5AQKB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqkB00
4HWDA 5AQKB 3FZKB 1UGOA 1HX1B 5AQMB 4HWFA 5AQFB 5AQOB 3FZLB 3FZFB 3FZHB 3M3ZB 5AQRB 5AQLB 2D9DA 5AQJB 5AQHB 5AQQB 1M62A 5AQNB 1T7SA 5AQUB 3A8YC 5AQTB 1M7KA 3LDQB 1UK5A 4HWCA 5AQSB 5AQVB 1I6ZA 5AQPB 5AQIB 3FZMB 5AQGB 4HWIB 4HWHA
chains in the Genus database with same CATH superfamily
2Y6XA 2CXDA 4QWNB 4EOZB 2LRLA 3IF8B 1CHUA 4CI2B 4KHPT 3LDQB 3MA9A 1WRDA 2PTFA 4JI7T 2GK9A 3LFMA 1LKXA 3AE4A 4CQIA 2KXPB 3TLUA 2A3DA 1FMWA 3RX6A 2VB6A 3SRZA 1IZNB 3J9X1 2CA5A 4TZ4C 4CN6A 4UVBB 1UCUA 2K5BB 3ZYMA 2XAJB 4PNIA 2C5JA 4X5TA 2H3RA 1N34T 5HEHA 3PUGA 2KINB 1WYBA 3AEAA 3C98B 5JTGA 1HX8A 3AVRA 4YXDA 2IIUA 4A56A 2E9XA 1KNPA 1OEDE 4G63A 2DNXA 4AKGA 2V6XA 4DMVA 3AE1A 4LF5T 4DO0A 2V7JA 4O4HE 4WYVA 2UUAT 1R8IA 4XAXB 3BQIA 2XM2A 4E7SA 4TWFA 1O3XA 3P4RA 5LHHB 3RH3A 5LHGB 4O2BE 1WR6A 5J0ZA 3RYFE 3ZPOA 4FI5A 2JPFA 2RA1A 4QH1A 4A98A 4EXTA 2B1EA 2L8KA 3DP7A 2UU9T 4AQFC 2N2NA 4TV9E 4X1YE 1Y01A 3BQKA 4HFHA 3UQ7A 5L4HA 3L3PA 2LSIA 3TLTA 1V9DA 2CEAA 2PBIA 4P0AA 5AQSB 4AISA 3ZCJA 4U74A 1LRZA 2NW7A 4IDZA 5HXHA 2W61A 3EHZA 1T8BA 1BR1A 1VRBA 4KUMB 4JI3T 4YJ2E 1IBMT 1US7B 3UFEA 3UT5E 4IDQA 4P09A 2XQ7A 5LXTE 2WZIA 2BVLA 3HR0A 2IC9A 2AE9A 1MNDA 2UXXB 4IIJE 4NUVA 4CI1B 2CM0A 4H9RC 2ES0A 3N2GE 4U33A 5FY0A 3AB3B 4TWDA 4CN1A 3U3IA 3HA4A 3C4WA 3ONJA 4JEHB 2WB5A 3KFWX 3RIAA 1AJ3A 4H9PC 5A1LA 2FJAA 2W62A 3IA3A 3PUVF 3UULA 2V7LA 1IBLT 2NOXA 4O8SA 1IJ6A 1QLBA 2LLYA 4OHFA 2WCAA 4LF6T 5AQPB 1HFAA 3KBUA 2VVNA 3FZMB 4HWHA 2XQAA 3O4XE 3GMIA 2VKDA 2UXNB 5KX5E 4PJMA 3KV5A 3GN5B 5FL1A 4NXMT 4AKIA 2YKSA 5AQIB 1Z8UA 2VASA 3UUMA 2DLRA 5LMNT 3KVBA 5ABGA 5M4YA 2X68A 3TLWA 3MACA 3PJAA 2LT3A 3P4WA 4LMJA 1HCIA 3Q5DA 4YTNA 3IHRA 3K1SA 2B76A 4EEBA 2KWIB 4AIUA 4UXNB 2XQ4A 4Z91A 2MTQA 3AXJA 3Q5XA 3B13A 4YFSA 3AE7A 5E0OA 2V1DB 5LP6E 2XQ6A 1FJGT 3AAAB 4A5XA 1Z0PA 4GYRA 5JRCB 4GK0E 2X9YA 3CK6A 4LF4T 4V1Av 2VWAA 4GOUA 4UIGA 3C50A 2IAKA 3P4PA 4ZI3D 3ONXA 3RQUA 3ZYKA 2YEVC 4GIWA 4JYAT 1IJ5A 3FBLA 1SE7A 4EEDA 2NWBA 3HI2A 4ZI2D 4DV4T 4DUYT 2WMOA 5HWYA 3NVOA 1NWMX 3NZQA 5JDQA 3RQWA 2EHOB 2L3LA 3EI0A 4QX8B 1MIVA 2FJBA 3CIRA 3V5UA 3ESLA 2BBHA 3FHNA 3RRCA 2WDVA 3WAKA 3VR8A 2K24A 1MIWA 2ODVA 2C5KT 4I55E 1T7SA 4IDNA 5AQUB 5AQVB 4YY3T 1YKEB 2ODUA 2XASB 3F31A 1HS7A 4YJ3E 1D0XA 4IL9A 4DR5T 2P9BA 2YINA 4AKHA 4HKAA 4GYSA 2JQ9A 2VKHA 2CCQA 3LK3B 4UELA 1LVKA 3RKGA 4ZS2A 4TWHA 5EK2A 1D0ZA 4HEAA 4HWIB 3FZKB 4YTPA 3C51A 4B3RT 2IHR1 1YD8G 2V5DA 1W0BA 2R6GF 2E8IA 2WM9A 4E7ZA 3RIFA 5DQWA 1I6ZA 1HG5A 1IAPA 4ZXLA 4HFDA 1X9BA 3QNUA 4CXWA 1XZYA 2HN1A 2IDOB 3LK42 4TN7B 3RRWA 2M67A 5LGNB 3UU4A 1KNZA 4KX6A 1E1HB 4WW0A 5LCYA 5H6QB 3CQGB 3ZJ2A 2RPAA 3I0QA 5AQKB 4ZI3C 4LF7T 4BJMA 2WP9A 4HE8A 4GKKT 3KINB 2CBJA 2BG9A 5IHYA 3PE0A 3KVAA 5CJ5A 4ZI2C 3NWIA 5HEJA 3AEFA 2XPKA 2BBJA 3ZC1A 4C90A 1SHZC 4ILBA 3UTKA 4ADZA 1ZOYA 3LBXB 5HXCA 5AQRB 1XMQT 1MMNA 2NTYA 2CXFA 5HEUA 4AKRB 4DR2T 3ANWA 3RC3A 4DR4T 2JMKA 2N9DA 5FY7A 5LJNA 2QVAA 5ABFA 4AQYT 4UR9A 3MKDA 2CMRA 1B7TA 3ETVA 1KNRA 3ONLC 5L3EB 3N2KE 2MOZA 2YDSA 4PW8A 1D1BA 2C0SA 3UQ4A 2WWUA 4OFZA 1UUSA 5JR9B 5BR8T 3AVSA 3AA0B 1U5PA 5AQHB 5J2UE 2UXBT 4TNVA 3BK9A 4QH4A 2PFVA 3EVYA 1HNZT 4U31A 4PFOA 5CB4E 4F8HA 4TX5A 3KBTA 4PK4A 2J47A 1QSDA 4U2ZA 1I94T 1SUMB 5CFBA 5IUXA 1S94A 4YHJA 3S4UA 2V6YB 4P1NA 4AQFA 4DVDA 2K9AA 3P8CD 2D2SA 2VQET 4DR6T 4H63V 2ZLYA 3WAJA 2JQKA 2UUCT 4JV5T 4ZI7E 2Y8DA 2YN6A 4UV8B 4EZHA 3E08A 3NZPA 2BVMA 1E2AA 4HWCA 4O4LE 5JR9C 3I0OA 2X0HA 2ZM2A 4Z90A 1HX1B 4QHOA 5IWAT 1XMOT 2WSSV 1IBKT 3F57A 2LOPA 4IL4A 4WZXA 2W0GA 1KF6A 2IMLA 1MIYA 5LMUT 4IDPA 3CQCB 3PU8A 2XQ5A 2FUPA 4JI2T 5ETWA 1OXZA 5ABEA 5JDLA 3CQXC 2YK0A 3QB5K 4ILCA 3K3OA 2JIWA 4H63H 4IDOA 5LOVE 2YDRA 2X67A 2XZEA 2ZM0A 3K8PC 1YKHB 4LFCT 3PU3A 4O4IE 3ZT6A 1N36T 3R84B 4EGWA 5AQQB 2E5VA 2LOSA 3SFEA 3RYIE 2H89A 4ZZCA 3CKDA 3WI3A 4IE7A 2V26A 2X9WA 4YTMA 4JI5T 2CXLA 5FL0A 1G73A 3FXEB 1W9RA 4HFCA 2D0TA 5HEOA 4HWFA 1FEWA 3QB5A 3AECA 4NXNT 3J7Yq 2CBIA 2XQ9A 4B6XA 2IW5B 1BR4A 4ILAA 3MXZA 2A9UA 2Z6EA 3ZSTA 2QYWA 4OK0A 2NP9A 3AE8A 4IE0A 4DV7T 2XJ7A 3CX8B 2DHRA 2XSAA 3HKBE 4ZS3A 4Z8XA 3UUNA 3GWHA 1S35A 2V7IA 4DR1T 3NRYA 3RLFF 4NPPA 3O9XA 4U2YA 4JI4T 1BR2A 1VCTA 3H3AA 3ZMTB 2QGSA 4COFA 1T98A 5L3DB 3GN5A 1E7PA 3OBVE 5FXZA 4U72A 3JCFA 1QUUA 3FZHB 2KMFA 3JAEA 2X0LB 2LSGA 4O2AE 3VR9A 4DV6T 2X9HA 2UUBT 3JC6D 5DJQC 4WBOA 3OJAA 2K48A 3ZMZB 5LNKA 2BS4A 3RC8A 5CA0E 4LFBT 5JRCA 4DR3T 4PAGA 2YU1A 3L09A 3QUJA 3EDVA 1CUNA 3F2EA 2WMNA 1ZHCA 4KHZF 5AQMB 2JJ9A 3SS1A 3X1DA 5JVDE 2J62A 4H9SE 1Y64B 2OA5A 3RPUA 2ACXA 1UK5A 2AXDS 2BKNA 5CGMA 2EHOA 2WY2A 5F8PA 1YXRA 4OYKA 3Q5EA 2D0UA 3PUWF 3UFGA 2WQYA 3K3QC 2KLQA 3PUZF 2XY8B 3DJBA 5FMNA 5HXSA 4LF8T 5AQNB 2A2FX 3A8YC 3I9YA 3AEDA 2VKJA 4K0KT 2WWVA 3B57A 4HGAA 1JNZA 3SFDA 2LSYA 4UF0B 3UUBA 2JQHA 1WR0A 2CHNA 4QXCB 1XWMA 3TKLB 3MJXA 3QOFA 2H7OA 1HNXT 3LG7A 2WU5A 2FJEA 3NRXA 5C8YE 4AI6A 3Q5WA 5LG4A 1OEDA 2IUBA 2V7KA 2CWOA 2CLYB 3ZMSB 4YSYA 3ZSSA 4A97A 1W0AA 3RYHE 4DNDA 5AQFB 5LGTB 2M6BA 2MBGA 3JC6C 4ZEYA 5C3JA 3AA6B 5AQJB 2DWKA 4CZZB 2H7VC 4OYJA 1YW0A 5IYZE 3D0TA 5FVKA 2PG8A 4DBQA 4L0RA 4L5GA 2WU2A 3G06A 4HWDA 5FY1A 5DQVA 4PJJA 2WS3A 2XSBA 4DV1T 5EK3A 3V5SA 4AKLA 2CPTA 4DV0T 5GONE 2IC6A 4PFPA 2XHEB 3O1IA 4B3TT 1T72A 4EZ4A 2WAUA 1KFYA 4MFRA 3R6NA 3PUSA 4XBFB 2NW9A 2CLYC 4UVAB 3LBXA 3UU3A 2D9DA 1HNWT 4PJNA 3OTOT 2XAGB 1YQ3A 3P4QA 3E22E 3AA1B 5AFUL 4ANJA 3AE9A 4IE5A 4L9IA 3RF1A 4BAYB 2QA7A 2QRXA 2ZMAA 1JNRA 3IBPA 2XUEA 3I1AA 2KSRA 3C4XA 3T8OA 1ZKEA 4B3ST 4TNWA 4YSXA 3ZC0A 2HPJA 1WCRA 2Q9QD 4YSZA 3GA8A 2C5IT 1KEYA 3PUAA 4XZCA 3JADA 3M65A 4ZOLE 4DV5T 3C64A 5JREA 4MHCA 2YU2A 3RIUC 4HFEA 2W2UA 5L3FB 1N32T 1HF8A 1NENA 3HKEE 2CHOA 3ZMVB 2VL8A 2V6YA 2J4GA 2X66A 2MYSA 3PUYF 3P50A 2FJDA 4DV3T 4CN4A 1LVFA 1UX5A 2CE7A 3AE2A 3ZLIA 5DABA 4TV8E 3Q2MA 3CMLA 5FYMA 5F3JA 1GQEA 2VK9A 2LKGA 2Q9QB 2E2AA 2KZ7B 4I50E 2XM1A 2XAFB 2XAHB 3ZJ1A 1UX4A 4JI8T 1FIOA 4ILUA 5J1GA 2X9XA 5AQOB 3VRAA 3EDUA 2WZHA 4EB6E 2I0MA 2LSKA 2N1GA 5EK4A 5EZYE 3VKHA 5LG3A 2D5UA 1OWAA 5FVLA 5TAOA 1XNRT 3LK2B 4DBRA 4I4TE 1FMVA 1SA0E 3CVRA 2VKOA 1WFDA 1EZ3A 3OPCA 4QXBB 4EIWA 3KDSE 3MZKB 3O1JA 2BG9C 2Q9QC 3M3ZB 4X1IE 3AE6A 3P4SA 3PDYA 1WLXA 2W66A 2E9XD 4WBNE 3QK6A 3AE3A 3VHLA 4X64T 2FBWA 4KMCA 1G8XA 3W15B 3T1HT 4NIQA 2XTLA 2VVSA 4MLKA 5F5WA 2W63A 4KBMB 4Q25A 3AEGA 3P7IA 2LHRA 4IHJE 3ZMUB 5KXJA 2LJLA 5HCJA 3CX7B 1YQ4A 5HXEA 3TLSA 3L39A 1L0VA 3VU7H 1MMDA 2WBLA 1MNEA 4K0UA 3ZYLA 1X79A 3RKOA 5JH7E 5L47A 4AQGA 3ZCIA 2E9XB 5ABHA 3T1YT 1NEKA 2VURA 3UU5A 4MBQA 2G0UA 4I0UA 4X65T 5HXRA 3OYZA 3RGLA 1W09A 3JAFA 4IGUA 3N9QA 3PUXF 3E0ZA 2JRKA 2LHNA 2DCFA 5L3CB 2W4XA 2LSJA 2Y48B 3H37A 1HR0T 4J2CA 4YLHA 1BR0A 5C2TA 2V7MA 4HFBA 3NBXX 5LJMA 1VOMA 3LSVA 4HTEA 2ACZA 1U4QA 4N78D 4JLEA 4H9NC 3N5LA 4X1KE 3RI5A 4CI3B 5JDHA 3AAEB 4H9OC 2CRBA 3UU8A 2BS3A 4WNKA 2BG9E 3KV4A 3N9OA 1WYCA 4JEUB 1J5WA 2E9XC 2NTXA 5AQLB 5HCMA 2WDRA 2X51A 3C4ZA 1D1AA 5LBMA 2K3WA 3ETUA 4IE4A 4ZHQE 4G2AA 4M1PA 4JI0T 2MPKA 1XDPA 3I9WA 1UGOA 4DV2T 1HTJF 2KWHA 4IREA 2DWGA 3MK7C 3N2OA 3OVUA 2DL1A 2H88A 2V5CA 3H3MA 1J5ET 3N9NA 4PK5A 3KV9A 2BKPA 5HAXA 5J2TE 2UXCT 2HPLA 3PUQA 2VL0A 4PK6A 2OLTA 4UF0A 3PURA 1DU2A 2JQQA 3PJAJ 3FB2A 3NKZA 3HKDE 2L9QA 1KK7A 2I6HA 3CWZB 4P0BA 4MALA 3SWHA 1D0YA 3CX6B 4GK5E 5KMGP 3TLVA 3HL6A 2LEHA 4KI0F 3U78A 5FNVE 2EHOD 5LA6E 3N9PA 3AA7B 4KP3C 4BA9A 5FP3A 5LGUB 2NR4A 2LM2A 3IEEA 3UU6A 2BS2A 3N9LA 2LE8A 1ZEEA 3FZFB 2UXDT 3PTRB 2A72A 1XDOA 2J1DG 5FXVA 5JDGA 4EYUA 3L8RA 3OKQA 4U7YA 3FZLB 4GKJT 1VCSA 2XQ3A 4IE6A 2SPCA 4LMKA 3ZKRA 2KNDA 2RP4A 2VQFT 2XAQB 4EV6A 3AXJB 3RIUA 3RYCE 3ZEFB 5BMVE 2LKHA 5CA1E 5HEGA 4HFVA 3RHWA 2E5LT 4NUUA 2X0YA 5H6RB 4ISSA 4JI6T 4IT4A 2V8SV 5AQGB 2PJQA 4U7IA 2HHHT 2LM9A 4QH5A 3O1HA 2BDEA 3B5MA 3A5XA 3AEEA 5ADXL 3FBZA 2BKOA 2KT9A 4O4JE 4QXHB 2HH7A 3VRBA 3Q9DA 4FJOA 4X20E 4ISTA 3AAIA 4TUYE 2M6IA 1UURA 2XQYA 5FXWA 2F4VT 2LRKA 1OEDB 5FKYA 4X62T 2EHOC 2JMHA 4H9QC 5JDNA 3KV6A 2XQ8A 5LHIB 4HN9A 2ZM8A 5L2LA 2YOEA 5JDFA 3ZN1B 4QX7B 1ZV4X 5FXXA 4HFIA 4DR7T 4DUZT 3LJCA 3EAMA 3ZT5A 4BJNA 3DTOA 3PV0F 5KDMC 3FXDB 3UUXB 3EABA 5LB7B 3BQLA 2MAWA 3QC9A 4UVCB 4ZZBA 3AE5A 4YHHT 4JBWF 1XNQT 5JR9A 4F6RC 1M62A 4UV9B 2I59A 2Q9QA 4U3CA 3K3NA 3OYXA 1OEDC 3ABVA 4PJLA 4YT0A 4LFAT 2CWYA 2HN2A 1N33T 5HYAA 3VKGA 2W67A 2WDQA 5JQGE 2NW8A 4EAHA 4EYYR 5L3BB 3N9MA 3CPZA 2BZBA 1M7KA 3SOLA 1MMGA 4QKNA 4AXPA 4UEMA 1NAFA 1J1JA 4DMWA 2ZM6T 2DI4A 4C91A 2OV9A 5L4EA 4JI1T 3EUHA 4X66T 3ZN0B 1ZP0A 4OX9T 5HWXA 2BG9B 3AEBA 5AQTB 4CXYA 5LYJE 1MMAA 4CXXA 3A7MA 1H7CA 4JUYA 2YDQA 5LBQB 1HG2A 4LF9T 4I43B 4ERRA 4ASKA 5L3GB 3HKCE 5JDMA 4LMLA 4B3MT 3ANWB 1D1CA 2W00A 3ZT7A 4DIDB 5ABFB
chains in the Genus database with same CATH topology
4HWDA 5AQKB 3FZKB 1UGOA 1HX1B 5AQMB 4HWFA 5AQFB 5AQOB 3FZLB 3FZFB 3FZHB 3M3ZB 5AQRB 5AQLB 2D9DA 5AQJB 5AQHB 5AQQB 1M62A 5AQNB 1T7SA 5AQUB 3A8YC 5AQTB 1M7KA 3LDQB 1UK5A 4HWCA 5AQSB 5AQVB 1I6ZA 5AQPB 5AQIB 3FZMB 5AQGB 4HWIB 4HWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWD A;  5AQK B;  3FZK B;  1UGO A;  1HX1 B;  5AQM B;  4HWF A;  5AQF B;  5AQO B;  3FZL B;  3FZF B;  3FZH B;  3M3Z B;  5AQR B;  5AQL B;  2D9D A;  5AQJ B;  5AQH B;  5AQQ B;  1M62 A;  5AQN B;  1T7S A;  5AQU B;  3A8Y C;  5AQT B;  1M7K A;  3LDQ B;  1UK5 A;  4HWC A;  5AQS B;  5AQV B;  1I6Z A;  5AQP B;  5AQI B;  3FZM B;  5AQG B;  4HWI B;  4HWH A; 
#chains in the Genus database with same CATH topology
 2Y6X A;  2CXD A;  4QWN B;  4EOZ B;  2LRL A;  3IF8 B;  1CHU A;  4CI2 B;  4KHP T;  3LDQ B;  3MA9 A;  1WRD A;  2PTF A;  4JI7 T;  2GK9 A;  3LFM A;  1LKX A;  3AE4 A;  4CQI A;  2KXP B;  3TLU A;  2A3D A;  1FMW A;  3RX6 A;  2VB6 A;  3SRZ A;  1IZN B;  3J9X 1;  2CA5 A;  4TZ4 C;  4CN6 A;  4UVB B;  1UCU A;  2K5B B;  3ZYM A;  2XAJ B;  4PNI A;  2C5J A;  4X5T A;  2H3R A;  1N34 T;  5HEH A;  3PUG A;  2KIN B;  1WYB A;  3AEA A;  3C98 B;  5JTG A;  1HX8 A;  3AVR A;  4YXD A;  2IIU A;  4A56 A;  2E9X A;  1KNP A;  1OED E;  4G63 A;  2DNX A;  4AKG A;  2V6X A;  4DMV A;  3AE1 A;  4LF5 T;  4DO0 A;  2V7J A;  4O4H E;  4WYV A;  2UUA T;  1R8I A;  4XAX B;  3BQI A;  2XM2 A;  4E7S A;  4TWF A;  1O3X A;  3P4R A;  5LHH B;  3RH3 A;  5LHG B;  4O2B E;  1WR6 A;  5J0Z A;  3RYF E;  3ZPO A;  4FI5 A;  2JPF A;  2RA1 A;  4QH1 A;  4A98 A;  4EXT A;  2B1E A;  2L8K A;  3DP7 A;  2UU9 T;  4AQF C;  2N2N A;  4TV9 E;  4X1Y E;  1Y01 A;  3BQK A;  4HFH A;  3UQ7 A;  5L4H A;  3L3P A;  2LSI A;  3TLT A;  1V9D A;  2CEA A;  2PBI A;  4P0A A;  5AQS B;  4AIS A;  3ZCJ A;  4U74 A;  1LRZ A;  2NW7 A;  4IDZ A;  5HXH A;  2W61 A;  3EHZ A;  1T8B A;  1BR1 A;  1VRB A;  4KUM B;  4JI3 T;  4YJ2 E;  1IBM T;  1US7 B;  3UFE A;  3UT5 E;  4IDQ A;  4P09 A;  2XQ7 A;  5LXT E;  2WZI A;  2BVL A;  3HR0 A;  2IC9 A;  2AE9 A;  1MND A;  2UXX B;  4IIJ E;  4NUV A;  4CI1 B;  2CM0 A;  4H9R C;  2ES0 A;  3N2G E;  4U33 A;  5FY0 A;  3AB3 B;  4TWD A;  4CN1 A;  3U3I A;  3HA4 A;  3C4W A;  3ONJ A;  4JEH B;  2WB5 A;  3KFW X;  3RIA A;  1AJ3 A;  4H9P C;  5A1L A;  2FJA A;  2W62 A;  3IA3 A;  3PUV F;  3UUL A;  2V7L A;  1IBL T;  2NOX A;  4O8S A;  1IJ6 A;  1QLB A;  2LLY A;  4OHF A;  2WCA A;  4LF6 T;  5AQP B;  1HFA A;  3KBU A;  2VVN A;  3FZM B;  4HWH A;  2XQA A;  3O4X E;  3GMI A;  2VKD A;  2UXN B;  5KX5 E;  4PJM A;  3KV5 A;  3GN5 B;  5FL1 A;  4NXM T;  4AKI A;  2YKS A;  5AQI B;  1Z8U A;  2VAS A;  3UUM A;  2DLR A;  5LMN T;  3KVB A;  5ABG A;  5M4Y A;  2X68 A;  3TLW A;  3MAC A;  3PJA A;  2LT3 A;  3P4W A;  4LMJ A;  1HCI A;  3Q5D A;  4YTN A;  3IHR A;  3K1S A;  2B76 A;  4EEB A;  2KWI B;  4AIU A;  4UXN B;  2XQ4 A;  4Z91 A;  2MTQ A;  3AXJ A;  3Q5X A;  3B13 A;  4YFS A;  3AE7 A;  5E0O A;  2V1D B;  5LP6 E;  2XQ6 A;  1FJG T;  3AAA B;  4A5X A;  1Z0P A;  4GYR A;  5JRC B;  4GK0 E;  2X9Y A;  3CK6 A;  4LF4 T;  4V1A v;  2VWA A;  4GOU A;  4UIG A;  3C50 A;  2IAK A;  3P4P A;  4ZI3 D;  3ONX A;  3RQU A;  3ZYK A;  2YEV C;  4GIW A;  4JYA T;  1IJ5 A;  3FBL A;  1SE7 A;  4EED A;  2NWB A;  3HI2 A;  4ZI2 D;  4DV4 T;  4DUY T;  2WMO A;  5HWY A;  3NVO A;  1NWM X;  3NZQ A;  5JDQ A;  3RQW A;  2EHO B;  2L3L A;  3EI0 A;  4QX8 B;  1MIV A;  2FJB A;  3CIR A;  3V5U A;  3ESL A;  2BBH A;  3FHN A;  3RRC A;  2WDV A;  3WAK A;  3VR8 A;  2K24 A;  1MIW A;  2ODV A;  2C5K T;  4I55 E;  1T7S A;  4IDN A;  5AQU B;  5AQV B;  4YY3 T;  1YKE B;  2ODU A;  2XAS B;  3F31 A;  1HS7 A;  4YJ3 E;  1D0X A;  4IL9 A;  4DR5 T;  2P9B A;  2YIN A;  4AKH A;  4HKA A;  4GYS A;  2JQ9 A;  2VKH A;  2CCQ A;  3LK3 B;  4UEL A;  1LVK A;  3RKG A;  4ZS2 A;  4TWH A;  5EK2 A;  1D0Z A;  4HEA A;  4HWI B;  3FZK B;  4YTP A;  3C51 A;  4B3R T;  2IHR 1;  1YD8 G;  2V5D A;  1W0B A;  2R6G F;  2E8I A;  2WM9 A;  4E7Z A;  3RIF A;  5DQW A;  1I6Z A;  1HG5 A;  1IAP A;  4ZXL A;  4HFD A;  1X9B A;  3QNU A;  4CXW A;  1XZY A;  2HN1 A;  2IDO B;  3LK4 2;  4TN7 B;  3RRW A;  2M67 A;  5LGN B;  3UU4 A;  1KNZ A;  4KX6 A;  1E1H B;  4WW0 A;  5LCY A;  5H6Q B;  3CQG B;  3ZJ2 A;  2RPA A;  3I0Q A;  5AQK B;  4ZI3 C;  4LF7 T;  4BJM A;  2WP9 A;  4HE8 A;  4GKK T;  3KIN B;  2CBJ A;  2BG9 A;  5IHY A;  3PE0 A;  3KVA A;  5CJ5 A;  4ZI2 C;  3NWI A;  5HEJ A;  3AEF A;  2XPK A;  2BBJ A;  3ZC1 A;  4C90 A;  1SHZ C;  4ILB A;  3UTK A;  4ADZ A;  1ZOY A;  3LBX B;  5HXC A;  5AQR B;  1XMQ T;  1MMN A;  2NTY A;  2CXF A;  5HEU A;  4AKR B;  4DR2 T;  3ANW A;  3RC3 A;  4DR4 T;  2JMK A;  2N9D A;  5FY7 A;  5LJN A;  2QVA A;  5ABF A;  4AQY T;  4UR9 A;  3MKD A;  2CMR A;  1B7T A;  3ETV A;  1KNR A;  3ONL C;  5L3E B;  3N2K E;  2MOZ A;  2YDS A;  4PW8 A;  1D1B A;  2C0S A;  3UQ4 A;  2WWU A;  4OFZ A;  1UUS A;  5JR9 B;  5BR8 T;  3AVS A;  3AA0 B;  1U5P A;  5AQH B;  5J2U E;  2UXB T;  4TNV A;  3BK9 A;  4QH4 A;  2PFV A;  3EVY A;  1HNZ T;  4U31 A;  4PFO A;  5CB4 E;  4F8H A;  4TX5 A;  3KBT A;  4PK4 A;  2J47 A;  1QSD A;  4U2Z A;  1I94 T;  1SUM B;  5CFB A;  5IUX A;  1S94 A;  4YHJ A;  3S4U A;  2V6Y B;  4P1N A;  4AQF A;  4DVD A;  2K9A A;  3P8C D;  2D2S A;  2VQE T;  4DR6 T;  4H63 V;  2ZLY A;  3WAJ A;  2JQK A;  2UUC T;  4JV5 T;  4ZI7 E;  2Y8D A;  2YN6 A;  4UV8 B;  4EZH A;  3E08 A;  3NZP A;  2BVM A;  1E2A A;  4HWC A;  4O4L E;  5JR9 C;  3I0O A;  2X0H A;  2ZM2 A;  4Z90 A;  1HX1 B;  4QHO A;  5IWA T;  1XMO T;  2WSS V;  1IBK T;  3F57 A;  2LOP A;  4IL4 A;  4WZX A;  2W0G A;  1KF6 A;  2IML A;  1MIY A;  5LMU T;  4IDP A;  3CQC B;  3PU8 A;  2XQ5 A;  2FUP A;  4JI2 T;  5ETW A;  1OXZ A;  5ABE A;  5JDL A;  3CQX C;  2YK0 A;  3QB5 K;  4ILC A;  3K3O A;  2JIW A;  4H63 H;  4IDO A;  5LOV E;  2YDR A;  2X67 A;  2XZE A;  2ZM0 A;  3K8P C;  1YKH B;  4LFC T;  3PU3 A;  4O4I E;  3ZT6 A;  1N36 T;  3R84 B;  4EGW A;  5AQQ B;  2E5V A;  2LOS A;  3SFE A;  3RYI E;  2H89 A;  4ZZC A;  3CKD A;  3WI3 A;  4IE7 A;  2V26 A;  2X9W A;  4YTM A;  4JI5 T;  2CXL A;  5FL0 A;  1G73 A;  3FXE B;  1W9R A;  4HFC A;  2D0T A;  5HEO A;  4HWF A;  1FEW A;  3QB5 A;  3AEC A;  4NXN T;  3J7Y q;  2CBI A;  2XQ9 A;  4B6X A;  2IW5 B;  1BR4 A;  4ILA A;  3MXZ A;  2A9U A;  2Z6E A;  3ZST A;  2QYW A;  4OK0 A;  2NP9 A;  3AE8 A;  4IE0 A;  4DV7 T;  2XJ7 A;  3CX8 B;  2DHR A;  2XSA A;  3HKB E;  4ZS3 A;  4Z8X A;  3UUN A;  3GWH A;  1S35 A;  2V7I A;  4DR1 T;  3NRY A;  3RLF F;  4NPP A;  3O9X A;  4U2Y A;  4JI4 T;  1BR2 A;  1VCT A;  3H3A A;  3ZMT B;  2QGS A;  4COF A;  1T98 A;  5L3D B;  3GN5 A;  1E7P A;  3OBV E;  5FXZ A;  4U72 A;  3JCF A;  1QUU A;  3FZH B;  2KMF A;  3JAE A;  2X0L B;  2LSG A;  4O2A E;  3VR9 A;  4DV6 T;  2X9H A;  2UUB T;  3JC6 D;  5DJQ C;  4WBO A;  3OJA A;  2K48 A;  3ZMZ B;  5LNK A;  2BS4 A;  3RC8 A;  5CA0 E;  4LFB T;  5JRC A;  4DR3 T;  4PAG A;  2YU1 A;  3L09 A;  3QUJ A;  3EDV A;  1CUN A;  3F2E A;  2WMN A;  1ZHC A;  4KHZ F;  5AQM B;  2JJ9 A;  3SS1 A;  3X1D A;  5JVD E;  2J62 A;  4H9S E;  1Y64 B;  2OA5 A;  3RPU A;  2ACX A;  1UK5 A;  2AXD S;  2BKN A;  5CGM A;  2EHO A;  2WY2 A;  5F8P A;  1YXR A;  4OYK A;  3Q5E A;  2D0U A;  3PUW F;  3UFG A;  2WQY A;  3K3Q C;  2KLQ A;  3PUZ F;  2XY8 B;  3DJB A;  5FMN A;  5HXS A;  4LF8 T;  5AQN B;  2A2F X;  3A8Y C;  3I9Y A;  3AED A;  2VKJ A;  4K0K T;  2WWV A;  3B57 A;  4HGA A;  1JNZ A;  3SFD A;  2LSY A;  4UF0 B;  3UUB A;  2JQH A;  1WR0 A;  2CHN A;  4QXC B;  1XWM A;  3TKL B;  3MJX A;  3QOF A;  2H7O A;  1HNX T;  3LG7 A;  2WU5 A;  2FJE A;  3NRX A;  5C8Y E;  4AI6 A;  3Q5W A;  5LG4 A;  1OED A;  2IUB A;  2V7K A;  2CWO A;  2CLY B;  3ZMS B;  4YSY A;  3ZSS A;  4A97 A;  1W0A A;  3RYH E;  4DND A;  5AQF B;  5LGT B;  2M6B A;  2MBG A;  3JC6 C;  4ZEY A;  5C3J A;  3AA6 B;  5AQJ B;  2DWK A;  4CZZ B;  2H7V C;  4OYJ A;  1YW0 A;  5IYZ E;  3D0T A;  5FVK A;  2PG8 A;  4DBQ A;  4L0R A;  4L5G A;  2WU2 A;  3G06 A;  4HWD A;  5FY1 A;  5DQV A;  4PJJ A;  2WS3 A;  2XSB A;  4DV1 T;  5EK3 A;  3V5S A;  4AKL A;  2CPT A;  4DV0 T;  5GON E;  2IC6 A;  4PFP A;  2XHE B;  3O1I A;  4B3T T;  1T72 A;  4EZ4 A;  2WAU A;  1KFY A;  4MFR A;  3R6N A;  3PUS A;  4XBF B;  2NW9 A;  2CLY C;  4UVA B;  3LBX A;  3UU3 A;  2D9D A;  1HNW T;  4PJN A;  3OTO T;  2XAG B;  1YQ3 A;  3P4Q A;  3E22 E;  3AA1 B;  5AFU L;  4ANJ A;  3AE9 A;  4IE5 A;  4L9I A;  3RF1 A;  4BAY B;  2QA7 A;  2QRX A;  2ZMA A;  1JNR A;  3IBP A;  2XUE A;  3I1A A;  2KSR A;  3C4X A;  3T8O A;  1ZKE A;  4B3S T;  4TNW A;  4YSX A;  3ZC0 A;  2HPJ A;  1WCR A;  2Q9Q D;  4YSZ A;  3GA8 A;  2C5I T;  1KEY A;  3PUA A;  4XZC A;  3JAD A;  3M65 A;  4ZOL E;  4DV5 T;  3C64 A;  5JRE A;  4MHC A;  2YU2 A;  3RIU C;  4HFE A;  2W2U A;  5L3F B;  1N32 T;  1HF8 A;  1NEN A;  3HKE E;  2CHO A;  3ZMV B;  2VL8 A;  2V6Y A;  2J4G A;  2X66 A;  2MYS A;  3PUY F;  3P50 A;  2FJD A;  4DV3 T;  4CN4 A;  1LVF A;  1UX5 A;  2CE7 A;  3AE2 A;  3ZLI A;  5DAB A;  4TV8 E;  3Q2M A;  3CML A;  5FYM A;  5F3J A;  1GQE A;  2VK9 A;  2LKG A;  2Q9Q B;  2E2A A;  2KZ7 B;  4I50 E;  2XM1 A;  2XAF B;  2XAH B;  3ZJ1 A;  1UX4 A;  4JI8 T;  1FIO A;  4ILU A;  5J1G A;  2X9X A;  5AQO B;  3VRA A;  3EDU A;  2WZH A;  4EB6 E;  2I0M A;  2LSK A;  2N1G A;  5EK4 A;  5EZY E;  3VKH A;  5LG3 A;  2D5U A;  1OWA A;  5FVL A;  5TAO A;  1XNR T;  3LK2 B;  4DBR A;  4I4T E;  1FMV A;  1SA0 E;  3CVR A;  2VKO A;  1WFD A;  1EZ3 A;  3OPC A;  4QXB B;  4EIW A;  3KDS E;  3MZK B;  3O1J A;  2BG9 C;  2Q9Q C;  3M3Z B;  4X1I E;  3AE6 A;  3P4S A;  3PDY A;  1WLX A;  2W66 A;  2E9X D;  4WBN E;  3QK6 A;  3AE3 A;  3VHL A;  4X64 T;  2FBW A;  4KMC A;  1G8X A;  3W15 B;  3T1H T;  4NIQ A;  2XTL A;  2VVS A;  4MLK A;  5F5W A;  2W63 A;  4KBM B;  4Q25 A;  3AEG A;  3P7I A;  2LHR A;  4IHJ E;  3ZMU B;  5KXJ A;  2LJL A;  5HCJ A;  3CX7 B;  1YQ4 A;  5HXE A;  3TLS A;  3L39 A;  1L0V A;  3VU7 H;  1MMD A;  2WBL A;  1MNE A;  4K0U A;  3ZYL A;  1X79 A;  3RKO A;  5JH7 E;  5L47 A;  4AQG A;  3ZCI A;  2E9X B;  5ABH A;  3T1Y T;  1NEK A;  2VUR A;  3UU5 A;  4MBQ A;  2G0U A;  4I0U A;  4X65 T;  5HXR A;  3OYZ A;  3RGL A;  1W09 A;  3JAF A;  4IGU A;  3N9Q A;  3PUX F;  3E0Z A;  2JRK A;  2LHN A;  2DCF A;  5L3C B;  2W4X A;  2LSJ A;  2Y48 B;  3H37 A;  1HR0 T;  4J2C A;  4YLH A;  1BR0 A;  5C2T A;  2V7M A;  4HFB A;  3NBX X;  5LJM A;  1VOM A;  3LSV A;  4HTE A;  2ACZ A;  1U4Q A;  4N78 D;  4JLE A;  4H9N C;  3N5L A;  4X1K E;  3RI5 A;  4CI3 B;  5JDH A;  3AAE B;  4H9O C;  2CRB A;  3UU8 A;  2BS3 A;  4WNK A;  2BG9 E;  3KV4 A;  3N9O A;  1WYC A;  4JEU B;  1J5W A;  2E9X C;  2NTX A;  5AQL B;  5HCM A;  2WDR A;  2X51 A;  3C4Z A;  1D1A A;  5LBM A;  2K3W A;  3ETU A;  4IE4 A;  4ZHQ E;  4G2A A;  4M1P A;  4JI0 T;  2MPK A;  1XDP A;  3I9W A;  1UGO A;  4DV2 T;  1HTJ F;  2KWH A;  4IRE A;  2DWG A;  3MK7 C;  3N2O A;  3OVU A;  2DL1 A;  2H88 A;  2V5C A;  3H3M A;  1J5E T;  3N9N A;  4PK5 A;  3KV9 A;  2BKP A;  5HAX A;  5J2T E;  2UXC T;  2HPL A;  3PUQ A;  2VL0 A;  4PK6 A;  2OLT A;  4UF0 A;  3PUR A;  1DU2 A;  2JQQ A;  3PJA J;  3FB2 A;  3NKZ A;  3HKD E;  2L9Q A;  1KK7 A;  2I6H A;  3CWZ B;  4P0B A;  4MAL A;  3SWH A;  1D0Y A;  3CX6 B;  4GK5 E;  5KMG P;  3TLV A;  3HL6 A;  2LEH A;  4KI0 F;  3U78 A;  5FNV E;  2EHO D;  5LA6 E;  3N9P A;  3AA7 B;  4KP3 C;  4BA9 A;  5FP3 A;  5LGU B;  2NR4 A;  2LM2 A;  3IEE A;  3UU6 A;  2BS2 A;  3N9L A;  2LE8 A;  1ZEE A;  3FZF B;  2UXD T;  3PTR B;  2A72 A;  1XDO A;  2J1D G;  5FXV A;  5JDG A;  4EYU A;  3L8R A;  3OKQ A;  4U7Y A;  3FZL B;  4GKJ T;  1VCS A;  2XQ3 A;  4IE6 A;  2SPC A;  4LMK A;  3ZKR A;  2KND A;  2RP4 A;  2VQF T;  2XAQ B;  4EV6 A;  3AXJ B;  3RIU A;  3RYC E;  3ZEF B;  5BMV E;  2LKH A;  5CA1 E;  5HEG A;  4HFV A;  3RHW A;  2E5L T;  4NUU A;  2X0Y A;  5H6R B;  4ISS A;  4JI6 T;  4IT4 A;  2V8S V;  5AQG B;  2PJQ A;  4U7I A;  2HHH T;  2LM9 A;  4QH5 A;  3O1H A;  2BDE A;  3B5M A;  3A5X A;  3AEE A;  5ADX L;  3FBZ A;  2BKO A;  2KT9 A;  4O4J E;  4QXH B;  2HH7 A;  3VRB A;  3Q9D A;  4FJO A;  4X20 E;  4IST A;  3AAI A;  4TUY E;  2M6I A;  1UUR A;  2XQY A;  5FXW A;  2F4V T;  2LRK A;  1OED B;  5FKY A;  4X62 T;  2EHO C;  2JMH A;  4H9Q C;  5JDN A;  3KV6 A;  2XQ8 A;  5LHI B;  4HN9 A;  2ZM8 A;  5L2L A;  2YOE A;  5JDF A;  3ZN1 B;  4QX7 B;  1ZV4 X;  5FXX A;  4HFI A;  4DR7 T;  4DUZ T;  3LJC A;  3EAM A;  3ZT5 A;  4BJN A;  3DTO A;  3PV0 F;  5KDM C;  3FXD B;  3UUX B;  3EAB A;  5LB7 B;  3BQL A;  2MAW A;  3QC9 A;  4UVC B;  4ZZB A;  3AE5 A;  4YHH T;  4JBW F;  1XNQ T;  5JR9 A;  4F6R C;  1M62 A;  4UV9 B;  2I59 A;  2Q9Q A;  4U3C A;  3K3N A;  3OYX A;  1OED C;  3ABV A;  4PJL A;  4YT0 A;  4LFA T;  2CWY A;  2HN2 A;  1N33 T;  5HYA A;  3VKG A;  2W67 A;  2WDQ A;  5JQG E;  2NW8 A;  4EAH A;  4EYY R;  5L3B B;  3N9M A;  3CPZ A;  2BZB A;  1M7K A;  3SOL A;  1MMG A;  4QKN A;  4AXP A;  4UEM A;  1NAF A;  1J1J A;  4DMW A;  2ZM6 T;  2DI4 A;  4C91 A;  2OV9 A;  5L4E A;  4JI1 T;  3EUH A;  4X66 T;  3ZN0 B;  1ZP0 A;  4OX9 T;  5HWX A;  2BG9 B;  3AEB A;  5AQT B;  4CXY A;  5LYJ E;  1MMA A;  4CXX A;  3A7M A;  1H7C A;  4JUY A;  2YDQ A;  5LBQ B;  1HG2 A;  4LF9 T;  4I43 B;  4ERR A;  4ASK A;  5L3G B;  3HKC E;  5JDM A;  4LML A;  4B3M T;  3ANW B;  1D1C A;  2W00 A;  3ZT7 A;  4DID B;  5ABF B; 
#chains in the Genus database with same CATH homology
 4HWD A;  5AQK B;  3FZK B;  1UGO A;  1HX1 B;  5AQM B;  4HWF A;  5AQF B;  5AQO B;  3FZL B;  3FZF B;  3FZH B;  3M3Z B;  5AQR B;  5AQL B;  2D9D A;  5AQJ B;  5AQH B;  5AQQ B;  1M62 A;  5AQN B;  1T7S A;  5AQU B;  3A8Y C;  5AQT B;  1M7K A;  3LDQ B;  1UK5 A;  4HWC A;  5AQS B;  5AQV B;  1I6Z A;  5AQP B;  5AQI B;  3FZM B;  5AQG B;  4HWI B;  4HWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...