5AQJB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
114
structure length
114
Chain Sequence
PLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 46
structure length 114
sequence length 114
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqjB00
1M7KA 5AQUB 5AQFB 2D9DA 3A8YC 1HX1B 1M62A 3LDQB 4HWHA 4HWFA 4HWIB 5AQVB 3FZHB 5AQNB 1T7SA 5AQIB 1I6ZA 5AQKB 5AQMB 4HWCA 3FZLB 5AQGB 3FZKB 5AQLB 1UGOA 5AQRB 3M3ZB 5AQQB 5AQSB 5AQTB 3FZFB 5AQHB 5AQOB 3FZMB 4HWDA 5AQPB 5AQJB 1UK5A
chains in the Genus database with same CATH superfamily
2X0HA 1W9RA 3ZCIA 4HFVA 5HXCA 5JDQA 2C5JA 3FBZA 5JDHA 1BR2A 2CEAA 2KT9A 3Q2MA 4U72A 2LJLA 1HNXT 2IHR1 3UUXB 3U3IA 4GIWA 4HFBA 2W67A 3AB3B 5HEJA 5IWAT 2L9QA 4X20E 5L3BB 3AA1B 3UU8A 3ONLC 1D1CA 2IMLA 4E7SA 2E2AA 2ACXA 2HN1A 3IEEA 1G73A 2WY2A 4F8HA 2CHNA 2M6BA 3AE7A 3EVYA 5FKYA 3ZYLA 2YEVC 5AFUL 4YHHT 4YXDA 5KX5E 1UGOA 4PW8A 3P4PA 4IE6A 1XMOT 3AEDA 2HN2A 3EAMA 3N9PA 2LOPA 4NIQA 3RC3A 3TLTA 3EABA 4ZOLE 4ZS2A 4ZI3C 4I55E 4PNIA 2A2FX 1W09A 2VKHA 2W2UA 3AXJA 5AQOB 3WAKA 4QXHB 4EYYR 4Q25A 3VKGA 3NVOA 5JDNA 5AQJB 1MNEA 2SPCA 3UQ7A 2LHNA 3C4ZA 3RF1A 4JI6T 4UR9A 5L4HA 3RIFA 3ZC1A 1W0BA 2H7VC 3ZYKA 4BAYB 2MBGA 3ZSTA 2PFVA 3KVBA 4P1NA 4TWDA 5JRCA 3ZMTB 2RP4A 4CXYA 1OEDB 2IAKA 3G06A 2KNDA 3PDYA 4GKJT 3PV0F 4QH1A 4WW0A 3LFMA 2UUBT 2HH7A 2QGSA 3E0ZA 4U2YA 4H63V 4EV6A 4UVCB 4DR1T 4NUVA 4MALA 5J1GA 3RRCA 3N9QA 4HN9A 4QH5A 3RH3A 3SFEA 5HCMA 3ZJ1A 2VL0A 2HPLA 2VKJA 1ZKEA 2XQ8A 4P0AA 3RC8A 4GKKT 4IDPA 4MHCA 4OK0A 4AQFA 1WYBA 3AE5A 2WBLA 3FZMB 4H63H 3OBVE 4HWDA 4N78D 5IHYA 2Q9QC 1FJGT 4DR4T 4AKIA 3UFGA 4HWFA 5LGNB 2B1EA 2NW8A 2KMFA 3KV6A 4DIDB 2DL1A 5FL0A 2YINA 3P7IA 4K0KT 5FVLA 4V1Av 1HX1B 1QLBA 3PJAA 4ANJA 2UXXB 4GOUA 5ABEA 2YDSA 5HAXA 3M65A 1N34T 3B5MA 1FMWA 3I0QA 3KINB 3TLVA 2XAGB 5JTGA 5JRCB 2JQQA 1L0VA 4YSXA 3HI2A 3NBXX 3F57A 2LE8A 3AEGA 4EYUA 3NWIA 3UUBA 4AISA 2A9UA 5AQKB 4WBNE 4X62T 4JI8T 4DV1T 3P8CD 4ZXLA 5BMVE 5FY1A 3KDSE 5EK2A 3AEEA 4FI5A 3ZYMA 5L47A 3VHLA 5JDMA 2V6XA 2UXDT 4AQYT 4KHZF 2DLRA 2NOXA 3AXJB 3VR8A 3PE0A 1WCRA 5AQPB 4YTNA 4O4HE 2J1DG 2D2SA 2V7MA 3ZSSA 1M7KA 1LKXA 1WR0A 4IE7A 4CN4A 3LK2B 1T8BA 3N9LA 3Q9DA 2BS3A 1Z0PA 2W62A 4JI2T 4U2ZA 5CGMA 3WI3A 1D0XA 1KNPA 3A8YC 3EDUA 4KX6A 5JVDE 2WB5A 4DMVA 2E9XA 2W00A 4TX5A 3NRYA 5HWXA 1N36T 4CN6A 2IC6A 5LMUT 4GYSA 2HHHT 4QKNA 4PK6A 3RYHE 3RHWA 5AQVB 1BR4A 3AE3A 3V5SA 2P9BA 3U78A 4MLKA 2XSBA 2OLTA 1E1HB 2JIWA 3LSVA 3RQWA 3EDVA 4O4LE 1SA0E 2LKGA 3P4RA 2B76A 4G63A 5LBQB 4DV0T 2JMKA 3I0OA 2WDRA 5EK4A 1BR0A 4JEHB 4AQGA 4LF4T 3JAEA 3B57A 3KVAA 3K3OA 5DQVA 3Q5WA 5HXRA 2WCAA 3T1YT 5JR9B 4ILUA 4HTEA 2VKDA 2JMHA 3I9YA 2UUCT 3ETUA 3FB2A 3PUZF 5LHHB 2XZEA 4HFDA 4I4TE 2CRBA 2X51A 4ERRA 5ABFB 3PURA 3WAJA 2BS2A 1MMGA 1U5PA 2R6GF 3GWHA 3NZQA 4CXWA 4DNDA 5M4YA 1DU2A 3KV9A 2D9DA 4AKGA 3TKLB 5LBMA 2VWAA 4EEBA 1MIWA 4UF0B 3OKQA 5J0ZA 1QUUA 2A3DA 3LDQB 5HXSA 5LGUB 4H9QC 4O8SA 4X1IE 3AE6A 3AE1A 4TWHA 4YFSA 4UELA 2BZBA 2YU1A 1SE7A 1CHUA 1X79A 4ZS3A 1S35A 2W0GA 2X67A 3ZT6A 1OWAA 2DI4A 4ZI2D 3DTOA 3IA3A 2WQYA 4I50E 4DV7T 1YQ4A 2XQAA 2H88A 1OEDE 2K48A 2LSYA 3JC6C 3LBXA 3L09A 4IGUA 3ZCJA 3MKDA 4DR7T 2AE9A 4CI3B 2Q9QB 2FJBA 2LRLA 3MK7C 4UV8B 4TV8E 5AQSB 5L3GB 3AAIA 3QC9A 4A56A 1VCSA 2LSGA 1MIVA 3AE2A 2ZLYA 3PUVF 4PFPA 1VCTA 5IYZE 1GQEA 2I6HA 2LM9A 2PBIA 2PTFA 3JCFA 3OYXA 3PUWF 2C0SA 4A5XA 5JQGE 1YKHB 4JI0T 4CXXA 3E08A 2CWYA 1HG5A 2XTLA 3UT5E 3UTKA 2X9XA 4IL4A 3AA7B 4LFCT 4JLEA 2BVLA 1HX8A 4HE8A 5F3JA 4X64T 4H9RC 1HFAA 2ES0A 4LMKA 4WNKA 4EGWA 2BG9B 2FBWA 1NWMX 3J9X1 4KMCA 2LKHA 3UUNA 3MXZA 3LK42 4XZCA 3TLSA 2V8SV 1D1AA 4JYAT 4HFHA 2CCQA 2V5CA 4TUYE 3HL6A 2IIUA 2L3LA 2EHOD 4ADZA 4QXBB 2OA5A 4QWNB 4MBQA 1J5WA 2LSJA 2JQHA 1KK7A 2CXLA 5H6QB 3ZMZB 2WP9A 3FXEB 3ONXA 2X9HA 3KBTA 2AXDS 5DJQC 1KFYA 5L4EA 3ZMSB 1MMAA 5LJNA 3BQIA 3K1SA 4IDOA 4NXNT 4LF8T 2XQ3A 3PUAA 3AVRA 3EI0A 3HA4A 4JBWF 1HNWT 2KINB 2KWIB 3N2OA 5L3FB 5FXVA 4O4JE 4DR5T 3IBPA 3ZT5A 2CHOA 4HWHA 2WZIA 2XM1A 2BG9A 2XUEA 4ZI7E 5CA0E 2NWBA 4HWIB 3CX6B 2E9XB 2XAHB 4WBOA 3H37A 3RRWA 5FL1A 1XZYA 1UUSA 4C90A 3CPZA 4U7IA 3HKBE 4WZXA 4EZHA 2CBIA 3AEBA 2WU2A 2KLQA 2LSIA 2J4GA 4TZ4C 2VB6A 2XAFB 3L3PA 2XQ4A 2V5DA 5AQQB 3CVRA 3FXDB 2D0TA 1FMVA 3SFDA 5JR9C 4NXMT 1VRBA 5AQHB 5LMNT 4OYKA 3SOLA 4AQFC 4H9NC 5ABHA 2W63A 5LOVE 2UUAT 5HXHA 2Q9QA 4X1YE 3O1HA 3ETVA 2CPTA 3LBXB 2E8IA 4AIUA 2J47A 3AAAB 1FIOA 1XWMA 5HEHA 3O9XA 2MPKA 3ANWA 1IJ6A 1H7CA 4BJNA 2H3RA 2XQ9A 2F4VT 4C91A 1JNZA 2WDQA 3OVUA 4FJOA 4Z8XA 2UU9T 1WYCA 4JI1T 1O3XA 4U31A 3VR9A 5LP6E 3ZT7A 2E5LT 1UX5A 4UF0A 3K3NA 4A97A 3K8PC 2Y8DA 2I59A 4H9SE 4OYJA 4H9OC 3RX6A 5FY0A 4LF5T 4LFAT 5AQMB 4HWCA 3UU3A 5ABFA 2ZM6T 5HXEA 4B3MT 4K0UA 3GA8A 3FBLA 2RA1A 3CQXC 5LJMA 1YQ3A 4JUYA 1IBKT 2ACZA 2NR4A 2JQKA 3D0TA 1WR6A 3LK3B 4JI3T 2DNXA 2YN6A 4YY3T 2V7IA 1T72A 3C50A 3CX7B 2OV9A 4HKAA 5EK3A 4DO0A 3W15B 4UEMA 2D5UA 3PU3A 1EZ3A 4IT4A 5JDGA 4BJMA 5HYAA 4O2BE 2WAUA 4DBQA 1WRDA 4YSYA 2N9DA 2XQYA 2NW7A 2C5IT 2BKNA 1SUMB 1Y01A 4KP3C 4DV3T 4IIJE 4LF9T 2VVNA 1NEKA 1OEDC 2FJDA 2D0UA 2XQ6A 3CKDA 4I43B 2X66A 3ESLA 3MA9A 2VQFT 2IDOB 2XAJB 2IUBA 5HEGA 5JDLA 2FJEA 2W66A 3EUHA 1X9BA 4HFEA 3BQLA 3ZMUB 1T7SA 3R84B 4ZI2C 2N2NA 4ILBA 4UXNB 5LHIB 4O2AE 4JI7T 2VVSA 5AQLB 1AJ3A 2G0UA 3C98B 5L2LA 1QSDA 2JJ9A 4U74A 2MOZA 3Q5DA 2K3WA 1U4QA 2WU5A 1UX4A 3PUGA 4EAHA 5ADXL 4DR2T 2XASB 2KWHA 2QYWA 3ZLIA 1KEYA 2ODVA 2XHEB 2EHOC 5FXWA 4EZ4A 4U7YA 5EZYE 1ZV4X 1JNRA 1E2AA 1VOMA 3SWHA 3VRAA 3ZC0A 4Z91A 2LM2A 2Z6EA 2ZM0A 5AQFB 5LXTE 1WFDA 2GK9A 4QHOA 2BKPA 5HEOA 3CX8B 2H7OA 4GYRA 3QOFA 3RIAA 3RQUA 2E9XC 3ZN1B 1UCUA 5GONE 3KBUA 5JDFA 4DUZT 1YXRA 3MACA 3OJAA 2LLYA 3QB5K 5J2TE 3QK6A 4PJMA 4U33A 3FZHB 2V1DB 2IC9A 4CZZB 5LGTB 2BBHA 3BQKA 5CB4E 2QVAA 3PJAJ 2X0YA 2KSRA 4G2AA 5LB7B 5LCYA 2WM9A 4DR3T 4XBFB 1I6ZA 1HF8A 4DUYT 2CXDA 3RGLA 4TNVA 1XNRT 1J1JA 3AVSA 2VQET 2ZM2A 1T98A 1B7TA 2M67A 3QNUA 4LMLA 2CLYC 4UIGA 2K24A 3F2EA 5HCJA 3SRZA 3RLFF 3H3AA 3IF8B 4GK5E 4L0RA 2CM0A 4U3CA 2VKOA 3RKOA 3UU6A 4DMWA 3CQGB 4YTPA 5C2TA 3P4QA 2N1GA 3ZPOA 3RKGA 1BR1A 4COFA 4HFCA 4TN7B 4UVAB 4LMJA 3RIUC 3LG7A 4PAGA 3VU7H 4LF7T 4KI0F 5C8YE 1OEDA 4YLHA 1KNRA 2BBJA 4KBMB 5JH7E 2H89A 5IUXA 4DBRA 4WYVA 4DV4T 5FVKA 2ZMAA 3P4WA 1MMNA 4OFZA 3PTRB 4ZZBA 1LRZA 2XPKA 4H9PC 2CLYB 3N9NA 3OTOT 1HR0T 3I9WA 3B13A 4IHJE 5ABGA 1XNQT 1IAPA 5ETWA 3JC6D 1I94T 4P0BA 3EHZA 3A7MA 4X5TA 2W61A 1MNDA 3CMLA 2WMNA 5F5WA 2PG8A 2MTQA 2KXPB 4YTMA 3LJCA 1ZHCA 2YDQA 4GK0E 3VRBA 1FEWA 3NRXA 5LA6E 3GMIA 2LRKA 1S94A 3ZKRA 3E22E 4AI6A 2NTXA 4MFRA 1ZP0A 3O4XE 1YKEB 2MYSA 2X0LB 2CWOA 2X68A 4AKHA 2XSAA 5FP3A 3ZMVB 1US7B 2FJAA 4TNWA 4JI4T 4L9IA 2UXCT 3C51A 1CUNA 4DR6T 3PUXF 3FZKB 4JV5T 1NAFA 1KNZA 5JREA 4IE4A 4LF6T 3PU8A 5C3JA 4XAXB 5J2UE 5FXZA 4Z90A 2CBJA 2EHOB 4EB6E 2YOEA 5A1LA 1N33T 1Z8UA 2E5VA 2V6YB 4NUUA 2VK9A 3O1IA 4TWFA 2LHRA 1UK5A 4PFOA 5BR8T 3UQ4A 4X66T 3DP7A 2LEHA 3AA6B 5AQUB 3GN5B 1MIYA 2A72A 4IREA 2BS4A 3AECA 2NW9A 3IHRA 5HEUA 3ZN0B 5CA1E 2CE7A 3MJXA 4AKRB 2CMRA 3DJBA 4PK4A 3RYFE 2L8KA 3AA0B 4CQIA 3P50A 3JADA 3C64A 3RIUA 1ZOYA 4IL9A 2XY8B 4KHPT 3T1HT 4LFBT 3A5XA 4OHFA 2K5BB 3RYCE 3OYZA 5AQNB 3RI5A 2PJQA 2DWGA 3ANWB 5L3DB 1WLXA 2BDEA 2BG9E 1UURA 2KZ7B 5AQGB 4ILAA 1Y64B 2Q9QD 5FXXA 1HCIA 3T8OA 2NP9A 5HWYA 4P09A 4QH4A 3P4SA 3HKCE 5DABA 2WZHA 4KUMB 3FZFB 2QA7A 2WS3A 5AQTB 1IBLT 2DWKA 3N5LA 2UXBT 3CWZB 2CXFA 4CN1A 2V7LA 1YW0A 3HR0A 2UXNB 4ZEYA 2VASA 2WMOA 3NKZA 4E7ZA 5LYJE 3PUQA 3AE8A 5FNVE 2XQ5A 3AEFA 4IDZA 3RYIE 3KV4A 4DVDA 4M1PA 2W4XA 5CJ5A 4L5GA 4X65T 1M62A 1MMDA 4YSZA 2BG9C 2XAQB 3ABVA 2LSKA 4I0UA 4ZZCA 3QB5A 4YJ3E 3N9MA 1NENA 3L8RA 4B6XA 4EXTA 2E9XD 2IW5B 1W0AA 2LOSA 4IE5A 5AQIB 4IDNA 1V9DA 2LT3A 3MZKB 4PJJA 4ASKA 4YT0A 4NPPA 1D1BA 3GN5A 4HFIA 5L3CB 1J5ET 4ZHQE 2YK0A 5F8PA 3TLWA 4B3RT 3M3ZB 3UULA 4ZI3D 1D0ZA 1ZEEA 1LVKA 3HKDE 2V6YA 1XDOA 4OX9T 2I0MA 4ISSA 3J7Yq 4ISTA 3UU4A 5FYMA 5LNKA 4ILCA 3Q5XA 2X9WA 2YU2A 3Q5EA 3AEAA 5DQWA 4PK5A 2V7KA 3UU5A 3UUMA 4DV5T 1HNZT 4PJNA 2ODUA 3I1AA 4CI2B 3KV5A 3VKHA 2JRKA 4HGAA 2QRXA 4JEUB 3C4XA 3H3MA 3HKEE 4AXPA 2XM2A 5TAOA 3KFWX 2WWVA 2Y6XA 4QXCB 4EEDA 1E7PA 3OPCA 2X9YA 3ZEFB 2FUPA 1R8IA 2YKSA 1IJ5A 3O1JA 2JPFA 5LG4A 4EIWA 2BKOA 3N2KE 2M6IA 3N9OA 4HEAA 2JQ9A 3FZLB 1N32T 4CI1B 3K3QC 4EOZB 4YJ2E 1D0YA 2V7JA 3F31A 4UV9B 3NZPA 5FY7A 4AKLA 1XDPA 3CK6A 4IDQA 3SS1A 4JI5T 4DV2T 3PUSA 1G8XA 2WDVA 2CA5A 4QX8B 2HPJA 5E0OA 3S4UA 1IZNB 2BVMA 1IBMT 2YDRA 5KXJA 2C5KT 2Y48B 5L3EB 1KF6A 2WWUA 3JAFA 3V5UA 5H6RB 2WSSV 2DCFA 3TLUA 1SHZC 2RPAA 2V26A 5KMGP 5LG3A 2NTYA 4TV9E 1LVFA 3X1DA 3AE4A 3ONJA 2VURA 5KDMC 4B3ST 4A98A 4YHJA 4QX7B 1OXZA 2VL8A 3L39A 4X1KE 4UVBB 3ZJ2A 2XQ7A 3CQCB 3AAEB 4O4IE 1XMQT 3AE9A 4PJLA 2K9AA 3BK9A 3R6NA 1HTJF 1HG2A 4J2CA 3PUYF 2XJ7A 5AQRB 5FMNA 5LHGB 3RPUA 3C4WA 3UFEA 2MAWA 2J62A 2ZM8A 3FHNA 4F6RC 5JR9A 1YD8G 3CIRA 4BA9A 1HS7A 2DHRA 3QUJA 5CFBA 2EHOA 3N2GE 4IE0A 4DV6T 4B3TT
chains in the Genus database with same CATH topology
1M7KA 5AQUB 5AQFB 2D9DA 3A8YC 1HX1B 1M62A 3LDQB 4HWHA 4HWFA 4HWIB 5AQVB 3FZHB 5AQNB 1T7SA 5AQIB 1I6ZA 5AQKB 5AQMB 4HWCA 3FZLB 5AQGB 3FZKB 5AQLB 1UGOA 5AQRB 3M3ZB 5AQQB 5AQSB 5AQTB 3FZFB 5AQHB 5AQOB 3FZMB 4HWDA 5AQPB 5AQJB 1UK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7K A;  5AQU B;  5AQF B;  2D9D A;  3A8Y C;  1HX1 B;  1M62 A;  3LDQ B;  4HWH A;  4HWF A;  4HWI B;  5AQV B;  3FZH B;  5AQN B;  1T7S A;  5AQI B;  1I6Z A;  5AQK B;  5AQM B;  4HWC A;  3FZL B;  5AQG B;  3FZK B;  5AQL B;  1UGO A;  5AQR B;  3M3Z B;  5AQQ B;  5AQS B;  5AQT B;  3FZF B;  5AQH B;  5AQO B;  3FZM B;  4HWD A;  5AQP B;  5AQJ B;  1UK5 A; 
#chains in the Genus database with same CATH topology
 2X0H A;  1W9R A;  3ZCI A;  4HFV A;  5HXC A;  5JDQ A;  2C5J A;  3FBZ A;  5JDH A;  1BR2 A;  2CEA A;  2KT9 A;  3Q2M A;  4U72 A;  2LJL A;  1HNX T;  2IHR 1;  3UUX B;  3U3I A;  4GIW A;  4HFB A;  2W67 A;  3AB3 B;  5HEJ A;  5IWA T;  2L9Q A;  4X20 E;  5L3B B;  3AA1 B;  3UU8 A;  3ONL C;  1D1C A;  2IML A;  4E7S A;  2E2A A;  2ACX A;  2HN1 A;  3IEE A;  1G73 A;  2WY2 A;  4F8H A;  2CHN A;  2M6B A;  3AE7 A;  3EVY A;  5FKY A;  3ZYL A;  2YEV C;  5AFU L;  4YHH T;  4YXD A;  5KX5 E;  1UGO A;  4PW8 A;  3P4P A;  4IE6 A;  1XMO T;  3AED A;  2HN2 A;  3EAM A;  3N9P A;  2LOP A;  4NIQ A;  3RC3 A;  3TLT A;  3EAB A;  4ZOL E;  4ZS2 A;  4ZI3 C;  4I55 E;  4PNI A;  2A2F X;  1W09 A;  2VKH A;  2W2U A;  3AXJ A;  5AQO B;  3WAK A;  4QXH B;  4EYY R;  4Q25 A;  3VKG A;  3NVO A;  5JDN A;  5AQJ B;  1MNE A;  2SPC A;  3UQ7 A;  2LHN A;  3C4Z A;  3RF1 A;  4JI6 T;  4UR9 A;  5L4H A;  3RIF A;  3ZC1 A;  1W0B A;  2H7V C;  3ZYK A;  4BAY B;  2MBG A;  3ZST A;  2PFV A;  3KVB A;  4P1N A;  4TWD A;  5JRC A;  3ZMT B;  2RP4 A;  4CXY A;  1OED B;  2IAK A;  3G06 A;  2KND A;  3PDY A;  4GKJ T;  3PV0 F;  4QH1 A;  4WW0 A;  3LFM A;  2UUB T;  2HH7 A;  2QGS A;  3E0Z A;  4U2Y A;  4H63 V;  4EV6 A;  4UVC B;  4DR1 T;  4NUV A;  4MAL A;  5J1G A;  3RRC A;  3N9Q A;  4HN9 A;  4QH5 A;  3RH3 A;  3SFE A;  5HCM A;  3ZJ1 A;  2VL0 A;  2HPL A;  2VKJ A;  1ZKE A;  2XQ8 A;  4P0A A;  3RC8 A;  4GKK T;  4IDP A;  4MHC A;  4OK0 A;  4AQF A;  1WYB A;  3AE5 A;  2WBL A;  3FZM B;  4H63 H;  3OBV E;  4HWD A;  4N78 D;  5IHY A;  2Q9Q C;  1FJG T;  4DR4 T;  4AKI A;  3UFG A;  4HWF A;  5LGN B;  2B1E A;  2NW8 A;  2KMF A;  3KV6 A;  4DID B;  2DL1 A;  5FL0 A;  2YIN A;  3P7I A;  4K0K T;  5FVL A;  4V1A v;  1HX1 B;  1QLB A;  3PJA A;  4ANJ A;  2UXX B;  4GOU A;  5ABE A;  2YDS A;  5HAX A;  3M65 A;  1N34 T;  3B5M A;  1FMW A;  3I0Q A;  3KIN B;  3TLV A;  2XAG B;  5JTG A;  5JRC B;  2JQQ A;  1L0V A;  4YSX A;  3HI2 A;  3NBX X;  3F57 A;  2LE8 A;  3AEG A;  4EYU A;  3NWI A;  3UUB A;  4AIS A;  2A9U A;  5AQK B;  4WBN E;  4X62 T;  4JI8 T;  4DV1 T;  3P8C D;  4ZXL A;  5BMV E;  5FY1 A;  3KDS E;  5EK2 A;  3AEE A;  4FI5 A;  3ZYM A;  5L47 A;  3VHL A;  5JDM A;  2V6X A;  2UXD T;  4AQY T;  4KHZ F;  2DLR A;  2NOX A;  3AXJ B;  3VR8 A;  3PE0 A;  1WCR A;  5AQP B;  4YTN A;  4O4H E;  2J1D G;  2D2S A;  2V7M A;  3ZSS A;  1M7K A;  1LKX A;  1WR0 A;  4IE7 A;  4CN4 A;  3LK2 B;  1T8B A;  3N9L A;  3Q9D A;  2BS3 A;  1Z0P A;  2W62 A;  4JI2 T;  4U2Z A;  5CGM A;  3WI3 A;  1D0X A;  1KNP A;  3A8Y C;  3EDU A;  4KX6 A;  5JVD E;  2WB5 A;  4DMV A;  2E9X A;  2W00 A;  4TX5 A;  3NRY A;  5HWX A;  1N36 T;  4CN6 A;  2IC6 A;  5LMU T;  4GYS A;  2HHH T;  4QKN A;  4PK6 A;  3RYH E;  3RHW A;  5AQV B;  1BR4 A;  3AE3 A;  3V5S A;  2P9B A;  3U78 A;  4MLK A;  2XSB A;  2OLT A;  1E1H B;  2JIW A;  3LSV A;  3RQW A;  3EDV A;  4O4L E;  1SA0 E;  2LKG A;  3P4R A;  2B76 A;  4G63 A;  5LBQ B;  4DV0 T;  2JMK A;  3I0O A;  2WDR A;  5EK4 A;  1BR0 A;  4JEH B;  4AQG A;  4LF4 T;  3JAE A;  3B57 A;  3KVA A;  3K3O A;  5DQV A;  3Q5W A;  5HXR A;  2WCA A;  3T1Y T;  5JR9 B;  4ILU A;  4HTE A;  2VKD A;  2JMH A;  3I9Y A;  2UUC T;  3ETU A;  3FB2 A;  3PUZ F;  5LHH B;  2XZE A;  4HFD A;  4I4T E;  2CRB A;  2X51 A;  4ERR A;  5ABF B;  3PUR A;  3WAJ A;  2BS2 A;  1MMG A;  1U5P A;  2R6G F;  3GWH A;  3NZQ A;  4CXW A;  4DND A;  5M4Y A;  1DU2 A;  3KV9 A;  2D9D A;  4AKG A;  3TKL B;  5LBM A;  2VWA A;  4EEB A;  1MIW A;  4UF0 B;  3OKQ A;  5J0Z A;  1QUU A;  2A3D A;  3LDQ B;  5HXS A;  5LGU B;  4H9Q C;  4O8S A;  4X1I E;  3AE6 A;  3AE1 A;  4TWH A;  4YFS A;  4UEL A;  2BZB A;  2YU1 A;  1SE7 A;  1CHU A;  1X79 A;  4ZS3 A;  1S35 A;  2W0G A;  2X67 A;  3ZT6 A;  1OWA A;  2DI4 A;  4ZI2 D;  3DTO A;  3IA3 A;  2WQY A;  4I50 E;  4DV7 T;  1YQ4 A;  2XQA A;  2H88 A;  1OED E;  2K48 A;  2LSY A;  3JC6 C;  3LBX A;  3L09 A;  4IGU A;  3ZCJ A;  3MKD A;  4DR7 T;  2AE9 A;  4CI3 B;  2Q9Q B;  2FJB A;  2LRL A;  3MK7 C;  4UV8 B;  4TV8 E;  5AQS B;  5L3G B;  3AAI A;  3QC9 A;  4A56 A;  1VCS A;  2LSG A;  1MIV A;  3AE2 A;  2ZLY A;  3PUV F;  4PFP A;  1VCT A;  5IYZ E;  1GQE A;  2I6H A;  2LM9 A;  2PBI A;  2PTF A;  3JCF A;  3OYX A;  3PUW F;  2C0S A;  4A5X A;  5JQG E;  1YKH B;  4JI0 T;  4CXX A;  3E08 A;  2CWY A;  1HG5 A;  2XTL A;  3UT5 E;  3UTK A;  2X9X A;  4IL4 A;  3AA7 B;  4LFC T;  4JLE A;  2BVL A;  1HX8 A;  4HE8 A;  5F3J A;  4X64 T;  4H9R C;  1HFA A;  2ES0 A;  4LMK A;  4WNK A;  4EGW A;  2BG9 B;  2FBW A;  1NWM X;  3J9X 1;  4KMC A;  2LKH A;  3UUN A;  3MXZ A;  3LK4 2;  4XZC A;  3TLS A;  2V8S V;  1D1A A;  4JYA T;  4HFH A;  2CCQ A;  2V5C A;  4TUY E;  3HL6 A;  2IIU A;  2L3L A;  2EHO D;  4ADZ A;  4QXB B;  2OA5 A;  4QWN B;  4MBQ A;  1J5W A;  2LSJ A;  2JQH A;  1KK7 A;  2CXL A;  5H6Q B;  3ZMZ B;  2WP9 A;  3FXE B;  3ONX A;  2X9H A;  3KBT A;  2AXD S;  5DJQ C;  1KFY A;  5L4E A;  3ZMS B;  1MMA A;  5LJN A;  3BQI A;  3K1S A;  4IDO A;  4NXN T;  4LF8 T;  2XQ3 A;  3PUA A;  3AVR A;  3EI0 A;  3HA4 A;  4JBW F;  1HNW T;  2KIN B;  2KWI B;  3N2O A;  5L3F B;  5FXV A;  4O4J E;  4DR5 T;  3IBP A;  3ZT5 A;  2CHO A;  4HWH A;  2WZI A;  2XM1 A;  2BG9 A;  2XUE A;  4ZI7 E;  5CA0 E;  2NWB A;  4HWI B;  3CX6 B;  2E9X B;  2XAH B;  4WBO A;  3H37 A;  3RRW A;  5FL1 A;  1XZY A;  1UUS A;  4C90 A;  3CPZ A;  4U7I A;  3HKB E;  4WZX A;  4EZH A;  2CBI A;  3AEB A;  2WU2 A;  2KLQ A;  2LSI A;  2J4G A;  4TZ4 C;  2VB6 A;  2XAF B;  3L3P A;  2XQ4 A;  2V5D A;  5AQQ B;  3CVR A;  3FXD B;  2D0T A;  1FMV A;  3SFD A;  5JR9 C;  4NXM T;  1VRB A;  5AQH B;  5LMN T;  4OYK A;  3SOL A;  4AQF C;  4H9N C;  5ABH A;  2W63 A;  5LOV E;  2UUA T;  5HXH A;  2Q9Q A;  4X1Y E;  3O1H A;  3ETV A;  2CPT A;  3LBX B;  2E8I A;  4AIU A;  2J47 A;  3AAA B;  1FIO A;  1XWM A;  5HEH A;  3O9X A;  2MPK A;  3ANW A;  1IJ6 A;  1H7C A;  4BJN A;  2H3R A;  2XQ9 A;  2F4V T;  4C91 A;  1JNZ A;  2WDQ A;  3OVU A;  4FJO A;  4Z8X A;  2UU9 T;  1WYC A;  4JI1 T;  1O3X A;  4U31 A;  3VR9 A;  5LP6 E;  3ZT7 A;  2E5L T;  1UX5 A;  4UF0 A;  3K3N A;  4A97 A;  3K8P C;  2Y8D A;  2I59 A;  4H9S E;  4OYJ A;  4H9O C;  3RX6 A;  5FY0 A;  4LF5 T;  4LFA T;  5AQM B;  4HWC A;  3UU3 A;  5ABF A;  2ZM6 T;  5HXE A;  4B3M T;  4K0U A;  3GA8 A;  3FBL A;  2RA1 A;  3CQX C;  5LJM A;  1YQ3 A;  4JUY A;  1IBK T;  2ACZ A;  2NR4 A;  2JQK A;  3D0T A;  1WR6 A;  3LK3 B;  4JI3 T;  2DNX A;  2YN6 A;  4YY3 T;  2V7I A;  1T72 A;  3C50 A;  3CX7 B;  2OV9 A;  4HKA A;  5EK3 A;  4DO0 A;  3W15 B;  4UEM A;  2D5U A;  3PU3 A;  1EZ3 A;  4IT4 A;  5JDG A;  4BJM A;  5HYA A;  4O2B E;  2WAU A;  4DBQ A;  1WRD A;  4YSY A;  2N9D A;  2XQY A;  2NW7 A;  2C5I T;  2BKN A;  1SUM B;  1Y01 A;  4KP3 C;  4DV3 T;  4IIJ E;  4LF9 T;  2VVN A;  1NEK A;  1OED C;  2FJD A;  2D0U A;  2XQ6 A;  3CKD A;  4I43 B;  2X66 A;  3ESL A;  3MA9 A;  2VQF T;  2IDO B;  2XAJ B;  2IUB A;  5HEG A;  5JDL A;  2FJE A;  2W66 A;  3EUH A;  1X9B A;  4HFE A;  3BQL A;  3ZMU B;  1T7S A;  3R84 B;  4ZI2 C;  2N2N A;  4ILB A;  4UXN B;  5LHI B;  4O2A E;  4JI7 T;  2VVS A;  5AQL B;  1AJ3 A;  2G0U A;  3C98 B;  5L2L A;  1QSD A;  2JJ9 A;  4U74 A;  2MOZ A;  3Q5D A;  2K3W A;  1U4Q A;  2WU5 A;  1UX4 A;  3PUG A;  4EAH A;  5ADX L;  4DR2 T;  2XAS B;  2KWH A;  2QYW A;  3ZLI A;  1KEY A;  2ODV A;  2XHE B;  2EHO C;  5FXW A;  4EZ4 A;  4U7Y A;  5EZY E;  1ZV4 X;  1JNR A;  1E2A A;  1VOM A;  3SWH A;  3VRA A;  3ZC0 A;  4Z91 A;  2LM2 A;  2Z6E A;  2ZM0 A;  5AQF B;  5LXT E;  1WFD A;  2GK9 A;  4QHO A;  2BKP A;  5HEO A;  3CX8 B;  2H7O A;  4GYR A;  3QOF A;  3RIA A;  3RQU A;  2E9X C;  3ZN1 B;  1UCU A;  5GON E;  3KBU A;  5JDF A;  4DUZ T;  1YXR A;  3MAC A;  3OJA A;  2LLY A;  3QB5 K;  5J2T E;  3QK6 A;  4PJM A;  4U33 A;  3FZH B;  2V1D B;  2IC9 A;  4CZZ B;  5LGT B;  2BBH A;  3BQK A;  5CB4 E;  2QVA A;  3PJA J;  2X0Y A;  2KSR A;  4G2A A;  5LB7 B;  5LCY A;  2WM9 A;  4DR3 T;  4XBF B;  1I6Z A;  1HF8 A;  4DUY T;  2CXD A;  3RGL A;  4TNV A;  1XNR T;  1J1J A;  3AVS A;  2VQE T;  2ZM2 A;  1T98 A;  1B7T A;  2M67 A;  3QNU A;  4LML A;  2CLY C;  4UIG A;  2K24 A;  3F2E A;  5HCJ A;  3SRZ A;  3RLF F;  3H3A A;  3IF8 B;  4GK5 E;  4L0R A;  2CM0 A;  4U3C A;  2VKO A;  3RKO A;  3UU6 A;  4DMW A;  3CQG B;  4YTP A;  5C2T A;  3P4Q A;  2N1G A;  3ZPO A;  3RKG A;  1BR1 A;  4COF A;  4HFC A;  4TN7 B;  4UVA B;  4LMJ A;  3RIU C;  3LG7 A;  4PAG A;  3VU7 H;  4LF7 T;  4KI0 F;  5C8Y E;  1OED A;  4YLH A;  1KNR A;  2BBJ A;  4KBM B;  5JH7 E;  2H89 A;  5IUX A;  4DBR A;  4WYV A;  4DV4 T;  5FVK A;  2ZMA A;  3P4W A;  1MMN A;  4OFZ A;  3PTR B;  4ZZB A;  1LRZ A;  2XPK A;  4H9P C;  2CLY B;  3N9N A;  3OTO T;  1HR0 T;  3I9W A;  3B13 A;  4IHJ E;  5ABG A;  1XNQ T;  1IAP A;  5ETW A;  3JC6 D;  1I94 T;  4P0B A;  3EHZ A;  3A7M A;  4X5T A;  2W61 A;  1MND A;  3CML A;  2WMN A;  5F5W A;  2PG8 A;  2MTQ A;  2KXP B;  4YTM A;  3LJC A;  1ZHC A;  2YDQ A;  4GK0 E;  3VRB A;  1FEW A;  3NRX A;  5LA6 E;  3GMI A;  2LRK A;  1S94 A;  3ZKR A;  3E22 E;  4AI6 A;  2NTX A;  4MFR A;  1ZP0 A;  3O4X E;  1YKE B;  2MYS A;  2X0L B;  2CWO A;  2X68 A;  4AKH A;  2XSA A;  5FP3 A;  3ZMV B;  1US7 B;  2FJA A;  4TNW A;  4JI4 T;  4L9I A;  2UXC T;  3C51 A;  1CUN A;  4DR6 T;  3PUX F;  3FZK B;  4JV5 T;  1NAF A;  1KNZ A;  5JRE A;  4IE4 A;  4LF6 T;  3PU8 A;  5C3J A;  4XAX B;  5J2U E;  5FXZ A;  4Z90 A;  2CBJ A;  2EHO B;  4EB6 E;  2YOE A;  5A1L A;  1N33 T;  1Z8U A;  2E5V A;  2V6Y B;  4NUU A;  2VK9 A;  3O1I A;  4TWF A;  2LHR A;  1UK5 A;  4PFO A;  5BR8 T;  3UQ4 A;  4X66 T;  3DP7 A;  2LEH A;  3AA6 B;  5AQU B;  3GN5 B;  1MIY A;  2A72 A;  4IRE A;  2BS4 A;  3AEC A;  2NW9 A;  3IHR A;  5HEU A;  3ZN0 B;  5CA1 E;  2CE7 A;  3MJX A;  4AKR B;  2CMR A;  3DJB A;  4PK4 A;  3RYF E;  2L8K A;  3AA0 B;  4CQI A;  3P50 A;  3JAD A;  3C64 A;  3RIU A;  1ZOY A;  4IL9 A;  2XY8 B;  4KHP T;  3T1H T;  4LFB T;  3A5X A;  4OHF A;  2K5B B;  3RYC E;  3OYZ A;  5AQN B;  3RI5 A;  2PJQ A;  2DWG A;  3ANW B;  5L3D B;  1WLX A;  2BDE A;  2BG9 E;  1UUR A;  2KZ7 B;  5AQG B;  4ILA A;  1Y64 B;  2Q9Q D;  5FXX A;  1HCI A;  3T8O A;  2NP9 A;  5HWY A;  4P09 A;  4QH4 A;  3P4S A;  3HKC E;  5DAB A;  2WZH A;  4KUM B;  3FZF B;  2QA7 A;  2WS3 A;  5AQT B;  1IBL T;  2DWK A;  3N5L A;  2UXB T;  3CWZ B;  2CXF A;  4CN1 A;  2V7L A;  1YW0 A;  3HR0 A;  2UXN B;  4ZEY A;  2VAS A;  2WMO A;  3NKZ A;  4E7Z A;  5LYJ E;  3PUQ A;  3AE8 A;  5FNV E;  2XQ5 A;  3AEF A;  4IDZ A;  3RYI E;  3KV4 A;  4DVD A;  4M1P A;  2W4X A;  5CJ5 A;  4L5G A;  4X65 T;  1M62 A;  1MMD A;  4YSZ A;  2BG9 C;  2XAQ B;  3ABV A;  2LSK A;  4I0U A;  4ZZC A;  3QB5 A;  4YJ3 E;  3N9M A;  1NEN A;  3L8R A;  4B6X A;  4EXT A;  2E9X D;  2IW5 B;  1W0A A;  2LOS A;  4IE5 A;  5AQI B;  4IDN A;  1V9D A;  2LT3 A;  3MZK B;  4PJJ A;  4ASK A;  4YT0 A;  4NPP A;  1D1B A;  3GN5 A;  4HFI A;  5L3C B;  1J5E T;  4ZHQ E;  2YK0 A;  5F8P A;  3TLW A;  4B3R T;  3M3Z B;  3UUL A;  4ZI3 D;  1D0Z A;  1ZEE A;  1LVK A;  3HKD E;  2V6Y A;  1XDO A;  4OX9 T;  2I0M A;  4ISS A;  3J7Y q;  4IST A;  3UU4 A;  5FYM A;  5LNK A;  4ILC A;  3Q5X A;  2X9W A;  2YU2 A;  3Q5E A;  3AEA A;  5DQW A;  4PK5 A;  2V7K A;  3UU5 A;  3UUM A;  4DV5 T;  1HNZ T;  4PJN A;  2ODU A;  3I1A A;  4CI2 B;  3KV5 A;  3VKH A;  2JRK A;  4HGA A;  2QRX A;  4JEU B;  3C4X A;  3H3M A;  3HKE E;  4AXP A;  2XM2 A;  5TAO A;  3KFW X;  2WWV A;  2Y6X A;  4QXC B;  4EED A;  1E7P A;  3OPC A;  2X9Y A;  3ZEF B;  2FUP A;  1R8I A;  2YKS A;  1IJ5 A;  3O1J A;  2JPF A;  5LG4 A;  4EIW A;  2BKO A;  3N2K E;  2M6I A;  3N9O A;  4HEA A;  2JQ9 A;  3FZL B;  1N32 T;  4CI1 B;  3K3Q C;  4EOZ B;  4YJ2 E;  1D0Y A;  2V7J A;  3F31 A;  4UV9 B;  3NZP A;  5FY7 A;  4AKL A;  1XDP A;  3CK6 A;  4IDQ A;  3SS1 A;  4JI5 T;  4DV2 T;  3PUS A;  1G8X A;  2WDV A;  2CA5 A;  4QX8 B;  2HPJ A;  5E0O A;  3S4U A;  1IZN B;  2BVM A;  1IBM T;  2YDR A;  5KXJ A;  2C5K T;  2Y48 B;  5L3E B;  1KF6 A;  2WWU A;  3JAF A;  3V5U A;  5H6R B;  2WSS V;  2DCF A;  3TLU A;  1SHZ C;  2RPA A;  2V26 A;  5KMG P;  5LG3 A;  2NTY A;  4TV9 E;  1LVF A;  3X1D A;  3AE4 A;  3ONJ A;  2VUR A;  5KDM C;  4B3S T;  4A98 A;  4YHJ A;  4QX7 B;  1OXZ A;  2VL8 A;  3L39 A;  4X1K E;  4UVB B;  3ZJ2 A;  2XQ7 A;  3CQC B;  3AAE B;  4O4I E;  1XMQ T;  3AE9 A;  4PJL A;  2K9A A;  3BK9 A;  3R6N A;  1HTJ F;  1HG2 A;  4J2C A;  3PUY F;  2XJ7 A;  5AQR B;  5FMN A;  5LHG B;  3RPU A;  3C4W A;  3UFE A;  2MAW A;  2J62 A;  2ZM8 A;  3FHN A;  4F6R C;  5JR9 A;  1YD8 G;  3CIR A;  4BA9 A;  1HS7 A;  2DHR A;  3QUJ A;  5CFB A;  2EHO A;  3N2G E;  4IE0 A;  4DV6 T;  4B3T T; 
#chains in the Genus database with same CATH homology
 1M7K A;  5AQU B;  5AQF B;  2D9D A;  3A8Y C;  1HX1 B;  1M62 A;  3LDQ B;  4HWH A;  4HWF A;  4HWI B;  5AQV B;  3FZH B;  5AQN B;  1T7S A;  5AQI B;  1I6Z A;  5AQK B;  5AQM B;  4HWC A;  3FZL B;  5AQG B;  3FZK B;  5AQL B;  1UGO A;  5AQR B;  3M3Z B;  5AQQ B;  5AQS B;  5AQT B;  3FZF B;  5AQH B;  5AQO B;  3FZM B;  4HWD A;  5AQP B;  5AQJ B;  1UK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...