5AQNB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
112
structure length
112
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
molecule tags Chaperone
source organism Homo sapiens
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
total genus 43
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqnB00
3A8YC 4HWCA 4HWHA 5AQUB 5AQVB 3FZMB 5AQFB 5AQKB 5AQQB 5AQJB 5AQTB 3FZFB 1UGOA 1HX1B 5AQHB 5AQIB 5AQLB 5AQSB 5AQPB 1M62A 5AQGB 3FZLB 1UK5A 4HWDA 5AQNB 3LDQB 4HWIB 5AQRB 3FZHB 2D9DA 5AQOB 1M7KA 5AQMB 3FZKB 1T7SA 1I6ZA 4HWFA 3M3ZB
chains in the Genus database with same CATH superfamily
4ZZBA 2D5UA 2L9QA 4UIGA 4O4JE 2I6HA 4CI1B 4X62T 1VCTA 3D0TA 4UVCB 3F31A 5JRCA 2XQ7A 2KNDA 2W66A 2XAJB 3RH3A 4JBWF 4DR1T 1IJ5A 5AQTB 1D0YA 3S4UA 5AQHB 5E0OA 2Q9QC 4F6RC 4YHJA 1IJ6A 5KMGP 3RRWA 1KNZA 4DV6T 4AKLA 4MBQA 2LSGA 2B76A 4P0BA 3ZC0A 3MKDA 3AAEB 3EDUA 1E7PA 2XQ8A 1LVKA 3MA9A 3NKZA 5FVLA 4DO0A 1OEDC 2XPKA 1KEYA 2FJEA 2XM2A 4QXHB 2NOXA 4AISA 3E22E 3P4RA 1NWMX 2Q9QB 2XAHB 4L0RA 4U33A 3RI5A 3AECA 5FXXA 2XQ3A 4A98A 2JRKA 4EGWA 4OHFA 2H3RA 4O2AE 3PDYA 3HKBE 2IAKA 4Q25A 5ETWA 2N9DA 4CI3B 3PUSA 2BBHA 2CPTA 3A7MA 3J9X1 2BS3A 2OLTA 2VKDA 4YTPA 3KBUA 2KXPB 4CQIA 3AAIA 1D0ZA 3RIUC 2FUPA 1ZEEA 3C50A 2XQYA 4YSYA 3JADA 4TZ4C 4U72A 5AQJB 5AQQB 4DR3T 2C5IT 3GMIA 2V8SV 2VQET 1WRDA 4JUYA 2WAUA 2IW5B 2GK9A 3ZSTA 4F8HA 2V1DB 2EHOC 2BKNA 3RYCE 1J5ET 1WR0A 3AE6A 5JDNA 3Q5EA 1M7KA 4I0UA 3GN5A 2X9YA 4PFOA 4M1PA 2W2UA 2X51A 4KBMB 4LF8T 3UU4A 3ZCIA 4AI6A 3ZMZB 2IMLA 1R8IA 2V26A 4U74A 3HA4A 4DR2T 2BG9C 2HN1A 5LGTB 1KFYA 2JQKA 3PUXF 1VRBA 2D0TA 3CQGB 3RQWA 5LJMA 1E2AA 3C64A 2WWUA 1UURA 3KDSE 5DQWA 5J1GA 2HPLA 4OFZA 2IC6A 2MOZA 3EDVA 2N1GA 3CPZA 3N9OA 2BG9E 3Q5WA 3JCFA 5HWYA 4EYUA 4WBNE 1FMVA 1YXRA 3CVRA 5H6QB 2UXBT 5TAOA 1NEKA 1HTJF 3FZFB 2KLQA 3OKQA 3MACA 3UULA 2UUBT 4AKGA 2W62A 5JDLA 3DTOA 1MIYA 4YJ2E 4MHCA 3MK7C 4QXCB 2FJAA 4JI4T 4LFCT 2Q9QA 5ABFA 1Y64B 2YINA 1NENA 2LE8A 3FZKB 2LKGA 2MYSA 3IF8B 5AQMB 5HEJA 4EV6A 3B13A 4CN6A 2DHRA 2BDEA 4EYYR 2ZLYA 3RX6A 4COFA 2LM9A 2X9WA 3L09A 5FKYA 3NRYA 4HWCA 2UXNB 5FMNA 5FP3A 4ZEYA 1HS7A 2E9XB 1N34T 4GYSA 4WZXA 1WR6A 1MMDA 2BVMA 4QX7B 1S35A 4JI6T 3Q5XA 4I55E 4YHHT 3RHWA 3EABA 4H9PC 2NW9A 4O4LE 3O4XE 4H9QC 2WDVA 5AQSB 3HI2A 3VU7H 1KF6A 5ABHA 1YW0A 2X0YA 3P4SA 4HWDA 3SRZA 4YSXA 1IBMT 5HXSA 4ILCA 4YTMA 1SHZC 1HFAA 1D0XA 1FIOA 4B3MT 2DWGA 2X0HA 2Y8DA 4DUZT 3PURA 4ILBA 4O8SA 2X9XA 5IHYA 2WS3A 4CXYA 1HR0T 4CXXA 2X67A 4IE6A 4YSZA 4LMJA 4P09A 3GWHA 4CN4A 2W63A 2BKPA 4MALA 4U31A 4CN1A 3QC9A 3N5LA 1QUUA 3SFDA 3ABVA 4ZI3D 2NW8A 3UU3A 2LLYA 3QOFA 3SWHA 2HPJA 3VRAA 1FJGT 2PFVA 2E2AA 1AJ3A 1MNDA 5FXVA 5J0ZA 5FXZA 4LMKA 4OYJA 3UU8A 1W0AA 2ZMAA 3O9XA 4DIDB 3QB5K 4LF9T 2H88A 3IBPA 2ES0A 3FXDB 2XUEA 3E0ZA 1XDOA 2CWOA 2V5DA 3LDQB 3N2OA 2WWVA 1Z8UA 2CLYC 5CJ5A 2HN2A 4ZS3A 2XSAA 4WBOA 5JDHA 3U3IA 2YEVC 3CKDA 4I43B 5JDMA 4GKKT 3V5UA 1T72A 2YDQA 5CA0E 4X65T 4QXBB 5EK2A 1UX5A 2XZEA 4JI5T 1YKHB 2BVLA 3UFGA 3ZPOA 4U7IA 5EK3A 4LF4T 2M6BA 4PJJA 2A3DA 2FJDA 1EZ3A 3TLTA 3AE3A 2EHOA 5JREA 4A97A 1Z0PA 2XQ9A 4UR9A 2VKHA 2E9XD 2J4GA 3KVAA 3L3PA 5FY1A 3O1IA 3RYFE 2CHOA 2E5VA 4X1KE 3FXEB 3L8RA 2K24A 2H7VC 2JQ9A 3PJAA 3TLWA 3JAFA 3J7Yq 1W0BA 2MAWA 2WCAA 1W9RA 2JQHA 2VQFT 3RPUA 5FL0A 2WDQA 3FBZA 3AEEA 4YFSA 2E8IA 4KI0F 3ZLIA 2LKHA 4AXPA 4KP3C 4HN9A 3NVOA 4IE7A 1QLBA 3ETUA 2WSSV 3KV4A 2IC9A 2XQ6A 5IYZE 5LJNA 5JR9C 2Y6XA 2LHRA 1YD8G 3AE2A 2CEAA 4IDZA 1MMNA 3BQKA 2WB5A 3RIUA 2V7MA 3EI0A 3ETVA 4JI0T 2CWYA 2E9XA 4TWFA 3NWIA 4IL4A 3K1SA 4AQYT 4DV1T 3LG7A 3NBXX 2IDOB 3PUZF 3T1YT 3AEGA 5LP6E 4P0AA 3AE9A 2VB6A 4YXDA 3DP7A 3SFEA 1W09A 3ZYMA 3K8PC 3P4WA 2WM9A 4HWIB 3GN5B 5CB4E 3OTOT 1WLXA 3E08A 2W67A 3I0QA 3LFMA 2ZM6T 2D9DA 4DR6T 3VR8A 5L3EB 5JQGE 2G0UA 4EZ4A 5LA6E 3RRCA 3ZMVB 3AXJB 2NW7A 5HXEA 3MXZA 2LOSA 4P1NA 1IBKT 3KFWX 1MIVA 4KHZF 4Z91A 3TKLB 4U3CA 2NWBA 2X9HA 2BG9A 3UQ7A 5LBMA 3H37A 5F8PA 4PJLA 3A8YC 3SOLA 3KVBA 3AEAA 5FNVE 2UU9T 3ZC1A 1UUSA 2CA5A 1YQ4A 2J47A 3FZMB 5HEUA 4H63H 4HGAA 5FL1A 4DUYT 3PTRB 4A5XA 2LRKA 1SA0E 4YT0A 3MJXA 3C4XA 2V6YA 4PAGA 2RP4A 2WZIA 4ILUA 4HFEA 5AQLB 1HX1B 4FJOA 1BR1A 5L47A 5AQPB 2VURA 2IUBA 2LSYA 3CX7B 4IE4A 5L3GB 2NR4A 3LBXA 5LHGB 5LYJE 3LBXB 4PW8A 3DJBA 3T8OA 4DV7T 4ZI3C 4PJNA 4NPPA 3EAMA 2WZHA 1BR2A 3CX6B 3PUAA 5L3CB 1XDPA 4UXNB 3TLSA 3C4WA 3VHLA 4HTEA 4TWDA 3R84B 4EEDA 5BMVE 2KT9A 1HNXT 2X0LB 4JI7T 2VL8A 3B57A 2WY2A 3RGLA 2A9UA 3X1DA 5ABEA 1E1HB 4IIJE 4QH5A 5L3FB 5DABA 4DBRA 5LXTE 3LJCA 5FY7A 2X68A 3WI3A 3O1JA 5LG4A 4U2ZA 4DV5T 1XNRT 3CQCB 2KMFA 4DV0T 4IL9A 4ISTA 4X1IE 2AXDS 1U5PA 4I50E 4TNWA 3AVSA 4ASKA 3Q2MA 5L3DB 2LOPA 4AQFA 4E7ZA 5C2TA 3ONXA 1H7CA 4BJNA 5AFUL 3WAJA 2OV9A 3I0OA 2WU2A 4O4HE 4JI3T 3RLFF 3ZMSB 4AQFC 3PUWF 5ADXL 3AA0B 4H9OC 1T8BA 3ZJ1A 2MBGA 5JVDE 3BK9A 3ZYKA 2QYWA 1US7B 1J5WA 4UEMA 4Z8XA 3I1AA 4HFCA 5L4EA 5J2TE 3OJAA 4EZHA 1IBLT 2UXDT 1I6ZA 2JMHA 1IAPA 4X66T 3A5XA 4G2AA 2QVAA 4TV8E 5LMNT 3R6NA 2YDRA 2W0GA 2P9BA 1U4QA 2Z6EA 4IDOA 4IREA 5FXWA 2BBJA 3N9NA 4UF0A 4X64T 2C5JA 3BQLA 2VK9A 3K3OA 2ODUA 5LOVE 4DR4T 5DQVA 3RKOA 1HG5A 3AVRA 1J1JA 2I59A 4JI1T 3UUMA 2PBIA 1UGOA 5LG3A 4X1YE 4JI8T 1WFDA 4NUUA 2BS2A 4GKJT 4ERRA 3VKHA 4ILAA 4NIQA 4YJ3E 2N2NA 3K3QC 4JEHB 4ZI7E 5JDGA 3FHNA 4ADZA 4UELA 3EUHA 1XWMA 3F2EA 4H9NC 1G8XA 4I4TE 5HEOA 2PJQA 5A1LA 3V5SA 4TV9E 4IE0A 4WNKA 3G06A 3HKDE 4MLKA 1HX8A 2DL1A 2WQYA 2WMOA 2QRXA 5LB7B 5HXHA 2W4XA 2XAQB 2YU2A 3B5MA 4IDPA 3AXJA 4N78D 2X66A 3UU5A 4C90A 4UV9B 3NZPA 5JTGA 5C3JA 3M3ZB 5JH7E 5LGNB 2CRBA 4HFDA 4AKIA 1NAFA 2L3LA 2FBWA 4DBQA 1D1BA 4O2BE 2ACZA 4KX6A 5FVKA 5LCYA 4GOUA 3RYHE 4LF5T 5HXCA 4CI2B 2IIUA 1KNPA 1KNRA 4J2CA 1BR4A 3CX8B 5H6RB 1N32T 2JQQA 2OA5A 2W00A 4LMLA 5AQGB 5GONE 5BR8T 3IEEA 3FZLB 3IHRA 2PTFA 5HEHA 3JC6C 4ISSA 4CZZB 2XM1A 2L8KA 5L3BB 4B3RT 4ZXLA 1T98A 2QA7A 4HEAA 5LBQB 2C5KT 2JJ9A 4OYKA 3FBLA 3FZHB 5HYAA 4YY3T 3LK2B 4DV4T 4JV5T 3KBTA 4PK6A 3ZN0B 4LFBT 1B7TA 2M67A 5C8YE 2F4VT 4UV8B 1UX4A 2WDRA 4TNVA 4V1Av 4LF7T 4G63A 4AKRB 5JR9A 1BR0A 3N9QA 2YK0A 5F5WA 3UT5E 3W15B 4EXTA 2HH7A 2K48A 1KK7A 2YDSA 3RYIE 3UTKA 3CK6A 2KSRA 2LHNA 3UUBA 4BJMA 4AKHA 5LMUT 5AQUB 1XZYA 1YQ3A 2H89A 1D1CA 2YKSA 4LF6T 4TUYE 3ZEFB 5AQFB 4NXNT 3HL6A 2UXXB 2LJLA 3AB3B 5KXJA 2AE9A 3CMLA 3PE0A 3UUNA 1YKEB 4YTNA 5LHIB 1HNZT 3ONLC 5AQIB 4TWHA 2KINB 3AEFA 2RPAA 1MNEA 2V7JA 5AQNB 3F57A 4TX5A 4DMWA 2XHEB 2XY8B 5AQRB 1IZNB 1LRZA 4GK5E 2UUCT 2J1DG 4GYRA 3ZN1B 2D2SA 5HEGA 4ZI2C 3AAAB 1ZHCA 3MZKB 4ZZCA 5JDQA 3O1HA 2DI4A 4DR7T 1LVFA 2LEHA 3P8CD 4WYVA 3VRBA 1DU2A 3AEBA 5L4HA 4AQGA 2ZM0A 4JEUB 2XSBA 4JLEA 4EIWA 5J2UE 2WP9A 2VKJA 1ZKEA 4DV3T 3ANWB 3PUYF 4C91A 2R6GF 2LT3A 2ODVA 3ANWA 3N9MA 3PUGA 5HCJA 1FEWA 2CXLA 4HFVA 1HG2A 2ZM8A 3P4QA 3P4PA 1OWAA 2VVNA 3PU3A 4BA9A 4TN7B 4IT4A 2C0SA 2LSJA 2V6YB 4WW0A 3AE5A 4PNIA 2WU5A 1OXZA 2J62A 3PUQA 3TLVA 4B3TT 2B1EA 4U2YA 2XQAA 4MFRA 5HXRA 2WMNA 4H63V 2E5LT 1X79A 5M4YA 3OPCA 3ZCJA 1X9BA 3OVUA 2W61A 4O4IE 1I94T 3UFEA 5HWXA 2LSIA 4IHJE 3RIFA 4EOZB 4ZS2A 4JI2T 5FYMA 2QGSA 2CLYB 4U7YA 1MIWA 1LKXA 2Y48B 3UQ4A 2XAFB 2NP9A 4DNDA 1OEDE 3NZQA 3WAKA 3ZT5A 5CA1E 3ESLA 2V7LA 4NXMT 2V7KA 2CM0A 3N9PA 3ZSSA 3N2GE 3FB2A 3C98B 2VL0A 4XBFB 3P7IA 3QB5A 4HFBA 4OK0A 5CFBA 2XQ4A 1L0VA 3RKGA 5JDFA 2KWIB 5JRCB 2XASB 3P50A 4L9IA 1QSDA 4UVBB 2BZBA 3TLUA 5ABFB 5KX5E 1CHUA 2Q9QD 4QWNB 5AQVB 1Y01A 2D0UA 2DNXA 4ZOLE 4NUVA 3Q5DA 4XZCA 4QH4A 3UUXB 4BAYB 5AQKB 3VKGA 3RC3A 1G73A 3HKEE 1O3XA 1S94A 2VKOA 3AEDA 1HF8A 3CIRA 1M62A 1ZV4X 3H3AA 4EAHA 4HFHA 1VCSA 2CBJA 2LRLA 1UK5A 1WCRA 1GQEA 4H9RC 4IDNA 3UU6A 5LGUB 4EEBA 4X20E 4H9SE 2E9XC 4ZHQE 3OYZA 3JAEA 5AQOB 3HKCE 2DWKA 4FI5A 2VVSA 4HWHA 3PJAJ 1JNRA 4B6XA 4OX9T 2UXCT 1JNZA 5HAXA 2XQ5A 4XAXB 3KV5A 4IGUA 4YLHA 1XMQT 2BKOA 4B3ST 3M65A 4QH1A 4GIWA 3OYXA 2CE7A 3EHZA 1WYCA 3AE7A 4QHOA 4UF0B 2IHR1 2K5BB 2VWAA 4DMVA 4ZI2D 1OEDA 2CBIA 2I0MA 1WYBA 5EK4A 2NTXA 3NRXA 3ONJA 3C4ZA 4K0KT 2KWHA 3EVYA 1XNQT 2A72A 2JPFA 3AA6B 2VASA 3Q9DA 3PV0F 2EHOD 2MPKA 4PJMA 5EZYE 5F3JA 2WBLA 3N9LA 4PK5A 4L5GA 4A56A 4LFAT 4ANJA 1N36T 2K9AA 2HHHT 3LK42 2JIWA 4QX8B 2V6XA 2CMRA 2FJBA 3U78A 3K3NA 3ZKRA 1VOMA 2JMKA 3RQUA 2K3WA 4EB6E 3OBVE 4PFPA 3ZT6A 3C51A 2BS4A 3QUJA 2A2FX 1ZP0A 4Z90A 3AE4A 3L39A 5HCMA 3SS1A 3PU8A 4JYAT 4E7SA 5IWAT 2CXFA 1HCIA 2BG9B 3ZMUB 1MMGA 5CGMA 2RA1A 3AA7B 1SE7A 4HE8A 1MMAA 4HFIA 3VR9A 3I9YA 2SPCA 4PK4A 2YOEA 2EHOB 3RIAA 3KINB 2YN6A 2CXDA 2XTLA 2YU1A 3KV6A 3AA1B 3QK6A 1CUNA 3JC6D 2DLRA 2MTQA 5FY0A 3ZYLA 3LK3B 1ZOYA 3ZT7A 3ZJ2A 2CCQA 4UVAB 1UCUA 3GA8A 2UUAT 4K0UA 2H7OA 3CQXC 3N2KE 5LHHB 3CWZB 4DR5T 1N33T 2V7IA 3PUVF 2PG8A 2LM2A 5LNKA 4DV2T 1D1AA 5IUXA 3LSVA 4KUMB 3KV9A 1FMWA 3IA3A 3BQIA 3I9WA 1XMOT 3RC8A 4KHPT 4KMCA 5DJQC 4QKNA 4DVDA 4X5TA 2NTYA 2ZM2A 5L2LA 3T1HT 1HNWT 2M6IA 5KDMC 2XJ7A 1SUMB 2ACXA 4CXWA 5JR9B 2V5CA 1T7SA 3ZMTB 2CHNA 2KZ7B 4IE5A 3AE8A 3QNUA 5ABGA 3AE1A 2DCFA 2LSKA 2XAGB 3HR0A 4IDQA 1OEDB 3RF1A 4AIUA 4HWFA 1V9DA 4HKAA 4GK0E 3H3MA
chains in the Genus database with same CATH topology
3A8YC 4HWCA 4HWHA 5AQUB 5AQVB 3FZMB 5AQFB 5AQKB 5AQQB 5AQJB 5AQTB 3FZFB 1UGOA 1HX1B 5AQHB 5AQIB 5AQLB 5AQSB 5AQPB 1M62A 5AQGB 3FZLB 1UK5A 4HWDA 5AQNB 3LDQB 4HWIB 5AQRB 3FZHB 2D9DA 5AQOB 1M7KA 5AQMB 3FZKB 1T7SA 1I6ZA 4HWFA 3M3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8Y C;  4HWC A;  4HWH A;  5AQU B;  5AQV B;  3FZM B;  5AQF B;  5AQK B;  5AQQ B;  5AQJ B;  5AQT B;  3FZF B;  1UGO A;  1HX1 B;  5AQH B;  5AQI B;  5AQL B;  5AQS B;  5AQP B;  1M62 A;  5AQG B;  3FZL B;  1UK5 A;  4HWD A;  5AQN B;  3LDQ B;  4HWI B;  5AQR B;  3FZH B;  2D9D A;  5AQO B;  1M7K A;  5AQM B;  3FZK B;  1T7S A;  1I6Z A;  4HWF A;  3M3Z B; 
#chains in the Genus database with same CATH topology
 4ZZB A;  2D5U A;  2L9Q A;  4UIG A;  4O4J E;  2I6H A;  4CI1 B;  4X62 T;  1VCT A;  3D0T A;  4UVC B;  3F31 A;  5JRC A;  2XQ7 A;  2KND A;  2W66 A;  2XAJ B;  3RH3 A;  4JBW F;  4DR1 T;  1IJ5 A;  5AQT B;  1D0Y A;  3S4U A;  5AQH B;  5E0O A;  2Q9Q C;  4F6R C;  4YHJ A;  1IJ6 A;  5KMG P;  3RRW A;  1KNZ A;  4DV6 T;  4AKL A;  4MBQ A;  2LSG A;  2B76 A;  4P0B A;  3ZC0 A;  3MKD A;  3AAE B;  3EDU A;  1E7P A;  2XQ8 A;  1LVK A;  3MA9 A;  3NKZ A;  5FVL A;  4DO0 A;  1OED C;  2XPK A;  1KEY A;  2FJE A;  2XM2 A;  4QXH B;  2NOX A;  4AIS A;  3E22 E;  3P4R A;  1NWM X;  2Q9Q B;  2XAH B;  4L0R A;  4U33 A;  3RI5 A;  3AEC A;  5FXX A;  2XQ3 A;  4A98 A;  2JRK A;  4EGW A;  4OHF A;  2H3R A;  4O2A E;  3PDY A;  3HKB E;  2IAK A;  4Q25 A;  5ETW A;  2N9D A;  4CI3 B;  3PUS A;  2BBH A;  2CPT A;  3A7M A;  3J9X 1;  2BS3 A;  2OLT A;  2VKD A;  4YTP A;  3KBU A;  2KXP B;  4CQI A;  3AAI A;  1D0Z A;  3RIU C;  2FUP A;  1ZEE A;  3C50 A;  2XQY A;  4YSY A;  3JAD A;  4TZ4 C;  4U72 A;  5AQJ B;  5AQQ B;  4DR3 T;  2C5I T;  3GMI A;  2V8S V;  2VQE T;  1WRD A;  4JUY A;  2WAU A;  2IW5 B;  2GK9 A;  3ZST A;  4F8H A;  2V1D B;  2EHO C;  2BKN A;  3RYC E;  1J5E T;  1WR0 A;  3AE6 A;  5JDN A;  3Q5E A;  1M7K A;  4I0U A;  3GN5 A;  2X9Y A;  4PFO A;  4M1P A;  2W2U A;  2X51 A;  4KBM B;  4LF8 T;  3UU4 A;  3ZCI A;  4AI6 A;  3ZMZ B;  2IML A;  1R8I A;  2V26 A;  4U74 A;  3HA4 A;  4DR2 T;  2BG9 C;  2HN1 A;  5LGT B;  1KFY A;  2JQK A;  3PUX F;  1VRB A;  2D0T A;  3CQG B;  3RQW A;  5LJM A;  1E2A A;  3C64 A;  2WWU A;  1UUR A;  3KDS E;  5DQW A;  5J1G A;  2HPL A;  4OFZ A;  2IC6 A;  2MOZ A;  3EDV A;  2N1G A;  3CPZ A;  3N9O A;  2BG9 E;  3Q5W A;  3JCF A;  5HWY A;  4EYU A;  4WBN E;  1FMV A;  1YXR A;  3CVR A;  5H6Q B;  2UXB T;  5TAO A;  1NEK A;  1HTJ F;  3FZF B;  2KLQ A;  3OKQ A;  3MAC A;  3UUL A;  2UUB T;  4AKG A;  2W62 A;  5JDL A;  3DTO A;  1MIY A;  4YJ2 E;  4MHC A;  3MK7 C;  4QXC B;  2FJA A;  4JI4 T;  4LFC T;  2Q9Q A;  5ABF A;  1Y64 B;  2YIN A;  1NEN A;  2LE8 A;  3FZK B;  2LKG A;  2MYS A;  3IF8 B;  5AQM B;  5HEJ A;  4EV6 A;  3B13 A;  4CN6 A;  2DHR A;  2BDE A;  4EYY R;  2ZLY A;  3RX6 A;  4COF A;  2LM9 A;  2X9W A;  3L09 A;  5FKY A;  3NRY A;  4HWC A;  2UXN B;  5FMN A;  5FP3 A;  4ZEY A;  1HS7 A;  2E9X B;  1N34 T;  4GYS A;  4WZX A;  1WR6 A;  1MMD A;  2BVM A;  4QX7 B;  1S35 A;  4JI6 T;  3Q5X A;  4I55 E;  4YHH T;  3RHW A;  3EAB A;  4H9P C;  2NW9 A;  4O4L E;  3O4X E;  4H9Q C;  2WDV A;  5AQS B;  3HI2 A;  3VU7 H;  1KF6 A;  5ABH A;  1YW0 A;  2X0Y A;  3P4S A;  4HWD A;  3SRZ A;  4YSX A;  1IBM T;  5HXS A;  4ILC A;  4YTM A;  1SHZ C;  1HFA A;  1D0X A;  1FIO A;  4B3M T;  2DWG A;  2X0H A;  2Y8D A;  4DUZ T;  3PUR A;  4ILB A;  4O8S A;  2X9X A;  5IHY A;  2WS3 A;  4CXY A;  1HR0 T;  4CXX A;  2X67 A;  4IE6 A;  4YSZ A;  4LMJ A;  4P09 A;  3GWH A;  4CN4 A;  2W63 A;  2BKP A;  4MAL A;  4U31 A;  4CN1 A;  3QC9 A;  3N5L A;  1QUU A;  3SFD A;  3ABV A;  4ZI3 D;  2NW8 A;  3UU3 A;  2LLY A;  3QOF A;  3SWH A;  2HPJ A;  3VRA A;  1FJG T;  2PFV A;  2E2A A;  1AJ3 A;  1MND A;  5FXV A;  5J0Z A;  5FXZ A;  4LMK A;  4OYJ A;  3UU8 A;  1W0A A;  2ZMA A;  3O9X A;  4DID B;  3QB5 K;  4LF9 T;  2H88 A;  3IBP A;  2ES0 A;  3FXD B;  2XUE A;  3E0Z A;  1XDO A;  2CWO A;  2V5D A;  3LDQ B;  3N2O A;  2WWV A;  1Z8U A;  2CLY C;  5CJ5 A;  2HN2 A;  4ZS3 A;  2XSA A;  4WBO A;  5JDH A;  3U3I A;  2YEV C;  3CKD A;  4I43 B;  5JDM A;  4GKK T;  3V5U A;  1T72 A;  2YDQ A;  5CA0 E;  4X65 T;  4QXB B;  5EK2 A;  1UX5 A;  2XZE A;  4JI5 T;  1YKH B;  2BVL A;  3UFG A;  3ZPO A;  4U7I A;  5EK3 A;  4LF4 T;  2M6B A;  4PJJ A;  2A3D A;  2FJD A;  1EZ3 A;  3TLT A;  3AE3 A;  2EHO A;  5JRE A;  4A97 A;  1Z0P A;  2XQ9 A;  4UR9 A;  2VKH A;  2E9X D;  2J4G A;  3KVA A;  3L3P A;  5FY1 A;  3O1I A;  3RYF E;  2CHO A;  2E5V A;  4X1K E;  3FXE B;  3L8R A;  2K24 A;  2H7V C;  2JQ9 A;  3PJA A;  3TLW A;  3JAF A;  3J7Y q;  1W0B A;  2MAW A;  2WCA A;  1W9R A;  2JQH A;  2VQF T;  3RPU A;  5FL0 A;  2WDQ A;  3FBZ A;  3AEE A;  4YFS A;  2E8I A;  4KI0 F;  3ZLI A;  2LKH A;  4AXP A;  4KP3 C;  4HN9 A;  3NVO A;  4IE7 A;  1QLB A;  3ETU A;  2WSS V;  3KV4 A;  2IC9 A;  2XQ6 A;  5IYZ E;  5LJN A;  5JR9 C;  2Y6X A;  2LHR A;  1YD8 G;  3AE2 A;  2CEA A;  4IDZ A;  1MMN A;  3BQK A;  2WB5 A;  3RIU A;  2V7M A;  3EI0 A;  3ETV A;  4JI0 T;  2CWY A;  2E9X A;  4TWF A;  3NWI A;  4IL4 A;  3K1S A;  4AQY T;  4DV1 T;  3LG7 A;  3NBX X;  2IDO B;  3PUZ F;  3T1Y T;  3AEG A;  5LP6 E;  4P0A A;  3AE9 A;  2VB6 A;  4YXD A;  3DP7 A;  3SFE A;  1W09 A;  3ZYM A;  3K8P C;  3P4W A;  2WM9 A;  4HWI B;  3GN5 B;  5CB4 E;  3OTO T;  1WLX A;  3E08 A;  2W67 A;  3I0Q A;  3LFM A;  2ZM6 T;  2D9D A;  4DR6 T;  3VR8 A;  5L3E B;  5JQG E;  2G0U A;  4EZ4 A;  5LA6 E;  3RRC A;  3ZMV B;  3AXJ B;  2NW7 A;  5HXE A;  3MXZ A;  2LOS A;  4P1N A;  1IBK T;  3KFW X;  1MIV A;  4KHZ F;  4Z91 A;  3TKL B;  4U3C A;  2NWB A;  2X9H A;  2BG9 A;  3UQ7 A;  5LBM A;  3H37 A;  5F8P A;  4PJL A;  3A8Y C;  3SOL A;  3KVB A;  3AEA A;  5FNV E;  2UU9 T;  3ZC1 A;  1UUS A;  2CA5 A;  1YQ4 A;  2J47 A;  3FZM B;  5HEU A;  4H63 H;  4HGA A;  5FL1 A;  4DUY T;  3PTR B;  4A5X A;  2LRK A;  1SA0 E;  4YT0 A;  3MJX A;  3C4X A;  2V6Y A;  4PAG A;  2RP4 A;  2WZI A;  4ILU A;  4HFE A;  5AQL B;  1HX1 B;  4FJO A;  1BR1 A;  5L47 A;  5AQP B;  2VUR A;  2IUB A;  2LSY A;  3CX7 B;  4IE4 A;  5L3G B;  2NR4 A;  3LBX A;  5LHG B;  5LYJ E;  3LBX B;  4PW8 A;  3DJB A;  3T8O A;  4DV7 T;  4ZI3 C;  4PJN A;  4NPP A;  3EAM A;  2WZH A;  1BR2 A;  3CX6 B;  3PUA A;  5L3C B;  1XDP A;  4UXN B;  3TLS A;  3C4W A;  3VHL A;  4HTE A;  4TWD A;  3R84 B;  4EED A;  5BMV E;  2KT9 A;  1HNX T;  2X0L B;  4JI7 T;  2VL8 A;  3B57 A;  2WY2 A;  3RGL A;  2A9U A;  3X1D A;  5ABE A;  1E1H B;  4IIJ E;  4QH5 A;  5L3F B;  5DAB A;  4DBR A;  5LXT E;  3LJC A;  5FY7 A;  2X68 A;  3WI3 A;  3O1J A;  5LG4 A;  4U2Z A;  4DV5 T;  1XNR T;  3CQC B;  2KMF A;  4DV0 T;  4IL9 A;  4IST A;  4X1I E;  2AXD S;  1U5P A;  4I50 E;  4TNW A;  3AVS A;  4ASK A;  3Q2M A;  5L3D B;  2LOP A;  4AQF A;  4E7Z A;  5C2T A;  3ONX A;  1H7C A;  4BJN A;  5AFU L;  3WAJ A;  2OV9 A;  3I0O A;  2WU2 A;  4O4H E;  4JI3 T;  3RLF F;  3ZMS B;  4AQF C;  3PUW F;  5ADX L;  3AA0 B;  4H9O C;  1T8B A;  3ZJ1 A;  2MBG A;  5JVD E;  3BK9 A;  3ZYK A;  2QYW A;  1US7 B;  1J5W A;  4UEM A;  4Z8X A;  3I1A A;  4HFC A;  5L4E A;  5J2T E;  3OJA A;  4EZH A;  1IBL T;  2UXD T;  1I6Z A;  2JMH A;  1IAP A;  4X66 T;  3A5X A;  4G2A A;  2QVA A;  4TV8 E;  5LMN T;  3R6N A;  2YDR A;  2W0G A;  2P9B A;  1U4Q A;  2Z6E A;  4IDO A;  4IRE A;  5FXW A;  2BBJ A;  3N9N A;  4UF0 A;  4X64 T;  2C5J A;  3BQL A;  2VK9 A;  3K3O A;  2ODU A;  5LOV E;  4DR4 T;  5DQV A;  3RKO A;  1HG5 A;  3AVR A;  1J1J A;  2I59 A;  4JI1 T;  3UUM A;  2PBI A;  1UGO A;  5LG3 A;  4X1Y E;  4JI8 T;  1WFD A;  4NUU A;  2BS2 A;  4GKJ T;  4ERR A;  3VKH A;  4ILA A;  4NIQ A;  4YJ3 E;  2N2N A;  3K3Q C;  4JEH B;  4ZI7 E;  5JDG A;  3FHN A;  4ADZ A;  4UEL A;  3EUH A;  1XWM A;  3F2E A;  4H9N C;  1G8X A;  4I4T E;  5HEO A;  2PJQ A;  5A1L A;  3V5S A;  4TV9 E;  4IE0 A;  4WNK A;  3G06 A;  3HKD E;  4MLK A;  1HX8 A;  2DL1 A;  2WQY A;  2WMO A;  2QRX A;  5LB7 B;  5HXH A;  2W4X A;  2XAQ B;  2YU2 A;  3B5M A;  4IDP A;  3AXJ A;  4N78 D;  2X66 A;  3UU5 A;  4C90 A;  4UV9 B;  3NZP A;  5JTG A;  5C3J A;  3M3Z B;  5JH7 E;  5LGN B;  2CRB A;  4HFD A;  4AKI A;  1NAF A;  2L3L A;  2FBW A;  4DBQ A;  1D1B A;  4O2B E;  2ACZ A;  4KX6 A;  5FVK A;  5LCY A;  4GOU A;  3RYH E;  4LF5 T;  5HXC A;  4CI2 B;  2IIU A;  1KNP A;  1KNR A;  4J2C A;  1BR4 A;  3CX8 B;  5H6R B;  1N32 T;  2JQQ A;  2OA5 A;  2W00 A;  4LML A;  5AQG B;  5GON E;  5BR8 T;  3IEE A;  3FZL B;  3IHR A;  2PTF A;  5HEH A;  3JC6 C;  4ISS A;  4CZZ B;  2XM1 A;  2L8K A;  5L3B B;  4B3R T;  4ZXL A;  1T98 A;  2QA7 A;  4HEA A;  5LBQ B;  2C5K T;  2JJ9 A;  4OYK A;  3FBL A;  3FZH B;  5HYA A;  4YY3 T;  3LK2 B;  4DV4 T;  4JV5 T;  3KBT A;  4PK6 A;  3ZN0 B;  4LFB T;  1B7T A;  2M67 A;  5C8Y E;  2F4V T;  4UV8 B;  1UX4 A;  2WDR A;  4TNV A;  4V1A v;  4LF7 T;  4G63 A;  4AKR B;  5JR9 A;  1BR0 A;  3N9Q A;  2YK0 A;  5F5W A;  3UT5 E;  3W15 B;  4EXT A;  2HH7 A;  2K48 A;  1KK7 A;  2YDS A;  3RYI E;  3UTK A;  3CK6 A;  2KSR A;  2LHN A;  3UUB A;  4BJM A;  4AKH A;  5LMU T;  5AQU B;  1XZY A;  1YQ3 A;  2H89 A;  1D1C A;  2YKS A;  4LF6 T;  4TUY E;  3ZEF B;  5AQF B;  4NXN T;  3HL6 A;  2UXX B;  2LJL A;  3AB3 B;  5KXJ A;  2AE9 A;  3CML A;  3PE0 A;  3UUN A;  1YKE B;  4YTN A;  5LHI B;  1HNZ T;  3ONL C;  5AQI B;  4TWH A;  2KIN B;  3AEF A;  2RPA A;  1MNE A;  2V7J A;  5AQN B;  3F57 A;  4TX5 A;  4DMW A;  2XHE B;  2XY8 B;  5AQR B;  1IZN B;  1LRZ A;  4GK5 E;  2UUC T;  2J1D G;  4GYR A;  3ZN1 B;  2D2S A;  5HEG A;  4ZI2 C;  3AAA B;  1ZHC A;  3MZK B;  4ZZC A;  5JDQ A;  3O1H A;  2DI4 A;  4DR7 T;  1LVF A;  2LEH A;  3P8C D;  4WYV A;  3VRB A;  1DU2 A;  3AEB A;  5L4H A;  4AQG A;  2ZM0 A;  4JEU B;  2XSB A;  4JLE A;  4EIW A;  5J2U E;  2WP9 A;  2VKJ A;  1ZKE A;  4DV3 T;  3ANW B;  3PUY F;  4C91 A;  2R6G F;  2LT3 A;  2ODV A;  3ANW A;  3N9M A;  3PUG A;  5HCJ A;  1FEW A;  2CXL A;  4HFV A;  1HG2 A;  2ZM8 A;  3P4Q A;  3P4P A;  1OWA A;  2VVN A;  3PU3 A;  4BA9 A;  4TN7 B;  4IT4 A;  2C0S A;  2LSJ A;  2V6Y B;  4WW0 A;  3AE5 A;  4PNI A;  2WU5 A;  1OXZ A;  2J62 A;  3PUQ A;  3TLV A;  4B3T T;  2B1E A;  4U2Y A;  2XQA A;  4MFR A;  5HXR A;  2WMN A;  4H63 V;  2E5L T;  1X79 A;  5M4Y A;  3OPC A;  3ZCJ A;  1X9B A;  3OVU A;  2W61 A;  4O4I E;  1I94 T;  3UFE A;  5HWX A;  2LSI A;  4IHJ E;  3RIF A;  4EOZ B;  4ZS2 A;  4JI2 T;  5FYM A;  2QGS A;  2CLY B;  4U7Y A;  1MIW A;  1LKX A;  2Y48 B;  3UQ4 A;  2XAF B;  2NP9 A;  4DND A;  1OED E;  3NZQ A;  3WAK A;  3ZT5 A;  5CA1 E;  3ESL A;  2V7L A;  4NXM T;  2V7K A;  2CM0 A;  3N9P A;  3ZSS A;  3N2G E;  3FB2 A;  3C98 B;  2VL0 A;  4XBF B;  3P7I A;  3QB5 A;  4HFB A;  4OK0 A;  5CFB A;  2XQ4 A;  1L0V A;  3RKG A;  5JDF A;  2KWI B;  5JRC B;  2XAS B;  3P50 A;  4L9I A;  1QSD A;  4UVB B;  2BZB A;  3TLU A;  5ABF B;  5KX5 E;  1CHU A;  2Q9Q D;  4QWN B;  5AQV B;  1Y01 A;  2D0U A;  2DNX A;  4ZOL E;  4NUV A;  3Q5D A;  4XZC A;  4QH4 A;  3UUX B;  4BAY B;  5AQK B;  3VKG A;  3RC3 A;  1G73 A;  3HKE E;  1O3X A;  1S94 A;  2VKO A;  3AED A;  1HF8 A;  3CIR A;  1M62 A;  1ZV4 X;  3H3A A;  4EAH A;  4HFH A;  1VCS A;  2CBJ A;  2LRL A;  1UK5 A;  1WCR A;  1GQE A;  4H9R C;  4IDN A;  3UU6 A;  5LGU B;  4EEB A;  4X20 E;  4H9S E;  2E9X C;  4ZHQ E;  3OYZ A;  3JAE A;  5AQO B;  3HKC E;  2DWK A;  4FI5 A;  2VVS A;  4HWH A;  3PJA J;  1JNR A;  4B6X A;  4OX9 T;  2UXC T;  1JNZ A;  5HAX A;  2XQ5 A;  4XAX B;  3KV5 A;  4IGU A;  4YLH A;  1XMQ T;  2BKO A;  4B3S T;  3M65 A;  4QH1 A;  4GIW A;  3OYX A;  2CE7 A;  3EHZ A;  1WYC A;  3AE7 A;  4QHO A;  4UF0 B;  2IHR 1;  2K5B B;  2VWA A;  4DMV A;  4ZI2 D;  1OED A;  2CBI A;  2I0M A;  1WYB A;  5EK4 A;  2NTX A;  3NRX A;  3ONJ A;  3C4Z A;  4K0K T;  2KWH A;  3EVY A;  1XNQ T;  2A72 A;  2JPF A;  3AA6 B;  2VAS A;  3Q9D A;  3PV0 F;  2EHO D;  2MPK A;  4PJM A;  5EZY E;  5F3J A;  2WBL A;  3N9L A;  4PK5 A;  4L5G A;  4A56 A;  4LFA T;  4ANJ A;  1N36 T;  2K9A A;  2HHH T;  3LK4 2;  2JIW A;  4QX8 B;  2V6X A;  2CMR A;  2FJB A;  3U78 A;  3K3N A;  3ZKR A;  1VOM A;  2JMK A;  3RQU A;  2K3W A;  4EB6 E;  3OBV E;  4PFP A;  3ZT6 A;  3C51 A;  2BS4 A;  3QUJ A;  2A2F X;  1ZP0 A;  4Z90 A;  3AE4 A;  3L39 A;  5HCM A;  3SS1 A;  3PU8 A;  4JYA T;  4E7S A;  5IWA T;  2CXF A;  1HCI A;  2BG9 B;  3ZMU B;  1MMG A;  5CGM A;  2RA1 A;  3AA7 B;  1SE7 A;  4HE8 A;  1MMA A;  4HFI A;  3VR9 A;  3I9Y A;  2SPC A;  4PK4 A;  2YOE A;  2EHO B;  3RIA A;  3KIN B;  2YN6 A;  2CXD A;  2XTL A;  2YU1 A;  3KV6 A;  3AA1 B;  3QK6 A;  1CUN A;  3JC6 D;  2DLR A;  2MTQ A;  5FY0 A;  3ZYL A;  3LK3 B;  1ZOY A;  3ZT7 A;  3ZJ2 A;  2CCQ A;  4UVA B;  1UCU A;  3GA8 A;  2UUA T;  4K0U A;  2H7O A;  3CQX C;  3N2K E;  5LHH B;  3CWZ B;  4DR5 T;  1N33 T;  2V7I A;  3PUV F;  2PG8 A;  2LM2 A;  5LNK A;  4DV2 T;  1D1A A;  5IUX A;  3LSV A;  4KUM B;  3KV9 A;  1FMW A;  3IA3 A;  3BQI A;  3I9W A;  1XMO T;  3RC8 A;  4KHP T;  4KMC A;  5DJQ C;  4QKN A;  4DVD A;  4X5T A;  2NTY A;  2ZM2 A;  5L2L A;  3T1H T;  1HNW T;  2M6I A;  5KDM C;  2XJ7 A;  1SUM B;  2ACX A;  4CXW A;  5JR9 B;  2V5C A;  1T7S A;  3ZMT B;  2CHN A;  2KZ7 B;  4IE5 A;  3AE8 A;  3QNU A;  5ABG A;  3AE1 A;  2DCF A;  2LSK A;  2XAG B;  3HR0 A;  4IDQ A;  1OED B;  3RF1 A;  4AIU A;  4HWF A;  1V9D A;  4HKA A;  4GK0 E;  3H3M A; 
#chains in the Genus database with same CATH homology
 3A8Y C;  4HWC A;  4HWH A;  5AQU B;  5AQV B;  3FZM B;  5AQF B;  5AQK B;  5AQQ B;  5AQJ B;  5AQT B;  3FZF B;  1UGO A;  1HX1 B;  5AQH B;  5AQI B;  5AQL B;  5AQS B;  5AQP B;  1M62 A;  5AQG B;  3FZL B;  1UK5 A;  4HWD A;  5AQN B;  3LDQ B;  4HWI B;  5AQR B;  3FZH B;  2D9D A;  5AQO B;  1M7K A;  5AQM B;  3FZK B;  1T7S A;  1I6Z A;  4HWF A;  3M3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...