5AQNB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 43
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqnB00
5AQVB 5AQPB 5AQHB 5AQMB 3LDQB 2D9DA 4HWCA 3FZLB 1UK5A 5AQTB 3FZFB 5AQFB 1M62A 3M3ZB 3FZKB 4HWIB 1M7KA 3FZMB 5AQNB 5AQGB 1HX1B 5AQUB 5AQQB 1I6ZA 5AQKB 1T7SA 5AQOB 3FZHB 5AQJB 1UGOA 3A8YC 5AQIB 4HWDA 5AQSB 5AQLB 5AQRB 4HWFA 4HWHA
chains in the Genus database with same CATH superfamily
4DBRA 3RGLA 4CI1B 4GIWA 4TWHA 5FVKA 4DUYT 3AE8A 1YXRA 2XJ7A 1MMNA 4B6XA 3K8PC 3M65A 3UUBA 3N9NA 1W9RA 3VRAA 3LJCA 1S35A 4LF4T 1KNPA 5F8PA 4TNWA 2WM9A 3AEBA 1N34T 4OFZA 3TKLB 3EHZA 2KT9A 2X51A 3RC8A 2H89A 2XAJB 5FXZA 3ABVA 2WDVA 3FB2A 4WW0A 3ANWB 4UVAB 1HX1B 2V6YA 3BQIA 3EI0A 1IJ6A 4AISA 4CI3B 2YOEA 4V1Av 3ZCIA 2WDRA 2SPCA 3AE1A 1D1CA 2NW8A 2WB5A 2WU5A 4TUYE 3WAKA 5ABFA 5AQIB 2DI4A 2ZM8A 3AA6B 4C90A 2KLQA 5ABGA 5FXWA 1Z0PA 2DL1A 3H3AA 4DR5T 3N2OA 5J1GA 2GK9A 2JQ9A 3OBVE 5KXJA 4X20E 5FL0A 2UXDT 3IF8B 2WS3A 1MMGA 4U2YA 2JMKA 2N9DA 2BG9C 1QUUA 3CQXC 5FP3A 3RLFF 3RYHE 3AEGA 4ZHQE 4YSXA 5M4YA 3LG7A 1ZOYA 1YQ3A 1U4QA 2IHR1 3MK7C 4TWFA 1WR6A 3ZLIA 5L3CB 2CRBA 4JI3T 2LT3A 2DWKA 2ODUA 2XASB 2KWIB 4TV8E 5IWAT 2BS3A 2Y6XA 1YW0A 1ZKEA 2WDQA 2XQAA 3L39A 2E5LT 4AI6A 5EK4A 4CN6A 3SWHA 2LM2A 2V7MA 2XQ8A 3ESLA 4IL9A 1HF8A 4HFVA 4IDOA 2LSGA 4YSYA 3ZC1A 1R8IA 4ZZCA 3UQ4A 4G2AA 2E9XD 1VCTA 2CPTA 4HFIA 2D2SA 3PUXF 2ACXA 4H9NC 4DIDB 4ISTA 3ANWA 3ZEFB 2VKOA 5EK2A 1NEKA 4LFCT 2FJBA 4YTNA 5LGNB 5LJNA 5HXCA 4O4IE 3EVYA 3Q5XA 3PU8A 4QH1A 2A2FX 4H9OC 4TNVA 4ASKA 1HTJF 3ZMVB 2ZM6T 3NVOA 3QK6A 4IGUA 2LKHA 5AQPB 3ZCJA 5L3FB 2UU9T 2VL0A 1Y01A 4KMCA 2UXCT 1KEYA 4IREA 2UUBT 4XZCA 3AE6A 5HCMA 4AKHA 4BA9A 2XHEB 4PJLA 3UQ7A 3AXJA 5C3JA 1XDPA 3UUNA 4DV3T 2CBIA 2G0UA 2YDRA 3GMIA 3E22E 2N2NA 3I1AA 4U3CA 5HEGA 5JTGA 2E9XC 3OYZA 2L9QA 1J5ET 2XAHB 2YN6A 3AE3A 3VR8A 3HKCE 2J1DG 2WY2A 2DNXA 2LOSA 3KBTA 2YU2A 2KXPB 2B76A 2I59A 3IA3A 1D0ZA 5HXHA 2XY8B 4H9SE 2C5IT 2VB6A 2CWOA 1UX4A 3JC6D 4HFBA 3MA9A 4ZS3A 4U31A 3PUZF 3KVAA 3RRCA 3ZSTA 2F4VT 3UU8A 2WSSV 4DMWA 2CCQA 3Q5EA 4KX6A 4TWDA 3CPZA 4CXYA 1I94T 2HPJA 3HL6A 3O1IA 2CMRA 3TLUA 5JREA 2XPKA 4H9PC 1H7CA 4ZI2C 5JR9C 1G73A 3HKDE 1QSDA 4ZEYA 5AQHB 5AQMB 2L3LA 2D9DA 2KWHA 3L8RA 3MKDA 2EHOD 1WLXA 2DCFA 3C4WA 2LRLA 4HWCA 4JUYA 2BS4A 2YKSA 4TN7B 4YLHA 2LHRA 2LRKA 2LJLA 3FHNA 5FY7A 2DHRA 3EABA 4AQGA 1HG2A 4CZZB 3ETUA 4JI5T 2CEAA 1E7PA 2WMNA 2HN1A 4HE8A 2XQYA 2J47A 2K9AA 2OLTA 1W09A 2WWUA 3EUHA 2X9WA 3FZMB 3HKEE 3L3PA 4IDNA 2XQ9A 4U72A 4E7ZA 3FXDB 2I6HA 4QX8B 4YTMA 3RIFA 1IJ5A 2FJDA 5CA1E 3RHWA 3PUGA 3EDUA 5LMNT 2YINA 1X79A 3A8YC 3E0ZA 5L47A 3SS1A 4UELA 3UFGA 4QX7B 4U7IA 3OKQA 4ZI2D 1CHUA 5F3JA 2XZEA 1T72A 1JNZA 4I4TE 3RX6A 2Y8DA 5KMGP 4PJJA 2XAQB 4MBQA 2A3DA 2XM2A 2Z6EA 4UF0B 1VOMA 4IDQA 2C5JA 2VURA 3FZLB 3MACA 4JLEA 4PK4A 4ZI3D 1Z8UA 4P1NA 1MIWA 3K3QC 3ZMZB 3C98B 4QHOA 1M62A 3JCFA 4LFAT 4J2CA 1YKEB 3D0TA 4DR4T 5L3GB 3PUAA 4I43B 4JI8T 3P8CD 4AKGA 5AQQB 1I6ZA 3PV0F 2XQ4A 5J0ZA 4F6RC 2IAKA 2CHNA 3N2KE 1BR2A 3OVUA 5F5WA 4GKJT 2X0HA 2XM1A 4JEHB 3GA8A 3ZKRA 1MIVA 3AXJB 5KDMC 5ETWA 5FY1A 2H3RA 2ACZA 4NUUA 1XMQT 4O8SA 5LG4A 2IIUA 2MYSA 2WWVA 1OWAA 2JMHA 2QYWA 3U3IA 1LRZA 5L3DB 3P4PA 5HAXA 2XUEA 5JDFA 2WP9A 4UV8B 2PJQA 4Z91A 2VKDA 2V7LA 3ZT6A 2PBIA 1S94A 1Y64B 2LSKA 3ZT7A 4AQYT 3PDYA 2M6IA 4HFHA 1HFAA 4MHCA 4P0AA 3MZKB 5IHYA 2XQ7A 2VASA 2P9BA 5AQTB 1J5WA 3K3NA 2KINB 3RYCE 4TZ4C 3K1SA 5FXXA 4DR7T 4LF8T 3PURA 2RP4A 4HWIB 1BR1A 1HG5A 4YTPA 3C50A 3RKGA 3ZMTB 4ZZBA 2CA5A 5C2TA 1BR0A 4OYKA 3F57A 4X5TA 5FXVA 1N36T 4LF6T 2XTLA 4MLKA 3RYFE 3RQWA 4AQFA 3HI2A 5EK3A 4UR9A 2DLRA 2MOZA 5LOVE 4BJMA 2Q9QA 5CJ5A 4F8HA 3ZT5A 5ADXL 5AQRB 5C8YE 4JI0T 4P09A 1O3XA 5ABHA 4DR3T 4B3RT 3LBXB 3N9QA 4MFRA 4UVCB 3RKOA 3DP7A 3KINB 2KSRA 3VU7H 4BJNA 3ZYKA 4ILCA 1L0VA 2UUAT 3PU3A 4GYSA 4A5XA 5JQGE 3P50A 3AA7B 4PFOA 5JRCA 1US7B 1NWMX 3V5UA 3ZPOA 4BAYB 1WFDA 1SE7A 3M3ZB 1LVKA 3X1DA 3ZMUB 2V6YB 4C91A 3PUYF 3I0QA 5J2UE 3QUJA 4UV9B 3KFWX 3UT5E 3QB5A 4DR1T 4YFSA 4G63A 2VVNA 3N2GE 4IE7A 1CUNA 1D0YA 3NBXX 3H37A 4PFPA 5HWYA 2W0GA 3R6NA 2LSIA 4EYUA 4YY3T 4I55E 2BVLA 2CE7A 1HS7A 2BG9E 3UTKA 3VR9A 2V1DB 3IHRA 4HGAA 2E9XA 2BZBA 4ISSA 2J62A 3LSVA 4EV6A 2OV9A 3TLWA 3BK9A 3CX8B 4ZI3C 3UU4A 4GKKT 3NKZA 2X9HA 2BKNA 2CXLA 4YJ2E 5DQVA 2KMFA 3CK6A 3AA0B 3C64A 4PW8A 4ILBA 4TX5A 3UUXB 3ZYLA 5TAOA 2W4XA 1G8XA 1U5PA 3ZYMA 3CWZB 5FMNA 2CHOA 2CWYA 1JNRA 3O1HA 2UUCT 2BS2A 2C5KT 2UXXB 2W67A 3A5XA 4HN9A 5FNVE 5L4HA 2ZMAA 5LGUB 3J7Yq 3FZKB 2WZIA 5CA0E 2V26A 3CQCB 4QWNB 5KX5E 4DNDA 4HFCA 4LF7T 4WZXA 4I0UA 5AQKB 2JJ9A 3F2EA 3KV6A 5JDHA 2EHOB 3UULA 3OTOT 3AEFA 2IW5B 4O4JE 4EZHA 1SA0E 4DV1T 3HKBE 1QLBA 1D0XA 5HXSA 4LFBT 2BBJA 2VKJA 4X1KE 2RA1A 2JQKA 3E08A 4ZXLA 1WYBA 5JVDE 4N78D 2ZLYA 1YD8G 4JYAT 2XAGB 3CX6B 3PTRB 2PG8A 4L0RA 3CX7B 3RC3A 3TLSA 2D5UA 4H9RC 4IE0A 3LFMA 1W0BA 3ONJA 1WCRA 2CXDA 2JRKA 3NZQA 4GYRA 4U74A 3Q2MA 5HCJA 4IT4A 4X66T 3KV4A 2WMOA 4B3ST 5HYAA 4OK0A 1N32T 2BDEA 1MNDA 5FKYA 1LVFA 1FIOA 4EYYR 2KNDA 5LBQB 2BG9B 3U78A 2OA5A 1FJGT 4IE6A 3PUQA 4K0KT 2A9UA 3CVRA 3JC6C 1XNQT 2JQHA 2ZM2A 3K3OA 2V8SV 3PUWF 5LYJE 3RPUA 2NOXA 1T7SA 5DABA 2LM9A 4X1YE 2E2AA 1UUSA 2HPLA 2Q9QB 4JI1T 2W63A 3RRWA 2K3WA 3GN5A 3TLVA 4EZ4A 5JH7E 1T98A 2IUBA 4HWDA 1ZEEA 2IDOB 2R6GF 2EHOA 2V7KA 4ILUA 5FL1A 1ZHCA 3BQLA 5JR9A 4DV2T 5IYZE 3C51A 1V9DA 2D0UA 2X0YA 4NIQA 5FYMA 4CI2B 5LGTB 3LDQB 2Q9QD 3W15B 4DMVA 1MMDA 4B3MT 3EDVA 4QXBB 1MNEA 4E7SA 5DQWA 3FBLA 4DUZT 1OXZA 4CXWA 4U2ZA 5LHGB 1UK5A 2CBJA 3RYIE 4DR2T 1HR0T 4JI4T 3VKHA 2W61A 2VVSA 4UXNB 5LBMA 3N5LA 2YDQA 4Q25A 4XBFB 4M1PA 2J4GA 3AAIA 3RIAA 1D1BA 3RIUC 2X66A 3V5SA 1IBKT 2AE9A 4KHZF 3AEAA 3BQKA 4I50E 5L3EB 5IUXA 2WAUA 4PAGA 2VQFT 1LKXA 4EIWA 4LF9T 1XZYA 5AQOB 2H88A 4L5GA 2LOPA 3VRBA 2CLYB 2X9XA 4IDZA 2MBGA 5J2TE 4DV4T 2HN2A 3HA4A 5ABFB 1UGOA 2NR4A 3ZJ2A 4YHJA 5JDGA 3L09A 2LKGA 3OPCA 5AQSB 2IC6A 4ZOLE 3ZSSA 1XMOT 1SUMB 1XDOA 3KBUA 4HEAA 4AXPA 5LHHB 2LEHA 1OEDA 2W2UA 2X9YA 3B5MA 3KV9A 4IDPA 3TLTA 2QA7A 4X62T 2XSBA 2M6BA 2NW7A 4OX9T 4K0UA 1XWMA 3FXEB 5CB4E 4OYJA 1KK7A 3O9XA 1HCIA 2X0LB 4PJNA 4ANJA 5AFUL 3UU3A 2JPFA 4AKRB 4COFA 2LE8A 4EEBA 2RPAA 2YEVC 4LMJA 4QH4A 3ZJ1A 4EOZB 5HWXA 4FJOA 4EGWA 3CMLA 3JAEA 1IZNB 2XQ5A 3JADA 4DV7T 1KNZA 1UCUA 2XQ3A 3AAEB 4TV9E 3H3MA 3IEEA 1HNWT 3RIUA 3N9OA 4DR6T 4QXHB 2KZ7B 3Q9DA 2NP9A 3UU6A 1DU2A 4EEDA 3G06A 5HEOA 4HWFA 4HWHA 3SOLA 4P0BA 3C4XA 2CLYC 4DO0A 4NXNT 3DTOA 1UURA 3RF1A 4X1IE 2Q9QC 2W62A 3C4ZA 2ES0A 2UXNB 1KFYA 2VK9A 4H9QC 2C0SA 3CKDA 1AJ3A 5HXEA 4OHFA 2B1EA 2X68A 4DV5T 4DV6T 4IHJE 3SFDA 4JV5T 1NENA 4AKIA 3PJAA 2VWAA 2K48A 5LCYA 5AQFB 3AVSA 4Z90A 4EXTA 4KHPT 2K24A 2LHNA 1EZ3A 4A56A 3I9YA 3WAJA 1GQEA 4QH5A 3AE9A 3ONLC 2NW9A 2LSJA 3B57A 4MALA 4NXMT 4DBQA 3AE4A 3O4XE 4HFEA 4PJMA 4GK5E 2E5VA 3PJAJ 5HXRA 4U7YA 2IC9A 1WR0A 4X64T 4GOUA 4KBMB 5E0OA 5L4EA 2UXBT 2K5BB 2MAWA 3AVRA 3N9LA 2I0MA 3I9WA 3KVBA 3MJXA 3QOFA 3QNUA 4Z8XA 4WYVA 3RI5A 2V7JA 5LA6E 2WCAA 4LF5T 3AE2A 2H7OA 2YDSA 5LMUT 1BR4A 4HFDA 4KI0F 3IBPA 4WBOA 1MIYA 2MTQA 3T8OA 3UU5A 4O2AE 4QXCB 3SFEA 2VKHA 3T1YT 1IBLT 1M7KA 1W0AA 5DJQC 2V6XA 3PE0A 5AQGB 1E2AA 4ILAA 3FBZA 1OEDB 1T8BA 4HTEA 4KP3C 5FVLA 4JI2T 2BKPA 2X67A 2VQET 3QC9A 4XAXB 4HKAA 5FY0A 5AQJB 5L3BB 1WYCA 4UF0A 4H63V 5JDNA 2WQYA 3ZN0B 1HX8A 3EAMA 1FMVA 3B13A 3LK3B 2NTXA 3LK42 3P4WA 3S4UA 5LG3A 3MXZA 5H6QB 4X65T 5AQVB 2JIWA 3P7IA 3AECA 1YQ4A 1IBMT 5LP6E 2LSYA 5LHIB 1UX5A 3DJBA 3P4QA 4H63H 3AA1B 5EZYE 5LB7B 5JDLA 2ZM0A 4UEMA 2ODVA 2XAFB 2XSAA 1XNRT 4ZS2A 4A97A 3N9PA 1HNZT 3ETVA 4O2BE 2IMLA 3QB5K 5AQUB 3O1JA 4CN1A 2L8KA 4IIJE 3RQUA 4IE5A 4O4HE 4O4LE 4UVBB 3AE5A 3ZC0A 3AEEA 3AAAB 2HHHT 1N33T 2LLYA 1D1AA 5LXTE 5HEUA 4CQIA 4UIGA 4WBNE 2EHOC 5BMVE 5LNKA 5GONE 4YXDA 2V5CA 4DVDA 3AB3B 4CN4A 3Q5DA 3VHLA 4AKLA 3KV5A 4EB6E 4EAHA 3GWHA 5JDMA 2WU2A 3SRZA 1HNXT 3AE7A 2N1GA 1E1HB 2DWGA 4NPPA 3OYXA 2Y48B 1B7TA 1OEDE 3A7MA 3WI3A 3ZN1B 4YJ3E 3NRYA 4GK0E 1KNRA 1ZV4X 2V7IA 4LMKA 2QRXA 3RH3A 2V5DA 3NZPA 2FUPA 5JRCB 3VKGA 4ZI7E 4YSZA 2A72A 3AEDA 2JQQA 2BBHA 2XQ6A 4ERRA 3PUSA 5AQNB 1SHZC 3N9MA 4IL4A 4AQFC 1VCSA 3LBXA 2PTFA 1X9BA 3NWIA 3KDSE 3FZHB 1ZP0A 4KUMB 3UFEA 5JDQA 1NAFA 4FI5A 3UUMA 1YKHB 2E8IA 2AXDS 2BKOA 2W00A 3NRXA 5HEJA 2CM0A 5BR8T 5AQLB 3J9X1 5CGMA 4IE4A 2BVMA 4YHHT 3CIRA 4JBWF 3ONXA 4NUVA 2FJEA 5LJMA 4JI6T 4ADZA 4B3TT 2H7VC 1VRBA 1OEDC 5H6RB 4L9IA 4QKNA 4AIUA 4CXXA 3ZMSB 5A1LA 5CFBA 5JR9B 2YK0A 3CQGB 5L2LA 4LMLA 4JEUB 4WNKA 2D0TA 2MPKA 2NWBA 3FZFB 1WRDA 3I0OA 4PNIA 4U33A 4PK6A 3GN5B 2CXFA 1MMAA 2M67A 5ABEA 2PFVA 3F31A 3JAFA 2WZHA 3P4RA 2FBWA 2QGSA 4PK5A 4A98A 4YT0A 2NTYA 2FJAA 2VL8A 1FEWA 2YU1A 3T1HT 1FMWA 3PUVF 2HH7A 3P4SA 1J1JA 2WBLA 3R84B 2BG9A 1KF6A 2E9XB 1IAPA 4JI7T 3Q5WA 3LK2B 3HR0A 3OJAA 2QVAA 4DV0T 5HEHA 2W66A
chains in the Genus database with same CATH topology
5AQVB 5AQPB 5AQHB 5AQMB 3LDQB 2D9DA 4HWCA 3FZLB 1UK5A 5AQTB 3FZFB 5AQFB 1M62A 3M3ZB 3FZKB 4HWIB 1M7KA 3FZMB 5AQNB 5AQGB 1HX1B 5AQUB 5AQQB 1I6ZA 5AQKB 1T7SA 5AQOB 3FZHB 5AQJB 1UGOA 3A8YC 5AQIB 4HWDA 5AQSB 5AQLB 5AQRB 4HWFA 4HWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQV B;  5AQP B;  5AQH B;  5AQM B;  3LDQ B;  2D9D A;  4HWC A;  3FZL B;  1UK5 A;  5AQT B;  3FZF B;  5AQF B;  1M62 A;  3M3Z B;  3FZK B;  4HWI B;  1M7K A;  3FZM B;  5AQN B;  5AQG B;  1HX1 B;  5AQU B;  5AQQ B;  1I6Z A;  5AQK B;  1T7S A;  5AQO B;  3FZH B;  5AQJ B;  1UGO A;  3A8Y C;  5AQI B;  4HWD A;  5AQS B;  5AQL B;  5AQR B;  4HWF A;  4HWH A; 
#chains in the Genus database with same CATH topology
 4DBR A;  3RGL A;  4CI1 B;  4GIW A;  4TWH A;  5FVK A;  4DUY T;  3AE8 A;  1YXR A;  2XJ7 A;  1MMN A;  4B6X A;  3K8P C;  3M65 A;  3UUB A;  3N9N A;  1W9R A;  3VRA A;  3LJC A;  1S35 A;  4LF4 T;  1KNP A;  5F8P A;  4TNW A;  2WM9 A;  3AEB A;  1N34 T;  4OFZ A;  3TKL B;  3EHZ A;  2KT9 A;  2X51 A;  3RC8 A;  2H89 A;  2XAJ B;  5FXZ A;  3ABV A;  2WDV A;  3FB2 A;  4WW0 A;  3ANW B;  4UVA B;  1HX1 B;  2V6Y A;  3BQI A;  3EI0 A;  1IJ6 A;  4AIS A;  4CI3 B;  2YOE A;  4V1A v;  3ZCI A;  2WDR A;  2SPC A;  3AE1 A;  1D1C A;  2NW8 A;  2WB5 A;  2WU5 A;  4TUY E;  3WAK A;  5ABF A;  5AQI B;  2DI4 A;  2ZM8 A;  3AA6 B;  4C90 A;  2KLQ A;  5ABG A;  5FXW A;  1Z0P A;  2DL1 A;  3H3A A;  4DR5 T;  3N2O A;  5J1G A;  2GK9 A;  2JQ9 A;  3OBV E;  5KXJ A;  4X20 E;  5FL0 A;  2UXD T;  3IF8 B;  2WS3 A;  1MMG A;  4U2Y A;  2JMK A;  2N9D A;  2BG9 C;  1QUU A;  3CQX C;  5FP3 A;  3RLF F;  3RYH E;  3AEG A;  4ZHQ E;  4YSX A;  5M4Y A;  3LG7 A;  1ZOY A;  1YQ3 A;  1U4Q A;  2IHR 1;  3MK7 C;  4TWF A;  1WR6 A;  3ZLI A;  5L3C B;  2CRB A;  4JI3 T;  2LT3 A;  2DWK A;  2ODU A;  2XAS B;  2KWI B;  4TV8 E;  5IWA T;  2BS3 A;  2Y6X A;  1YW0 A;  1ZKE A;  2WDQ A;  2XQA A;  3L39 A;  2E5L T;  4AI6 A;  5EK4 A;  4CN6 A;  3SWH A;  2LM2 A;  2V7M A;  2XQ8 A;  3ESL A;  4IL9 A;  1HF8 A;  4HFV A;  4IDO A;  2LSG A;  4YSY A;  3ZC1 A;  1R8I A;  4ZZC A;  3UQ4 A;  4G2A A;  2E9X D;  1VCT A;  2CPT A;  4HFI A;  2D2S A;  3PUX F;  2ACX A;  4H9N C;  4DID B;  4IST A;  3ANW A;  3ZEF B;  2VKO A;  5EK2 A;  1NEK A;  4LFC T;  2FJB A;  4YTN A;  5LGN B;  5LJN A;  5HXC A;  4O4I E;  3EVY A;  3Q5X A;  3PU8 A;  4QH1 A;  2A2F X;  4H9O C;  4TNV A;  4ASK A;  1HTJ F;  3ZMV B;  2ZM6 T;  3NVO A;  3QK6 A;  4IGU A;  2LKH A;  5AQP B;  3ZCJ A;  5L3F B;  2UU9 T;  2VL0 A;  1Y01 A;  4KMC A;  2UXC T;  1KEY A;  4IRE A;  2UUB T;  4XZC A;  3AE6 A;  5HCM A;  4AKH A;  4BA9 A;  2XHE B;  4PJL A;  3UQ7 A;  3AXJ A;  5C3J A;  1XDP A;  3UUN A;  4DV3 T;  2CBI A;  2G0U A;  2YDR A;  3GMI A;  3E22 E;  2N2N A;  3I1A A;  4U3C A;  5HEG A;  5JTG A;  2E9X C;  3OYZ A;  2L9Q A;  1J5E T;  2XAH B;  2YN6 A;  3AE3 A;  3VR8 A;  3HKC E;  2J1D G;  2WY2 A;  2DNX A;  2LOS A;  3KBT A;  2YU2 A;  2KXP B;  2B76 A;  2I59 A;  3IA3 A;  1D0Z A;  5HXH A;  2XY8 B;  4H9S E;  2C5I T;  2VB6 A;  2CWO A;  1UX4 A;  3JC6 D;  4HFB A;  3MA9 A;  4ZS3 A;  4U31 A;  3PUZ F;  3KVA A;  3RRC A;  3ZST A;  2F4V T;  3UU8 A;  2WSS V;  4DMW A;  2CCQ A;  3Q5E A;  4KX6 A;  4TWD A;  3CPZ A;  4CXY A;  1I94 T;  2HPJ A;  3HL6 A;  3O1I A;  2CMR A;  3TLU A;  5JRE A;  2XPK A;  4H9P C;  1H7C A;  4ZI2 C;  5JR9 C;  1G73 A;  3HKD E;  1QSD A;  4ZEY A;  5AQH B;  5AQM B;  2L3L A;  2D9D A;  2KWH A;  3L8R A;  3MKD A;  2EHO D;  1WLX A;  2DCF A;  3C4W A;  2LRL A;  4HWC A;  4JUY A;  2BS4 A;  2YKS A;  4TN7 B;  4YLH A;  2LHR A;  2LRK A;  2LJL A;  3FHN A;  5FY7 A;  2DHR A;  3EAB A;  4AQG A;  1HG2 A;  4CZZ B;  3ETU A;  4JI5 T;  2CEA A;  1E7P A;  2WMN A;  2HN1 A;  4HE8 A;  2XQY A;  2J47 A;  2K9A A;  2OLT A;  1W09 A;  2WWU A;  3EUH A;  2X9W A;  3FZM B;  3HKE E;  3L3P A;  4IDN A;  2XQ9 A;  4U72 A;  4E7Z A;  3FXD B;  2I6H A;  4QX8 B;  4YTM A;  3RIF A;  1IJ5 A;  2FJD A;  5CA1 E;  3RHW A;  3PUG A;  3EDU A;  5LMN T;  2YIN A;  1X79 A;  3A8Y C;  3E0Z A;  5L47 A;  3SS1 A;  4UEL A;  3UFG A;  4QX7 B;  4U7I A;  3OKQ A;  4ZI2 D;  1CHU A;  5F3J A;  2XZE A;  1T72 A;  1JNZ A;  4I4T E;  3RX6 A;  2Y8D A;  5KMG P;  4PJJ A;  2XAQ B;  4MBQ A;  2A3D A;  2XM2 A;  2Z6E A;  4UF0 B;  1VOM A;  4IDQ A;  2C5J A;  2VUR A;  3FZL B;  3MAC A;  4JLE A;  4PK4 A;  4ZI3 D;  1Z8U A;  4P1N A;  1MIW A;  3K3Q C;  3ZMZ B;  3C98 B;  4QHO A;  1M62 A;  3JCF A;  4LFA T;  4J2C A;  1YKE B;  3D0T A;  4DR4 T;  5L3G B;  3PUA A;  4I43 B;  4JI8 T;  3P8C D;  4AKG A;  5AQQ B;  1I6Z A;  3PV0 F;  2XQ4 A;  5J0Z A;  4F6R C;  2IAK A;  2CHN A;  3N2K E;  1BR2 A;  3OVU A;  5F5W A;  4GKJ T;  2X0H A;  2XM1 A;  4JEH B;  3GA8 A;  3ZKR A;  1MIV A;  3AXJ B;  5KDM C;  5ETW A;  5FY1 A;  2H3R A;  2ACZ A;  4NUU A;  1XMQ T;  4O8S A;  5LG4 A;  2IIU A;  2MYS A;  2WWV A;  1OWA A;  2JMH A;  2QYW A;  3U3I A;  1LRZ A;  5L3D B;  3P4P A;  5HAX A;  2XUE A;  5JDF A;  2WP9 A;  4UV8 B;  2PJQ A;  4Z91 A;  2VKD A;  2V7L A;  3ZT6 A;  2PBI A;  1S94 A;  1Y64 B;  2LSK A;  3ZT7 A;  4AQY T;  3PDY A;  2M6I A;  4HFH A;  1HFA A;  4MHC A;  4P0A A;  3MZK B;  5IHY A;  2XQ7 A;  2VAS A;  2P9B A;  5AQT B;  1J5W A;  3K3N A;  2KIN B;  3RYC E;  4TZ4 C;  3K1S A;  5FXX A;  4DR7 T;  4LF8 T;  3PUR A;  2RP4 A;  4HWI B;  1BR1 A;  1HG5 A;  4YTP A;  3C50 A;  3RKG A;  3ZMT B;  4ZZB A;  2CA5 A;  5C2T A;  1BR0 A;  4OYK A;  3F57 A;  4X5T A;  5FXV A;  1N36 T;  4LF6 T;  2XTL A;  4MLK A;  3RYF E;  3RQW A;  4AQF A;  3HI2 A;  5EK3 A;  4UR9 A;  2DLR A;  2MOZ A;  5LOV E;  4BJM A;  2Q9Q A;  5CJ5 A;  4F8H A;  3ZT5 A;  5ADX L;  5AQR B;  5C8Y E;  4JI0 T;  4P09 A;  1O3X A;  5ABH A;  4DR3 T;  4B3R T;  3LBX B;  3N9Q A;  4MFR A;  4UVC B;  3RKO A;  3DP7 A;  3KIN B;  2KSR A;  3VU7 H;  4BJN A;  3ZYK A;  4ILC A;  1L0V A;  2UUA T;  3PU3 A;  4GYS A;  4A5X A;  5JQG E;  3P50 A;  3AA7 B;  4PFO A;  5JRC A;  1US7 B;  1NWM X;  3V5U A;  3ZPO A;  4BAY B;  1WFD A;  1SE7 A;  3M3Z B;  1LVK A;  3X1D A;  3ZMU B;  2V6Y B;  4C91 A;  3PUY F;  3I0Q A;  5J2U E;  3QUJ A;  4UV9 B;  3KFW X;  3UT5 E;  3QB5 A;  4DR1 T;  4YFS A;  4G63 A;  2VVN A;  3N2G E;  4IE7 A;  1CUN A;  1D0Y A;  3NBX X;  3H37 A;  4PFP A;  5HWY A;  2W0G A;  3R6N A;  2LSI A;  4EYU A;  4YY3 T;  4I55 E;  2BVL A;  2CE7 A;  1HS7 A;  2BG9 E;  3UTK A;  3VR9 A;  2V1D B;  3IHR A;  4HGA A;  2E9X A;  2BZB A;  4ISS A;  2J62 A;  3LSV A;  4EV6 A;  2OV9 A;  3TLW A;  3BK9 A;  3CX8 B;  4ZI3 C;  3UU4 A;  4GKK T;  3NKZ A;  2X9H A;  2BKN A;  2CXL A;  4YJ2 E;  5DQV A;  2KMF A;  3CK6 A;  3AA0 B;  3C64 A;  4PW8 A;  4ILB A;  4TX5 A;  3UUX B;  3ZYL A;  5TAO A;  2W4X A;  1G8X A;  1U5P A;  3ZYM A;  3CWZ B;  5FMN A;  2CHO A;  2CWY A;  1JNR A;  3O1H A;  2UUC T;  2BS2 A;  2C5K T;  2UXX B;  2W67 A;  3A5X A;  4HN9 A;  5FNV E;  5L4H A;  2ZMA A;  5LGU B;  3J7Y q;  3FZK B;  2WZI A;  5CA0 E;  2V26 A;  3CQC B;  4QWN B;  5KX5 E;  4DND A;  4HFC A;  4LF7 T;  4WZX A;  4I0U A;  5AQK B;  2JJ9 A;  3F2E A;  3KV6 A;  5JDH A;  2EHO B;  3UUL A;  3OTO T;  3AEF A;  2IW5 B;  4O4J E;  4EZH A;  1SA0 E;  4DV1 T;  3HKB E;  1QLB A;  1D0X A;  5HXS A;  4LFB T;  2BBJ A;  2VKJ A;  4X1K E;  2RA1 A;  2JQK A;  3E08 A;  4ZXL A;  1WYB A;  5JVD E;  4N78 D;  2ZLY A;  1YD8 G;  4JYA T;  2XAG B;  3CX6 B;  3PTR B;  2PG8 A;  4L0R A;  3CX7 B;  3RC3 A;  3TLS A;  2D5U A;  4H9R C;  4IE0 A;  3LFM A;  1W0B A;  3ONJ A;  1WCR A;  2CXD A;  2JRK A;  3NZQ A;  4GYR A;  4U74 A;  3Q2M A;  5HCJ A;  4IT4 A;  4X66 T;  3KV4 A;  2WMO A;  4B3S T;  5HYA A;  4OK0 A;  1N32 T;  2BDE A;  1MND A;  5FKY A;  1LVF A;  1FIO A;  4EYY R;  2KND A;  5LBQ B;  2BG9 B;  3U78 A;  2OA5 A;  1FJG T;  4IE6 A;  3PUQ A;  4K0K T;  2A9U A;  3CVR A;  3JC6 C;  1XNQ T;  2JQH A;  2ZM2 A;  3K3O A;  2V8S V;  3PUW F;  5LYJ E;  3RPU A;  2NOX A;  1T7S A;  5DAB A;  2LM9 A;  4X1Y E;  2E2A A;  1UUS A;  2HPL A;  2Q9Q B;  4JI1 T;  2W63 A;  3RRW A;  2K3W A;  3GN5 A;  3TLV A;  4EZ4 A;  5JH7 E;  1T98 A;  2IUB A;  4HWD A;  1ZEE A;  2IDO B;  2R6G F;  2EHO A;  2V7K A;  4ILU A;  5FL1 A;  1ZHC A;  3BQL A;  5JR9 A;  4DV2 T;  5IYZ E;  3C51 A;  1V9D A;  2D0U A;  2X0Y A;  4NIQ A;  5FYM A;  4CI2 B;  5LGT B;  3LDQ B;  2Q9Q D;  3W15 B;  4DMV A;  1MMD A;  4B3M T;  3EDV A;  4QXB B;  1MNE A;  4E7S A;  5DQW A;  3FBL A;  4DUZ T;  1OXZ A;  4CXW A;  4U2Z A;  5LHG B;  1UK5 A;  2CBJ A;  3RYI E;  4DR2 T;  1HR0 T;  4JI4 T;  3VKH A;  2W61 A;  2VVS A;  4UXN B;  5LBM A;  3N5L A;  2YDQ A;  4Q25 A;  4XBF B;  4M1P A;  2J4G A;  3AAI A;  3RIA A;  1D1B A;  3RIU C;  2X66 A;  3V5S A;  1IBK T;  2AE9 A;  4KHZ F;  3AEA A;  3BQK A;  4I50 E;  5L3E B;  5IUX A;  2WAU A;  4PAG A;  2VQF T;  1LKX A;  4EIW A;  4LF9 T;  1XZY A;  5AQO B;  2H88 A;  4L5G A;  2LOP A;  3VRB A;  2CLY B;  2X9X A;  4IDZ A;  2MBG A;  5J2T E;  4DV4 T;  2HN2 A;  3HA4 A;  5ABF B;  1UGO A;  2NR4 A;  3ZJ2 A;  4YHJ A;  5JDG A;  3L09 A;  2LKG A;  3OPC A;  5AQS B;  2IC6 A;  4ZOL E;  3ZSS A;  1XMO T;  1SUM B;  1XDO A;  3KBU A;  4HEA A;  4AXP A;  5LHH B;  2LEH A;  1OED A;  2W2U A;  2X9Y A;  3B5M A;  3KV9 A;  4IDP A;  3TLT A;  2QA7 A;  4X62 T;  2XSB A;  2M6B A;  2NW7 A;  4OX9 T;  4K0U A;  1XWM A;  3FXE B;  5CB4 E;  4OYJ A;  1KK7 A;  3O9X A;  1HCI A;  2X0L B;  4PJN A;  4ANJ A;  5AFU L;  3UU3 A;  2JPF A;  4AKR B;  4COF A;  2LE8 A;  4EEB A;  2RPA A;  2YEV C;  4LMJ A;  4QH4 A;  3ZJ1 A;  4EOZ B;  5HWX A;  4FJO A;  4EGW A;  3CML A;  3JAE A;  1IZN B;  2XQ5 A;  3JAD A;  4DV7 T;  1KNZ A;  1UCU A;  2XQ3 A;  3AAE B;  4TV9 E;  3H3M A;  3IEE A;  1HNW T;  3RIU A;  3N9O A;  4DR6 T;  4QXH B;  2KZ7 B;  3Q9D A;  2NP9 A;  3UU6 A;  1DU2 A;  4EED A;  3G06 A;  5HEO A;  4HWF A;  4HWH A;  3SOL A;  4P0B A;  3C4X A;  2CLY C;  4DO0 A;  4NXN T;  3DTO A;  1UUR A;  3RF1 A;  4X1I E;  2Q9Q C;  2W62 A;  3C4Z A;  2ES0 A;  2UXN B;  1KFY A;  2VK9 A;  4H9Q C;  2C0S A;  3CKD A;  1AJ3 A;  5HXE A;  4OHF A;  2B1E A;  2X68 A;  4DV5 T;  4DV6 T;  4IHJ E;  3SFD A;  4JV5 T;  1NEN A;  4AKI A;  3PJA A;  2VWA A;  2K48 A;  5LCY A;  5AQF B;  3AVS A;  4Z90 A;  4EXT A;  4KHP T;  2K24 A;  2LHN A;  1EZ3 A;  4A56 A;  3I9Y A;  3WAJ A;  1GQE A;  4QH5 A;  3AE9 A;  3ONL C;  2NW9 A;  2LSJ A;  3B57 A;  4MAL A;  4NXM T;  4DBQ A;  3AE4 A;  3O4X E;  4HFE A;  4PJM A;  4GK5 E;  2E5V A;  3PJA J;  5HXR A;  4U7Y A;  2IC9 A;  1WR0 A;  4X64 T;  4GOU A;  4KBM B;  5E0O A;  5L4E A;  2UXB T;  2K5B B;  2MAW A;  3AVR A;  3N9L A;  2I0M A;  3I9W A;  3KVB A;  3MJX A;  3QOF A;  3QNU A;  4Z8X A;  4WYV A;  3RI5 A;  2V7J A;  5LA6 E;  2WCA A;  4LF5 T;  3AE2 A;  2H7O A;  2YDS A;  5LMU T;  1BR4 A;  4HFD A;  4KI0 F;  3IBP A;  4WBO A;  1MIY A;  2MTQ A;  3T8O A;  3UU5 A;  4O2A E;  4QXC B;  3SFE A;  2VKH A;  3T1Y T;  1IBL T;  1M7K A;  1W0A A;  5DJQ C;  2V6X A;  3PE0 A;  5AQG B;  1E2A A;  4ILA A;  3FBZ A;  1OED B;  1T8B A;  4HTE A;  4KP3 C;  5FVL A;  4JI2 T;  2BKP A;  2X67 A;  2VQE T;  3QC9 A;  4XAX B;  4HKA A;  5FY0 A;  5AQJ B;  5L3B B;  1WYC A;  4UF0 A;  4H63 V;  5JDN A;  2WQY A;  3ZN0 B;  1HX8 A;  3EAM A;  1FMV A;  3B13 A;  3LK3 B;  2NTX A;  3LK4 2;  3P4W A;  3S4U A;  5LG3 A;  3MXZ A;  5H6Q B;  4X65 T;  5AQV B;  2JIW A;  3P7I A;  3AEC A;  1YQ4 A;  1IBM T;  5LP6 E;  2LSY A;  5LHI B;  1UX5 A;  3DJB A;  3P4Q A;  4H63 H;  3AA1 B;  5EZY E;  5LB7 B;  5JDL A;  2ZM0 A;  4UEM A;  2ODV A;  2XAF B;  2XSA A;  1XNR T;  4ZS2 A;  4A97 A;  3N9P A;  1HNZ T;  3ETV A;  4O2B E;  2IML A;  3QB5 K;  5AQU B;  3O1J A;  4CN1 A;  2L8K A;  4IIJ E;  3RQU A;  4IE5 A;  4O4H E;  4O4L E;  4UVB B;  3AE5 A;  3ZC0 A;  3AEE A;  3AAA B;  2HHH T;  1N33 T;  2LLY A;  1D1A A;  5LXT E;  5HEU A;  4CQI A;  4UIG A;  4WBN E;  2EHO C;  5BMV E;  5LNK A;  5GON E;  4YXD A;  2V5C A;  4DVD A;  3AB3 B;  4CN4 A;  3Q5D A;  3VHL A;  4AKL A;  3KV5 A;  4EB6 E;  4EAH A;  3GWH A;  5JDM A;  2WU2 A;  3SRZ A;  1HNX T;  3AE7 A;  2N1G A;  1E1H B;  2DWG A;  4NPP A;  3OYX A;  2Y48 B;  1B7T A;  1OED E;  3A7M A;  3WI3 A;  3ZN1 B;  4YJ3 E;  3NRY A;  4GK0 E;  1KNR A;  1ZV4 X;  2V7I A;  4LMK A;  2QRX A;  3RH3 A;  2V5D A;  3NZP A;  2FUP A;  5JRC B;  3VKG A;  4ZI7 E;  4YSZ A;  2A72 A;  3AED A;  2JQQ A;  2BBH A;  2XQ6 A;  4ERR A;  3PUS A;  5AQN B;  1SHZ C;  3N9M A;  4IL4 A;  4AQF C;  1VCS A;  3LBX A;  2PTF A;  1X9B A;  3NWI A;  3KDS E;  3FZH B;  1ZP0 A;  4KUM B;  3UFE A;  5JDQ A;  1NAF A;  4FI5 A;  3UUM A;  1YKH B;  2E8I A;  2AXD S;  2BKO A;  2W00 A;  3NRX A;  5HEJ A;  2CM0 A;  5BR8 T;  5AQL B;  3J9X 1;  5CGM A;  4IE4 A;  2BVM A;  4YHH T;  3CIR A;  4JBW F;  3ONX A;  4NUV A;  2FJE A;  5LJM A;  4JI6 T;  4ADZ A;  4B3T T;  2H7V C;  1VRB A;  1OED C;  5H6R B;  4L9I A;  4QKN A;  4AIU A;  4CXX A;  3ZMS B;  5A1L A;  5CFB A;  5JR9 B;  2YK0 A;  3CQG B;  5L2L A;  4LML A;  4JEU B;  4WNK A;  2D0T A;  2MPK A;  2NWB A;  3FZF B;  1WRD A;  3I0O A;  4PNI A;  4U33 A;  4PK6 A;  3GN5 B;  2CXF A;  1MMA A;  2M67 A;  5ABE A;  2PFV A;  3F31 A;  3JAF A;  2WZH A;  3P4R A;  2FBW A;  2QGS A;  4PK5 A;  4A98 A;  4YT0 A;  2NTY A;  2FJA A;  2VL8 A;  1FEW A;  2YU1 A;  3T1H T;  1FMW A;  3PUV F;  2HH7 A;  3P4S A;  1J1J A;  2WBL A;  3R84 B;  2BG9 A;  1KF6 A;  2E9X B;  1IAP A;  4JI7 T;  3Q5W A;  3LK2 B;  3HR0 A;  3OJA A;  2QVA A;  4DV0 T;  5HEH A;  2W66 A; 
#chains in the Genus database with same CATH homology
 5AQV B;  5AQP B;  5AQH B;  5AQM B;  3LDQ B;  2D9D A;  4HWC A;  3FZL B;  1UK5 A;  5AQT B;  3FZF B;  5AQF B;  1M62 A;  3M3Z B;  3FZK B;  4HWI B;  1M7K A;  3FZM B;  5AQN B;  5AQG B;  1HX1 B;  5AQU B;  5AQQ B;  1I6Z A;  5AQK B;  1T7S A;  5AQO B;  3FZH B;  5AQJ B;  1UGO A;  3A8Y C;  5AQI B;  4HWD A;  5AQS B;  5AQL B;  5AQR B;  4HWF A;  4HWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...