5AQKB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
molecule tags Chaperone
source organism Homo sapiens
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqkB00
5AQPB 5AQQB 3M3ZB 5AQJB 5AQNB 1I6ZA 5AQMB 3FZFB 5AQHB 3A8YC 4HWCA 4HWIB 2D9DA 1T7SA 1UK5A 1HX1B 5AQUB 4HWDA 1M62A 5AQTB 1M7KA 1UGOA 3LDQB 4HWHA 5AQKB 5AQVB 5AQFB 5AQLB 3FZLB 5AQGB 3FZMB 3FZHB 5AQIB 5AQOB 5AQSB 5AQRB 4HWFA 3FZKB
chains in the Genus database with same CATH superfamily
1W0BA 2C5JA 4JEUB 2K9AA 3UFEA 4JYAT 1KEYA 3AE9A 3PTRB 2VVNA 3K8PC 1UUSA 3EUHA 3LK3B 2OV9A 3QUJA 1HS7A 2Y48B 1W09A 4PFPA 3TLTA 2WS3A 3AE8A 1MIVA 1J5WA 5CFBA 1WFDA 3O1HA 2Q9QB 4BA9A 2X9WA 1Y64B 2FJAA 2XSBA 2XAFB 5FVLA 4ANJA 4ZZBA 2LOSA 3CK6A 4DBQA 4B3ST 3ZMVB 4ISTA 1T8BA 1D0XA 2E5LT 3V5SA 3Q5DA 2V6YA 2JQKA 1S35A 2J62A 2A2FX 2CRBA 2EHOA 4COFA 2BG9E 5AQNB 2E9XA 4GYSA 1QSDA 3I9YA 4UF0A 3DP7A 1G73A 5HXSA 3FZLB 5LJNA 4H63H 2NW7A 1W9RA 4CXYA 4LF5T 4DR5T 4PJNA 3ZJ2A 3N2OA 2BS2A 3KV9A 4H9NC 3UU8A 5HCJA 4LF9T 2BS3A 3WAKA 5EK4A 2N1GA 2XM1A 4I55E 3CX8B 4PNIA 4UV8B 4X64T 4H9PC 2LKHA 4HEAA 1MNEA 2MTQA 3ZPOA 4UVAB 2YDQA 4XBFB 3AA7B 4ILBA 3LFMA 4WYVA 3RLFF 4U33A 4EEDA 3QK6A 1OWAA 3AEDA 3A7MA 1CHUA 2N2NA 4O4HE 1XNQT 4X66T 3C50A 4CN4A 2CMRA 2WMNA 3LK2B 2BDEA 5KDMC 5LBMA 2V1DB 2XQ9A 2Y6XA 4CI3B 2Y8DA 1OEDE 3PUWF 2BBJA 2F4VT 3SWHA 4DR6T 2HH7A 1ZEEA 3VHLA 1HR0T 4YJ2E 4GOUA 4JI7T 4DIDB 5DJQC 1VRBA 2W0GA 2JMHA 3ETVA 2X0HA 5L4HA 2HN1A 1YQ4A 4QXCB 4GK0E 4EXTA 1LRZA 3AE7A 3SFDA 3KDSE 2DWGA 2KMFA 1OEDC 1O3XA 4DR4T 4EEBA 3ZCIA 4OYJA 3UUMA 4A5XA 4UXNB 4YFSA 1T7SA 5JH7E 3AEBA 2NP9A 4HN9A 3RKGA 4TV9E 2EHOD 5AQVB 5LB7B 4EYYR 3O4XE 4U7IA 2WAUA 4H9RC 1ZOYA 5E0OA 1R8IA 4PK4A 5LCYA 4B6XA 2V6YB 1V9DA 5M4YA 3L3PA 4L9IA 4AISA 2ZM8A 4WBNE 3T1HT 2E9XB 4CN6A 3MKDA 4YLHA 2DHRA 4QX7B 2NWBA 4I4TE 2LE8A 5JREA 4YTPA 3RYFE 4KMCA 2HPLA 3N9NA 3GWHA 4U3CA 1MMGA 1LKXA 3PUAA 3IBPA 2XJ7A 3UU5A 3CX7B 2H7OA 2FUPA 3AEAA 2I59A 2PBIA 5J2TE 4Z90A 2H89A 3P4RA 2P9BA 4HKAA 4BJNA 3AVRA 5L3BB 2NR4A 3VU7H 5JDHA 2A3DA 4YHHT 3RIFA 3UQ7A 4U7YA 1M7KA 5LG4A 5CGMA 4JV5T 4QWNB 1NEKA 3UU3A 4EB6E 3LJCA 2LRKA 2JQHA 5FKYA 1FEWA 4HFDA 4PJJA 4MALA 3OBVE 5HEOA 5LBQB 2IMLA 5AQTB 1ZHCA 5ABFA 4P0AA 2FJEA 4YTNA 5HWYA 3H3MA 2LSIA 4IREA 3M3ZB 3E0ZA 4P0BA 4TUYE 4KP3C 4E7SA 3I0OA 4ZXLA 2AXDS 3PUQA 5IHYA 1IBMT 3KVAA 4UVCB 2UU9T 2KINB 5KMGP 3FZMB 2XQ6A 5HWXA 4YTMA 3CMLA 2EHOC 5DQVA 4GKKT 4OYKA 2XAHB 3JCFA 2Q9QA 2XQ7A 4EAHA 4NUUA 2D0UA 5LGTB 3UTKA 3AA6B 4TZ4C 2PFVA 3RPUA 1G8XA 3F2EA 2ZLYA 1ZV4X 3AE6A 4E7ZA 2VVSA 2MBGA 2CEAA 2V5CA 2BZBA 4Z91A 4BAYB 4DMWA 3N2KE 3A8YC 4QH4A 3K3OA 5FXVA 4KX6A 4CQIA 3PUGA 2CA5A 1IAPA 5L2LA 3SFEA 2DWKA 2LSGA 2XSAA 3FZKB 4TV8E 5AQJB 3QNUA 3P4QA 2ODUA 3NBXX 2BKPA 2G0UA 4IGUA 2IC9A 3N9QA 4IDNA 3EI0A 2FJBA 4X20E 5JDLA 5FY7A 2UXDT 2XPKA 4A97A 2QVAA 4DVDA 4HWCA 4MHCA 5EK2A 4O8SA 1U5PA 3N9MA 3ONLC 2XAGB 4B3MT 1WR0A 3KV5A 4TWDA 3K1SA 4NUVA 4LMLA 4EGWA 1I94T 4L0RA 4X65T 4J2CA 3WAJA 2MPKA 2JQ9A 4DO0A 5C2TA 3QC9A 3UU4A 4NXMT 2LM2A 4I0UA 3C4XA 5HXEA 5J2UE 2LSJA 1KFYA 2BVLA 4DUYT 2H7VC 3QB5K 4EIWA 3F31A 1HTJF 2UXNB 2VL0A 4WNKA 3C98B 4YT0A 2UXCT 3AAIA 4AQFC 4DR2T 3ZSSA 2ZM6T 3P7IA 4I43B 4TX5A 4WW0A 1HNWT 2J1DG 2YKSA 5GONE 3RRWA 5FL0A 2V7IA 1D1BA 4HFIA 3ZYKA 3MXZA 3ZCJA 3TKLB 5ABFB 2LRLA 3ZC0A 4ZI7E 4LMKA 4ZS2A 3UT5E 5CA0E 5L3GB 2D9DA 4DV6T 4DNDA 3N5LA 2KWHA 5C8YE 3NVOA 2Q9QD 2BG9B 3JAFA 4HWFA 1MMDA 5AQPB 1MIYA 4IE5A 3KVBA 3UFGA 3VRBA 3AAEB 3RYHE 1D1AA 1HX8A 2YOEA 5AQGB 5LA6E 2J4GA 2DLRA 5LP6E 3MA9A 5JDFA 4QH1A 2VB6A 4YJ3E 4FJOA 2V7MA 2MYSA 4X1KE 3RQUA 3ONXA 2V7LA 3L8RA 4DMVA 2IC6A 2CXFA 2M6IA 3HKDE 4HFCA 3BK9A 5ABEA 4GKJT 5HEUA 3N2GE 3AE3A 3ZN0B 4UELA 2CLYB 4IL9A 2ODVA 3AA1B 2FBWA 1HG2A 4TNWA 3N9PA 4Q25A 3PUXF 4NIQA 1YD8G 3KBTA 4DV1T 3GN5A 2WMOA 5HXRA 1KNZA 3L09A 4DV3T 1N36T 3VR9A 2JRKA 4QXHB 3W15B 3PJAA 1LVKA 4ZHQE 4HGAA 2H88A 3ZN1B 2WDVA 4MFRA 1KNPA 3N9LA 2E2AA 5ABHA 4IHJE 2ES0A 3OJAA 3MJXA 2E8IA 2XQ5A 5BMVE 4U72A 1BR1A 1ZP0A 4LF8T 2WU5A 3OTOT 2VQET 2V7JA 1XMOT 4DBRA 3S4UA 4N78D 3P50A 2Q9QC 4OK0A 5HEGA 3KINB 3ZT5A 2IHR1 3LSVA 2KSRA 1SHZC 3PU3A 3RHWA 4F8HA 3D0TA 4NPPA 3RIAA 2V5DA 1YKHB 1FJGT 2I0MA 3VRAA 2WP9A 5DQWA 2YN6A 4HTEA 3R6NA 2XAQB 1S94A 3C51A 2VASA 2L3LA 2LHNA 4LMJA 5FY0A 1WRDA 1MIWA 3Q5XA 2LJLA 3M65A 3MZKB 4LFAT 4EOZB 5KX5E 2CBJA 3EABA 4UEMA 1J1JA 5AQMB 5LGNB 3CKDA 2M67A 3ZT7A 4O2AE 3K3QC 3HKEE 4I50E 4L5GA 1WYCA 2ZM2A 4AKIA 3UUXB 5FMNA 3HL6A 1QUUA 3I0QA 2LSKA 4ZI3D 2LOPA 3AA0B 3HI2A 4JI3T 3QOFA 3J7Yq 4TNVA 4H9SE 2OA5A 2XQ8A 2H3RA 3CQXC 3J9X1 3RKOA 5JR9B 5LGUB 2E9XD 1OXZA 3UU6A 4JI2T 2BKOA 4CN1A 3O9XA 1JNRA 4IDPA 3RIUA 5EK3A 3C4WA 4IE4A 4GK5E 3FXEB 2CWOA 4Z8XA 3ONJA 2A9UA 3UUNA 4FI5A 2X67A 2HHHT 4O4JE 3CQGB 1XDPA 3JADA 3GN5B 2XHEB 4ILCA 5JDGA 5LNKA 4ZOLE 2QRXA 3ZLIA 2LHRA 5AQIB 2VL8A 3V5UA 1WCRA 2UUCT 3CIRA 5BR8T 1AJ3A 2WCAA 4HFEA 4H63V 1MMAA 3PE0A 4UR9A 5HXCA 4X5TA 3P4WA 1U4QA 1D0ZA 2UXBT 5FXZA 3WI3A 4JI4T 5JDMA 2X66A 4ISSA 2W62A 4ILAA 3MK7C 2YU2A 3PUSA 3ZEFB 5AQKB 3B57A 3Q5WA 4DR3T 1XMQT 2AE9A 1YW0A 5EZYE 1BR2A 2VK9A 3ABVA 4TN7B 3DJBA 5HCMA 3RYIE 2LEHA 2CHOA 2PTFA 2XQAA 4UV9B 2XQYA 2JIWA 2BG9A 4C91A 5HXHA 2JMKA 4X1YE 4AKLA 4AKGA 2XM2A 3K3NA 2CHNA 4YXDA 4JUYA 2E9XC 4ZS3A 2WZHA 3AVSA 4UIGA 2XY8B 4CXXA 2W67A 5ABGA 2YDRA 3OVUA 3IHRA 2K48A 3AE5A 4KHZF 5IYZE 2KZ7B 3Q5EA 1YXRA 2C0SA 4MBQA 1XNRT 3ZYMA 5H6QB 1UURA 1VOMA 2PG8A 1FMWA 2DNXA 5C3JA 1N33T 4X1IE 3QB5A 2GK9A 3ZC1A 1US7B 4DUZT 2K5BB 1YQ3A 2ACXA 3ZMUB 4AKHA 5LMUT 3RF1A 2W2UA 5JQGE 4DV2T 3RGLA 2LM9A 4U2YA 3AE2A 1T98A 4H9OC 1E1HB 5AQOB 2D5UA 1OEDA 3UQ4A 2ZMAA 3TLSA 4AIUA 2KWIB 2X9XA 3RQWA 5HYAA 1SUMB 3PV0F 1NENA 3NWIA 3KFWX 4JI5T 1SE7A 2X0YA 4QXBB 2WDQA 4DR7T 3UUBA 5AQLB 2I6HA 2LLYA 4ADZA 5HEJA 4IDZA 2N9DA 1Y01A 3ZMZB 2J47A 4QKNA 4IE7A 1I6ZA 5H6RB 4WZXA 5JVDE 4HFBA 4CI2B 3X1DA 5IUXA 2BKNA 2LKGA 3C4ZA 4OFZA 1IBLT 2B76A 2V6XA 5F3JA 2DL1A 3CWZB 4LFCT 4AKRB 2NTXA 4U74A 3IA3A 2KLQA 4QX8B 3CPZA 3IF8B 2M6BA 3AB3B 4AXPA 5AQUB 1XWMA 2X9HA 4ZEYA 5CJ5A 3GMIA 3AEEA 3SRZA 3AE4A 2VWAA 5AQRB 4KI0F 5FY1A 3RC8A 5AQQB 3RIUC 4OX9T 4TWHA 4EV6A 2CM0A 4HWIB 4IT4A 3NZPA 5HAXA 1KF6A 3F57A 5CA1E 2LSYA 4B3RT 1IJ6A 5AQSB 1KNRA 2VKOA 4F6RC 4MLKA 3U3IA 2WZIA 3EAMA 5AQHB 5JDQA 5FNVE 3AE1A 4P09A 5DABA 1E7PA 4JI6T 5JR9A 5JTGA 3TLVA 2FJDA 2XTLA 5LHHB 5FYMA 3NZQA 5LOVE 4QH5A 4NXNT 1VCSA 4HFVA 3FBLA 3VR8A 3AECA 4HWDA 4IL4A 1NWMX 2WSSV 4LFBT 4HFHA 4YHJA 3AAAB 1BR0A 4ERRA 3HKBE 1E2AA 2CPTA 3NRYA 4B3TT 5J1GA 3PURA 3PUVF 2UUBT 5HEHA 3E08A 3RYCE 1UCUA 2VQFT 3ZMSB 2D2SA 5FXXA 3LBXB 4DV5T 4AQYT 1OEDB 2IW5B 4JI8T 4KHPT 4PAGA 3JAEA 1Z8UA 3CQCB 5JRCA 2BG9C 4ILUA 2VKHA 2WY2A 2K3WA 4EYUA 2CBIA 4HE8A 2B1EA 4K0UA 3ZSTA 3EHZA 2NTYA 1X79A 1NAFA 1HG5A 3LDQB 1QLBA 2W66A 3RI5A 2XUEA 3VKGA 1X9BA 3EDVA 3FBZA 3FHNA 1CUNA 3RX6A 5L3EB 1HNZT 3G06A 1IJ5A 4V1Av 3ANWA 2NW8A 3EDUA 3OYZA 3HR0A 5LJMA 3ZT6A 2CLYC 2KXPB 2HN2A 3I1AA 4DV7T 2Z6EA 5L4EA 3TLUA 5F8PA 4BJMA 1B7TA 4LF7T 3CX6B 3ZYLA 2RP4A 3LG7A 1DU2A 1N32T 4AI6A 5ADXL 3NKZA 1XDOA 3ETUA 4JI1T 4EZ4A 4KUMB 2X0LB 3BQIA 1UX5A 3EVYA 3MACA 4C90A 4LF6T 5FL1A 3P4PA 5L47A 4AQFA 1MMNA 3GA8A 1IBKT 5FVKA 2NOXA 4M1PA 3OPCA 2V8SV 4YSZA 2IDOB 2JPFA 2V26A 1JNZA 4ZI2D 3PUYF 3U78A 4XAXB 4H9QC 4P1NA 2W63A 3AXJA 2L8KA 3AEFA 3P4SA 4QHOA 3SOLA 3O1JA 5TAOA 3BQLA 3ESLA 4XZCA 2KT9A 3P8CD 1VCTA 2RA1A 1KK7A 3FXDB 4ZZCA 3HKCE 1H7CA 4PW8A 2C5IT 3B13A 4GYRA 2WB5A 2XQ3A 3JC6D 2EHOB 2LT3A 3R84B 4DV0T 4JEHB 4X62T 3ZJ1A 4UF0B 3I9WA 4U31A 1WYBA 4DV4T 4O2BE 1HFAA 4A56A 2RPAA 4GIWA 3HA4A 1HCIA 1ZKEA 3FB2A 2BBHA 2CCQA 3LK42 3ZMTB 3O1IA 1GQEA 1L0VA 1IZNB 2WDRA 3AEGA 2XQ4A 5AQFB 2CXLA 5JRCB 3IEEA 5F5WA 2IAKA 4EZHA 5KXJA 2CE7A 3N9OA 4CXWA 2K24A 1WLXA 1LVFA 3FZHB 1Z0PA 2V7KA 2VKJA 4LF4T 1EZ3A 2BVMA 4IDQA 4PK6A 5L3DB 1FIOA 2PJQA 2W4XA 5L3FB 4G2AA 2WQYA 1SA0E 1HX1B 2IUBA 4ZI3C 4PJLA 5JDNA 5JR9C 2XZEA 3UULA 3PU8A 3L39A 2E5VA 2W61A 3CVRA 2SPCA 3ANWB 3H3AA 1D0YA 2ZM0A 1FMVA 2CXDA 4IE0A 4ASKA 2A72A 4ZI2C 2JJ9A 2NW9A 2YEVC 2R6GF 2OLTA 5LHIB 1UGOA 2YU1A 2IIUA 2YINA 5LYJE 3Q2MA 4OHFA 1UX4A 5J0ZA 4YSXA 4U2ZA 5FXWA 4K0KT 4JBWF 2MAWA 1UK5A 5AFUL 3RC3A 3JC6C 4PFOA 2CWYA 4A98A 2QA7A 1N34T 5LHGB 2X51A 3B5MA 4G63A 4JLEA 1XZYA 4IDOA 5CB4E 1BR4A 2W00A 3T1YT 5LXTE 5L3CB 2DCFA 2QYWA 2MOZA 1J5ET 3AXJB 1WR6A 1D1CA 4TWFA 2WWVA 2KNDA 2DI4A 3PDYA 2YDSA 1W0AA 2ACZA 4YY3T 1HF8A 1M62A 2X9YA 3OKQA 3LBXA 2VURA 3RRCA 4AQGA 5LMNT 5A1LA 3KV4A 3TLWA 3KBUA 3BQKA 4UVBB 3T8OA 3PUZF 3C64A 3FZFB 2WWUA 2BS4A 3PJAJ 2L9QA 2WM9A 4JI0T 5FP3A 2WU2A 4HWHA 2HPJA 2QGSA 4O4LE 4CZZB 3KV6A 2XASB 4CI1B 5IWAT 4O4IE 2XAJB 2UXXB 3RH3A 3DTOA 4PK5A 4YSYA 2C5KT 2JQQA 2D0TA 4IIJE 5LG3A 2X68A 2UUAT 1YKEB 5ETWA 3NRXA 2WBLA 4PJMA 4IE6A 1MNDA 3E22E 3A5XA 3VKHA 4DR1T 3Q9DA 3H37A 1T72A 1HNXT 3SS1A 4WBOA 3OYXA 2YK0A 3ZKRA 4KBMB 2VKDA
chains in the Genus database with same CATH topology
5AQPB 5AQQB 3M3ZB 5AQJB 5AQNB 1I6ZA 5AQMB 3FZFB 5AQHB 3A8YC 4HWCA 4HWIB 2D9DA 1T7SA 1UK5A 1HX1B 5AQUB 4HWDA 1M62A 5AQTB 1M7KA 1UGOA 3LDQB 4HWHA 5AQKB 5AQVB 5AQFB 5AQLB 3FZLB 5AQGB 3FZMB 3FZHB 5AQIB 5AQOB 5AQSB 5AQRB 4HWFA 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQP B;  5AQQ B;  3M3Z B;  5AQJ B;  5AQN B;  1I6Z A;  5AQM B;  3FZF B;  5AQH B;  3A8Y C;  4HWC A;  4HWI B;  2D9D A;  1T7S A;  1UK5 A;  1HX1 B;  5AQU B;  4HWD A;  1M62 A;  5AQT B;  1M7K A;  1UGO A;  3LDQ B;  4HWH A;  5AQK B;  5AQV B;  5AQF B;  5AQL B;  3FZL B;  5AQG B;  3FZM B;  3FZH B;  5AQI B;  5AQO B;  5AQS B;  5AQR B;  4HWF A;  3FZK B; 
#chains in the Genus database with same CATH topology
 1W0B A;  2C5J A;  4JEU B;  2K9A A;  3UFE A;  4JYA T;  1KEY A;  3AE9 A;  3PTR B;  2VVN A;  3K8P C;  1UUS A;  3EUH A;  3LK3 B;  2OV9 A;  3QUJ A;  1HS7 A;  2Y48 B;  1W09 A;  4PFP A;  3TLT A;  2WS3 A;  3AE8 A;  1MIV A;  1J5W A;  5CFB A;  1WFD A;  3O1H A;  2Q9Q B;  4BA9 A;  2X9W A;  1Y64 B;  2FJA A;  2XSB A;  2XAF B;  5FVL A;  4ANJ A;  4ZZB A;  2LOS A;  3CK6 A;  4DBQ A;  4B3S T;  3ZMV B;  4IST A;  1T8B A;  1D0X A;  2E5L T;  3V5S A;  3Q5D A;  2V6Y A;  2JQK A;  1S35 A;  2J62 A;  2A2F X;  2CRB A;  2EHO A;  4COF A;  2BG9 E;  5AQN B;  2E9X A;  4GYS A;  1QSD A;  3I9Y A;  4UF0 A;  3DP7 A;  1G73 A;  5HXS A;  3FZL B;  5LJN A;  4H63 H;  2NW7 A;  1W9R A;  4CXY A;  4LF5 T;  4DR5 T;  4PJN A;  3ZJ2 A;  3N2O A;  2BS2 A;  3KV9 A;  4H9N C;  3UU8 A;  5HCJ A;  4LF9 T;  2BS3 A;  3WAK A;  5EK4 A;  2N1G A;  2XM1 A;  4I55 E;  3CX8 B;  4PNI A;  4UV8 B;  4X64 T;  4H9P C;  2LKH A;  4HEA A;  1MNE A;  2MTQ A;  3ZPO A;  4UVA B;  2YDQ A;  4XBF B;  3AA7 B;  4ILB A;  3LFM A;  4WYV A;  3RLF F;  4U33 A;  4EED A;  3QK6 A;  1OWA A;  3AED A;  3A7M A;  1CHU A;  2N2N A;  4O4H E;  1XNQ T;  4X66 T;  3C50 A;  4CN4 A;  2CMR A;  2WMN A;  3LK2 B;  2BDE A;  5KDM C;  5LBM A;  2V1D B;  2XQ9 A;  2Y6X A;  4CI3 B;  2Y8D A;  1OED E;  3PUW F;  2BBJ A;  2F4V T;  3SWH A;  4DR6 T;  2HH7 A;  1ZEE A;  3VHL A;  1HR0 T;  4YJ2 E;  4GOU A;  4JI7 T;  4DID B;  5DJQ C;  1VRB A;  2W0G A;  2JMH A;  3ETV A;  2X0H A;  5L4H A;  2HN1 A;  1YQ4 A;  4QXC B;  4GK0 E;  4EXT A;  1LRZ A;  3AE7 A;  3SFD A;  3KDS E;  2DWG A;  2KMF A;  1OED C;  1O3X A;  4DR4 T;  4EEB A;  3ZCI A;  4OYJ A;  3UUM A;  4A5X A;  4UXN B;  4YFS A;  1T7S A;  5JH7 E;  3AEB A;  2NP9 A;  4HN9 A;  3RKG A;  4TV9 E;  2EHO D;  5AQV B;  5LB7 B;  4EYY R;  3O4X E;  4U7I A;  2WAU A;  4H9R C;  1ZOY A;  5E0O A;  1R8I A;  4PK4 A;  5LCY A;  4B6X A;  2V6Y B;  1V9D A;  5M4Y A;  3L3P A;  4L9I A;  4AIS A;  2ZM8 A;  4WBN E;  3T1H T;  2E9X B;  4CN6 A;  3MKD A;  4YLH A;  2DHR A;  4QX7 B;  2NWB A;  4I4T E;  2LE8 A;  5JRE A;  4YTP A;  3RYF E;  4KMC A;  2HPL A;  3N9N A;  3GWH A;  4U3C A;  1MMG A;  1LKX A;  3PUA A;  3IBP A;  2XJ7 A;  3UU5 A;  3CX7 B;  2H7O A;  2FUP A;  3AEA A;  2I59 A;  2PBI A;  5J2T E;  4Z90 A;  2H89 A;  3P4R A;  2P9B A;  4HKA A;  4BJN A;  3AVR A;  5L3B B;  2NR4 A;  3VU7 H;  5JDH A;  2A3D A;  4YHH T;  3RIF A;  3UQ7 A;  4U7Y A;  1M7K A;  5LG4 A;  5CGM A;  4JV5 T;  4QWN B;  1NEK A;  3UU3 A;  4EB6 E;  3LJC A;  2LRK A;  2JQH A;  5FKY A;  1FEW A;  4HFD A;  4PJJ A;  4MAL A;  3OBV E;  5HEO A;  5LBQ B;  2IML A;  5AQT B;  1ZHC A;  5ABF A;  4P0A A;  2FJE A;  4YTN A;  5HWY A;  3H3M A;  2LSI A;  4IRE A;  3M3Z B;  3E0Z A;  4P0B A;  4TUY E;  4KP3 C;  4E7S A;  3I0O A;  4ZXL A;  2AXD S;  3PUQ A;  5IHY A;  1IBM T;  3KVA A;  4UVC B;  2UU9 T;  2KIN B;  5KMG P;  3FZM B;  2XQ6 A;  5HWX A;  4YTM A;  3CML A;  2EHO C;  5DQV A;  4GKK T;  4OYK A;  2XAH B;  3JCF A;  2Q9Q A;  2XQ7 A;  4EAH A;  4NUU A;  2D0U A;  5LGT B;  3UTK A;  3AA6 B;  4TZ4 C;  2PFV A;  3RPU A;  1G8X A;  3F2E A;  2ZLY A;  1ZV4 X;  3AE6 A;  4E7Z A;  2VVS A;  2MBG A;  2CEA A;  2V5C A;  2BZB A;  4Z91 A;  4BAY B;  4DMW A;  3N2K E;  3A8Y C;  4QH4 A;  3K3O A;  5FXV A;  4KX6 A;  4CQI A;  3PUG A;  2CA5 A;  1IAP A;  5L2L A;  3SFE A;  2DWK A;  2LSG A;  2XSA A;  3FZK B;  4TV8 E;  5AQJ B;  3QNU A;  3P4Q A;  2ODU A;  3NBX X;  2BKP A;  2G0U A;  4IGU A;  2IC9 A;  3N9Q A;  4IDN A;  3EI0 A;  2FJB A;  4X20 E;  5JDL A;  5FY7 A;  2UXD T;  2XPK A;  4A97 A;  2QVA A;  4DVD A;  4HWC A;  4MHC A;  5EK2 A;  4O8S A;  1U5P A;  3N9M A;  3ONL C;  2XAG B;  4B3M T;  1WR0 A;  3KV5 A;  4TWD A;  3K1S A;  4NUV A;  4LML A;  4EGW A;  1I94 T;  4L0R A;  4X65 T;  4J2C A;  3WAJ A;  2MPK A;  2JQ9 A;  4DO0 A;  5C2T A;  3QC9 A;  3UU4 A;  4NXM T;  2LM2 A;  4I0U A;  3C4X A;  5HXE A;  5J2U E;  2LSJ A;  1KFY A;  2BVL A;  4DUY T;  2H7V C;  3QB5 K;  4EIW A;  3F31 A;  1HTJ F;  2UXN B;  2VL0 A;  4WNK A;  3C98 B;  4YT0 A;  2UXC T;  3AAI A;  4AQF C;  4DR2 T;  3ZSS A;  2ZM6 T;  3P7I A;  4I43 B;  4TX5 A;  4WW0 A;  1HNW T;  2J1D G;  2YKS A;  5GON E;  3RRW A;  5FL0 A;  2V7I A;  1D1B A;  4HFI A;  3ZYK A;  3MXZ A;  3ZCJ A;  3TKL B;  5ABF B;  2LRL A;  3ZC0 A;  4ZI7 E;  4LMK A;  4ZS2 A;  3UT5 E;  5CA0 E;  5L3G B;  2D9D A;  4DV6 T;  4DND A;  3N5L A;  2KWH A;  5C8Y E;  3NVO A;  2Q9Q D;  2BG9 B;  3JAF A;  4HWF A;  1MMD A;  5AQP B;  1MIY A;  4IE5 A;  3KVB A;  3UFG A;  3VRB A;  3AAE B;  3RYH E;  1D1A A;  1HX8 A;  2YOE A;  5AQG B;  5LA6 E;  2J4G A;  2DLR A;  5LP6 E;  3MA9 A;  5JDF A;  4QH1 A;  2VB6 A;  4YJ3 E;  4FJO A;  2V7M A;  2MYS A;  4X1K E;  3RQU A;  3ONX A;  2V7L A;  3L8R A;  4DMV A;  2IC6 A;  2CXF A;  2M6I A;  3HKD E;  4HFC A;  3BK9 A;  5ABE A;  4GKJ T;  5HEU A;  3N2G E;  3AE3 A;  3ZN0 B;  4UEL A;  2CLY B;  4IL9 A;  2ODV A;  3AA1 B;  2FBW A;  1HG2 A;  4TNW A;  3N9P A;  4Q25 A;  3PUX F;  4NIQ A;  1YD8 G;  3KBT A;  4DV1 T;  3GN5 A;  2WMO A;  5HXR A;  1KNZ A;  3L09 A;  4DV3 T;  1N36 T;  3VR9 A;  2JRK A;  4QXH B;  3W15 B;  3PJA A;  1LVK A;  4ZHQ E;  4HGA A;  2H88 A;  3ZN1 B;  2WDV A;  4MFR A;  1KNP A;  3N9L A;  2E2A A;  5ABH A;  4IHJ E;  2ES0 A;  3OJA A;  3MJX A;  2E8I A;  2XQ5 A;  5BMV E;  4U72 A;  1BR1 A;  1ZP0 A;  4LF8 T;  2WU5 A;  3OTO T;  2VQE T;  2V7J A;  1XMO T;  4DBR A;  3S4U A;  4N78 D;  3P50 A;  2Q9Q C;  4OK0 A;  5HEG A;  3KIN B;  3ZT5 A;  2IHR 1;  3LSV A;  2KSR A;  1SHZ C;  3PU3 A;  3RHW A;  4F8H A;  3D0T A;  4NPP A;  3RIA A;  2V5D A;  1YKH B;  1FJG T;  2I0M A;  3VRA A;  2WP9 A;  5DQW A;  2YN6 A;  4HTE A;  3R6N A;  2XAQ B;  1S94 A;  3C51 A;  2VAS A;  2L3L A;  2LHN A;  4LMJ A;  5FY0 A;  1WRD A;  1MIW A;  3Q5X A;  2LJL A;  3M65 A;  3MZK B;  4LFA T;  4EOZ B;  5KX5 E;  2CBJ A;  3EAB A;  4UEM A;  1J1J A;  5AQM B;  5LGN B;  3CKD A;  2M67 A;  3ZT7 A;  4O2A E;  3K3Q C;  3HKE E;  4I50 E;  4L5G A;  1WYC A;  2ZM2 A;  4AKI A;  3UUX B;  5FMN A;  3HL6 A;  1QUU A;  3I0Q A;  2LSK A;  4ZI3 D;  2LOP A;  3AA0 B;  3HI2 A;  4JI3 T;  3QOF A;  3J7Y q;  4TNV A;  4H9S E;  2OA5 A;  2XQ8 A;  2H3R A;  3CQX C;  3J9X 1;  3RKO A;  5JR9 B;  5LGU B;  2E9X D;  1OXZ A;  3UU6 A;  4JI2 T;  2BKO A;  4CN1 A;  3O9X A;  1JNR A;  4IDP A;  3RIU A;  5EK3 A;  3C4W A;  4IE4 A;  4GK5 E;  3FXE B;  2CWO A;  4Z8X A;  3ONJ A;  2A9U A;  3UUN A;  4FI5 A;  2X67 A;  2HHH T;  4O4J E;  3CQG B;  1XDP A;  3JAD A;  3GN5 B;  2XHE B;  4ILC A;  5JDG A;  5LNK A;  4ZOL E;  2QRX A;  3ZLI A;  2LHR A;  5AQI B;  2VL8 A;  3V5U A;  1WCR A;  2UUC T;  3CIR A;  5BR8 T;  1AJ3 A;  2WCA A;  4HFE A;  4H63 V;  1MMA A;  3PE0 A;  4UR9 A;  5HXC A;  4X5T A;  3P4W A;  1U4Q A;  1D0Z A;  2UXB T;  5FXZ A;  3WI3 A;  4JI4 T;  5JDM A;  2X66 A;  4ISS A;  2W62 A;  4ILA A;  3MK7 C;  2YU2 A;  3PUS A;  3ZEF B;  5AQK B;  3B57 A;  3Q5W A;  4DR3 T;  1XMQ T;  2AE9 A;  1YW0 A;  5EZY E;  1BR2 A;  2VK9 A;  3ABV A;  4TN7 B;  3DJB A;  5HCM A;  3RYI E;  2LEH A;  2CHO A;  2PTF A;  2XQA A;  4UV9 B;  2XQY A;  2JIW A;  2BG9 A;  4C91 A;  5HXH A;  2JMK A;  4X1Y E;  4AKL A;  4AKG A;  2XM2 A;  3K3N A;  2CHN A;  4YXD A;  4JUY A;  2E9X C;  4ZS3 A;  2WZH A;  3AVS A;  4UIG A;  2XY8 B;  4CXX A;  2W67 A;  5ABG A;  2YDR A;  3OVU A;  3IHR A;  2K48 A;  3AE5 A;  4KHZ F;  5IYZ E;  2KZ7 B;  3Q5E A;  1YXR A;  2C0S A;  4MBQ A;  1XNR T;  3ZYM A;  5H6Q B;  1UUR A;  1VOM A;  2PG8 A;  1FMW A;  2DNX A;  5C3J A;  1N33 T;  4X1I E;  3QB5 A;  2GK9 A;  3ZC1 A;  1US7 B;  4DUZ T;  2K5B B;  1YQ3 A;  2ACX A;  3ZMU B;  4AKH A;  5LMU T;  3RF1 A;  2W2U A;  5JQG E;  4DV2 T;  3RGL A;  2LM9 A;  4U2Y A;  3AE2 A;  1T98 A;  4H9O C;  1E1H B;  5AQO B;  2D5U A;  1OED A;  3UQ4 A;  2ZMA A;  3TLS A;  4AIU A;  2KWI B;  2X9X A;  3RQW A;  5HYA A;  1SUM B;  3PV0 F;  1NEN A;  3NWI A;  3KFW X;  4JI5 T;  1SE7 A;  2X0Y A;  4QXB B;  2WDQ A;  4DR7 T;  3UUB A;  5AQL B;  2I6H A;  2LLY A;  4ADZ A;  5HEJ A;  4IDZ A;  2N9D A;  1Y01 A;  3ZMZ B;  2J47 A;  4QKN A;  4IE7 A;  1I6Z A;  5H6R B;  4WZX A;  5JVD E;  4HFB A;  4CI2 B;  3X1D A;  5IUX A;  2BKN A;  2LKG A;  3C4Z A;  4OFZ A;  1IBL T;  2B76 A;  2V6X A;  5F3J A;  2DL1 A;  3CWZ B;  4LFC T;  4AKR B;  2NTX A;  4U74 A;  3IA3 A;  2KLQ A;  4QX8 B;  3CPZ A;  3IF8 B;  2M6B A;  3AB3 B;  4AXP A;  5AQU B;  1XWM A;  2X9H A;  4ZEY A;  5CJ5 A;  3GMI A;  3AEE A;  3SRZ A;  3AE4 A;  2VWA A;  5AQR B;  4KI0 F;  5FY1 A;  3RC8 A;  5AQQ B;  3RIU C;  4OX9 T;  4TWH A;  4EV6 A;  2CM0 A;  4HWI B;  4IT4 A;  3NZP A;  5HAX A;  1KF6 A;  3F57 A;  5CA1 E;  2LSY A;  4B3R T;  1IJ6 A;  5AQS B;  1KNR A;  2VKO A;  4F6R C;  4MLK A;  3U3I A;  2WZI A;  3EAM A;  5AQH B;  5JDQ A;  5FNV E;  3AE1 A;  4P09 A;  5DAB A;  1E7P A;  4JI6 T;  5JR9 A;  5JTG A;  3TLV A;  2FJD A;  2XTL A;  5LHH B;  5FYM A;  3NZQ A;  5LOV E;  4QH5 A;  4NXN T;  1VCS A;  4HFV A;  3FBL A;  3VR8 A;  3AEC A;  4HWD A;  4IL4 A;  1NWM X;  2WSS V;  4LFB T;  4HFH A;  4YHJ A;  3AAA B;  1BR0 A;  4ERR A;  3HKB E;  1E2A A;  2CPT A;  3NRY A;  4B3T T;  5J1G A;  3PUR A;  3PUV F;  2UUB T;  5HEH A;  3E08 A;  3RYC E;  1UCU A;  2VQF T;  3ZMS B;  2D2S A;  5FXX A;  3LBX B;  4DV5 T;  4AQY T;  1OED B;  2IW5 B;  4JI8 T;  4KHP T;  4PAG A;  3JAE A;  1Z8U A;  3CQC B;  5JRC A;  2BG9 C;  4ILU A;  2VKH A;  2WY2 A;  2K3W A;  4EYU A;  2CBI A;  4HE8 A;  2B1E A;  4K0U A;  3ZST A;  3EHZ A;  2NTY A;  1X79 A;  1NAF A;  1HG5 A;  3LDQ B;  1QLB A;  2W66 A;  3RI5 A;  2XUE A;  3VKG A;  1X9B A;  3EDV A;  3FBZ A;  3FHN A;  1CUN A;  3RX6 A;  5L3E B;  1HNZ T;  3G06 A;  1IJ5 A;  4V1A v;  3ANW A;  2NW8 A;  3EDU A;  3OYZ A;  3HR0 A;  5LJM A;  3ZT6 A;  2CLY C;  2KXP B;  2HN2 A;  3I1A A;  4DV7 T;  2Z6E A;  5L4E A;  3TLU A;  5F8P A;  4BJM A;  1B7T A;  4LF7 T;  3CX6 B;  3ZYL A;  2RP4 A;  3LG7 A;  1DU2 A;  1N32 T;  4AI6 A;  5ADX L;  3NKZ A;  1XDO A;  3ETU A;  4JI1 T;  4EZ4 A;  4KUM B;  2X0L B;  3BQI A;  1UX5 A;  3EVY A;  3MAC A;  4C90 A;  4LF6 T;  5FL1 A;  3P4P A;  5L47 A;  4AQF A;  1MMN A;  3GA8 A;  1IBK T;  5FVK A;  2NOX A;  4M1P A;  3OPC A;  2V8S V;  4YSZ A;  2IDO B;  2JPF A;  2V26 A;  1JNZ A;  4ZI2 D;  3PUY F;  3U78 A;  4XAX B;  4H9Q C;  4P1N A;  2W63 A;  3AXJ A;  2L8K A;  3AEF A;  3P4S A;  4QHO A;  3SOL A;  3O1J A;  5TAO A;  3BQL A;  3ESL A;  4XZC A;  2KT9 A;  3P8C D;  1VCT A;  2RA1 A;  1KK7 A;  3FXD B;  4ZZC A;  3HKC E;  1H7C A;  4PW8 A;  2C5I T;  3B13 A;  4GYR A;  2WB5 A;  2XQ3 A;  3JC6 D;  2EHO B;  2LT3 A;  3R84 B;  4DV0 T;  4JEH B;  4X62 T;  3ZJ1 A;  4UF0 B;  3I9W A;  4U31 A;  1WYB A;  4DV4 T;  4O2B E;  1HFA A;  4A56 A;  2RPA A;  4GIW A;  3HA4 A;  1HCI A;  1ZKE A;  3FB2 A;  2BBH A;  2CCQ A;  3LK4 2;  3ZMT B;  3O1I A;  1GQE A;  1L0V A;  1IZN B;  2WDR A;  3AEG A;  2XQ4 A;  5AQF B;  2CXL A;  5JRC B;  3IEE A;  5F5W A;  2IAK A;  4EZH A;  5KXJ A;  2CE7 A;  3N9O A;  4CXW A;  2K24 A;  1WLX A;  1LVF A;  3FZH B;  1Z0P A;  2V7K A;  2VKJ A;  4LF4 T;  1EZ3 A;  2BVM A;  4IDQ A;  4PK6 A;  5L3D B;  1FIO A;  2PJQ A;  2W4X A;  5L3F B;  4G2A A;  2WQY A;  1SA0 E;  1HX1 B;  2IUB A;  4ZI3 C;  4PJL A;  5JDN A;  5JR9 C;  2XZE A;  3UUL A;  3PU8 A;  3L39 A;  2E5V A;  2W61 A;  3CVR A;  2SPC A;  3ANW B;  3H3A A;  1D0Y A;  2ZM0 A;  1FMV A;  2CXD A;  4IE0 A;  4ASK A;  2A72 A;  4ZI2 C;  2JJ9 A;  2NW9 A;  2YEV C;  2R6G F;  2OLT A;  5LHI B;  1UGO A;  2YU1 A;  2IIU A;  2YIN A;  5LYJ E;  3Q2M A;  4OHF A;  1UX4 A;  5J0Z A;  4YSX A;  4U2Z A;  5FXW A;  4K0K T;  4JBW F;  2MAW A;  1UK5 A;  5AFU L;  3RC3 A;  3JC6 C;  4PFO A;  2CWY A;  4A98 A;  2QA7 A;  1N34 T;  5LHG B;  2X51 A;  3B5M A;  4G63 A;  4JLE A;  1XZY A;  4IDO A;  5CB4 E;  1BR4 A;  2W00 A;  3T1Y T;  5LXT E;  5L3C B;  2DCF A;  2QYW A;  2MOZ A;  1J5E T;  3AXJ B;  1WR6 A;  1D1C A;  4TWF A;  2WWV A;  2KND A;  2DI4 A;  3PDY A;  2YDS A;  1W0A A;  2ACZ A;  4YY3 T;  1HF8 A;  1M62 A;  2X9Y A;  3OKQ A;  3LBX A;  2VUR A;  3RRC A;  4AQG A;  5LMN T;  5A1L A;  3KV4 A;  3TLW A;  3KBU A;  3BQK A;  4UVB B;  3T8O A;  3PUZ F;  3C64 A;  3FZF B;  2WWU A;  2BS4 A;  3PJA J;  2L9Q A;  2WM9 A;  4JI0 T;  5FP3 A;  2WU2 A;  4HWH A;  2HPJ A;  2QGS A;  4O4L E;  4CZZ B;  3KV6 A;  2XAS B;  4CI1 B;  5IWA T;  4O4I E;  2XAJ B;  2UXX B;  3RH3 A;  3DTO A;  4PK5 A;  4YSY A;  2C5K T;  2JQQ A;  2D0T A;  4IIJ E;  5LG3 A;  2X68 A;  2UUA T;  1YKE B;  5ETW A;  3NRX A;  2WBL A;  4PJM A;  4IE6 A;  1MND A;  3E22 E;  3A5X A;  3VKH A;  4DR1 T;  3Q9D A;  3H37 A;  1T72 A;  1HNX T;  3SS1 A;  4WBO A;  3OYX A;  2YK0 A;  3ZKR A;  4KBM B;  2VKD A; 
#chains in the Genus database with same CATH homology
 5AQP B;  5AQQ B;  3M3Z B;  5AQJ B;  5AQN B;  1I6Z A;  5AQM B;  3FZF B;  5AQH B;  3A8Y C;  4HWC A;  4HWI B;  2D9D A;  1T7S A;  1UK5 A;  1HX1 B;  5AQU B;  4HWD A;  1M62 A;  5AQT B;  1M7K A;  1UGO A;  3LDQ B;  4HWH A;  5AQK B;  5AQV B;  5AQF B;  5AQL B;  3FZL B;  5AQG B;  3FZM B;  3FZH B;  5AQI B;  5AQO B;  5AQS B;  5AQR B;  4HWF A;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...