5AQKB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
b'SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqkB00
4HWFA 1UGOA 5AQSB 5AQLB 1M7KA 5AQVB 3FZFB 2D9DA 1M62A 3LDQB 3M3ZB 3FZHB 5AQGB 5AQKB 4HWCA 5AQHB 4HWHA 5AQQB 4HWIB 1I6ZA 5AQJB 5AQPB 5AQMB 1UK5A 5AQOB 1T7SA 5AQUB 1HX1B 5AQNB 3FZLB 5AQFB 4HWDA 3FZMB 5AQRB 5AQTB 3A8YC 5AQIB 3FZKB
chains in the Genus database with same CATH superfamily
2JQ9A 3PE0A 5F8PA 4L0RA 2UUAT 1WLXA 1UX4A 5FVLA 3ONXA 2I0MA 3H3MA 1FMVA 3KV9A 4WBOA 4H9SE 1T8BA 5LMNT 2J62A 2SPCA 3IA3A 4EB6E 3OPCA 5LNKA 3N2GE 2BG9E 1HF8A 2LSKA 3PUVF 2YDRA 3WI3A 5AQLB 3C98B 3Q2MA 4LFCT 2WZIA 5JDGA 3QOFA 4IDZA 3LDQB 2Q9QB 2JPFA 2YDQA 4TNVA 2J47A 2WWVA 4BJNA 4GK0E 1KNRA 2EHOA 3N9NA 4KHZF 3JC6C 3SWHA 1ZV4X 5E0OA 3SFDA 4TWDA 2B1EA 2JJ9A 4DR6T 3PUAA 2IDOB 3VU7H 2OV9A 3X1DA 2L9QA 2LSYA 2FJBA 3AECA 3ZMSB 3F2EA 4MBQA 2BS2A 5LHIB 5BR8T 4YTMA 3N9MA 4DNDA 1LVKA 5FL1A 2X67A 1HCIA 3AXJA 4AXPA 4WNKA 4OK0A 1W09A 2CBJA 3RIUA 1KFYA 4HWDA 5EZYE 3O1JA 5HEUA 3ANWA 3ZMTB 2E9XC 4XBFB 5HCMA 3AAEB 4NPPA 2CWOA 3Q5XA 3N2KE 4IDNA 2WY2A 5AQMB 3EAMA 4ZZBA 4GYSA 4X5TA 4CI3B 4O4JE 1YW0A 3GMIA 5LBQB 4TZ4C 3JAFA 4O4HE 2XQ5A 4HWCA 1AJ3A 1I6ZA 4AQFC 4ZS3A 5L3BB 3KDSE 3RQWA 2VKOA 1J5ET 2E8IA 4B3TT 2FUPA 2WU5A 3ONLC 4DVDA 4DO0A 2LJLA 5HXHA 2KXPB 1YQ3A 2XQAA 4O2AE 3JAEA 2IMLA 2VL8A 5LOVE 2K48A 5EK2A 3MA9A 2IHR1 2XQ4A 4JBWF 3A8YC 2CBIA 3ZLIA 4E7SA 4O4IE 4I0UA 4JEUB 1D1AA 1HS7A 2YDSA 3MZKB 4ZHQE 5LXTE 3RYCE 4PFPA 1XNRT 3EI0A 3RRCA 2DLRA 4ZI3D 5F3JA 1VCTA 4HGAA 2I6HA 1OEDE 1ZOYA 3KFWX 3BQKA 2X68A 4EZ4A 2XQYA 3Q5WA 2Y6XA 4DV6T 4HFEA 4IDOA 1IZNB 5EK3A 3B57A 3LBXA 5TAOA 4I55E 2IIUA 2VVSA 2E9XB 1SUMB 1J1JA 3H3AA 3ETVA 4X1IE 5ABFA 1BR0A 5KXJA 2EHOC 4GKJT 1OXZA 3RLFF 3P8CD 3R6NA 3VKGA 4OFZA 3UFGA 3PUWF 1UUSA 2DI4A 4H63H 2HH7A 4LFBT 3N9PA 2UXCT 2MBGA 3ZYLA 2HN2A 3ZEFB 3L09A 2X9HA 3RQUA 2WAUA 4QH4A 3CX8B 1T72A 4PW8A 2C5IT 3ZN1B 3RIUC 1KNZA 2V7MA 3CMLA 2QGSA 2CXLA 4UV9B 3HI2A 4O4LE 1UURA 3ZN0B 3ZJ1A 4DR3T 3P4WA 2VKHA 4JI2T 5JDMA 5HXSA 2PG8A 2IC6A 2CMRA 5J2UE 4B3RT 4CZZB 2XUEA 3NRYA 3RKGA 2LRLA 3I0OA 3F57A 2VWAA 2XAQB 4XZCA 2D5UA 4YSYA 2W67A 4QWNB 2BS3A 1FMWA 3MXZA 4EIWA 2K24A 3VRAA 4DR2T 5HWYA 3C64A 3UUXB 5ABGA 2YN6A 2HPLA 4DIDB 3RYIE 1G8XA 2FJDA 5C8YE 1HX1B 1SE7A 2XHEB 2D0TA 3S4UA 5LGTB 1HFAA 4KP3C 4YY3T 2LEHA 1HR0T 4U7YA 4U74A 3RKOA 4V1Av 3U3IA 4F6RC 3EHZA 2ACZA 1S35A 1N36T 2W4XA 2EHOB 4JI1T 2XAFB 3ZPOA 2WSSV 4MLKA 4TNWA 4Z8XA 2V5CA 3RX6A 2XAJB 4G2AA 4WZXA 4B3MT 4KHPT 1IBMT 4P0AA 4HFIA 2XM2A 3TLTA 4YSXA 2Q9QD 2ZM0A 3N9OA 4U31A 4DMVA 4P0BA 2XSAA 5JH7E 4QKNA 3ZC0A 3AXJB 3ZYMA 3QB5A 2N9DA 3JADA 5LYJE 3P50A 3ANWB 2JQKA 1W9RA 3QNUA 1UGOA 3PV0F 3PUXF 2LSIA 1HNWT 5FL0A 2IUBA 1HNZT 5FY7A 4H9NC 2LE8A 3LK3B 4TUYE 2BBHA 2XY8B 3MJXA 4EXTA 1OWAA 2H7OA 2C5JA 1FIOA 3ZSSA 3M3ZB 2XPKA 3PUZF 2W66A 3ONJA 4UXNB 4ERRA 3G06A 4UVCB 4JEHB 4DR5T 2BG9A 4HFDA 3MK7C 2XQ8A 4NXNT 3CWZB 3NWIA 4DMWA 3FXEB 2CLYB 4QHOA 5CB4E 4I4TE 2BZBA 2RA1A 4QXHB 2CXDA 2J4GA 4GYRA 4ZXLA 2UXDT 4LF5T 4DBQA 4I50E 1MMNA 2WS3A 2V7JA 4LFAT 3A7MA 3AVRA 5AQHB 2FJAA 4PFOA 3CQXC 2IW5B 3AEAA 3N9LA 1VOMA 2L3LA 3AA1B 4C90A 3ABVA 3CVRA 4IE0A 1IJ5A 3P7IA 2V7IA 4NUUA 4OHFA 4TX5A 5CGMA 1M62A 4XAXB 3BQIA 2CCQA 5HXEA 2D2SA 2W2UA 3UUBA 3AE4A 5AQNB 1Y01A 4HFVA 3UFEA 2A3DA 2DL1A 3LBXB 3LK2B 3JC6D 5L3CB 3VR8A 2V7KA 5AQPB 4YTPA 4HE8A 2X9YA 4YJ2E 2CRBA 4JI0T 5ABFB 4UF0A 2NOXA 3UT5E 2NTXA 2CHOA 3KBUA 1SA0E 3PUSA 2CPTA 2XM1A 2X0HA 2XZEA 3RHWA 4X1YE 2BDEA 1VCSA 3UU5A 2ZM8A 4ASKA 5FXXA 2KT9A 2BVMA 5LMUT 4GKKT 5JRCB 4WW0A 5IHYA 2RPAA 4H9QC 3ZSTA 5C3JA 1YXRA 2LKHA 1LRZA 2E9XD 2CHNA 2GK9A 1ZEEA 3HKCE 3OYXA 4DR4T 4EV6A 4PK5A 2LM2A 2QYWA 4TWFA 1W0BA 3CIRA 2LSJA 2Z6EA 1E7PA 3UQ7A 2AXDS 2WMNA 3WAJA 4HWFA 4QH5A 4OYKA 4TV8E 1IBKT 3LK42 4GOUA 2D9DA 5LHHB 4U33A 1WFDA 5AQJB 4AKIA 3AEFA 4COFA 3ESLA 1SHZC 1US7B 2WBLA 2XQ7A 5DJQC 4U7IA 5LCYA 4DR7T 4AKLA 5FVKA 1OEDA 3LSVA 3IHRA 3AVSA 5KDMC 4PK4A 5ADXL 4NIQA 4UV8B 2LOPA 2V6YA 2A2FX 1X9BA 2W62A 4JI8T 2KZ7B 4ANJA 3HR0A 3AA6B 4QXCB 3ZMZB 5JDHA 1D1CA 3AEEA 3B13A 4IDQA 2BG9C 4C91A 5HWXA 1VRBA 1W0AA 3FZFB 2K9AA 4X66T 4X65T 1MNDA 4ILBA 3Q9DA 2LKGA 3GA8A 5CJ5A 1S94A 3QUJA 5HEGA 4IE6A 3OVUA 3AAIA 3T8OA 2W00A 3AA0B 3IBPA 2MYSA 5L4EA 1ZHCA 2UUBT 4HWIB 2LLYA 2YU1A 2MTQA 2Y48B 2H88A 3P4QA 2OLTA 3TLUA 3AE2A 1Y64B 4CN1A 2CE7A 1T98A 2DNXA 4UVAB 2X0LB 5JDNA 2VURA 4IE5A 3AE1A 5HEOA 3RRWA 2BKPA 3TKLB 2UXBT 1NEKA 3HKBE 3OKQA 5H6QB 4H9RC 2H7VC 2LHRA 4JI7T 5IUXA 3EDUA 4O8SA 3FZHB 4JI6T 3TLWA 4EOZB 2EHOD 3KV4A 5CFBA 1FEWA 4NUVA 4EEBA 5HCJA 5AQUB 3VR9A 4ZOLE 5HEHA 5JRCA 3O1IA 2NP9A 2V26A 3E22E 5L3DB 3V5SA 3MACA 4IE7A 3FHNA 2DWGA 2C5KT 1QLBA 4Z91A 2NR4A 2X9XA 2LHNA 2IC9A 2XSBA 3FZKB 4UIGA 3NZPA 5J1GA 2BS4A 3QK6A 2VASA 3AE7A 1HX8A 3PUYF 3NKZA 2A72A 3PU8A 2WCAA 2BG9B 3EABA 3GWHA 4CXWA 3KV6A 3ZKRA 4EZHA 4IE4A 1G73A 4X20E 2KWIB 1R8IA 4LF8T 5JDFA 4J2CA 3PDYA 2QA7A 2OA5A 3VHLA 4X1KE 3K3QC 2NTYA 2YINA 4KI0F 2ES0A 3K1SA 4HKAA 2DCFA 1NENA 4YTNA 3C4ZA 4Q25A 1XWMA 4YLHA 2WDRA 2CA5A 1KNPA 4ZZCA 1OEDC 3LG7A 2YK0A 3AEDA 3R84B 1V9DA 2CLYC 2LSGA 5AQIB 2JQQA 5HXRA 3D0TA 4KX6A 2KLQA 4KMCA 3CPZA 2ODUA 1YD8G 3CX6B 3GN5A 3K3OA 1CUNA 1MMDA 2C0SA 1BR1A 3DTOA 3N2OA 2QVAA 3IF8B 4EAHA 3UU8A 1I94T 2UU9T 1J5WA 2VQET 2VL0A 2LRKA 3I0QA 4HWHA 4A56A 1ZKEA 2E5VA 4WYVA 1YKEB 2MOZA 2H89A 2N1GA 4UF0B 1NAFA 2AE9A 1MIYA 5ABHA 3M65A 4LF7T 3PUQA 5LG3A 2E2AA 3UQ4A 2JIWA 3RI5A 3OBVE 3IEEA 1D1BA 2A9UA 5AQTB 2HPJA 5L2LA 2W0GA 5FXZA 3J7Yq 5GONE 5JR9A 4F8HA 3NRXA 1WYCA 3CX7B 1MMGA 4ADZA 2P9BA 3CKDA 5AQRB 5J0ZA 4PAGA 3EVYA 4ILCA 1H7CA 3ZYKA 1WYBA 3I1AA 5HYAA 3A5XA 4DV2T 4DBRA 1HG2A 2KWHA 4UVBB 5L3FB 4HEAA 3RYFE 3Q5DA 4ZI2D 5L4HA 4ILAA 4QX8B 3SS1A 1KEYA 3OYZA 2J1DG 3PURA 1OEDB 4DV1T 2KSRA 1B7TA 5BMVE 4B3ST 2V6YB 2UXNB 5CA0E 5FY0A 4MHCA 2XASB 1JNZA 1L0VA 3QB5K 3B5MA 3N5LA 4GIWA 5CA1E 5FXVA 2FBWA 5KMGP 4TN7B 4HN9A 3SOLA 5AQGB 5DABA 5AQQB 3DP7A 2VQFT 2KMFA 5AQOB 5DQVA 2RP4A 5L3GB 3FZMB 3FBLA 1N33T 4IREA 5LHGB 2ZM2A 3AE6A 1N32T 4B6XA 4K0KT 4TWHA 2WWUA 3SRZA 2BKNA 1KF6A 3P4PA 4LF4T 3U78A 3UUMA 5FNVE 3W15B 4DUZT 1YQ4A 4K0UA 3F31A 4YJ3E 4EEDA 3AA7B 5LJNA 1IJ6A 4QH1A 2KNDA 3NBXX 5M4YA 4OYJA 2F4VT 4BA9A 4UEMA 4DR1T 3UU3A 5EK4A 1MIWA 4H9PC 2ZM6T 3I9YA 2B76A 4UR9A 3RF1A 1DU2A 3QC9A 2R6GF 3KBTA 2VKJA 2MAWA 5AFUL 3ZCIA 2V8SV 2M6IA 1UX5A 1MMAA 3E08A 3VRBA 1U5PA 2WZHA 2JMKA 4H9OC 4FI5A 1M7KA 4CN6A 3C4WA 3RIFA 4BAYB 5LJMA 4PJMA 3RPUA 4QX7B 2UXXB 3PJAJ 2PJQA 2X51A 3Q5EA 3UUNA 4E7ZA 3AEGA 2Y8DA 5HXCA 4BJMA 4CI2B 4PK6A 3ZMVB 3HKDE 5FP3A 5LBMA 3CK6A 3AE3A 2ACXA 2DHRA 2BKOA 4L5GA 1T7SA 3JCFA 4HFBA 2YKSA 3FB2A 2JQHA 4PJNA 2UUCT 4LMLA 4LF6T 2LM9A 1BR4A 1E2AA 5HAXA 2YOEA 2WMOA 4AKGA 4ISSA 4YT0A 4JV5T 5JR9C 4P1NA 3ZMUB 1QSDA 3BK9A 2I59A 4DV3T 1D0ZA 5LB7B 4U72A 4QXBB 5FYMA 2WQYA 3SFEA 4X64T 3H37A 4IHJE 2XAHB 3ZJ2A 4ILUA 4MALA 4AI6A 5JTGA 4G63A 1QUUA 4A5XA 4EYYR 2XJ7A 3L8RA 4ZEYA 4EYUA 2HN1A 4YHJA 1IAPA 3PU3A 2WDVA 1X79A 2K5BB 3RH3A 3O1HA 1CHUA 2CWYA 2YU2A 2KINB 4AKHA 1D0XA 3CQCB 3EUHA 2VB6A 3N9QA 5L3EB 4HFHA 2W61A 3AAAB 4A97A 1XDOA 2XQ9A 1GQEA 4I43B 4DV5T 4IIJE 3UTKA 2WU2A 3GN5B 4CXXA 4DV4T 4CQIA 4DV7T 2CEAA 4ZI3C 1Z0PA 5H6RB 4AQYT 2CXFA 3FXDB 4LF9T 4OX9T 2LOSA 4IT4A 3LFMA 2V5DA 3HL6A 3L39A 4KUMB 2Q9QA 1HG5A 1XMOT 5JVDE 4FJOA 3EDVA 5AQFB 2WDQA 3T1YT 4LMJA 2V1DB 2ZLYA 1BR2A 4JYAT 1XNQT 4N78D 4JI3T 3K8PC 3VKHA 3AE5A 2XAGB 1N34T 5ETWA 4X62T 5L47A 4IL4A 4WBNE 5A1LA 4ZI7E 2N2NA 2M67A 2NW9A 2LT3A 3RYHE 2X9WA 2JMHA 5JR9B 2ZMAA 4PNIA 5IWAT 3MKDA 4AQGA 2VKDA 1MIVA 3E0ZA 3TLVA 4HFCA 2IAKA 5DQWA 2NW8A 4M1PA 5LA6E 1WCRA 1WR0A 3LJCA 2NWBA 1XZYA 2PFVA 3DJBA 5FXWA 4U2YA 2CM0A 5FY1A 3OTOT 2WB5A 4JI4T 3KVBA 4IGUA 3RGLA 1UCUA 3TLSA 3C50A 5AQKB 3P4RA 4ISTA 3RC3A 2PTFA 3ZT7A 5HEJA 5F5WA 2XQ6A 3ZT6A 3PTRB 3RC8A 1U4QA 2K3WA 4LMKA 1LVFA 5KX5E 1UK5A 4YHHT 2BBJA 3UU4A 2HHHT 3HKEE 3AE9A 2X0YA 3O9XA 2V6XA 2MPKA 4DV0T 3PUGA 2NW7A 4Z90A 3HA4A 3KINB 3ZCJA 3P4SA 5C2TA 3C4XA 3KV5A 5LG4A 4P09A 3T1HT 4JUYA 4EGWA 2L8KA 4PJLA 1YKHB 2D0UA 3RIAA 3K3NA 3ZC1A 1HNXT 3FZLB 3J9X1 1E1HB 1D0YA 4YXDA 4ZS2A 4JLEA 4CN4A 1MNEA 5AQVB 4IL9A 1EZ3A 2WP9A 4YFSA 2G0UA 4L9IA 1WRDA 1IBLT 1HTJF 2E9XA 3AB3B 2DWKA 2Q9QC 4CXYA 2E5LT 4YSZA 2PBIA 5FKYA 2H3RA 4PJJA 4UELA 5JREA 3WAKA 1ZP0A 3NZQA 1LKXA 3AEBA 4O2BE 2W63A 4MFRA 4U3CA 2M6BA 5JDLA 3AE8A 4GK5E 5AQSB 4AQFA 4AKRB 5IYZE 3CQGB 3NVOA 4AIUA 3ETUA 1O3XA 1JNRA 2XQ3A 3OJAA 4JI5T 3FBZA 2YEVC 5JDQA 2JRKA 2ODVA 5LP6E 3UULA 4IDPA 1XDPA 2WM9A 4AISA 5J2TE 3C51A 4ZI2C 2V7LA 1Z8UA 1FJGT 3UU6A 5LGUB 3V5UA 4U2ZA 4DUYT 4TV9E 2VK9A 4HTEA 3L3PA 3ZT5A 5ABEA 2QRXA 2BVLA 3KVAA 2VVNA 5JQGE 4H63V 2X66A 1NWMX 2XTLA 1XMQT 4A98A 4CI1B 1KK7A 2FJEA 3O4XE 4NXMT 5FMNA 4KBMB 3I9WA 3BQLA 1WR6A 5LGNB 3PJAA
chains in the Genus database with same CATH topology
4HWFA 1UGOA 5AQSB 5AQLB 1M7KA 5AQVB 3FZFB 2D9DA 1M62A 3LDQB 3M3ZB 3FZHB 5AQGB 5AQKB 4HWCA 5AQHB 4HWHA 5AQQB 4HWIB 1I6ZA 5AQJB 5AQPB 5AQMB 1UK5A 5AQOB 1T7SA 5AQUB 1HX1B 5AQNB 3FZLB 5AQFB 4HWDA 3FZMB 5AQRB 5AQTB 3A8YC 5AQIB 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWF A;  1UGO A;  5AQS B;  5AQL B;  1M7K A;  5AQV B;  3FZF B;  2D9D A;  1M62 A;  3LDQ B;  3M3Z B;  3FZH B;  5AQG B;  5AQK B;  4HWC A;  5AQH B;  4HWH A;  5AQQ B;  4HWI B;  1I6Z A;  5AQJ B;  5AQP B;  5AQM B;  1UK5 A;  5AQO B;  1T7S A;  5AQU B;  1HX1 B;  5AQN B;  3FZL B;  5AQF B;  4HWD A;  3FZM B;  5AQR B;  5AQT B;  3A8Y C;  5AQI B;  3FZK B; 
#chains in the Genus database with same CATH topology
 2JQ9 A;  3PE0 A;  5F8P A;  4L0R A;  2UUA T;  1WLX A;  1UX4 A;  5FVL A;  3ONX A;  2I0M A;  3H3M A;  1FMV A;  3KV9 A;  4WBO A;  4H9S E;  1T8B A;  5LMN T;  2J62 A;  2SPC A;  3IA3 A;  4EB6 E;  3OPC A;  5LNK A;  3N2G E;  2BG9 E;  1HF8 A;  2LSK A;  3PUV F;  2YDR A;  3WI3 A;  5AQL B;  3C98 B;  3Q2M A;  4LFC T;  2WZI A;  5JDG A;  3QOF A;  4IDZ A;  3LDQ B;  2Q9Q B;  2JPF A;  2YDQ A;  4TNV A;  2J47 A;  2WWV A;  4BJN A;  4GK0 E;  1KNR A;  2EHO A;  3N9N A;  4KHZ F;  3JC6 C;  3SWH A;  1ZV4 X;  5E0O A;  3SFD A;  4TWD A;  2B1E A;  2JJ9 A;  4DR6 T;  3PUA A;  2IDO B;  3VU7 H;  2OV9 A;  3X1D A;  2L9Q A;  2LSY A;  2FJB A;  3AEC A;  3ZMS B;  3F2E A;  4MBQ A;  2BS2 A;  5LHI B;  5BR8 T;  4YTM A;  3N9M A;  4DND A;  1LVK A;  5FL1 A;  2X67 A;  1HCI A;  3AXJ A;  4AXP A;  4WNK A;  4OK0 A;  1W09 A;  2CBJ A;  3RIU A;  1KFY A;  4HWD A;  5EZY E;  3O1J A;  5HEU A;  3ANW A;  3ZMT B;  2E9X C;  4XBF B;  5HCM A;  3AAE B;  4NPP A;  2CWO A;  3Q5X A;  3N2K E;  4IDN A;  2WY2 A;  5AQM B;  3EAM A;  4ZZB A;  4GYS A;  4X5T A;  4CI3 B;  4O4J E;  1YW0 A;  3GMI A;  5LBQ B;  4TZ4 C;  3JAF A;  4O4H E;  2XQ5 A;  4HWC A;  1AJ3 A;  1I6Z A;  4AQF C;  4ZS3 A;  5L3B B;  3KDS E;  3RQW A;  2VKO A;  1J5E T;  2E8I A;  4B3T T;  2FUP A;  2WU5 A;  3ONL C;  4DVD A;  4DO0 A;  2LJL A;  5HXH A;  2KXP B;  1YQ3 A;  2XQA A;  4O2A E;  3JAE A;  2IML A;  2VL8 A;  5LOV E;  2K48 A;  5EK2 A;  3MA9 A;  2IHR 1;  2XQ4 A;  4JBW F;  3A8Y C;  2CBI A;  3ZLI A;  4E7S A;  4O4I E;  4I0U A;  4JEU B;  1D1A A;  1HS7 A;  2YDS A;  3MZK B;  4ZHQ E;  5LXT E;  3RYC E;  4PFP A;  1XNR T;  3EI0 A;  3RRC A;  2DLR A;  4ZI3 D;  5F3J A;  1VCT A;  4HGA A;  2I6H A;  1OED E;  1ZOY A;  3KFW X;  3BQK A;  2X68 A;  4EZ4 A;  2XQY A;  3Q5W A;  2Y6X A;  4DV6 T;  4HFE A;  4IDO A;  1IZN B;  5EK3 A;  3B57 A;  3LBX A;  5TAO A;  4I55 E;  2IIU A;  2VVS A;  2E9X B;  1SUM B;  1J1J A;  3H3A A;  3ETV A;  4X1I E;  5ABF A;  1BR0 A;  5KXJ A;  2EHO C;  4GKJ T;  1OXZ A;  3RLF F;  3P8C D;  3R6N A;  3VKG A;  4OFZ A;  3UFG A;  3PUW F;  1UUS A;  2DI4 A;  4H63 H;  2HH7 A;  4LFB T;  3N9P A;  2UXC T;  2MBG A;  3ZYL A;  2HN2 A;  3ZEF B;  3L09 A;  2X9H A;  3RQU A;  2WAU A;  4QH4 A;  3CX8 B;  1T72 A;  4PW8 A;  2C5I T;  3ZN1 B;  3RIU C;  1KNZ A;  2V7M A;  3CML A;  2QGS A;  2CXL A;  4UV9 B;  3HI2 A;  4O4L E;  1UUR A;  3ZN0 B;  3ZJ1 A;  4DR3 T;  3P4W A;  2VKH A;  4JI2 T;  5JDM A;  5HXS A;  2PG8 A;  2IC6 A;  2CMR A;  5J2U E;  4B3R T;  4CZZ B;  2XUE A;  3NRY A;  3RKG A;  2LRL A;  3I0O A;  3F57 A;  2VWA A;  2XAQ B;  4XZC A;  2D5U A;  4YSY A;  2W67 A;  4QWN B;  2BS3 A;  1FMW A;  3MXZ A;  4EIW A;  2K24 A;  3VRA A;  4DR2 T;  5HWY A;  3C64 A;  3UUX B;  5ABG A;  2YN6 A;  2HPL A;  4DID B;  3RYI E;  1G8X A;  2FJD A;  5C8Y E;  1HX1 B;  1SE7 A;  2XHE B;  2D0T A;  3S4U A;  5LGT B;  1HFA A;  4KP3 C;  4YY3 T;  2LEH A;  1HR0 T;  4U7Y A;  4U74 A;  3RKO A;  4V1A v;  3U3I A;  4F6R C;  3EHZ A;  2ACZ A;  1S35 A;  1N36 T;  2W4X A;  2EHO B;  4JI1 T;  2XAF B;  3ZPO A;  2WSS V;  4MLK A;  4TNW A;  4Z8X A;  2V5C A;  3RX6 A;  2XAJ B;  4G2A A;  4WZX A;  4B3M T;  4KHP T;  1IBM T;  4P0A A;  4HFI A;  2XM2 A;  3TLT A;  4YSX A;  2Q9Q D;  2ZM0 A;  3N9O A;  4U31 A;  4DMV A;  4P0B A;  2XSA A;  5JH7 E;  4QKN A;  3ZC0 A;  3AXJ B;  3ZYM A;  3QB5 A;  2N9D A;  3JAD A;  5LYJ E;  3P50 A;  3ANW B;  2JQK A;  1W9R A;  3QNU A;  1UGO A;  3PV0 F;  3PUX F;  2LSI A;  1HNW T;  5FL0 A;  2IUB A;  1HNZ T;  5FY7 A;  4H9N C;  2LE8 A;  3LK3 B;  4TUY E;  2BBH A;  2XY8 B;  3MJX A;  4EXT A;  1OWA A;  2H7O A;  2C5J A;  1FIO A;  3ZSS A;  3M3Z B;  2XPK A;  3PUZ F;  2W66 A;  3ONJ A;  4UXN B;  4ERR A;  3G06 A;  4UVC B;  4JEH B;  4DR5 T;  2BG9 A;  4HFD A;  3MK7 C;  2XQ8 A;  4NXN T;  3CWZ B;  3NWI A;  4DMW A;  3FXE B;  2CLY B;  4QHO A;  5CB4 E;  4I4T E;  2BZB A;  2RA1 A;  4QXH B;  2CXD A;  2J4G A;  4GYR A;  4ZXL A;  2UXD T;  4LF5 T;  4DBQ A;  4I50 E;  1MMN A;  2WS3 A;  2V7J A;  4LFA T;  3A7M A;  3AVR A;  5AQH B;  2FJA A;  4PFO A;  3CQX C;  2IW5 B;  3AEA A;  3N9L A;  1VOM A;  2L3L A;  3AA1 B;  4C90 A;  3ABV A;  3CVR A;  4IE0 A;  1IJ5 A;  3P7I A;  2V7I A;  4NUU A;  4OHF A;  4TX5 A;  5CGM A;  1M62 A;  4XAX B;  3BQI A;  2CCQ A;  5HXE A;  2D2S A;  2W2U A;  3UUB A;  3AE4 A;  5AQN B;  1Y01 A;  4HFV A;  3UFE A;  2A3D A;  2DL1 A;  3LBX B;  3LK2 B;  3JC6 D;  5L3C B;  3VR8 A;  2V7K A;  5AQP B;  4YTP A;  4HE8 A;  2X9Y A;  4YJ2 E;  2CRB A;  4JI0 T;  5ABF B;  4UF0 A;  2NOX A;  3UT5 E;  2NTX A;  2CHO A;  3KBU A;  1SA0 E;  3PUS A;  2CPT A;  2XM1 A;  2X0H A;  2XZE A;  3RHW A;  4X1Y E;  2BDE A;  1VCS A;  3UU5 A;  2ZM8 A;  4ASK A;  5FXX A;  2KT9 A;  2BVM A;  5LMU T;  4GKK T;  5JRC B;  4WW0 A;  5IHY A;  2RPA A;  4H9Q C;  3ZST A;  5C3J A;  1YXR A;  2LKH A;  1LRZ A;  2E9X D;  2CHN A;  2GK9 A;  1ZEE A;  3HKC E;  3OYX A;  4DR4 T;  4EV6 A;  4PK5 A;  2LM2 A;  2QYW A;  4TWF A;  1W0B A;  3CIR A;  2LSJ A;  2Z6E A;  1E7P A;  3UQ7 A;  2AXD S;  2WMN A;  3WAJ A;  4HWF A;  4QH5 A;  4OYK A;  4TV8 E;  1IBK T;  3LK4 2;  4GOU A;  2D9D A;  5LHH B;  4U33 A;  1WFD A;  5AQJ B;  4AKI A;  3AEF A;  4COF A;  3ESL A;  1SHZ C;  1US7 B;  2WBL A;  2XQ7 A;  5DJQ C;  4U7I A;  5LCY A;  4DR7 T;  4AKL A;  5FVK A;  1OED A;  3LSV A;  3IHR A;  3AVS A;  5KDM C;  4PK4 A;  5ADX L;  4NIQ A;  4UV8 B;  2LOP A;  2V6Y A;  2A2F X;  1X9B A;  2W62 A;  4JI8 T;  2KZ7 B;  4ANJ A;  3HR0 A;  3AA6 B;  4QXC B;  3ZMZ B;  5JDH A;  1D1C A;  3AEE A;  3B13 A;  4IDQ A;  2BG9 C;  4C91 A;  5HWX A;  1VRB A;  1W0A A;  3FZF B;  2K9A A;  4X66 T;  4X65 T;  1MND A;  4ILB A;  3Q9D A;  2LKG A;  3GA8 A;  5CJ5 A;  1S94 A;  3QUJ A;  5HEG A;  4IE6 A;  3OVU A;  3AAI A;  3T8O A;  2W00 A;  3AA0 B;  3IBP A;  2MYS A;  5L4E A;  1ZHC A;  2UUB T;  4HWI B;  2LLY A;  2YU1 A;  2MTQ A;  2Y48 B;  2H88 A;  3P4Q A;  2OLT A;  3TLU A;  3AE2 A;  1Y64 B;  4CN1 A;  2CE7 A;  1T98 A;  2DNX A;  4UVA B;  2X0L B;  5JDN A;  2VUR A;  4IE5 A;  3AE1 A;  5HEO A;  3RRW A;  2BKP A;  3TKL B;  2UXB T;  1NEK A;  3HKB E;  3OKQ A;  5H6Q B;  4H9R C;  2H7V C;  2LHR A;  4JI7 T;  5IUX A;  3EDU A;  4O8S A;  3FZH B;  4JI6 T;  3TLW A;  4EOZ B;  2EHO D;  3KV4 A;  5CFB A;  1FEW A;  4NUV A;  4EEB A;  5HCJ A;  5AQU B;  3VR9 A;  4ZOL E;  5HEH A;  5JRC A;  3O1I A;  2NP9 A;  2V26 A;  3E22 E;  5L3D B;  3V5S A;  3MAC A;  4IE7 A;  3FHN A;  2DWG A;  2C5K T;  1QLB A;  4Z91 A;  2NR4 A;  2X9X A;  2LHN A;  2IC9 A;  2XSB A;  3FZK B;  4UIG A;  3NZP A;  5J1G A;  2BS4 A;  3QK6 A;  2VAS A;  3AE7 A;  1HX8 A;  3PUY F;  3NKZ A;  2A72 A;  3PU8 A;  2WCA A;  2BG9 B;  3EAB A;  3GWH A;  4CXW A;  3KV6 A;  3ZKR A;  4EZH A;  4IE4 A;  1G73 A;  4X20 E;  2KWI B;  1R8I A;  4LF8 T;  5JDF A;  4J2C A;  3PDY A;  2QA7 A;  2OA5 A;  3VHL A;  4X1K E;  3K3Q C;  2NTY A;  2YIN A;  4KI0 F;  2ES0 A;  3K1S A;  4HKA A;  2DCF A;  1NEN A;  4YTN A;  3C4Z A;  4Q25 A;  1XWM A;  4YLH A;  2WDR A;  2CA5 A;  1KNP A;  4ZZC A;  1OED C;  3LG7 A;  2YK0 A;  3AED A;  3R84 B;  1V9D A;  2CLY C;  2LSG A;  5AQI B;  2JQQ A;  5HXR A;  3D0T A;  4KX6 A;  2KLQ A;  4KMC A;  3CPZ A;  2ODU A;  1YD8 G;  3CX6 B;  3GN5 A;  3K3O A;  1CUN A;  1MMD A;  2C0S A;  1BR1 A;  3DTO A;  3N2O A;  2QVA A;  3IF8 B;  4EAH A;  3UU8 A;  1I94 T;  2UU9 T;  1J5W A;  2VQE T;  2VL0 A;  2LRK A;  3I0Q A;  4HWH A;  4A56 A;  1ZKE A;  2E5V A;  4WYV A;  1YKE B;  2MOZ A;  2H89 A;  2N1G A;  4UF0 B;  1NAF A;  2AE9 A;  1MIY A;  5ABH A;  3M65 A;  4LF7 T;  3PUQ A;  5LG3 A;  2E2A A;  3UQ4 A;  2JIW A;  3RI5 A;  3OBV E;  3IEE A;  1D1B A;  2A9U A;  5AQT B;  2HPJ A;  5L2L A;  2W0G A;  5FXZ A;  3J7Y q;  5GON E;  5JR9 A;  4F8H A;  3NRX A;  1WYC A;  3CX7 B;  1MMG A;  4ADZ A;  2P9B A;  3CKD A;  5AQR B;  5J0Z A;  4PAG A;  3EVY A;  4ILC A;  1H7C A;  3ZYK A;  1WYB A;  3I1A A;  5HYA A;  3A5X A;  4DV2 T;  4DBR A;  1HG2 A;  2KWH A;  4UVB B;  5L3F B;  4HEA A;  3RYF E;  3Q5D A;  4ZI2 D;  5L4H A;  4ILA A;  4QX8 B;  3SS1 A;  1KEY A;  3OYZ A;  2J1D G;  3PUR A;  1OED B;  4DV1 T;  2KSR A;  1B7T A;  5BMV E;  4B3S T;  2V6Y B;  2UXN B;  5CA0 E;  5FY0 A;  4MHC A;  2XAS B;  1JNZ A;  1L0V A;  3QB5 K;  3B5M A;  3N5L A;  4GIW A;  5CA1 E;  5FXV A;  2FBW A;  5KMG P;  4TN7 B;  4HN9 A;  3SOL A;  5AQG B;  5DAB A;  5AQQ B;  3DP7 A;  2VQF T;  2KMF A;  5AQO B;  5DQV A;  2RP4 A;  5L3G B;  3FZM B;  3FBL A;  1N33 T;  4IRE A;  5LHG B;  2ZM2 A;  3AE6 A;  1N32 T;  4B6X A;  4K0K T;  4TWH A;  2WWU A;  3SRZ A;  2BKN A;  1KF6 A;  3P4P A;  4LF4 T;  3U78 A;  3UUM A;  5FNV E;  3W15 B;  4DUZ T;  1YQ4 A;  4K0U A;  3F31 A;  4YJ3 E;  4EED A;  3AA7 B;  5LJN A;  1IJ6 A;  4QH1 A;  2KND A;  3NBX X;  5M4Y A;  4OYJ A;  2F4V T;  4BA9 A;  4UEM A;  4DR1 T;  3UU3 A;  5EK4 A;  1MIW A;  4H9P C;  2ZM6 T;  3I9Y A;  2B76 A;  4UR9 A;  3RF1 A;  1DU2 A;  3QC9 A;  2R6G F;  3KBT A;  2VKJ A;  2MAW A;  5AFU L;  3ZCI A;  2V8S V;  2M6I A;  1UX5 A;  1MMA A;  3E08 A;  3VRB A;  1U5P A;  2WZH A;  2JMK A;  4H9O C;  4FI5 A;  1M7K A;  4CN6 A;  3C4W A;  3RIF A;  4BAY B;  5LJM A;  4PJM A;  3RPU A;  4QX7 B;  2UXX B;  3PJA J;  2PJQ A;  2X51 A;  3Q5E A;  3UUN A;  4E7Z A;  3AEG A;  2Y8D A;  5HXC A;  4BJM A;  4CI2 B;  4PK6 A;  3ZMV B;  3HKD E;  5FP3 A;  5LBM A;  3CK6 A;  3AE3 A;  2ACX A;  2DHR A;  2BKO A;  4L5G A;  1T7S A;  3JCF A;  4HFB A;  2YKS A;  3FB2 A;  2JQH A;  4PJN A;  2UUC T;  4LML A;  4LF6 T;  2LM9 A;  1BR4 A;  1E2A A;  5HAX A;  2YOE A;  2WMO A;  4AKG A;  4ISS A;  4YT0 A;  4JV5 T;  5JR9 C;  4P1N A;  3ZMU B;  1QSD A;  3BK9 A;  2I59 A;  4DV3 T;  1D0Z A;  5LB7 B;  4U72 A;  4QXB B;  5FYM A;  2WQY A;  3SFE A;  4X64 T;  3H37 A;  4IHJ E;  2XAH B;  3ZJ2 A;  4ILU A;  4MAL A;  4AI6 A;  5JTG A;  4G63 A;  1QUU A;  4A5X A;  4EYY R;  2XJ7 A;  3L8R A;  4ZEY A;  4EYU A;  2HN1 A;  4YHJ A;  1IAP A;  3PU3 A;  2WDV A;  1X79 A;  2K5B B;  3RH3 A;  3O1H A;  1CHU A;  2CWY A;  2YU2 A;  2KIN B;  4AKH A;  1D0X A;  3CQC B;  3EUH A;  2VB6 A;  3N9Q A;  5L3E B;  4HFH A;  2W61 A;  3AAA B;  4A97 A;  1XDO A;  2XQ9 A;  1GQE A;  4I43 B;  4DV5 T;  4IIJ E;  3UTK A;  2WU2 A;  3GN5 B;  4CXX A;  4DV4 T;  4CQI A;  4DV7 T;  2CEA A;  4ZI3 C;  1Z0P A;  5H6R B;  4AQY T;  2CXF A;  3FXD B;  4LF9 T;  4OX9 T;  2LOS A;  4IT4 A;  3LFM A;  2V5D A;  3HL6 A;  3L39 A;  4KUM B;  2Q9Q A;  1HG5 A;  1XMO T;  5JVD E;  4FJO A;  3EDV A;  5AQF B;  2WDQ A;  3T1Y T;  4LMJ A;  2V1D B;  2ZLY A;  1BR2 A;  4JYA T;  1XNQ T;  4N78 D;  4JI3 T;  3K8P C;  3VKH A;  3AE5 A;  2XAG B;  1N34 T;  5ETW A;  4X62 T;  5L47 A;  4IL4 A;  4WBN E;  5A1L A;  4ZI7 E;  2N2N A;  2M67 A;  2NW9 A;  2LT3 A;  3RYH E;  2X9W A;  2JMH A;  5JR9 B;  2ZMA A;  4PNI A;  5IWA T;  3MKD A;  4AQG A;  2VKD A;  1MIV A;  3E0Z A;  3TLV A;  4HFC A;  2IAK A;  5DQW A;  2NW8 A;  4M1P A;  5LA6 E;  1WCR A;  1WR0 A;  3LJC A;  2NWB A;  1XZY A;  2PFV A;  3DJB A;  5FXW A;  4U2Y A;  2CM0 A;  5FY1 A;  3OTO T;  2WB5 A;  4JI4 T;  3KVB A;  4IGU A;  3RGL A;  1UCU A;  3TLS A;  3C50 A;  5AQK B;  3P4R A;  4IST A;  3RC3 A;  2PTF A;  3ZT7 A;  5HEJ A;  5F5W A;  2XQ6 A;  3ZT6 A;  3PTR B;  3RC8 A;  1U4Q A;  2K3W A;  4LMK A;  1LVF A;  5KX5 E;  1UK5 A;  4YHH T;  2BBJ A;  3UU4 A;  2HHH T;  3HKE E;  3AE9 A;  2X0Y A;  3O9X A;  2V6X A;  2MPK A;  4DV0 T;  3PUG A;  2NW7 A;  4Z90 A;  3HA4 A;  3KIN B;  3ZCJ A;  3P4S A;  5C2T A;  3C4X A;  3KV5 A;  5LG4 A;  4P09 A;  3T1H T;  4JUY A;  4EGW A;  2L8K A;  4PJL A;  1YKH B;  2D0U A;  3RIA A;  3K3N A;  3ZC1 A;  1HNX T;  3FZL B;  3J9X 1;  1E1H B;  1D0Y A;  4YXD A;  4ZS2 A;  4JLE A;  4CN4 A;  1MNE A;  5AQV B;  4IL9 A;  1EZ3 A;  2WP9 A;  4YFS A;  2G0U A;  4L9I A;  1WRD A;  1IBL T;  1HTJ F;  2E9X A;  3AB3 B;  2DWK A;  2Q9Q C;  4CXY A;  2E5L T;  4YSZ A;  2PBI A;  5FKY A;  2H3R A;  4PJJ A;  4UEL A;  5JRE A;  3WAK A;  1ZP0 A;  3NZQ A;  1LKX A;  3AEB A;  4O2B E;  2W63 A;  4MFR A;  4U3C A;  2M6B A;  5JDL A;  3AE8 A;  4GK5 E;  5AQS B;  4AQF A;  4AKR B;  5IYZ E;  3CQG B;  3NVO A;  4AIU A;  3ETU A;  1O3X A;  1JNR A;  2XQ3 A;  3OJA A;  4JI5 T;  3FBZ A;  2YEV C;  5JDQ A;  2JRK A;  2ODV A;  5LP6 E;  3UUL A;  4IDP A;  1XDP A;  2WM9 A;  4AIS A;  5J2T E;  3C51 A;  4ZI2 C;  2V7L A;  1Z8U A;  1FJG T;  3UU6 A;  5LGU B;  3V5U A;  4U2Z A;  4DUY T;  4TV9 E;  2VK9 A;  4HTE A;  3L3P A;  3ZT5 A;  5ABE A;  2QRX A;  2BVL A;  3KVA A;  2VVN A;  5JQG E;  4H63 V;  2X66 A;  1NWM X;  2XTL A;  1XMQ T;  4A98 A;  4CI1 B;  1KK7 A;  2FJE A;  3O4X E;  4NXM T;  5FMN A;  4KBM B;  3I9W A;  3BQL A;  1WR6 A;  5LGN B;  3PJA A; 
#chains in the Genus database with same CATH homology
 4HWF A;  1UGO A;  5AQS B;  5AQL B;  1M7K A;  5AQV B;  3FZF B;  2D9D A;  1M62 A;  3LDQ B;  3M3Z B;  3FZH B;  5AQG B;  5AQK B;  4HWC A;  5AQH B;  4HWH A;  5AQQ B;  4HWI B;  1I6Z A;  5AQJ B;  5AQP B;  5AQM B;  1UK5 A;  5AQO B;  1T7S A;  5AQU B;  1HX1 B;  5AQN B;  3FZL B;  5AQF B;  4HWD A;  3FZM B;  5AQR B;  5AQT B;  3A8Y C;  5AQI B;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...