5AQJB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
114
structure length
114
Chain Sequence
b'PLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 114
sequence length 114
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqjB00
1T7SA 3LDQB 5AQMB 3FZKB 3A8YC 5AQNB 3FZHB 5AQRB 4HWHA 5AQQB 1UGOA 1M7KA 4HWDA 1M62A 4HWFA 5AQSB 5AQHB 3FZLB 3FZFB 5AQGB 3M3ZB 5AQJB 1HX1B 5AQTB 4HWIB 5AQIB 1UK5A 5AQLB 5AQPB 5AQFB 5AQUB 4HWCA 5AQKB 5AQOB 2D9DA 3FZMB 5AQVB 1I6ZA
chains in the Genus database with same CATH superfamily
3F31A 4ILCA 3HI2A 2VKOA 2BKPA 4IDZA 2XM1A 2GK9A 4H9QC 2JQHA 4CN4A 2XPKA 2LSJA 3RYHE 4QH5A 2CWYA 5HWXA 1MMNA 1Z0PA 2V8SV 2MOZA 4GYRA 2D0TA 3RC3A 2V7KA 2VL0A 2BS3A 2A2FX 5LBQB 2FJAA 2H89A 1IJ5A 2V26A 2YK0A 1WR0A 4ZI7E 5FY0A 2LKHA 3RX6A 4QHOA 3MKDA 2WWUA 2V7LA 3PUAA 4EB6E 4YXDA 5AQUB 4DNDA 3T1HT 4IL9A 3GWHA 3CVRA 2YEVC 2JJ9A 3I0QA 5LCYA 2YDQA 1H7CA 4U7IA 3H3AA 3JAEA 4ZXLA 4LF5T 2P9BA 2X66A 3BQLA 1ZOYA 4YTNA 5CFBA 5FMNA 2A9UA 1KF6A 1MIYA 4WBOA 4KP3C 2FJEA 4YTMA 3AB3B 3GA8A 5FY1A 3VR9A 3ANWA 2XAJB 4CZZB 1V9DA 2DI4A 5AQFB 2XQ7A 2XHEB 2LOSA 4EZ4A 4LMLA 4UIGA 3UTKA 2X0HA 5EK3A 4E7ZA 3PUXF 3ZJ1A 2VQET 3UU8A 3UU6A 1QLBA 1U5PA 2E8IA 2E9XD 3H3MA 3CPZA 1J1JA 4TNWA 5H6RB 3SRZA 4TWHA 4HFDA 2CLYC 1XMQT 4U74A 3IF8B 5GONE 1WR6A 2ODUA 4JI0T 1UURA 2V5CA 3UFGA 2IUBA 5AQHB 1S94A 3G06A 4JYAT 3HL6A 3PUSA 2I59A 5FXVA 3ZPOA 2NR4A 3AE5A 4JI5T 5FNVE 1XDPA 3RRWA 4JEHB 1T72A 1LVKA 2MBGA 4TWFA 4ERRA 1OEDC 3OYZA 4CXYA 3RYCE 5LHHB 3RI5A 1FEWA 4LFCT 2CBJA 5HXSA 2LE8A 2LKGA 3QC9A 1J5WA 2DLRA 2UUCT 4ZI3C 2JIWA 2RPAA 1LVFA 2QVAA 4DR3T 3VU7H 3ZC1A 3AE7A 4IE6A 5AQTB 2DNXA 4V1Av 1MNDA 4HTEA 5L4EA 4DR2T 1OWAA 5LP6E 4GK0E 4UF0B 5FP3A 4AQFA 2LHRA 4TZ4C 3CWZB 2ZM0A 1Y01A 4YJ2E 1N32T 3DTOA 3RIAA 3KVBA 3AE4A 5L3DB 3N9OA 2XASB 4YJ3E 3FXEB 2JQQA 1HF8A 3LBXB 2VASA 3AE2A 5ABEA 2BG9B 2BDEA 3SWHA 1LRZA 4J2CA 4HFBA 4DV4T 1OXZA 3PTRB 4H9OC 5FL0A 4EEBA 1E7PA 2LRLA 3RH3A 5FYMA 4Z90A 1UX5A 2FUPA 3ZEFB 2NTXA 2ACZA 4DUYT 5JVDE 2DCFA 2X68A 3KV4A 4IDPA 2UU9T 1JNRA 2CE7A 4DV2T 3QK6A 5C8YE 2HH7A 4DV3T 3IEEA 2PFVA 2NW7A 1BR1A 4QKNA 2UXCT 3KV5A 3U3IA 5LHGB 2PTFA 3LK2B 2UUBT 3UUBA 1MMGA 2IIUA 2Q9QC 1HR0T 2IC9A 3RGLA 3CKDA 3Q5WA 3GN5A 1WRDA 4DR7T 2IW5B 3EAMA 5LMUT 5HEUA 2YU2A 2WSSV 1OEDE 4JI6T 2UXDT 3FBLA 5HXRA 5JTGA 2VKHA 1IBMT 4YTPA 4UVBB 2MTQA 2WZIA 2VKDA 4YHHT 3ONXA 5JRCB 4MBQA 4GKKT 4PJMA 3PE0A 4NXNT 4X65T 2UXBT 3UU5A 3L8RA 3HKCE 4JI4T 3I9WA 4U31A 4UXNB 3RC8A 5LGNB 3L39A 3AVSA 3ESLA 3DJBA 3PJAJ 5HEHA 4YSXA 1AJ3A 2X9WA 3ZKRA 3NZQA 1M7KA 1G73A 4JV5T 1YW0A 4YY3T 3PUGA 3ETVA 3MACA 4DMWA 2KMFA 5IHYA 3ZYKA 2LLYA 4PW8A 4H9RC 3RLFF 4YSZA 3VKHA 3N9LA 3RYIE 4PJJA 2YKSA 1UCUA 4QH4A 2UXNB 3SS1A 2CPTA 3MA9A 2NTYA 4C91A 4DR6T 4IE0A 1E2AA 1KEYA 5AQOB 2W0GA 1MNEA 4WNKA 5JR9A 4KX6A 2XQ4A 3ZN0B 5HEOA 4CI3B 2V7JA 5JDLA 4HFHA 4KMCA 4DR5T 2K5BB 4F6RC 3JCFA 2VURA 3JC6D 2E9XC 5KXJA 4YFSA 1JNZA 2D0UA 5HXHA 1VOMA 3UUMA 1I94T 2WM9A 2WDQA 3P4PA 3QUJA 3AEGA 1IAPA 3PV0F 2UUAT 2YN6A 4GOUA 4BJNA 1J5ET 5HEJA 1ZV4X 1WFDA 1BR2A 4AKLA 4B3RT 1U4QA 5LMNT 4UVCB 4H9PC 4IDOA 3BK9A 3PUVF 5L3BB 4FJOA 4ZOLE 5JREA 2E5LT 2BVMA 4O8SA 5C3JA 3W15B 4L0RA 3UQ7A 2BVLA 4U33A 2QGSA 3OYXA 4ISTA 1DU2A 4DBQA 4JI1T 2L9QA 3TLUA 4PAGA 3PUYF 4PFOA 5L47A 4QXBB 4P0BA 2QRXA 1HX8A 4HWHA 4GKJT 3RQUA 3BQIA 1KNPA 2LSKA 3RYFE 1MMAA 3OPCA 4CI1B 2W63A 4PNIA 2YOEA 5CA1E 2WCAA 3PURA 2XQ5A 4H63H 2V6YB 3PUQA 1S35A 4EYYR 3UU3A 4WW0A 2WAUA 2WDVA 4CN1A 4DUZT 3OVUA 4EYUA 1W0BA 5TAOA 4A5XA 4XAXB 4HWFA 4QWNB 4I43B 3QNUA 3KBTA 2IC6A 1HNZT 4U3CA 3GMIA 4IDQA 2CHOA 4X62T 2XJ7A 2FJBA 4L9IA 2ODVA 4YHJA 2D2SA 2VKJA 2CEAA 3P4QA 2V7MA 3AE1A 4X1YE 2XQ9A 4H9SE 3R6NA 3AEAA 3M3ZB 1XDOA 1UK5A 5DQVA 3N2OA 1ZP0A 4OHFA 4QX7B 4ILAA 2ZLYA 4QX8B 4LF4T 2YINA 4LMJA 5JDGA 4GK5E 4HN9A 4AQGA 2LSIA 3ZT5A 3Q5XA 1ZKEA 4HFIA 4HKAA 4JLEA 3EDUA 1SHZC 4JI8T 5KX5E 4HE8A 2SPCA 3RIUC 4B3MT 2WWVA 2ZM6T 3C4WA 3PU3A 3LSVA 3AXJB 5F8PA 3K8PC 2NP9A 3CIRA 4KHZF 3Q2MA 3Q9DA 2K9AA 4IDNA 4NIQA 4WYVA 2R6GF 2IMLA 4PK6A 5HEGA 2XQ8A 3PUWF 2BBHA 5LXTE 2I0MA 1IJ6A 5ABFB 2WS3A 3TLSA 1CUNA 4DVDA 5LGUB 2EHOA 3ZCJA 3AE3A 2IDOB 3HKBE 3EUHA 1D1CA 4IT4A 4OYKA 2BG9C 3O1HA 2FBWA 1XZYA 4HFVA 2VWAA 2JPFA 3MJXA 4AIUA 5IWAT 4IE5A 1CHUA 2AE9A 3ZCIA 3C64A 3FZMB 2NW8A 3NWIA 5LB7B 3K3OA 4KUMB 3ZMTB 5BR8T 2WZHA 1EZ3A 4O4HE 4U2ZA 5J1GA 3KFWX 3AA1B 4GYSA 2J4GA 2KLQA 1D1BA 4O2AE 5EK4A 3RIFA 2RA1A 1SA0E 1W09A 1WLXA 2B76A 3NZPA 4AKGA 1IZNB 4N78D 3A5XA 5AQQB 4G63A 4AQYT 3E0ZA 4KI0F 3RKOA 4EEDA 5JR9B 4HFEA 5DABA 4BAYB 4DO0A 2OV9A 4DR4T 3AEFA 3FZLB 3N9NA 4NUVA 1B7TA 4ILUA 5L2LA 3ONJA 3JAFA 3JC6C 3PUZF 5HCMA 4U7YA 2D5UA 5JDQA 1VCSA 4IREA 2MAWA 3M65A 2BKNA 2J1DG 4ISSA 1X9BA 5ADXL 1FJGT 5ABGA 1HNWT 2X9XA 1N36T 2W00A 4B3TT 3ZLIA 4TNVA 4PK4A 3AE9A 4P1NA 2B1EA 2KINB 3CX8B 1IBLT 1D0XA 4X1KE 2CMRA 5J2UE 3P50A 5AQIB 3IA3A 4TN7B 2KNDA 3H37A 4ANJA 1HS7A 3HR0A 5KDMC 5FXWA 4DMVA 3C51A 2BZBA 2DL1A 2XAGB 5AQNB 2C5JA 3ZYLA 3J9X1 4ZEYA 4EIWA 4I50E 3PDYA 3KBUA 3U78A 2YDRA 4JEUB 5HXCA 3EHZA 5EK2A 4AXPA 3ETUA 3WI3A 3C50A 3JADA 1UX4A 3P4WA 2VL8A 2ACXA 3S4UA 2XAHB 5A1LA 2JMKA 5L3FB 3ZN1B 2W62A 3R84B 2BG9E 3O1IA 3RIUA 2A72A 3UQ4A 3N9PA 4UVAB 2V5DA 4LF8T 2C5IT 3N9MA 2AXDS 4BA9A 1HTJF 2LRKA 3CQXC 3UFEA 3VKGA 4CI2B 3CK6A 5HCJA 5LBMA 3A8YC 1OEDA 2CA5A 3K3QC 2BBJA 2CXDA 4UEMA 2CXFA 5H6QB 2KWIB 3B5MA 4HWIB 4QH1A 2N2NA 3EVYA 1HFAA 3T1YT 4Q25A 2HN1A 5LYJE 1T98A 4X64T 1UGOA 3LBXA 4DV5T 3TKLB 2BG9A 3FHNA 3P4SA 4CN6A 4AISA 5LGTB 2M6BA 2QA7A 4AKHA 2XQ3A 5LJNA 3ANWB 5JH7E 2BS4A 3LK42 2OLTA 2J47A 2LJLA 1BR4A 3J7Yq 3X1DA 2PJQA 3UT5E 4H9NC 5KMGP 1NWMX 2NWBA 4HWCA 5AFUL 2ES0A 2WU2A 1XMOT 1ZEEA 4F8HA 2X0YA 3EABA 2HPJA 2WMNA 1WYBA 3AEEA 4OK0A 3OTOT 1KK7A 5JDMA 3P4RA 2J62A 5HAXA 3RF1A 2XM2A 1XWMA 2K3WA 2WBLA 3HA4A 5HXEA 3E08A 5F3JA 2N1GA 4NUUA 5FVKA 3K3NA 3NBXX 5AQSB 2W67A 2XSAA 5CA0E 3O4XE 5AQGB 2V1DB 3KV6A 1D0ZA 1NEKA 4ZI2D 2BKOA 4ZS3A 3MK7C 4AQFC 4ZHQE 4YT0A 5LJMA 4AI6A 3BQKA 4DV1T 2NW9A 1IBKT 5ABHA 4H63V 3AE6A 2VQFT 3OJAA 1M62A 4U2YA 2EHOB 2W2UA 5JRCA 3P7IA 3L3PA 3FXDB 1FMWA 3NRXA 2BS2A 4PFPA 4JI3T 4O4IE 1NAFA 3L09A 2QYWA 4NPPA 1SE7A 1YQ4A 4KHPT 3LFMA 2Q9QA 2XQAA 3K1SA 3LK3B 4Z91A 5DQWA 3SFEA 1WYCA 3CQGB 4MHCA 5CB4E 3ZYMA 3HKDE 1MIWA 4DIDB 4P0AA 4MALA 3B13A 3O1JA 2JMHA 4EOZB 3LG7A 5LA6E 5LOVE 3E22E 3EDVA 3PJAA 2XTLA 4A97A 3A7MA 4G2AA 2H7VC 1BR0A 4JBWF 1US7B 2ZM2A 2KT9A 5E0OA 5L3EB 5CJ5A 2YU1A 4IIJE 4I4TE 3NVOA 4LF6T 4GIWA 4QXHB 3I1AA 2CXLA 4X1IE 3CQCB 2X9HA 3N2GE 3DP7A 3LJCA 4XBFB 3AAIA 2X67A 2LM2A 4IGUA 3B57A 4M1PA 2XUEA 4ZZCA 3C98B 2I6HA 3D0TA 3O9XA 4PK5A 4KBMB 1O3XA 5AQVB 3F57A 3AA7B 4L5GA 4ASKA 4DV0T 4LFBT 4E7SA 4JUYA 3SOLA 4EV6A 2CRBA 3TLVA 4FI5A 2EHOD 5L3GB 3Q5EA 1KFYA 4YSYA 4IE4A 5HWYA 2XZEA 3N9QA 1I6ZA 2VK9A 5EZYE 4U72A 4X5TA 1YKHB 3GN5B 3RQWA 2Y8DA 4HWDA 3QB5K 3F2EA 3VHLA 2L3LA 4WZXA 5C2TA 3QB5A 5LG4A 4DBRA 4COFA 3CX6B 4ZZBA 1N33T 2E9XA 5JDFA 1HCIA 1HNXT 3AECA 3ZMUB 5HYAA 3KINB 4BJMA 2L8KA 2Y6XA 5JDNA 2WY2A 3ZSSA 2VVSA 3ZC0A 2G0UA 2CLYB 4HGAA 3VR8A 5JR9C 3AAEB 1W9RA 2Z6EA 2JQKA 2XQYA 2V6XA 4HEAA 1YD8G 5AQJB 3P8CD 3UULA 4ILBA 4O4JE 2ZM8A 2X51A 3RRCA 5ETWA 2VB6A 1T8BA 3I9YA 1W0AA 1SUMB 5J2TE 1UUSA 1QUUA 1T7SA 2HN2A 4XZCA 4CXXA 1Y64B 2V6YA 2WDRA 4ADZA 3AE8A 4JI2T 3NRYA 3C4ZA 1OEDB 1HX1B 2CWOA 2W4XA 4EXTA 3VRAA 1VRBA 1WCRA 1ZHCA 2NOXA 3V5UA 2LEHA 2WQYA 4YLHA 3I0OA 4CQIA 4WBNE 4LF7T 2WB5A 3ZMSB 2HPLA 3WAJA 5IUXA 2MPKA 4CXWA 4JI7T 1R8IA 5FL1A 3ZSTA 4LF9T 3UUXB 4UV8B 5AQLB 4NXMT 1GQEA 3EI0A 4I55E 4HFCA 1E1HB 3LDQB 5F5WA 2CCQA 4OYJA 2LM9A 4C90A 2KZ7B 3WAKA 2C5KT 2LSGA 3AEDA 4X66T 3Q5DA 4DR1T 2F4VT 4K0UA 2XAFB 3FB2A 4I0UA 1D1AA 1YKEB 2VVNA 3SFDA 3FZKB 3ABVA 3VRBA 3IHRA 2XQ6A 2XAQB 2DHRA 5FKYA 4TV9E 4OFZA 4IL4A 2ZMAA 1MMDA 5FY7A 3MXZA 3HKEE 3TLWA 3AXJA 3ZJ2A 4ZI2C 2E5VA 5LHIB 1G8XA 1NENA 2CBIA 3FBZA 4EZHA 1XNRT 2CHNA 4UELA 3AEBA 2D9DA 4PJLA 2XSBA 2M6IA 3CX7B 3ONLC 3KV9A 2Y48B 4TV8E 3FZHB 4B6XA 3ZT6A 4EGWA 2DWKA 4IE7A 3FZFB 5ABFA 1KNRA 3CMLA 5CGMA 4TWDA 4AKRB 2LHNA 2IHR1 2M67A 1HG5A 2LSYA 2KXPB 1Z8UA 2V7IA 2CM0A 2H7OA 5J0ZA 5DJQC 2K24A 3AA0B 3ZMVB 3T8OA 3QOFA 2KSRA 4A98A 1D0YA 4LMKA 4ZI3D 1L0VA 2Q9QB 5JDHA 3MZKB 4UF0A 3ZT7A 2LT3A 1X79A 2XY8B 4UV9B 5JQGE 2C0SA 1HG2A 4B3ST 5M4YA 4TX5A 3KVAA 2X0LB 4QXCB 4IHJE 4EAHA 3RKGA 4DV6T 4Z8XA 1KNZA 2W61A 3AAAB 2HHHT 3OBVE 3NKZA 5FXXA 5AQKB 2YDSA 4OX9T 5FXZA 3UUNA 3UU4A 2DWGA 4MLKA 5AQMB 4UR9A 2IAKA 2PG8A 3V5SA 2W66A 3ZMZB 2A3DA 5FVLA 1YQ3A 3KDSE 3N5LA 4O2BE 2WU5A 3RHWA 4LFAT 1YXRA 5AQPB 3OKQA 4A56A 1N34T 1VCTA 2OA5A 2MYSA 3PU8A 2JQ9A 5LNKA 3C4XA 2EHOC 2WP9A 1FIOA 5LG3A 4X20E 2E2AA 1LKXA 4DV7T 2KWHA 2WMOA 4O4LE 1FMVA 4K0KT 5L4HA 5BMVE 5AQRB 2PBIA 4AKIA 5IYZE 3TLTA 1MIVA 2LOPA 5L3CB 2H88A 2JRKA 2RP4A 3AA6B 4PJNA 4TUYE 2Q9QD 4MFRA 2UXXB 2N9DA 4P09A 4ZS2A 1XNQT 1QSDA 2E9XB 2K48A 3N2KE 3RPUA 3AVRA 2H3RA 2X9YA 3IBPA 2FJDA
chains in the Genus database with same CATH topology
1T7SA 3LDQB 5AQMB 3FZKB 3A8YC 5AQNB 3FZHB 5AQRB 4HWHA 5AQQB 1UGOA 1M7KA 4HWDA 1M62A 4HWFA 5AQSB 5AQHB 3FZLB 3FZFB 5AQGB 3M3ZB 5AQJB 1HX1B 5AQTB 4HWIB 5AQIB 1UK5A 5AQLB 5AQPB 5AQFB 5AQUB 4HWCA 5AQKB 5AQOB 2D9DA 3FZMB 5AQVB 1I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7S A;  3LDQ B;  5AQM B;  3FZK B;  3A8Y C;  5AQN B;  3FZH B;  5AQR B;  4HWH A;  5AQQ B;  1UGO A;  1M7K A;  4HWD A;  1M62 A;  4HWF A;  5AQS B;  5AQH B;  3FZL B;  3FZF B;  5AQG B;  3M3Z B;  5AQJ B;  1HX1 B;  5AQT B;  4HWI B;  5AQI B;  1UK5 A;  5AQL B;  5AQP B;  5AQF B;  5AQU B;  4HWC A;  5AQK B;  5AQO B;  2D9D A;  3FZM B;  5AQV B;  1I6Z A; 
#chains in the Genus database with same CATH topology
 3F31 A;  4ILC A;  3HI2 A;  2VKO A;  2BKP A;  4IDZ A;  2XM1 A;  2GK9 A;  4H9Q C;  2JQH A;  4CN4 A;  2XPK A;  2LSJ A;  3RYH E;  4QH5 A;  2CWY A;  5HWX A;  1MMN A;  1Z0P A;  2V8S V;  2MOZ A;  4GYR A;  2D0T A;  3RC3 A;  2V7K A;  2VL0 A;  2BS3 A;  2A2F X;  5LBQ B;  2FJA A;  2H89 A;  1IJ5 A;  2V26 A;  2YK0 A;  1WR0 A;  4ZI7 E;  5FY0 A;  2LKH A;  3RX6 A;  4QHO A;  3MKD A;  2WWU A;  2V7L A;  3PUA A;  4EB6 E;  4YXD A;  5AQU B;  4DND A;  3T1H T;  4IL9 A;  3GWH A;  3CVR A;  2YEV C;  2JJ9 A;  3I0Q A;  5LCY A;  2YDQ A;  1H7C A;  4U7I A;  3H3A A;  3JAE A;  4ZXL A;  4LF5 T;  2P9B A;  2X66 A;  3BQL A;  1ZOY A;  4YTN A;  5CFB A;  5FMN A;  2A9U A;  1KF6 A;  1MIY A;  4WBO A;  4KP3 C;  2FJE A;  4YTM A;  3AB3 B;  3GA8 A;  5FY1 A;  3VR9 A;  3ANW A;  2XAJ B;  4CZZ B;  1V9D A;  2DI4 A;  5AQF B;  2XQ7 A;  2XHE B;  2LOS A;  4EZ4 A;  4LML A;  4UIG A;  3UTK A;  2X0H A;  5EK3 A;  4E7Z A;  3PUX F;  3ZJ1 A;  2VQE T;  3UU8 A;  3UU6 A;  1QLB A;  1U5P A;  2E8I A;  2E9X D;  3H3M A;  3CPZ A;  1J1J A;  4TNW A;  5H6R B;  3SRZ A;  4TWH A;  4HFD A;  2CLY C;  1XMQ T;  4U74 A;  3IF8 B;  5GON E;  1WR6 A;  2ODU A;  4JI0 T;  1UUR A;  2V5C A;  3UFG A;  2IUB A;  5AQH B;  1S94 A;  3G06 A;  4JYA T;  3HL6 A;  3PUS A;  2I59 A;  5FXV A;  3ZPO A;  2NR4 A;  3AE5 A;  4JI5 T;  5FNV E;  1XDP A;  3RRW A;  4JEH B;  1T72 A;  1LVK A;  2MBG A;  4TWF A;  4ERR A;  1OED C;  3OYZ A;  4CXY A;  3RYC E;  5LHH B;  3RI5 A;  1FEW A;  4LFC T;  2CBJ A;  5HXS A;  2LE8 A;  2LKG A;  3QC9 A;  1J5W A;  2DLR A;  2UUC T;  4ZI3 C;  2JIW A;  2RPA A;  1LVF A;  2QVA A;  4DR3 T;  3VU7 H;  3ZC1 A;  3AE7 A;  4IE6 A;  5AQT B;  2DNX A;  4V1A v;  1MND A;  4HTE A;  5L4E A;  4DR2 T;  1OWA A;  5LP6 E;  4GK0 E;  4UF0 B;  5FP3 A;  4AQF A;  2LHR A;  4TZ4 C;  3CWZ B;  2ZM0 A;  1Y01 A;  4YJ2 E;  1N32 T;  3DTO A;  3RIA A;  3KVB A;  3AE4 A;  5L3D B;  3N9O A;  2XAS B;  4YJ3 E;  3FXE B;  2JQQ A;  1HF8 A;  3LBX B;  2VAS A;  3AE2 A;  5ABE A;  2BG9 B;  2BDE A;  3SWH A;  1LRZ A;  4J2C A;  4HFB A;  4DV4 T;  1OXZ A;  3PTR B;  4H9O C;  5FL0 A;  4EEB A;  1E7P A;  2LRL A;  3RH3 A;  5FYM A;  4Z90 A;  1UX5 A;  2FUP A;  3ZEF B;  2NTX A;  2ACZ A;  4DUY T;  5JVD E;  2DCF A;  2X68 A;  3KV4 A;  4IDP A;  2UU9 T;  1JNR A;  2CE7 A;  4DV2 T;  3QK6 A;  5C8Y E;  2HH7 A;  4DV3 T;  3IEE A;  2PFV A;  2NW7 A;  1BR1 A;  4QKN A;  2UXC T;  3KV5 A;  3U3I A;  5LHG B;  2PTF A;  3LK2 B;  2UUB T;  3UUB A;  1MMG A;  2IIU A;  2Q9Q C;  1HR0 T;  2IC9 A;  3RGL A;  3CKD A;  3Q5W A;  3GN5 A;  1WRD A;  4DR7 T;  2IW5 B;  3EAM A;  5LMU T;  5HEU A;  2YU2 A;  2WSS V;  1OED E;  4JI6 T;  2UXD T;  3FBL A;  5HXR A;  5JTG A;  2VKH A;  1IBM T;  4YTP A;  4UVB B;  2MTQ A;  2WZI A;  2VKD A;  4YHH T;  3ONX A;  5JRC B;  4MBQ A;  4GKK T;  4PJM A;  3PE0 A;  4NXN T;  4X65 T;  2UXB T;  3UU5 A;  3L8R A;  3HKC E;  4JI4 T;  3I9W A;  4U31 A;  4UXN B;  3RC8 A;  5LGN B;  3L39 A;  3AVS A;  3ESL A;  3DJB A;  3PJA J;  5HEH A;  4YSX A;  1AJ3 A;  2X9W A;  3ZKR A;  3NZQ A;  1M7K A;  1G73 A;  4JV5 T;  1YW0 A;  4YY3 T;  3PUG A;  3ETV A;  3MAC A;  4DMW A;  2KMF A;  5IHY A;  3ZYK A;  2LLY A;  4PW8 A;  4H9R C;  3RLF F;  4YSZ A;  3VKH A;  3N9L A;  3RYI E;  4PJJ A;  2YKS A;  1UCU A;  4QH4 A;  2UXN B;  3SS1 A;  2CPT A;  3MA9 A;  2NTY A;  4C91 A;  4DR6 T;  4IE0 A;  1E2A A;  1KEY A;  5AQO B;  2W0G A;  1MNE A;  4WNK A;  5JR9 A;  4KX6 A;  2XQ4 A;  3ZN0 B;  5HEO A;  4CI3 B;  2V7J A;  5JDL A;  4HFH A;  4KMC A;  4DR5 T;  2K5B B;  4F6R C;  3JCF A;  2VUR A;  3JC6 D;  2E9X C;  5KXJ A;  4YFS A;  1JNZ A;  2D0U A;  5HXH A;  1VOM A;  3UUM A;  1I94 T;  2WM9 A;  2WDQ A;  3P4P A;  3QUJ A;  3AEG A;  1IAP A;  3PV0 F;  2UUA T;  2YN6 A;  4GOU A;  4BJN A;  1J5E T;  5HEJ A;  1ZV4 X;  1WFD A;  1BR2 A;  4AKL A;  4B3R T;  1U4Q A;  5LMN T;  4UVC B;  4H9P C;  4IDO A;  3BK9 A;  3PUV F;  5L3B B;  4FJO A;  4ZOL E;  5JRE A;  2E5L T;  2BVM A;  4O8S A;  5C3J A;  3W15 B;  4L0R A;  3UQ7 A;  2BVL A;  4U33 A;  2QGS A;  3OYX A;  4IST A;  1DU2 A;  4DBQ A;  4JI1 T;  2L9Q A;  3TLU A;  4PAG A;  3PUY F;  4PFO A;  5L47 A;  4QXB B;  4P0B A;  2QRX A;  1HX8 A;  4HWH A;  4GKJ T;  3RQU A;  3BQI A;  1KNP A;  2LSK A;  3RYF E;  1MMA A;  3OPC A;  4CI1 B;  2W63 A;  4PNI A;  2YOE A;  5CA1 E;  2WCA A;  3PUR A;  2XQ5 A;  4H63 H;  2V6Y B;  3PUQ A;  1S35 A;  4EYY R;  3UU3 A;  4WW0 A;  2WAU A;  2WDV A;  4CN1 A;  4DUZ T;  3OVU A;  4EYU A;  1W0B A;  5TAO A;  4A5X A;  4XAX B;  4HWF A;  4QWN B;  4I43 B;  3QNU A;  3KBT A;  2IC6 A;  1HNZ T;  4U3C A;  3GMI A;  4IDQ A;  2CHO A;  4X62 T;  2XJ7 A;  2FJB A;  4L9I A;  2ODV A;  4YHJ A;  2D2S A;  2VKJ A;  2CEA A;  3P4Q A;  2V7M A;  3AE1 A;  4X1Y E;  2XQ9 A;  4H9S E;  3R6N A;  3AEA A;  3M3Z B;  1XDO A;  1UK5 A;  5DQV A;  3N2O A;  1ZP0 A;  4OHF A;  4QX7 B;  4ILA A;  2ZLY A;  4QX8 B;  4LF4 T;  2YIN A;  4LMJ A;  5JDG A;  4GK5 E;  4HN9 A;  4AQG A;  2LSI A;  3ZT5 A;  3Q5X A;  1ZKE A;  4HFI A;  4HKA A;  4JLE A;  3EDU A;  1SHZ C;  4JI8 T;  5KX5 E;  4HE8 A;  2SPC A;  3RIU C;  4B3M T;  2WWV A;  2ZM6 T;  3C4W A;  3PU3 A;  3LSV A;  3AXJ B;  5F8P A;  3K8P C;  2NP9 A;  3CIR A;  4KHZ F;  3Q2M A;  3Q9D A;  2K9A A;  4IDN A;  4NIQ A;  4WYV A;  2R6G F;  2IML A;  4PK6 A;  5HEG A;  2XQ8 A;  3PUW F;  2BBH A;  5LXT E;  2I0M A;  1IJ6 A;  5ABF B;  2WS3 A;  3TLS A;  1CUN A;  4DVD A;  5LGU B;  2EHO A;  3ZCJ A;  3AE3 A;  2IDO B;  3HKB E;  3EUH A;  1D1C A;  4IT4 A;  4OYK A;  2BG9 C;  3O1H A;  2FBW A;  1XZY A;  4HFV A;  2VWA A;  2JPF A;  3MJX A;  4AIU A;  5IWA T;  4IE5 A;  1CHU A;  2AE9 A;  3ZCI A;  3C64 A;  3FZM B;  2NW8 A;  3NWI A;  5LB7 B;  3K3O A;  4KUM B;  3ZMT B;  5BR8 T;  2WZH A;  1EZ3 A;  4O4H E;  4U2Z A;  5J1G A;  3KFW X;  3AA1 B;  4GYS A;  2J4G A;  2KLQ A;  1D1B A;  4O2A E;  5EK4 A;  3RIF A;  2RA1 A;  1SA0 E;  1W09 A;  1WLX A;  2B76 A;  3NZP A;  4AKG A;  1IZN B;  4N78 D;  3A5X A;  5AQQ B;  4G63 A;  4AQY T;  3E0Z A;  4KI0 F;  3RKO A;  4EED A;  5JR9 B;  4HFE A;  5DAB A;  4BAY B;  4DO0 A;  2OV9 A;  4DR4 T;  3AEF A;  3FZL B;  3N9N A;  4NUV A;  1B7T A;  4ILU A;  5L2L A;  3ONJ A;  3JAF A;  3JC6 C;  3PUZ F;  5HCM A;  4U7Y A;  2D5U A;  5JDQ A;  1VCS A;  4IRE A;  2MAW A;  3M65 A;  2BKN A;  2J1D G;  4ISS A;  1X9B A;  5ADX L;  1FJG T;  5ABG A;  1HNW T;  2X9X A;  1N36 T;  2W00 A;  4B3T T;  3ZLI A;  4TNV A;  4PK4 A;  3AE9 A;  4P1N A;  2B1E A;  2KIN B;  3CX8 B;  1IBL T;  1D0X A;  4X1K E;  2CMR A;  5J2U E;  3P50 A;  5AQI B;  3IA3 A;  4TN7 B;  2KND A;  3H37 A;  4ANJ A;  1HS7 A;  3HR0 A;  5KDM C;  5FXW A;  4DMV A;  3C51 A;  2BZB A;  2DL1 A;  2XAG B;  5AQN B;  2C5J A;  3ZYL A;  3J9X 1;  4ZEY A;  4EIW A;  4I50 E;  3PDY A;  3KBU A;  3U78 A;  2YDR A;  4JEU B;  5HXC A;  3EHZ A;  5EK2 A;  4AXP A;  3ETU A;  3WI3 A;  3C50 A;  3JAD A;  1UX4 A;  3P4W A;  2VL8 A;  2ACX A;  3S4U A;  2XAH B;  5A1L A;  2JMK A;  5L3F B;  3ZN1 B;  2W62 A;  3R84 B;  2BG9 E;  3O1I A;  3RIU A;  2A72 A;  3UQ4 A;  3N9P A;  4UVA B;  2V5D A;  4LF8 T;  2C5I T;  3N9M A;  2AXD S;  4BA9 A;  1HTJ F;  2LRK A;  3CQX C;  3UFE A;  3VKG A;  4CI2 B;  3CK6 A;  5HCJ A;  5LBM A;  3A8Y C;  1OED A;  2CA5 A;  3K3Q C;  2BBJ A;  2CXD A;  4UEM A;  2CXF A;  5H6Q B;  2KWI B;  3B5M A;  4HWI B;  4QH1 A;  2N2N A;  3EVY A;  1HFA A;  3T1Y T;  4Q25 A;  2HN1 A;  5LYJ E;  1T98 A;  4X64 T;  1UGO A;  3LBX A;  4DV5 T;  3TKL B;  2BG9 A;  3FHN A;  3P4S A;  4CN6 A;  4AIS A;  5LGT B;  2M6B A;  2QA7 A;  4AKH A;  2XQ3 A;  5LJN A;  3ANW B;  5JH7 E;  2BS4 A;  3LK4 2;  2OLT A;  2J47 A;  2LJL A;  1BR4 A;  3J7Y q;  3X1D A;  2PJQ A;  3UT5 E;  4H9N C;  5KMG P;  1NWM X;  2NWB A;  4HWC A;  5AFU L;  2ES0 A;  2WU2 A;  1XMO T;  1ZEE A;  4F8H A;  2X0Y A;  3EAB A;  2HPJ A;  2WMN A;  1WYB A;  3AEE A;  4OK0 A;  3OTO T;  1KK7 A;  5JDM A;  3P4R A;  2J62 A;  5HAX A;  3RF1 A;  2XM2 A;  1XWM A;  2K3W A;  2WBL A;  3HA4 A;  5HXE A;  3E08 A;  5F3J A;  2N1G A;  4NUU A;  5FVK A;  3K3N A;  3NBX X;  5AQS B;  2W67 A;  2XSA A;  5CA0 E;  3O4X E;  5AQG B;  2V1D B;  3KV6 A;  1D0Z A;  1NEK A;  4ZI2 D;  2BKO A;  4ZS3 A;  3MK7 C;  4AQF C;  4ZHQ E;  4YT0 A;  5LJM A;  4AI6 A;  3BQK A;  4DV1 T;  2NW9 A;  1IBK T;  5ABH A;  4H63 V;  3AE6 A;  2VQF T;  3OJA A;  1M62 A;  4U2Y A;  2EHO B;  2W2U A;  5JRC A;  3P7I A;  3L3P A;  3FXD B;  1FMW A;  3NRX A;  2BS2 A;  4PFP A;  4JI3 T;  4O4I E;  1NAF A;  3L09 A;  2QYW A;  4NPP A;  1SE7 A;  1YQ4 A;  4KHP T;  3LFM A;  2Q9Q A;  2XQA A;  3K1S A;  3LK3 B;  4Z91 A;  5DQW A;  3SFE A;  1WYC A;  3CQG B;  4MHC A;  5CB4 E;  3ZYM A;  3HKD E;  1MIW A;  4DID B;  4P0A A;  4MAL A;  3B13 A;  3O1J A;  2JMH A;  4EOZ B;  3LG7 A;  5LA6 E;  5LOV E;  3E22 E;  3EDV A;  3PJA A;  2XTL A;  4A97 A;  3A7M A;  4G2A A;  2H7V C;  1BR0 A;  4JBW F;  1US7 B;  2ZM2 A;  2KT9 A;  5E0O A;  5L3E B;  5CJ5 A;  2YU1 A;  4IIJ E;  4I4T E;  3NVO A;  4LF6 T;  4GIW A;  4QXH B;  3I1A A;  2CXL A;  4X1I E;  3CQC B;  2X9H A;  3N2G E;  3DP7 A;  3LJC A;  4XBF B;  3AAI A;  2X67 A;  2LM2 A;  4IGU A;  3B57 A;  4M1P A;  2XUE A;  4ZZC A;  3C98 B;  2I6H A;  3D0T A;  3O9X A;  4PK5 A;  4KBM B;  1O3X A;  5AQV B;  3F57 A;  3AA7 B;  4L5G A;  4ASK A;  4DV0 T;  4LFB T;  4E7S A;  4JUY A;  3SOL A;  4EV6 A;  2CRB A;  3TLV A;  4FI5 A;  2EHO D;  5L3G B;  3Q5E A;  1KFY A;  4YSY A;  4IE4 A;  5HWY A;  2XZE A;  3N9Q A;  1I6Z A;  2VK9 A;  5EZY E;  4U72 A;  4X5T A;  1YKH B;  3GN5 B;  3RQW A;  2Y8D A;  4HWD A;  3QB5 K;  3F2E A;  3VHL A;  2L3L A;  4WZX A;  5C2T A;  3QB5 A;  5LG4 A;  4DBR A;  4COF A;  3CX6 B;  4ZZB A;  1N33 T;  2E9X A;  5JDF A;  1HCI A;  1HNX T;  3AEC A;  3ZMU B;  5HYA A;  3KIN B;  4BJM A;  2L8K A;  2Y6X A;  5JDN A;  2WY2 A;  3ZSS A;  2VVS A;  3ZC0 A;  2G0U A;  2CLY B;  4HGA A;  3VR8 A;  5JR9 C;  3AAE B;  1W9R A;  2Z6E A;  2JQK A;  2XQY A;  2V6X A;  4HEA A;  1YD8 G;  5AQJ B;  3P8C D;  3UUL A;  4ILB A;  4O4J E;  2ZM8 A;  2X51 A;  3RRC A;  5ETW A;  2VB6 A;  1T8B A;  3I9Y A;  1W0A A;  1SUM B;  5J2T E;  1UUS A;  1QUU A;  1T7S A;  2HN2 A;  4XZC A;  4CXX A;  1Y64 B;  2V6Y A;  2WDR A;  4ADZ A;  3AE8 A;  4JI2 T;  3NRY A;  3C4Z A;  1OED B;  1HX1 B;  2CWO A;  2W4X A;  4EXT A;  3VRA A;  1VRB A;  1WCR A;  1ZHC A;  2NOX A;  3V5U A;  2LEH A;  2WQY A;  4YLH A;  3I0O A;  4CQI A;  4WBN E;  4LF7 T;  2WB5 A;  3ZMS B;  2HPL A;  3WAJ A;  5IUX A;  2MPK A;  4CXW A;  4JI7 T;  1R8I A;  5FL1 A;  3ZST A;  4LF9 T;  3UUX B;  4UV8 B;  5AQL B;  4NXM T;  1GQE A;  3EI0 A;  4I55 E;  4HFC A;  1E1H B;  3LDQ B;  5F5W A;  2CCQ A;  4OYJ A;  2LM9 A;  4C90 A;  2KZ7 B;  3WAK A;  2C5K T;  2LSG A;  3AED A;  4X66 T;  3Q5D A;  4DR1 T;  2F4V T;  4K0U A;  2XAF B;  3FB2 A;  4I0U A;  1D1A A;  1YKE B;  2VVN A;  3SFD A;  3FZK B;  3ABV A;  3VRB A;  3IHR A;  2XQ6 A;  2XAQ B;  2DHR A;  5FKY A;  4TV9 E;  4OFZ A;  4IL4 A;  2ZMA A;  1MMD A;  5FY7 A;  3MXZ A;  3HKE E;  3TLW A;  3AXJ A;  3ZJ2 A;  4ZI2 C;  2E5V A;  5LHI B;  1G8X A;  1NEN A;  2CBI A;  3FBZ A;  4EZH A;  1XNR T;  2CHN A;  4UEL A;  3AEB A;  2D9D A;  4PJL A;  2XSB A;  2M6I A;  3CX7 B;  3ONL C;  3KV9 A;  2Y48 B;  4TV8 E;  3FZH B;  4B6X A;  3ZT6 A;  4EGW A;  2DWK A;  4IE7 A;  3FZF B;  5ABF A;  1KNR A;  3CML A;  5CGM A;  4TWD A;  4AKR B;  2LHN A;  2IHR 1;  2M67 A;  1HG5 A;  2LSY A;  2KXP B;  1Z8U A;  2V7I A;  2CM0 A;  2H7O A;  5J0Z A;  5DJQ C;  2K24 A;  3AA0 B;  3ZMV B;  3T8O A;  3QOF A;  2KSR A;  4A98 A;  1D0Y A;  4LMK A;  4ZI3 D;  1L0V A;  2Q9Q B;  5JDH A;  3MZK B;  4UF0 A;  3ZT7 A;  2LT3 A;  1X79 A;  2XY8 B;  4UV9 B;  5JQG E;  2C0S A;  1HG2 A;  4B3S T;  5M4Y A;  4TX5 A;  3KVA A;  2X0L B;  4QXC B;  4IHJ E;  4EAH A;  3RKG A;  4DV6 T;  4Z8X A;  1KNZ A;  2W61 A;  3AAA B;  2HHH T;  3OBV E;  3NKZ A;  5FXX A;  5AQK B;  2YDS A;  4OX9 T;  5FXZ A;  3UUN A;  3UU4 A;  2DWG A;  4MLK A;  5AQM B;  4UR9 A;  2IAK A;  2PG8 A;  3V5S A;  2W66 A;  3ZMZ B;  2A3D A;  5FVL A;  1YQ3 A;  3KDS E;  3N5L A;  4O2B E;  2WU5 A;  3RHW A;  4LFA T;  1YXR A;  5AQP B;  3OKQ A;  4A56 A;  1N34 T;  1VCT A;  2OA5 A;  2MYS A;  3PU8 A;  2JQ9 A;  5LNK A;  3C4X A;  2EHO C;  2WP9 A;  1FIO A;  5LG3 A;  4X20 E;  2E2A A;  1LKX A;  4DV7 T;  2KWH A;  2WMO A;  4O4L E;  1FMV A;  4K0K T;  5L4H A;  5BMV E;  5AQR B;  2PBI A;  4AKI A;  5IYZ E;  3TLT A;  1MIV A;  2LOP A;  5L3C B;  2H88 A;  2JRK A;  2RP4 A;  3AA6 B;  4PJN A;  4TUY E;  2Q9Q D;  4MFR A;  2UXX B;  2N9D A;  4P09 A;  4ZS2 A;  1XNQ T;  1QSD A;  2E9X B;  2K48 A;  3N2K E;  3RPU A;  3AVR A;  2H3R A;  2X9Y A;  3IBP A;  2FJD A; 
#chains in the Genus database with same CATH homology
 1T7S A;  3LDQ B;  5AQM B;  3FZK B;  3A8Y C;  5AQN B;  3FZH B;  5AQR B;  4HWH A;  5AQQ B;  1UGO A;  1M7K A;  4HWD A;  1M62 A;  4HWF A;  5AQS B;  5AQH B;  3FZL B;  3FZF B;  5AQG B;  3M3Z B;  5AQJ B;  1HX1 B;  5AQT B;  4HWI B;  5AQI B;  1UK5 A;  5AQL B;  5AQP B;  5AQF B;  5AQU B;  4HWC A;  5AQK B;  5AQO B;  2D9D A;  3FZM B;  5AQV B;  1I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...