5AQJB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
114
structure length
114
Chain Sequence
PLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 46
structure length 114
sequence length 114
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqjB00
5AQNB 3FZHB 1I6ZA 3M3ZB 5AQMB 4HWDA 4HWHA 5AQTB 5AQKB 3A8YC 5AQIB 1UGOA 5AQVB 5AQPB 5AQQB 5AQUB 1T7SA 5AQHB 3FZKB 5AQJB 5AQRB 1M62A 3FZMB 1M7KA 5AQSB 1HX1B 4HWCA 3FZLB 5AQLB 5AQOB 4HWFA 1UK5A 5AQGB 3LDQB 5AQFB 2D9DA 3FZFB 4HWIB
chains in the Genus database with same CATH superfamily
4QH1A 2CPTA 2WDVA 4PJJA 5H6RB 2HHHT 3MACA 3Q5EA 3VRAA 1J5WA 1SA0E 1NAFA 3PUQA 3CQXC 4HWDA 4TV8E 3ZYMA 2XQ5A 5AQIB 1MIWA 3QUJA 4CZZB 3U3IA 1X9BA 2H88A 2E9XA 2WU5A 4NXNT 3ZJ1A 2E5VA 2I6HA 4P1NA 4EGWA 2UXDT 1CHUA 3N2KE 5CFBA 4PFOA 4X1KE 4N78D 4O4IE 2QGSA 3I9YA 4BJNA 1UUSA 5JREA 2ZM8A 3P4SA 2ZM6T 1M7KA 5E0OA 5EK3A 2JIWA 3TLWA 3AEGA 5ABFB 5HEJA 4HWCA 4U7IA 3N9LA 5FXWA 3RF1A 2V1DB 3OKQA 3JADA 4YTPA 5LGNB 3N9PA 1KNZA 1JNRA 2XY8B 4HFVA 2YU2A 2XPKA 2XZEA 1HTJF 4PK6A 4PFPA 5LA6E 3RGLA 3LJCA 2Y8DA 2W00A 3C4XA 4TWDA 4A5XA 3O1IA 1XNRT 1UCUA 1LKXA 5M4YA 1E2AA 4HEAA 3FZHB 5ABGA 4ILAA 3RI5A 2CHNA 3CQGB 2Y48B 4HFBA 3ZC0A 3N9MA 2UXCT 2BG9B 2FBWA 1UGOA 5HEUA 3E08A 2K48A 3FBZA 2W66A 2W0GA 4L9IA 2HN2A 5LJNA 2KWIB 4ILBA 2XQYA 4GKKT 2BG9A 4DV2T 3AE7A 4UVAB 4MBQA 3HI2A 5J0ZA 2QVAA 3NBXX 3CPZA 1W09A 4ZEYA 2X51A 4ILCA 2X9WA 4U33A 5FP3A 3AA6B 5J2TE 4GIWA 4CI1B 2LSIA 2KMFA 2KZ7B 3QNUA 3L8RA 3NZPA 5F8PA 2VASA 2DWKA 2C5KT 1UK5A 2LE8A 2ZLYA 4U2YA 4I43B 3UUXB 2H89A 4UVCB 3UUMA 3RLFF 3PE0A 3AEEA 3UU8A 5HYAA 3WAJA 3AAAB 5FNVE 2PG8A 3ZEFB 4NUVA 2FJEA 5ABFA 3BK9A 5FY1A 2ZM2A 2W4XA 3MK7C 1MMGA 3EAMA 2PFVA 2WMOA 4YY3T 2WS3A 3N5LA 3UU6A 2VKJA 4LMLA 4JEHB 3P4QA 3X1DA 4PJMA 2XQ7A 2IDOB 2WBLA 2E9XB 2VVNA 3I1AA 3VR9A 3ZN1B 4DIDB 4LF9T 3H3MA 2X66A 4EB6E 4O8SA 3VKHA 1J1JA 2UU9T 3C4WA 2D5UA 4X5TA 1T8BA 2WZIA 3AEBA 2ES0A 3RPUA 3E0ZA 4YJ3E 3WI3A 4LFCT 4NXMT 4KBMB 2NP9A 1OWAA 2IIUA 4UV9B 2VURA 2X67A 4H9PC 2EHOD 3IEEA 2XASB 2X9HA 3KFWX 2PJQA 5LG4A 4DBQA 2K24A 2FJBA 4XAXB 5FY0A 5LG3A 2W61A 4GYSA 1XWMA 3UFEA 3KINB 1QSDA 3ZCIA 1T98A 4HFDA 2CA5A 1CUNA 2H3RA 2XQAA 3P8CD 2V7MA 4HFEA 4TN7B 5JDHA 3ABVA 3L3PA 5C3JA 2BG9E 2MAWA 3CK6A 3VRBA 1X79A 4LFAT 4OX9T 1UX4A 4HFCA 3AE9A 3MXZA 1MMDA 5CGMA 2XAQB 1HX8A 4TX5A 3AXJB 5H6QB 2WWVA 2X0LB 3K3OA 4P0BA 3RH3A 4AKRB 4YXDA 5DQWA 5KXJA 2KT9A 3AE5A 4I55E 3AE3A 2WU2A 3UUNA 5C2TA 4AKIA 2LRKA 4ZI2D 1FIOA 2CBJA 5L3FB 5FL0A 1BR4A 1VOMA 5LMNT 4UF0B 1MMAA 3KBTA 4MHCA 4LF5T 3NZQA 1OXZA 3P4WA 3UFGA 3EDVA 2MBGA 5L4HA 3GMIA 4ZS3A 5AQFB 3QB5A 2CCQA 1N32T 2D9DA 3AE2A 5LOVE 2DLRA 3HL6A 4FJOA 3LFMA 5JRCA 2XQ4A 3AEDA 1XDPA 3Q9DA 4PK4A 4DR7T 4IE4A 3JCFA 3M3ZB 5JDGA 4HWHA 4H9OC 4O4LE 4U31A 5AFUL 4EAHA 2YK0A 3CQCB 4OYJA 3ZYKA 2WCAA 3K1SA 2E5LT 1G8XA 5DABA 4CI2B 3PTRB 1T7SA 2YU1A 2H7VC 2W2UA 2WY2A 4H9RC 4LF6T 1WLXA 4QX7B 3FHNA 4OFZA 2J62A 2XAHB 2KSRA 2YDRA 4DV1T 4TWHA 2JJ9A 3A7MA 3K8PC 2AE9A 2M67A 3EUHA 1W0AA 3RKGA 4O2AE 5FKYA 2V6YB 4QKNA 3VU7H 4CN1A 4WNKA 1HG2A 2A72A 3B13A 3LBXB 4HWFA 3Q5WA 2RA1A 4MALA 2RP4A 4YJ2E 5JDFA 1B7TA 3FZFB 3GWHA 2XQ3A 3JC6C 1XNQT 4TUYE 4ADZA 3PU8A 4DV0T 5C8YE 2CWOA 2Q9QD 1FEWA 3CKDA 3E22E 4OYKA 4A97A 3QOFA 4YT0A 2UUBT 2HPJA 2XAGB 2M6BA 3ZLIA 2ZM0A 1D0ZA 3MJXA 1S94A 4A56A 2IMLA 4X65T 3RC8A 1V9DA 3HKEE 2E9XC 2E2AA 3AVRA 1MMNA 4PAGA 2JQKA 2WDQA 4IE7A 2CHOA 2WQYA 2YINA 2LRLA 2LM9A 1KFYA 2WMNA 3P7IA 4IL4A 2W67A 5LXTE 4V1Av 2V5CA 4XZCA 3AEAA 3C98B 3L09A 3LG7A 4CN4A 5ABEA 2CLYB 2NW7A 3CX8B 2HN1A 1Z8UA 5A1LA 4UR9A 3UQ4A 2V26A 4EYYR 5JQGE 4AQYT 1Z0PA 2XM2A 3H3AA 3PUYF 4L5GA 2SPCA 2LHNA 2VVSA 5HWYA 4DR4T 4P0AA 4K0UA 3RKOA 4AQFA 2D0TA 2Q9QA 3HKCE 1G73A 2XAJB 4U2ZA 5CB4E 3RC3A 4COFA 2WWUA 2NW8A 4C90A 2E8IA 3R84B 4CXYA 3JAEA 2FJAA 4GK5E 4I50E 3AA1B 4ISSA 2VKHA 4JEUB 3A8YC 1OEDB 4AKLA 2V7KA 2LKHA 2NOXA 1D1BA 2BVMA 2B76A 3LK2B 3S4UA 2JMKA 4H9SE 5AQQB 3ZC1A 5IUXA 1IBLT 1HS7A 2DCFA 5HWXA 2KWHA 3SWHA 1WYCA 5JDLA 2BKOA 4B3RT 3F31A 4YTMA 4ZHQE 4JI0T 3Q2MA 1LVFA 3Q5DA 5CA1E 3ONJA 2CMRA 2RPAA 1KNRA 2IC6A 3FZLB 4KMCA 2XHEB 3UU4A 2LEHA 3M65A 4O2BE 4IDPA 1HF8A 5KMGP 3DTOA 3AECA 4AISA 1IJ5A 5HXHA 3SFEA 3RRWA 1W9RA 2LOSA 3OTOT 1LRZA 5LHIB 4H9NC 4AI6A 3ZSSA 3CX7B 4JI3T 2W62A 2X9XA 3ETVA 4QXHB 4ILUA 5HXSA 3RRCA 5LMUT 5FYMA 2JQHA 2X0HA 2XUEA 4DR3T 4IHJE 2VL8A 3ZJ2A 5JR9C 2CBIA 3H37A 2V7IA 3Q5XA 4I4TE 4JLEA 2KLQA 3ONXA 3QC9A 2VK9A 4HN9A 4JUYA 3A5XA 4KI0F 5AQHB 4HGAA 1E1HB 3KBUA 5JDMA 2V5DA 2BBJA 4QX8B 2YDSA 1D0YA 2L8KA 3PUWF 2BVLA 5J1GA 3TLTA 4GYRA 3SFDA 4EV6A 1IBMT 4GKJT 3NVOA 2C0SA 4X66T 3C50A 4KUMB 4ZZBA 4NPPA 4DV5T 5J2UE 1KF6A 2ACZA 3FXDB 4IDQA 5FY7A 5LBQB 2CE7A 2IHR1 1L0VA 2J1DG 2N2NA 2IAKA 3RYIE 4BJMA 3ZMSB 3NKZA 2JQ9A 4TWFA 3VHLA 4C91A 2CLYC 5CA0E 5LNKA 3CIRA 3NWIA 3R6NA 2H7OA 3L39A 1S35A 1QLBA 1T72A 2J47A 4WZXA 2LKGA 3RYHE 4YHJA 3NRYA 3SOLA 2UUCT 4HE8A 4ZOLE 1YQ4A 2LSJA 4IGUA 4OK0A 1IJ6A 1D1AA 5AQVB 2UXBT 2CM0A 5LHHB 3ANWA 2V8SV 3EI0A 2QYWA 3ETUA 4ISTA 1BR1A 4PJNA 3MZKB 1U4QA 3JC6D 5BMVE 5JR9B 2ACXA 3W15B 3PUXF 4JI7T 1MIVA 5LBMA 4DNDA 4LFBT 4PW8A 4H63H 2JQQA 4MLKA 5FL1A 3AEFA 1VRBA 2BKNA 2V6XA 2VB6A 3CVRA 3EVYA 3J9X1 5L4EA 2ODVA 5IHYA 3ZMZB 5L3CB 5HCMA 3HKBE 3N2OA 3O4XE 3RIUC 5BR8T 1N34T 2L3LA 5LHGB 4DV3T 2LLYA 2FJDA 3GN5A 1NENA 1LVKA 4UVBB 2EHOB 2XJ7A 4X1IE 1YXRA 2K9AA 5ETWA 5TAOA 5HEOA 2BS2A 4IDNA 1ZKEA 4ZS2A 4DUYT 3ESLA 3RIFA 1Y64B 4CQIA 5L47A 2N1GA 1KK7A 2R6GF 3EHZA 2XQ6A 3HR0A 1J5ET 3ZPOA 4B3TT 5F3JA 1HG5A 3KV5A 4OHFA 2Y6XA 2WDRA 5L3DB 3AB3B 3DP7A 2OLTA 4KHPT 5EZYE 1FJGT 1ZEEA 4IDOA 4AQGA 1IAPA 1FMVA 4WW0A 4YLHA 4DO0A 5AQRB 3BQIA 1U5PA 2N9DA 1WFDA 3IF8B 3P4PA 3TLVA 1HNWT 2YEVC 4DV4T 5JTGA 5ADXL 2KNDA 2GK9A 2EHOA 3AE4A 3TLSA 1DU2A 3IA3A 3WAKA 3ZMUB 2BKPA 5CJ5A 3UT5E 2JRKA 2OA5A 3GN5B 3ZSTA 4BA9A 4ERRA 4H9QC 4YTNA 3N2GE 4HWIB 3I9WA 2CXDA 2V7JA 4Z90A 2DWGA 4I0UA 1YQ3A 5AQMB 3J7Yq 1WR6A 5AQTB 1QUUA 3RIUA 3ZT7A 2I0MA 2B1EA 4KHZF 4LF7T 3LK42 1XZYA 3C64A 3MA9A 5JR9A 2LSKA 3LK3B 2XSBA 3ANWB 4ZI3C 4HFIA 1HR0T 5JDNA 2PBIA 2VKOA 4JBWF 1W0BA 4JI8T 1US7B 3AE1A 4CN6A 4DBRA 1UX5A 1VCSA 2BS3A 2NR4A 5IYZE 3QK6A 3FZMB 3V5UA 4ZZCA 5HEHA 3V5SA 5JDQA 3UQ7A 4AKGA 2A3DA 2YDQA 4QWNB 4F6RC 4M1PA 5JH7E 2M6IA 3RYFE 2K3WA 1BR0A 2HPLA 2XTLA 5AQGB 4ANJA 1NWMX 1YKHB 5KX5E 5DJQC 3CWZB 4ZXLA 4E7ZA 3KVBA 3OJAA 4IL9A 4QHOA 3F57A 4U74A 5HCJA 5EK2A 1D1CA 3AE6A 4XBFB 4YSYA 4JYAT 4UELA 3UUBA 4JI4T 1XMOT 1WCRA 2NWBA 2X9YA 2MTQA 3B5MA 2DI4A 3P50A 4NIQA 3ZYLA 4CXXA 4CI3B 4Z8XA 5LGTB 1D0XA 4E7SA 5HEGA 2BS4A 3JAFA 4H63V 3N9QA 4U72A 1FMWA 3TLUA 4UEMA 1N36T 1JNZA 3PUVF 2WM9A 2DHRA 1VCTA 2VKDA 3UTKA 4X20E 5HAXA 2W63A 1ZV4X 4YSZA 3UU3A 5L3EB 4EYUA 4O4JE 4EXTA 4DV7T 2LM2A 2QRXA 4PJLA 3SRZA 3PUGA 1SE7A 2D0UA 3ZMVB 4YSXA 3UU5A 4X62T 2UUAT 2QA7A 4DMVA 5KDMC 3D0TA 4X1YE 3EABA 4B3MT 5IWAT 1WYBA 1ZP0A 1R8IA 1YD8G 3KV9A 4TNVA 4B6XA 1XMQT 1I6ZA 4GOUA 3RX6A 4U7YA 3GA8A 2Z6EA 4EZHA 1IZNB 1SUMB 4JV5T 3N9OA 4WBOA 5AQKB 3O1HA 2A2FX 2PTFA 3RQUA 3OYZA 2P9BA 1E7PA 4U3CA 3ZKRA 3C51A 4EEBA 3PJAJ 3FZKB 3ONLC 2WB5A 4EOZB 1OEDA 2Q9QC 3AA7B 4A98A 1HNXT 4TZ4C 3NRXA 4DR1T 1MNEA 1YKEB 4JI5T 4EZ4A 5AQSB 1HX1B 2DL1A 2OV9A 3IHRA 4HKAA 4ASKA 2HH7A 2MOZA 5FMNA 3RIAA 2Q9QB 3C4ZA 4FI5A 4QH5A 3ZMTB 4ZI7E 2F4VT 2A9UA 2VWAA 5LJMA 1NEKA 4G2AA 1Y01A 2NW9A 5ABHA 4YHHT 4QXCB 4IDZA 4IREA 5AQNB 4LF8T 4K0KT 2LT3A 4O4HE 3PUZF 1GQEA 4ZI2C 2G0UA 2LJLA 4KX6A 2LSGA 4LMJA 3LSVA 5FXVA 4JI6T 3EDUA 3ZN0B 2WAUA 3KV4A 3ZT6A 3DJBA 4TNWA 1EZ3A 2YOEA 3AAIA 2UXNB 3KVAA 4DMWA 5L2LA 4AKHA 5AQUB 3PUAA 2I59A 4IE5A 3FBLA 4MFRA 1KNPA 2YKSA 2BZBA 4IE0A 2AXDS 2XSAA 4EEDA 2VQET 1BR2A 2K5BB 2ODUA 1AJ3A 3U78A 4Q25A 2CXFA 2L9QA 2LSYA 1ZHCA 4JI2T 4PK5A 4LMKA 5LCYA 2C5JA 3I0OA 1IBKT 3PV0F 2UXXB 3T8OA 5GONE 4YFSA 1WR0A 3BQLA 3LBXA 4TV9E 4CXWA 3TKLB 2V6YA 2WZHA 5L3BB 3PURA 4IT4A 2J4GA 3OVUA 2LOPA 3PUSA 4DR2T 2DNXA 1UURA 4UIGA 3AA0B 3O9XA 2KXPB 5LYJE 2XQ8A 4IIJE 1OEDE 2BDEA 5AQPB 1MIYA 2WP9A 4UXNB 2V7LA 5DQVA 5HXRA 2IW5B 3SS1A 4DR6T 3RQWA 4P09A 5LP6E 3VKGA 4WYVA 3G06A 3VR8A 2BG9C 3OPCA 5F5WA 1HNZT 3B57A 3IBPA 4G63A 5FXZA 1O3XA 5FVKA 5JRCB 2X0YA 4BAYB 4DUZT 2NTXA 2MPKA 4EIWA 3T1HT 3T1YT 3AAEB 3FXEB 2EHOC 2VL0A 3K3QC 1XDOA 3P4RA 3CX6B 2CRBA 3BQKA 1HCIA 2JMHA 3LDQB 4HTEA 1MNDA 2YN6A 5FVLA 2E9XD 2ZMAA 3CMLA 5L3GB 4DR5T 3I0QA 4UF0A 4LF4T 2X68A 3HA4A 5LGUB 3MKDA 2FUPA 2D2SA 2KINB 2MYSA 3OBVE 4GK0E 2CWYA 4KP3C 4WBNE 1YW0A 1ZOYA 4UV8B 2IC9A 3FB2A 2XAFB 3N9NA 3PJAA 4L0RA 4ZI3D 4DV6T 4JI1T 2JPFA 4QH4A 3RYCE 2WSSV 2BBHA 1HFAA 3AVSA 4J2CA 3AXJA 3O1JA 5EK4A 4AQFC 4B3ST 2CXLA 2XM1A 3QB5K 1OEDC 4QXBB 3RHWA 5AQJB 1WRDA 3KV6A 5HXEA 2C5IT 3AE8A 3KDSE 2CEAA 4HFHA 5JVDE 1M62A 1SHZC 4DVDA 5FXXA 2VQFT 3F2EA 4IE6A 3ZCJA 4PNIA 1I94T 2NTYA 1H7CA 2XQ9A 1N33T 3PDYA 5AQLB 5AQOB 5LB7B 4NUUA 3OYXA 3UULA 1KEYA 4AIUA 4AXPA 4F8HA 3ZT5A 5HXCA 3HKDE 3K3NA 3PU3A 4X64T 2LHRA 4Z91A 2IUBA
chains in the Genus database with same CATH topology
5AQNB 3FZHB 1I6ZA 3M3ZB 5AQMB 4HWDA 4HWHA 5AQTB 5AQKB 3A8YC 5AQIB 1UGOA 5AQVB 5AQPB 5AQQB 5AQUB 1T7SA 5AQHB 3FZKB 5AQJB 5AQRB 1M62A 3FZMB 1M7KA 5AQSB 1HX1B 4HWCA 3FZLB 5AQLB 5AQOB 4HWFA 1UK5A 5AQGB 3LDQB 5AQFB 2D9DA 3FZFB 4HWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQN B;  3FZH B;  1I6Z A;  3M3Z B;  5AQM B;  4HWD A;  4HWH A;  5AQT B;  5AQK B;  3A8Y C;  5AQI B;  1UGO A;  5AQV B;  5AQP B;  5AQQ B;  5AQU B;  1T7S A;  5AQH B;  3FZK B;  5AQJ B;  5AQR B;  1M62 A;  3FZM B;  1M7K A;  5AQS B;  1HX1 B;  4HWC A;  3FZL B;  5AQL B;  5AQO B;  4HWF A;  1UK5 A;  5AQG B;  3LDQ B;  5AQF B;  2D9D A;  3FZF B;  4HWI B; 
#chains in the Genus database with same CATH topology
 4QH1 A;  2CPT A;  2WDV A;  4PJJ A;  5H6R B;  2HHH T;  3MAC A;  3Q5E A;  3VRA A;  1J5W A;  1SA0 E;  1NAF A;  3PUQ A;  3CQX C;  4HWD A;  4TV8 E;  3ZYM A;  2XQ5 A;  5AQI B;  1MIW A;  3QUJ A;  4CZZ B;  3U3I A;  1X9B A;  2H88 A;  2E9X A;  2WU5 A;  4NXN T;  3ZJ1 A;  2E5V A;  2I6H A;  4P1N A;  4EGW A;  2UXD T;  1CHU A;  3N2K E;  5CFB A;  4PFO A;  4X1K E;  4N78 D;  4O4I E;  2QGS A;  3I9Y A;  4BJN A;  1UUS A;  5JRE A;  2ZM8 A;  3P4S A;  2ZM6 T;  1M7K A;  5E0O A;  5EK3 A;  2JIW A;  3TLW A;  3AEG A;  5ABF B;  5HEJ A;  4HWC A;  4U7I A;  3N9L A;  5FXW A;  3RF1 A;  2V1D B;  3OKQ A;  3JAD A;  4YTP A;  5LGN B;  3N9P A;  1KNZ A;  1JNR A;  2XY8 B;  4HFV A;  2YU2 A;  2XPK A;  2XZE A;  1HTJ F;  4PK6 A;  4PFP A;  5LA6 E;  3RGL A;  3LJC A;  2Y8D A;  2W00 A;  3C4X A;  4TWD A;  4A5X A;  3O1I A;  1XNR T;  1UCU A;  1LKX A;  5M4Y A;  1E2A A;  4HEA A;  3FZH B;  5ABG A;  4ILA A;  3RI5 A;  2CHN A;  3CQG B;  2Y48 B;  4HFB A;  3ZC0 A;  3N9M A;  2UXC T;  2BG9 B;  2FBW A;  1UGO A;  5HEU A;  3E08 A;  2K48 A;  3FBZ A;  2W66 A;  2W0G A;  4L9I A;  2HN2 A;  5LJN A;  2KWI B;  4ILB A;  2XQY A;  4GKK T;  2BG9 A;  4DV2 T;  3AE7 A;  4UVA B;  4MBQ A;  3HI2 A;  5J0Z A;  2QVA A;  3NBX X;  3CPZ A;  1W09 A;  4ZEY A;  2X51 A;  4ILC A;  2X9W A;  4U33 A;  5FP3 A;  3AA6 B;  5J2T E;  4GIW A;  4CI1 B;  2LSI A;  2KMF A;  2KZ7 B;  3QNU A;  3L8R A;  3NZP A;  5F8P A;  2VAS A;  2DWK A;  2C5K T;  1UK5 A;  2LE8 A;  2ZLY A;  4U2Y A;  4I43 B;  3UUX B;  2H89 A;  4UVC B;  3UUM A;  3RLF F;  3PE0 A;  3AEE A;  3UU8 A;  5HYA A;  3WAJ A;  3AAA B;  5FNV E;  2PG8 A;  3ZEF B;  4NUV A;  2FJE A;  5ABF A;  3BK9 A;  5FY1 A;  2ZM2 A;  2W4X A;  3MK7 C;  1MMG A;  3EAM A;  2PFV A;  2WMO A;  4YY3 T;  2WS3 A;  3N5L A;  3UU6 A;  2VKJ A;  4LML A;  4JEH B;  3P4Q A;  3X1D A;  4PJM A;  2XQ7 A;  2IDO B;  2WBL A;  2E9X B;  2VVN A;  3I1A A;  3VR9 A;  3ZN1 B;  4DID B;  4LF9 T;  3H3M A;  2X66 A;  4EB6 E;  4O8S A;  3VKH A;  1J1J A;  2UU9 T;  3C4W A;  2D5U A;  4X5T A;  1T8B A;  2WZI A;  3AEB A;  2ES0 A;  3RPU A;  3E0Z A;  4YJ3 E;  3WI3 A;  4LFC T;  4NXM T;  4KBM B;  2NP9 A;  1OWA A;  2IIU A;  4UV9 B;  2VUR A;  2X67 A;  4H9P C;  2EHO D;  3IEE A;  2XAS B;  2X9H A;  3KFW X;  2PJQ A;  5LG4 A;  4DBQ A;  2K24 A;  2FJB A;  4XAX B;  5FY0 A;  5LG3 A;  2W61 A;  4GYS A;  1XWM A;  3UFE A;  3KIN B;  1QSD A;  3ZCI A;  1T98 A;  4HFD A;  2CA5 A;  1CUN A;  2H3R A;  2XQA A;  3P8C D;  2V7M A;  4HFE A;  4TN7 B;  5JDH A;  3ABV A;  3L3P A;  5C3J A;  2BG9 E;  2MAW A;  3CK6 A;  3VRB A;  1X79 A;  4LFA T;  4OX9 T;  1UX4 A;  4HFC A;  3AE9 A;  3MXZ A;  1MMD A;  5CGM A;  2XAQ B;  1HX8 A;  4TX5 A;  3AXJ B;  5H6Q B;  2WWV A;  2X0L B;  3K3O A;  4P0B A;  3RH3 A;  4AKR B;  4YXD A;  5DQW A;  5KXJ A;  2KT9 A;  3AE5 A;  4I55 E;  3AE3 A;  2WU2 A;  3UUN A;  5C2T A;  4AKI A;  2LRK A;  4ZI2 D;  1FIO A;  2CBJ A;  5L3F B;  5FL0 A;  1BR4 A;  1VOM A;  5LMN T;  4UF0 B;  1MMA A;  3KBT A;  4MHC A;  4LF5 T;  3NZQ A;  1OXZ A;  3P4W A;  3UFG A;  3EDV A;  2MBG A;  5L4H A;  3GMI A;  4ZS3 A;  5AQF B;  3QB5 A;  2CCQ A;  1N32 T;  2D9D A;  3AE2 A;  5LOV E;  2DLR A;  3HL6 A;  4FJO A;  3LFM A;  5JRC A;  2XQ4 A;  3AED A;  1XDP A;  3Q9D A;  4PK4 A;  4DR7 T;  4IE4 A;  3JCF A;  3M3Z B;  5JDG A;  4HWH A;  4H9O C;  4O4L E;  4U31 A;  5AFU L;  4EAH A;  2YK0 A;  3CQC B;  4OYJ A;  3ZYK A;  2WCA A;  3K1S A;  2E5L T;  1G8X A;  5DAB A;  4CI2 B;  3PTR B;  1T7S A;  2YU1 A;  2H7V C;  2W2U A;  2WY2 A;  4H9R C;  4LF6 T;  1WLX A;  4QX7 B;  3FHN A;  4OFZ A;  2J62 A;  2XAH B;  2KSR A;  2YDR A;  4DV1 T;  4TWH A;  2JJ9 A;  3A7M A;  3K8P C;  2AE9 A;  2M67 A;  3EUH A;  1W0A A;  3RKG A;  4O2A E;  5FKY A;  2V6Y B;  4QKN A;  3VU7 H;  4CN1 A;  4WNK A;  1HG2 A;  2A72 A;  3B13 A;  3LBX B;  4HWF A;  3Q5W A;  2RA1 A;  4MAL A;  2RP4 A;  4YJ2 E;  5JDF A;  1B7T A;  3FZF B;  3GWH A;  2XQ3 A;  3JC6 C;  1XNQ T;  4TUY E;  4ADZ A;  3PU8 A;  4DV0 T;  5C8Y E;  2CWO A;  2Q9Q D;  1FEW A;  3CKD A;  3E22 E;  4OYK A;  4A97 A;  3QOF A;  4YT0 A;  2UUB T;  2HPJ A;  2XAG B;  2M6B A;  3ZLI A;  2ZM0 A;  1D0Z A;  3MJX A;  1S94 A;  4A56 A;  2IML A;  4X65 T;  3RC8 A;  1V9D A;  3HKE E;  2E9X C;  2E2A A;  3AVR A;  1MMN A;  4PAG A;  2JQK A;  2WDQ A;  4IE7 A;  2CHO A;  2WQY A;  2YIN A;  2LRL A;  2LM9 A;  1KFY A;  2WMN A;  3P7I A;  4IL4 A;  2W67 A;  5LXT E;  4V1A v;  2V5C A;  4XZC A;  3AEA A;  3C98 B;  3L09 A;  3LG7 A;  4CN4 A;  5ABE A;  2CLY B;  2NW7 A;  3CX8 B;  2HN1 A;  1Z8U A;  5A1L A;  4UR9 A;  3UQ4 A;  2V26 A;  4EYY R;  5JQG E;  4AQY T;  1Z0P A;  2XM2 A;  3H3A A;  3PUY F;  4L5G A;  2SPC A;  2LHN A;  2VVS A;  5HWY A;  4DR4 T;  4P0A A;  4K0U A;  3RKO A;  4AQF A;  2D0T A;  2Q9Q A;  3HKC E;  1G73 A;  2XAJ B;  4U2Z A;  5CB4 E;  3RC3 A;  4COF A;  2WWU A;  2NW8 A;  4C90 A;  2E8I A;  3R84 B;  4CXY A;  3JAE A;  2FJA A;  4GK5 E;  4I50 E;  3AA1 B;  4ISS A;  2VKH A;  4JEU B;  3A8Y C;  1OED B;  4AKL A;  2V7K A;  2LKH A;  2NOX A;  1D1B A;  2BVM A;  2B76 A;  3LK2 B;  3S4U A;  2JMK A;  4H9S E;  5AQQ B;  3ZC1 A;  5IUX A;  1IBL T;  1HS7 A;  2DCF A;  5HWX A;  2KWH A;  3SWH A;  1WYC A;  5JDL A;  2BKO A;  4B3R T;  3F31 A;  4YTM A;  4ZHQ E;  4JI0 T;  3Q2M A;  1LVF A;  3Q5D A;  5CA1 E;  3ONJ A;  2CMR A;  2RPA A;  1KNR A;  2IC6 A;  3FZL B;  4KMC A;  2XHE B;  3UU4 A;  2LEH A;  3M65 A;  4O2B E;  4IDP A;  1HF8 A;  5KMG P;  3DTO A;  3AEC A;  4AIS A;  1IJ5 A;  5HXH A;  3SFE A;  3RRW A;  1W9R A;  2LOS A;  3OTO T;  1LRZ A;  5LHI B;  4H9N C;  4AI6 A;  3ZSS A;  3CX7 B;  4JI3 T;  2W62 A;  2X9X A;  3ETV A;  4QXH B;  4ILU A;  5HXS A;  3RRC A;  5LMU T;  5FYM A;  2JQH A;  2X0H A;  2XUE A;  4DR3 T;  4IHJ E;  2VL8 A;  3ZJ2 A;  5JR9 C;  2CBI A;  3H37 A;  2V7I A;  3Q5X A;  4I4T E;  4JLE A;  2KLQ A;  3ONX A;  3QC9 A;  2VK9 A;  4HN9 A;  4JUY A;  3A5X A;  4KI0 F;  5AQH B;  4HGA A;  1E1H B;  3KBU A;  5JDM A;  2V5D A;  2BBJ A;  4QX8 B;  2YDS A;  1D0Y A;  2L8K A;  3PUW F;  2BVL A;  5J1G A;  3TLT A;  4GYR A;  3SFD A;  4EV6 A;  1IBM T;  4GKJ T;  3NVO A;  2C0S A;  4X66 T;  3C50 A;  4KUM B;  4ZZB A;  4NPP A;  4DV5 T;  5J2U E;  1KF6 A;  2ACZ A;  3FXD B;  4IDQ A;  5FY7 A;  5LBQ B;  2CE7 A;  2IHR 1;  1L0V A;  2J1D G;  2N2N A;  2IAK A;  3RYI E;  4BJM A;  3ZMS B;  3NKZ A;  2JQ9 A;  4TWF A;  3VHL A;  4C91 A;  2CLY C;  5CA0 E;  5LNK A;  3CIR A;  3NWI A;  3R6N A;  2H7O A;  3L39 A;  1S35 A;  1QLB A;  1T72 A;  2J47 A;  4WZX A;  2LKG A;  3RYH E;  4YHJ A;  3NRY A;  3SOL A;  2UUC T;  4HE8 A;  4ZOL E;  1YQ4 A;  2LSJ A;  4IGU A;  4OK0 A;  1IJ6 A;  1D1A A;  5AQV B;  2UXB T;  2CM0 A;  5LHH B;  3ANW A;  2V8S V;  3EI0 A;  2QYW A;  3ETU A;  4IST A;  1BR1 A;  4PJN A;  3MZK B;  1U4Q A;  3JC6 D;  5BMV E;  5JR9 B;  2ACX A;  3W15 B;  3PUX F;  4JI7 T;  1MIV A;  5LBM A;  4DND A;  4LFB T;  4PW8 A;  4H63 H;  2JQQ A;  4MLK A;  5FL1 A;  3AEF A;  1VRB A;  2BKN A;  2V6X A;  2VB6 A;  3CVR A;  3EVY A;  3J9X 1;  5L4E A;  2ODV A;  5IHY A;  3ZMZ B;  5L3C B;  5HCM A;  3HKB E;  3N2O A;  3O4X E;  3RIU C;  5BR8 T;  1N34 T;  2L3L A;  5LHG B;  4DV3 T;  2LLY A;  2FJD A;  3GN5 A;  1NEN A;  1LVK A;  4UVB B;  2EHO B;  2XJ7 A;  4X1I E;  1YXR A;  2K9A A;  5ETW A;  5TAO A;  5HEO A;  2BS2 A;  4IDN A;  1ZKE A;  4ZS2 A;  4DUY T;  3ESL A;  3RIF A;  1Y64 B;  4CQI A;  5L47 A;  2N1G A;  1KK7 A;  2R6G F;  3EHZ A;  2XQ6 A;  3HR0 A;  1J5E T;  3ZPO A;  4B3T T;  5F3J A;  1HG5 A;  3KV5 A;  4OHF A;  2Y6X A;  2WDR A;  5L3D B;  3AB3 B;  3DP7 A;  2OLT A;  4KHP T;  5EZY E;  1FJG T;  1ZEE A;  4IDO A;  4AQG A;  1IAP A;  1FMV A;  4WW0 A;  4YLH A;  4DO0 A;  5AQR B;  3BQI A;  1U5P A;  2N9D A;  1WFD A;  3IF8 B;  3P4P A;  3TLV A;  1HNW T;  2YEV C;  4DV4 T;  5JTG A;  5ADX L;  2KND A;  2GK9 A;  2EHO A;  3AE4 A;  3TLS A;  1DU2 A;  3IA3 A;  3WAK A;  3ZMU B;  2BKP A;  5CJ5 A;  3UT5 E;  2JRK A;  2OA5 A;  3GN5 B;  3ZST A;  4BA9 A;  4ERR A;  4H9Q C;  4YTN A;  3N2G E;  4HWI B;  3I9W A;  2CXD A;  2V7J A;  4Z90 A;  2DWG A;  4I0U A;  1YQ3 A;  5AQM B;  3J7Y q;  1WR6 A;  5AQT B;  1QUU A;  3RIU A;  3ZT7 A;  2I0M A;  2B1E A;  4KHZ F;  4LF7 T;  3LK4 2;  1XZY A;  3C64 A;  3MA9 A;  5JR9 A;  2LSK A;  3LK3 B;  2XSB A;  3ANW B;  4ZI3 C;  4HFI A;  1HR0 T;  5JDN A;  2PBI A;  2VKO A;  4JBW F;  1W0B A;  4JI8 T;  1US7 B;  3AE1 A;  4CN6 A;  4DBR A;  1UX5 A;  1VCS A;  2BS3 A;  2NR4 A;  5IYZ E;  3QK6 A;  3FZM B;  3V5U A;  4ZZC A;  5HEH A;  3V5S A;  5JDQ A;  3UQ7 A;  4AKG A;  2A3D A;  2YDQ A;  4QWN B;  4F6R C;  4M1P A;  5JH7 E;  2M6I A;  3RYF E;  2K3W A;  1BR0 A;  2HPL A;  2XTL A;  5AQG B;  4ANJ A;  1NWM X;  1YKH B;  5KX5 E;  5DJQ C;  3CWZ B;  4ZXL A;  4E7Z A;  3KVB A;  3OJA A;  4IL9 A;  4QHO A;  3F57 A;  4U74 A;  5HCJ A;  5EK2 A;  1D1C A;  3AE6 A;  4XBF B;  4YSY A;  4JYA T;  4UEL A;  3UUB A;  4JI4 T;  1XMO T;  1WCR A;  2NWB A;  2X9Y A;  2MTQ A;  3B5M A;  2DI4 A;  3P50 A;  4NIQ A;  3ZYL A;  4CXX A;  4CI3 B;  4Z8X A;  5LGT B;  1D0X A;  4E7S A;  5HEG A;  2BS4 A;  3JAF A;  4H63 V;  3N9Q A;  4U72 A;  1FMW A;  3TLU A;  4UEM A;  1N36 T;  1JNZ A;  3PUV F;  2WM9 A;  2DHR A;  1VCT A;  2VKD A;  3UTK A;  4X20 E;  5HAX A;  2W63 A;  1ZV4 X;  4YSZ A;  3UU3 A;  5L3E B;  4EYU A;  4O4J E;  4EXT A;  4DV7 T;  2LM2 A;  2QRX A;  4PJL A;  3SRZ A;  3PUG A;  1SE7 A;  2D0U A;  3ZMV B;  4YSX A;  3UU5 A;  4X62 T;  2UUA T;  2QA7 A;  4DMV A;  5KDM C;  3D0T A;  4X1Y E;  3EAB A;  4B3M T;  5IWA T;  1WYB A;  1ZP0 A;  1R8I A;  1YD8 G;  3KV9 A;  4TNV A;  4B6X A;  1XMQ T;  1I6Z A;  4GOU A;  3RX6 A;  4U7Y A;  3GA8 A;  2Z6E A;  4EZH A;  1IZN B;  1SUM B;  4JV5 T;  3N9O A;  4WBO A;  5AQK B;  3O1H A;  2A2F X;  2PTF A;  3RQU A;  3OYZ A;  2P9B A;  1E7P A;  4U3C A;  3ZKR A;  3C51 A;  4EEB A;  3PJA J;  3FZK B;  3ONL C;  2WB5 A;  4EOZ B;  1OED A;  2Q9Q C;  3AA7 B;  4A98 A;  1HNX T;  4TZ4 C;  3NRX A;  4DR1 T;  1MNE A;  1YKE B;  4JI5 T;  4EZ4 A;  5AQS B;  1HX1 B;  2DL1 A;  2OV9 A;  3IHR A;  4HKA A;  4ASK A;  2HH7 A;  2MOZ A;  5FMN A;  3RIA A;  2Q9Q B;  3C4Z A;  4FI5 A;  4QH5 A;  3ZMT B;  4ZI7 E;  2F4V T;  2A9U A;  2VWA A;  5LJM A;  1NEK A;  4G2A A;  1Y01 A;  2NW9 A;  5ABH A;  4YHH T;  4QXC B;  4IDZ A;  4IRE A;  5AQN B;  4LF8 T;  4K0K T;  2LT3 A;  4O4H E;  3PUZ F;  1GQE A;  4ZI2 C;  2G0U A;  2LJL A;  4KX6 A;  2LSG A;  4LMJ A;  3LSV A;  5FXV A;  4JI6 T;  3EDU A;  3ZN0 B;  2WAU A;  3KV4 A;  3ZT6 A;  3DJB A;  4TNW A;  1EZ3 A;  2YOE A;  3AAI A;  2UXN B;  3KVA A;  4DMW A;  5L2L A;  4AKH A;  5AQU B;  3PUA A;  2I59 A;  4IE5 A;  3FBL A;  4MFR A;  1KNP A;  2YKS A;  2BZB A;  4IE0 A;  2AXD S;  2XSA A;  4EED A;  2VQE T;  1BR2 A;  2K5B B;  2ODU A;  1AJ3 A;  3U78 A;  4Q25 A;  2CXF A;  2L9Q A;  2LSY A;  1ZHC A;  4JI2 T;  4PK5 A;  4LMK A;  5LCY A;  2C5J A;  3I0O A;  1IBK T;  3PV0 F;  2UXX B;  3T8O A;  5GON E;  4YFS A;  1WR0 A;  3BQL A;  3LBX A;  4TV9 E;  4CXW A;  3TKL B;  2V6Y A;  2WZH A;  5L3B B;  3PUR A;  4IT4 A;  2J4G A;  3OVU A;  2LOP A;  3PUS A;  4DR2 T;  2DNX A;  1UUR A;  4UIG A;  3AA0 B;  3O9X A;  2KXP B;  5LYJ E;  2XQ8 A;  4IIJ E;  1OED E;  2BDE A;  5AQP B;  1MIY A;  2WP9 A;  4UXN B;  2V7L A;  5DQV A;  5HXR A;  2IW5 B;  3SS1 A;  4DR6 T;  3RQW A;  4P09 A;  5LP6 E;  3VKG A;  4WYV A;  3G06 A;  3VR8 A;  2BG9 C;  3OPC A;  5F5W A;  1HNZ T;  3B57 A;  3IBP A;  4G63 A;  5FXZ A;  1O3X A;  5FVK A;  5JRC B;  2X0Y A;  4BAY B;  4DUZ T;  2NTX A;  2MPK A;  4EIW A;  3T1H T;  3T1Y T;  3AAE B;  3FXE B;  2EHO C;  2VL0 A;  3K3Q C;  1XDO A;  3P4R A;  3CX6 B;  2CRB A;  3BQK A;  1HCI A;  2JMH A;  3LDQ B;  4HTE A;  1MND A;  2YN6 A;  5FVL A;  2E9X D;  2ZMA A;  3CML A;  5L3G B;  4DR5 T;  3I0Q A;  4UF0 A;  4LF4 T;  2X68 A;  3HA4 A;  5LGU B;  3MKD A;  2FUP A;  2D2S A;  2KIN B;  2MYS A;  3OBV E;  4GK0 E;  2CWY A;  4KP3 C;  4WBN E;  1YW0 A;  1ZOY A;  4UV8 B;  2IC9 A;  3FB2 A;  2XAF B;  3N9N A;  3PJA A;  4L0R A;  4ZI3 D;  4DV6 T;  4JI1 T;  2JPF A;  4QH4 A;  3RYC E;  2WSS V;  2BBH A;  1HFA A;  3AVS A;  4J2C A;  3AXJ A;  3O1J A;  5EK4 A;  4AQF C;  4B3S T;  2CXL A;  2XM1 A;  3QB5 K;  1OED C;  4QXB B;  3RHW A;  5AQJ B;  1WRD A;  3KV6 A;  5HXE A;  2C5I T;  3AE8 A;  3KDS E;  2CEA A;  4HFH A;  5JVD E;  1M62 A;  1SHZ C;  4DVD A;  5FXX A;  2VQF T;  3F2E A;  4IE6 A;  3ZCJ A;  4PNI A;  1I94 T;  2NTY A;  1H7C A;  2XQ9 A;  1N33 T;  3PDY A;  5AQL B;  5AQO B;  5LB7 B;  4NUU A;  3OYX A;  3UUL A;  1KEY A;  4AIU A;  4AXP A;  4F8H A;  3ZT5 A;  5HXC A;  3HKD E;  3K3N A;  3PU3 A;  4X64 T;  2LHR A;  4Z91 A;  2IUB A; 
#chains in the Genus database with same CATH homology
 5AQN B;  3FZH B;  1I6Z A;  3M3Z B;  5AQM B;  4HWD A;  4HWH A;  5AQT B;  5AQK B;  3A8Y C;  5AQI B;  1UGO A;  5AQV B;  5AQP B;  5AQQ B;  5AQU B;  1T7S A;  5AQH B;  3FZK B;  5AQJ B;  5AQR B;  1M62 A;  3FZM B;  1M7K A;  5AQS B;  1HX1 B;  4HWC A;  3FZL B;  5AQL B;  5AQO B;  4HWF A;  1UK5 A;  5AQG B;  3LDQ B;  5AQF B;  2D9D A;  3FZF B;  4HWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...