2U E;  3N9P A;  3ZMU B;  4EYY R;  2YDR A;  4YSX A;  3GWH A;  2PTF A;  2D0U A;  3RI5 A;  2XQ9 A;  5FL1 A;  2IAK A;  3RC8 A;  4K0U A;  1QLB A;  2LRL A;  2BBJ A;  2EHO C;  4JYA T;  2ZM6 T;  5LP6 E;  4IDP A;  5JDL A;  4LF8 T;  3BQI A;  3RQW A;  2EHO D;  4AQF A;  4DBQ A;  4EZ4 A;  5F3J A;  2LEH A;  1XNR T;  2WZI A;  2ODU A;  2EHO B;  2NW9 A;  3P4R A;  4LF4 T;  4XBF B;  4DV5 T;  4YSZ A;  3RYC E;  2LHN A;  4AQF C;  2VAS A;  4ZEY A;  2WS3 A;  3EDU A;  5LB7 B;  2V5D A;  3UUN A;  4EOZ B;  2UXC T;  2CM0 A;  1XNQ T;  5EK2 A;  3MXZ A;  3RGL A;  3FZM B;  3AA1 B;  3G06 A;  4EZH A;  2WBL A;  3VKH A;  4YHH T;  4B3M T;  3ANW A;  5FKY A;  3PDY A;  1UGO A;  1S94 A;  2XY8 B;  1X9B A;  4QWN B;  5FP3 A;  5AQH B;  2BZB A;  4Q25 A;  1T98 A;  4IE0 A;  4BA9 A;  3OYX A;  4NXN T;  1KNZ A;  2D0T A;  4OHF A;  3AE8 A;  1JNZ A;  1UUS A;  2J62 A;  2VQF T;  3ZT6 A;  4H9R C;  3PJA A;  4CXY A;  2UXX B;  5FNV E;  3ZEF B;  3H37 A;  5ABF A;  4IDN A;  4WYV A;  2V1D B;  4ILA A;  5LBQ B;  3RKG A;  2MPK A;  4Z91 A;  2VKD A;  4AXP A;  2XAF B;  4TUY E;  2V8S V;  3AEB A;  5H6Q B;  3ANW B;  3DJB A;  3JAE A;  4PK6 A;  2E8I A;  3ZT5 A;  5C3J A;  3S4U A;  2W00 A;  5JTG A;  5J1G A;  4H63 V;  4YTN A;  4ZI3 D;  2A9U A;  2V26 A;  4OFZ A;  2WM9 A;  4YXD A;  4YLH A;  3VRA A;  5LJN A;  2HH7 A;  4YT0 A;  4CN6 A;  4UVC B;  5LA6 E;  4X64 T;  2N1G A;  4PJN A;  4O8S A;  3KFW X;  1EZ3 A;  3AAI A;  5ABF B;  2KLQ A;  4LF9 T;  5ADX L;  2CWY A;  3N9Q A;  5LOV E;  3PUZ F;  5JDF A;  2JQQ A;  4JLE A;  2LSG A;  1MNE A;  3LBX B;  2RP4 A;  2XM2 A;  5AQF B;  4B3T T;  4HFE A;  4ASK A;  4HFD A;  2W4X A;  3PUY F;  3P4P A;  3Q5W A;  5JQG E;  1XZY A;  2CXF A;  3OPC A;  4UEL A;  3AE4 A;  2A72 A;  4GYS A;  3UU3 A;  4XZC A;  2X51 A;  2ACX A;  1IJ5 A;  3B5M A;  4KHP T;  5HXS A;  4C90 A;  3T1H T;  4KBM B;  2UUB T;  3FBZ A;  4PJM A;  2XAJ B;  3EI0 A;  1YQ3 A;  4X66 T;  3E22 E;  2BS3 A;  4G63 A;  4LMK A;  2RA1 A;  2XQ7 A;  2YIN A;  2X68 A;  2Y6X A;  3V5S A;  5DQV A;  4EAH A;  1HX1 B;  1B7T A;  2CBI A;  5JVD E;  2DI4 A;  3ONL C;  4UF0 B;  5FXX A;  1MIV A;  3LFM A;  1CHU A;  3P4S A;  4H9N C;  4TNV A;  4GIW A;  2V7I A;  4HN9 A;  2YDQ A;  3AE9 A;  1HTJ F;  4U31 A;  3GN5 B;  4DR5 T;  2XAQ B;  4IGU A;  4DMW A;  2KZ7 B;  3I1A A;  4TZ4 C;  1ZEE A;  4JUY A;  2YKS A;  4H9S E;  5CFB A;  4DV6 T;  2A3D A;  2QRX A;  2ZLY A;  4QH4 A;  3SOL A;  4OYK A;  2WAU A;  3ZYL A;  2XUE A;  3FB2 A;  2C5I T;  3Q5D A;  1E1H B;  2WWV A;  4I50 E;  1N33 T;  2UXN B;  3MK7 C;  1UUR A;  4V1A v;  3HKC E;  2MOZ A;  5FXZ A;  4QH5 A;  4HWH A;  1BR2 A;  3RH3 A;  5J2T E;  4P0A A;  4E7Z A;  2JIW A;  2M6I A;  3M3Z B;  3SS1 A;  1E2A A;  2B76 A;  3I9Y A;  1W0B A;  3LK3 B;  3FZK B;  1IZN B;  2WMO A;  3KVA A;  4JI7 T;  1BR0 A;  5KXJ A;  3SRZ A;  2HN2 A;  3OBV E;  5EK4 A;  2BS2 A;  4IT4 A;  2MBG A;  2KWH A;  3HL6 A;  3ZPO A;  2UUC T;  3AAA B;  2X67 A;  3X1D A;  3PUX F;  2CCQ A;  3ZT7 A;  5JDQ A;  4LF6 T;  2BVM A;  2IW5 B;  1WFD A;  2DWG A;  2K48 A;  2HN1 A;  3O1H A;  4IST A;  4O4L E;  4TWH A;  3RRW A;  3MZK B;  4X1I E;  2BBH A;  4ILU A;  2VQE T;  4EEB A;  2W67 A;  2KIN B;  4TV8 E;  3R84 B;  5JDG A;  3O1I A;  3UFG A;  2X9H A;  2D9D A;  5AQU B;  1L0V A;  4JI4 T;  4IE5 A;  5LHH B;  2YK0 A;  1OED E;  2CRB A;  1UK5 A;  3ONX A;  3ZMS B;  4DV4 T;  4ZS2 A;  3CX6 B;  2VKJ A;  2BKN A;  5LG3 A;  2QYW A;  4YFS A;  5E0O A;  1ZV4 X;  3U78 A;  1FJG T;  2I0M A;  4JI3 T;  2JRK A;  4U7I A;  3TLT A;  3ONJ A;  2YEV C;  3NZQ A;  3CQC B;  1LRZ A;  2NTX A;  4P09 A;  3ZST A;  2J4G A;  1D1C A;  3N2O A;  4WBO A;  4F8H A;  5L2L A;  4BJM A;  1NAF A;  3CKD A;  2JMH A;  3F2E A;  3ZLI A;  2NR4 A;  4U33 A;  2H89 A;  4IDZ A;  5CJ5 A;  2I59 A;  3MA9 A;  1UX4 A;  3P7I A;  4QXB B;  4MFR A;  3J7Y q;  5DJQ C;  5ABH A;  2XQ5 A;  2ZM2 A;  3K8P C;  4MBQ A;  4NXM T;  2NW7 A;  5AQK B;  3B13 A;  1MIY A;  5AQV B;  2UU9 T;  3NRY A;  3O1J A;  2CXL A;  2R6G F;  2XSB A;  1VRB A;  4AKH A;  3PUQ A;  4DR2 T;  1YKH B;  3WAK A;  4X20 E;  4O4I E;  5A1L A;  2X66 A;  1OED A;  1XDP A;  3RYF E;  3P4W A;  3ZYK A;  3ZC1 A;  2OV9 A;  1KNR A;  3B57 A;  4KUM B;  5HEH A;  4QXC B;  3C4W A;  4NUU A;  2CBJ A;  5L4E A;  1QSD A;  5AQJ B;  4FJO A;  2V6X A;  4AKR B;  5ETW A;  3Q5X A;  2DWK A;  3RPU A;  3FXE B;  4QH1 A;  1VOM A;  3C50 A;  5LJM A;  1MMA A;  4GK0 E;  1OED C;  3F57 A;  5IYZ E;  3AAE B;  2IC6 A;  2G0U A;  3D0T A;  2LSY A;  1ZKE A;  3N9O A;  4A97 A;  5CGM A;  3MJX A;  5AQT B;  4YY3 T;  4L0R A;  2BS4 A;  1G73 A;  1YD8 G;  2J1D G;  2MAW A;  1OED B;  2ES0 A;  5AQI B;  4FI5 A;  3ESL A;  4DBR A;  2LLY A;  3EHZ A;  3RF1 A;  3DTO A;  3PUR A;  1SHZ C;  3A8Y C;  3ZC0 A;  3AA6 B;  2JPF A;  4EYU A;  1WYC A;  2X0Y A;  1MND A;  4HKA A;  2XPK A;  3RIF A;  3AB3 B;  5LGN B;  2XTL A;  2H7V C;  2Y48 B;  3N9L A;  4IDO A;  1SA0 E;  3AA7 B;  3JC6 C;  2WDQ A;  1ZP0 A;  3CWZ B;  2E9X C;  1M7K A;  3WAJ A;  2BG9 E;  4GYR A;  2E2A A;  1MMN A;  2E9X D;  4OX9 T;  4I55 E;  5HEG A;  4X65 T;  4I43 B;  3C98 B;  1D0Z A;  2ODV A;  4TN7 B;  2E9X B;  4U3C A;  4GOU A;  5HXC A;  4TWD A;  4LF5 T;  1OXZ A;  4WNK A;  1J5W A;  2LKG A;  3N2K E;  4IL4 A;  2OLT A;  4WZX A;  5JH7 E;  4DUZ T;  4JI6 T;  3T1Y T;  2CHO A;  5AQG B;  4DV1 T;  2GK9 A;  3L3P A;  2LM9 A;  3H3M A;  3CX7 B;  5JRC A;  2LKH A;  4AI6 A;  1J5E T;  4X62 T;  3DP7 A;  4U2Y A;  5AQQ B;  3LBX A;  4KX6 A;  2XQ3 A;  5JRE A;  4HFI A;  4COF A;  3N9N A;  4GK5 E;  1FIO A;  4CN1 A;  2D5U A;  2IHR 1;  2IUB A;  1OWA A;  5L3G B;  5LGU B;  3I0Q A;  3OVU A;  5HEJ A;  3NZP A;  5F8P A;  5FL0 A;  4NPP A;  4ADZ A;  2KMF A;  4UIG A;  3UUB A;  1X79 A;  4YHJ A;  3ZKR A;  2WQY A;  1YKE B;  3ZN1 B;  1KEY A;  2ACZ A;  3AE2 A;  2OA5 A;  4QXH B;  2HPL A;  5JRC B;  2VL0 A;  2LSI A;  3PUG A;  4CN4 A;  4AQY T;  3N9M A;  1U5P A;  3IA3 A;  2V7K A;  1D0X A;  2VWA A;  4EED A;  4UF0 A;  2QVA A;  2KND A;  2HPJ A;  1YQ4 A;  2CPT A;  2WP9 A;  4UEM A;  4E7S A;  2BKP A;  3ZYM A;  1WYB A;  4QX8 B;  1T8B A;  4PJL A;  3TLW A;  4OK0 A;  1KK7 A;  4NUV A;  1XDO A;  2N2N A;  3FXD B;  2BG9 C;  5AQS B;  3GN5 A;  1US7 B;  2H3R A;  3SFE A;  3KBU A;  3NRX A;  4ERR A;  3TLV A;  2XQY A;  3HA4 A;  3CQG B;  1O3X A;  3BK9 A;  1UX5 A;  3P4Q A;  2BKO A;  2C5J A;  5AFU L;  4DR1 T;  2PBI A;  4H9O C;  2BG9 B;  1J1J A;  3ZCJ A;  5HWX A;  3ZJ1 A;  3HKB E;  1HNW T;  2VVS A;  1VCS A;  3C4X A;  4QX7 B;  5GON E;  4UXN B;  4YSY A;  1Y01 A;  1H7C A;  1IJ6 A;  4PNI A;  2DL1 A;  1R8I A;  5L4H A;  5HXE A;  2LOS A;  3EDV A;  4PFP A;  2NOX A;  3QNU A;  5DQW A;  4MHC A;  5JDM A;  3KIN B;  4DUY T;  3AVR A;  3O4X E;  2KSR A;  4IE6 A;  1W0A A;  4YJ2 E;  2KT9 A;  2VK9 A;  5FVL A;  3ZMT B;  3CVR A;  2YN6 A;  2M6B A;  3AEC A;  3HR0 A;  4UVB B;  2XAS B;  2J47 A;  3C51 A;  1HF8 A;  2XHE B;  1WR6 A;  3FZF B;  1HNZ T;  4AQG A;  4O4H E;  2UXD T;  2NWB A;  4DV2 T;  4YTM A;  2YU1 A;  3CML A;  4WBN E;  3ETV A;  1HNX T;  4I0U A;  3AEG A;  1SUM B;  3EAB A;  2UUA T;  3NKZ A;  3QC9 A;  4NIQ A;  2LSK A;  4DR7 T;  3NBX X;  1FEW A;  4U7Y A;  4ZXL A;  4AIS A;  3FZH B;  3K3Q C;  3L8R A;  3QOF A;  2W61 A;  2K24 A;  2NP9 A;  4EXT A;  3P50 A;  4M1P A;  2H88 A;  1D0Y A;  2XAH B;  2FJD A;  2XM1 A;  3N5L A;  2CE7 A;  3PTR B;  2QA7 A;  3KDS E;  5DAB A;  2H7O A;  2L3L A;  5HXH A;  2N9D A;  4JEH B;  3EVY A;  1HCI A;  5EZY E;  2WSS V;  5C8Y E;  3KV4 A;  5LMU T;  4JI5 T;  2W2U A;  1MMD A;  3E08 A;  3RYI E;  3NVO A;  2DCF A;  4KHZ F;  3GMI A;  5CB4 E;  4N78 D;  2FBW A;  4I4T E;  1IBM T;  3RIU A;  5H6R B;  1D1B A;  4Z8X A;  2B1E A;  4H63 H;  4EGW A;  5LBM A;  1WR0 A;  4O2A E;  4Z90 A;  3UU5 A;  3ZN0 B;  3MKD A;  4HE8 A;  5LHG B;  2ZMA A;  3VR8 A;  3CK6 A;  5JDH A;  2LT3 A;  4HFC A;  2DLR A;  4BAY B;  1HS7 A;  4O4J E;  3RIU C;  3FZL B;  5ABE A;  4JI1 T;  2WZH A;  4TNW A;  5HEU A;  4PFO A;  3UFE A;  4GKJ T;  4U2Z A;  3SWH A;  1GQE A;  4TWF A;  4GKK T;  1ZHC A;  4IIJ E;  1NEK A;  4B3R T;  3N2G E;  5FY1 A;  2V5C A;  3AXJ B;  4AKG A;  4HFH A;  4ZOL E;  3OTO T;  3UQ7 A;  4X5T A;  3FBL A;  4BJN A;  2A2F X;  5HEO A;  4OYJ A;  5HCM A;  4DVD A;  4A56 A;  2VVN A;  4ZHQ E;  3TLS A;  4YJ3 E;  1BR4 A;  4UV8 B;  4AKL A;  4B6X A;  2SPC A;  2UXB T;  3L09 A;  3C64 A;  3UU4 A;  3AVS A;  4IDQ A;  3OJA A;  3KV5 A;  5KMG P;  3AE3 A;  4HFB A;  5ABG A;  1WRD A;  3F31 A;  3I9W A;  3MAC A;  2FJA A;  4CQI A;  5L3D B;  3UQ4 A;  2MTQ A;  5AQO B;  3K3O A;  4DND A;  4ZS3 A;  5LMN T;  3ABV A;  2LRK A;  3UT5 E;  3RIA A;  4UV9 B;  2IDO B;  1MMG A;  2JJ9 A;  1G8X A;  4IE4 A;  3CX8 B;  4ILB A;  2FUP A;  3PE0 A;  2LJL A;  3PU3 A;  2XAG B;  3EUH A;  2LM2 A;  5FMN A;  1UCU A;  4HWF A;  3ZJ2 A;  3VKG A;  2I6H A;  4UVA B;  3RHW A;  4JI2 T;  4JI8 T; 
#chains in the Genus database with same CATH homology
 5AQR B;  3LDQ B;  5AQS B;  3FZH B;  5AQF B;  5AQO B;  5AQP B;  1UK5 A;  1M62 A;  3FZK B;  4HWH A;  5AQK B;  5AQI B;  1UGO A;  3FZF B;  5AQV B;  4HWI B;  5AQG B;  4HWD A;  4HWF A;  3A8Y C;  5AQM B;  3FZM B;  4HWC A;  5AQL B;  5AQH B;  1M7K A;  5AQJ B;  3M3Z B;  5AQN B;  1T7S A;  5AQQ B;  2D9D A;  5AQT B;  1HX1 B;  5AQU B;  1I6Z A;  3FZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...