5AQOB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 46
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqoB00
5AQIB 3FZKB 5AQTB 1M7KA 5AQRB 1UGOA 1T7SA 3M3ZB 5AQJB 5AQQB 3LDQB 5AQHB 5AQOB 3FZHB 4HWHA 3FZLB 5AQMB 5AQGB 5AQNB 5AQLB 5AQUB 5AQSB 1M62A 1I6ZA 5AQVB 3FZFB 5AQFB 1UK5A 5AQKB 3FZMB 4HWCA 3A8YC 4HWDA 2D9DA 5AQPB 4HWIB 4HWFA 1HX1B
chains in the Genus database with same CATH superfamily
4ERRA 2BVMA 4AQYT 3M65A 3OJAA 3OPCA 3Q5EA 2UXBT 3B57A 2VKHA 4HFVA 4CXYA 3PUGA 4PAGA 1NENA 3ZMZB 4JV5T 2KMFA 5JQGE 1MIWA 4LFCT 3UFEA 1KNPA 3N9OA 2C0SA 2CCQA 3E08A 2G0UA 2LSJA 3CPZA 5FKYA 5L4HA 1OEDA 2E8IA 2ODVA 2XQ6A 2WWUA 4XAXB 1WLXA 3JAFA 2N9DA 5HEUA 3N9NA 5AQVB 2L9QA 4ZI3D 4LF9T 3ZMUB 4DR4T 4MFRA 2KLQA 2XAJB 2BS3A 2ZMAA 1T98A 3QNUA 4HFBA 5FXXA 3VR9A 5JDFA 5IUXA 5JDGA 4FI5A 4DV4T 3RYHE 3AVSA 2XQ9A 1AJ3A 3Q9DA 3ZLIA 4IL4A 4AISA 4JI8T 3GN5B 3BQLA 1HNZT 4QWNB 2LRKA 5LJNA 2LHNA 5AQIB 4Z90A 5AQTB 2CXFA 2V7KA 2BBHA 2WM9A 3BQIA 4HE8A 1NEKA 3AEEA 2XSAA 2QA7A 4X1KE 3RX6A 3CX7B 3ZSSA 4YXDA 5CGMA 2JMKA 4B3MT 3CMLA 2UXDT 2KNDA 4BA9A 1KNZA 2H89A 3NWIA 2K5BB 4DR2T 4UEMA 4TN7B 1IBLT 5L4EA 4LF4T 3AE9A 1E1HB 4HTEA 4MBQA 3UU4A 5C3JA 4HFCA 5AQSB 3D0TA 2X9YA 2VKOA 5KDMC 3I9WA 4OHFA 4YSZA 3PDYA 2SPCA 4ISSA 4OFZA 5LJMA 4NUVA 3PU8A 3FBZA 4Z91A 4YJ2E 1OXZA 2YU1A 5EZYE 3K8PC 4ZOLE 5HEHA 3SS1A 1VCTA 2GK9A 5L3GB 2QVAA 3JADA 3RKOA 1W9RA 5LGUB 3HA4A 1HG5A 2ES0A 2V6YB 3B13A 4B3RT 3LBXA 4ZI2C 2OLTA 2WSSV 3C64A 3L39A 3VKHA 4MALA 3RQUA 4DBQA 2VVSA 2CXLA 1W0BA 3R6NA 1XWMA 3I9YA 3QC9A 3ZEFB 3OYZA 2E9XA 2XAHB 2PJQA 5CJ5A 4U7IA 3RC8A 4UR9A 1FMWA 2H7OA 2WU5A 2NWBA 4A98A 2NTXA 2EHOC 5IWAT 1QLBA 4QH5A 2XTLA 2LHRA 2WCAA 3ONJA 3AB3B 4NIQA 2V7LA 3N9MA 5JR9A 3FHNA 3SFEA 1FMVA 2WQYA 2X9HA 4P1NA 3W15B 2XZEA 5KXJA 5J2TE 5LBMA 2WB5A 2Q9QD 2V7MA 4PJJA 4K0UA 4E7SA 5F5WA 1MMDA 2H3RA 4X5TA 2PFVA 2L8KA 3IA3A 3KVBA 4H9QC 4YJ3E 1J5ET 4I0UA 1WFDA 2WDQA 5JVDE 5DQWA 5AQRB 4O2AE 3TLTA 4X62T 2BG9A 4PFOA 1HNXT 3HKCE 2HH7A 4DV6T 2ACXA 4N78D 1IBMT 4X64T 2WZHA 2RPAA 3ZKRA 4BJNA 3FB2A 4GYRA 1IBKT 5JRCB 3ABVA 5M4YA 2DLRA 1S35A 3ZPOA 3WI3A 5J2UE 5L3BB 2I6HA 1KNRA 3CQXC 5AQLB 1XNQT 2CBIA 3AE4A 3ANWB 4UF0A 3SRZA 2LM9A 4OK0A 4ZZCA 5HXEA 3NRXA 4IDQA 2YINA 5BR8T 4ASKA 4ZS3A 4IDNA 2XAFB 4UVAB 3ONXA 3VR8A 4CXWA 2LKGA 2KT9A 4JI1T 4ZI7E 3EABA 2CEAA 2DHRA 2XQ3A 1OEDE 4UVCB 4HKAA 3VU7H 1BR2A 4U74A 2R6GF 2P9BA 2E9XD 2BVLA 2VURA 3FZKB 4ILBA 1ZOYA 1T72A 1M7KA 2UU9T 1HF8A 5LA6E 1D0XA 2WBLA 5L3FB 3RIUC 5LHIB 3AE1A 5AQQB 5LGNB 4HGAA 3R84B 4O4JE 4U72A 3UUBA 3ZT6A 5FL1A 3ZN0B 2CBJA 3NVOA 2UUAT 4YT0A 3PUYF 2XQ8A 3UQ4A 5ABGA 2J62A 1J5WA 3AA1B 3PTRB 1EZ3A 2L3LA 1T8BA 4IIJE 2V26A 1Y64B 2MBGA 4X65T 1V9DA 2V6XA 4YTMA 5AQUB 1B7TA 1I6ZA 3QK6A 4JUYA 1HS7A 2B76A 3B5MA 3IEEA 3AXJB 2W63A 3F31A 1ZHCA 1E2AA 4QXHB 3FZMB 2C5JA 4AQFC 4DR5T 4YHJA 4DV0T 2A3DA 4HFEA 4H63V 5F8PA 1SA0E 3N9PA 2NOXA 3RF1A 3FBLA 4A97A 2XQ7A 4PJNA 4L9IA 2D0UA 3AE3A 2KSRA 3O1HA 3N2GE 3ZYKA 2EHOD 3BQKA 3RLFF 4EEDA 3IBPA 5JTGA 1NWMX 2H7VC 3VHLA 3N9LA 4YLHA 3RRWA 4DV2T 3SFDA 3HI2A 3UTKA 3AEBA 5LBQB 4KBMB 3UUMA 4H9PC 5FYMA 2WAUA 4CZZB 3AA0B 4UELA 3VRBA 3GA8A 4P09A 4UV8B 3KV6A 4UVBB 2IDOB 2XUEA 3L09A 3K3QC 3LG7A 2NP9A 2C5IT 2WZIA 3P4WA 4G2AA 4IE5A 3MJXA 2NTYA 4WNKA 4EXTA 4X1YE 5JDQA 3OTOT 5BMVE 1H7CA 3AE8A 2ZM0A 2LSIA 2XY8B 4O8SA 4IE4A 2Q9QB 3KV5A 1FIOA 5CFBA 3P50A 2X67A 5LXTE 5JDHA 2YDQA 4EB6E 2D9DA 4YSXA 4MHCA 4ILUA 3CK6A 4U2ZA 3V5SA 2JQHA 5LGTB 2FUPA 3TLUA 5CA0E 2DL1A 2BG9C 1UURA 2BDEA 2Y48B 2Y8DA 3M3ZB 2IAKA 5LG4A 4DV1T 2IMLA 1D1CA 2VKDA 4NXNT 3KBTA 4IE7A 2M6BA 4LMLA 5IYZE 2KXPB 3PUQA 4HWHA 2X0LB 1OEDB 1ZKEA 2A2FX 3EHZA 1X9BA 2LSKA 4IHJE 4JI2T 5HWXA 4IL9A 5JDLA 2UUCT 2XPKA 2ZLYA 4AKLA 2N2NA 4YFSA 2W66A 5CB4E 4ZZBA 1VOMA 2W61A 5LG3A 2DWKA 5F3JA 3OBVE 2YOEA 3H37A 4MLKA 3WAKA 3TKLB 4EAHA 2BG9B 3SOLA 3V5UA 3BK9A 1WR6A 4UXNB 3RC3A 2OA5A 2YU2A 3CX8B 4HFHA 4X1IE 3J9X1 3RRCA 3AAAB 2JRKA 4A56A 3TLVA 4AKRB 3N9QA 3P4SA 4B3TT 2MTQA 4DR7T 5E0OA 2CWYA 2WP9A 1YKHB 4V1Av 3AA7B 3OVUA 3P4PA 2BKNA 4I50E 3JC6D 2W2UA 2XASB 3DTOA 3NBXX 4HFDA 4ANJA 5C2TA 1MIVA 5FVLA 1WR0A 4YTNA 3F57A 4BJMA 5HXHA 3FZLB 3O9XA 3PU3A 4EYYR 3AE2A 2VK9A 5FXZA 2D2SA 3CWZB 1XDOA 3PUWF 3PJAA 2LSYA 3QB5A 4QHOA 3CVRA 3ZCIA 1WRDA 2VL8A 4TWDA 1D1AA 2CRBA 4PK4A 3FZFB 2I59A 4PJLA 1US7B 4EEBA 2D0TA 4ILAA 2MYSA 2BS4A 2B1EA 3LK2B 4CN4A 3N2OA 3RH3A 1XMOT 4O2BE 2J1DG 3AEGA 2Q9QC 5AQKB 1XMQT 3C98B 4O4LE 3UU3A 5HCMA 4LF7T 2IIUA 3EAMA 1SE7A 1SHZC 3AAEB 3N2KE 3Q5DA 4IGUA 1YD8G 4ZS2A 1IZNB 3TLWA 4O4IE 3LBXB 2V6YA 3UUNA 4ZI2D 2RP4A 3FXDB 2YDSA 4LMKA 1UGOA 2CXDA 2XQ5A 3KBUA 5A1LA 2EHOB 4M1PA 2MPKA 2VQFT 5HXCA 4WZXA 3P4RA 2XAGB 4AKHA 3MA9A 1ZV4X 2NW7A 2V1DB 3FZHB 3JC6C 5ABHA 1XDPA 2VB6A 1JNRA 5JDNA 4P0AA 3S4UA 3T1YT 2OV9A 1HR0T 2CE7A 2Q9QA 1DU2A 3AE6A 4G63A 5FP3A 3ZMVB 4BAYB 1W0AA 2JJ9A 2I0MA 4DIDB 1E7PA 2N1GA 4KX6A 4OYKA 1HCIA 4WW0A 2V5CA 3UU5A 3JCFA 3HKBE 4ZHQE 3KDSE 4TNVA 4AQGA 2W67A 4IDOA 1G73A 2C5KT 4LF6T 3OYXA 4TWHA 3UFGA 4EGWA 2A72A 2BZBA 2NR4A 1KEYA 2IC6A 3KV4A 5DQVA 4LF8T 4PW8A 4DNDA 2K3WA 4KUMB 4QKNA 5FY0A 4YHHT 4AKIA 5LMNT 4H63H 1D0ZA 2KWHA 2LEHA 3RHWA 3DJBA 1UX5A 4GK5E 4EV6A 4EZ4A 5JRCA 5AQHB 4ZXLA 3NZPA 5IHYA 3ZC1A 4IT4A 3L3PA 3DP7A 2XQ4A 3AE5A 2EHOA 3A5XA 4DVDA 4DV7T 3EDVA 4KHPT 3AEFA 3ETUA 4CN6A 3HKDE 4DUYT 4JBWF 2BKOA 3CIRA 4OYJA 3ZN1B 3ZSTA 3LK3B 3ZMTB 3I0OA 1G8XA 4PFPA 3RIUA 5LYJE 4AXPA 2QYWA 1S94A 5JH7E 2E9XB 1N34T 3PE0A 4YSYA 3KVAA 3GMIA 3E22E 4TUYE 2FJEA 4HEAA 2V7JA 3ZJ2A 3A8YC 3PUSA 1LVFA 2IUBA 4HWDA 4KI0F 5GONE 3RIFA 3ZMSB 2XAQB 1UX4A 4IE0A 4HWIB 2RA1A 5HXRA 5HXSA 1MNEA 4LMJA 5KMGP 2XQAA 4X20E 4DR6T 3UQ7A 2LE8A 2UXXB 5TAOA 4FJOA 4JEHB 3RGLA 1IJ5A 2W00A 1XNRT 5AQJB 1WYCA 1UUSA 1LRZA 2VASA 3ETVA 3QUJA 4L5GA 4YTPA 2K24A 4PK5A 4U33A 3NRYA 4Q25A 4NPPA 4F6RC 5ETWA 1CHUA 4H9SE 3RYCE 2VQET 1N32T 1OWAA 4B3ST 2V8SV 5AQGB 3P4QA 5FVKA 1XZYA 5HEJA 4OX9T 1FJGT 3LSVA 3PURA 3QOFA 3ZJ1A 3VKGA 2XHEB 1ZP0A 4IREA 5DABA 1HG2A 3AEDA 4IDPA 4GYSA 4H9NC 1L0VA 5AQFB 1BR4A 1UK5A 3LFMA 4I55E 4TV9E 5FY7A 2WWVA 3U78A 2WDVA 2X66A 3A7MA 4QH1A 3C50A 5H6QB 3RYFE 2A9UA 4JI6T 4XBFB 4KMCA 1X79A 1N33T 2FJBA 2BBJA 2FJAA 3PUZF 2CMRA 2HPLA 2V5DA 4TV8E 4ADZA 1Z8UA 4CI1B 1UCUA 3NZQA 4GIWA 2X0HA 2FJDA 3EVYA 3RPUA 2CA5A 4A5XA 3HKEE 5ABFA 3HR0A 3IF8B 4AKGA 1LKXA 2FBWA 4C90A 4AQFA 2AE9A 3K1SA 2K48A 3P7IA 4L0RA 1KK7A 4JI4T 1J1JA 4LF5T 4U31A 5L47A 3WAJA 5AQNB 1HTJF 2X68A 3ZC0A 4JLEA 3F2EA 2XM1A 4NUUA 5LCYA 2XJ7A 3Q5WA 3MXZA 4KP3C 4IDZA 3ZYMA 4JI3T 3AEAA 1U4QA 1W09A 4KHZF 4CXXA 2Y6XA 4J2CA 3N5LA 1D1BA 4NXMT 5DJQC 5HYAA 5L3EB 5J0ZA 3PUXF 2ZM6T 5H6RB 2YEVC 5LB7B 2PG8A 2LLYA 3CKDA 2X9XA 5JR9C 5EK4A 2W62A 2JQ9A 2X51A 5LHGB 4GKKT 5ABEA 1OEDC 2WDRA 2WY2A 4O4HE 4QX7B 5L2LA 3I1AA 2WU2A 4PNIA 5JDMA 5LMUT 2HN2A 4DUZT 4LFBT 3CQGB 2BKPA 1VCSA 2BG9E 2W4XA 2J47A 4CI3B 3C4XA 4WBNE 2X0YA 1HFAA 1KF6A 2IHR1 2LSGA 2YDRA 3GN5A 2CLYC 3MK7C 4IE6A 2DWGA 5HEOA 5AFUL 2VWAA 5LOVE 3AVRA 1YQ4A 5HWYA 5JR9B 1Z0PA 3MACA 3EI0A 1Y01A 2DNXA 2BS2A 2CPTA 4WYVA 4X66T 3K3OA 2E2AA 3RYIE 5HAXA 4HWCA 4QXBB 3CQCB 4H9RC 3PV0F 3T1HT 3ONLC 2LM2A 3I0QA 1IAPA 5AQPB 5FXVA 3J7Yq 4CI2B 1HX1B 2ZM2A 4DBRA 1HX8A 2JMHA 3PUAA 3H3AA 4JEUB 3HL6A 4PJMA 4Z8XA 3RIAA 1MMAA 3JAEA 4ZEYA 4DR3T 1KFYA 1SUMB 1T7SA 3E0ZA 3KFWX 4DO0A 3QB5K 5FY1A 4C91A 4H9OC 2V7IA 2LOPA 2M67A 4I4TE 1MMNA 1CUNA 2D5UA 2VVNA 4PK6A 5FXWA 2MAWA 1YW0A 1ZEEA 3EDUA 3MKDA 3T8OA 2AXDS 4XZCA 1QUUA 5L3DB 2KWIB 3ESLA 2XQYA 5AQMB 4EOZB 5EK3A 4JI7T 3ZT5A 1LVKA 4GK0E 1M62A 3O1JA 3UT5E 3AA6B 3SWHA 2CM0A 3KV9A 3LJCA 2NW9A 5FNVE 3UU8A 4JI0T 4K0KT 1D0YA 2HN1A 2W0GA 2YK0A 2WS3A 2VL0A 5HCJA 2JQQA 4B6XA 2DI4A 4UIGA 3L8RA 2MOZA 3C4WA 3K3NA 2WMOA 1JNZA 3KINB 3OKQA 4UV9B 2CWOA 2E9XC 2YKSA 3CX6B 2CHNA 4CQIA 4ZI3C 2PTFA 4DMVA 5C8YE 1R8IA 4YY3T 3FXEB 4HWFA 5KX5E 1YQ3A 5L3CB 2M6IA 2JPFA 4DV3T 4TNWA 4COFA 1FEWA 4JYAT 4U7YA 2DCFA 3LDQB 1MMGA 4ILCA 4EIWA 1QSDA 3UU6A 2X9WA 2QGSA 3C4ZA 5AQOB 1WCRA 4U3CA 2ACZA 3O4XE 4P0BA 4U2YA 5JREA 4DMWA 2VKJA 3LK42 3ANWA 4UF0B 2CLYB 3Q2MA 4I43B 2UUBT 1HNWT 2ZM8A 5LP6E 4WBOA 3NKZA 3AXJA 1I94T 1U5PA 3PUVF 2IW5B 1WYBA 5LNKA 4TZ4C 5ADXL 2F4VT 4CN1A 3AECA 2KINB 2ODUA 4F8HA 3GWHA 4QH4A 4HN9A 5ABFB 3U3IA 3ZCJA 2HHHT 1VRBA 3RI5A 2J4GA 1GQEA 1YXRA 4LFAT 2KZ7B 3PJAJ 2XSBA 3P8CD 2JQKA 3TLSA 3ZYLA 2QRXA 3IHRA 3MZKB 2LOSA 2LJLA 2LKHA 5FL0A 1MIYA 2K9AA 3H3MA 3VRAA 5EK2A 4DV5T 3RQWA 2Z6EA 1N36T 5CA1E 2HPJA 2JIWA 2WMNA 3O1IA 4ISTA 2XM2A 2H88A 2LRLA 4QXCB 1NAFA 5FMNA 4QX8B 5LHHB 4JI5T 2UXCT 2E5VA 5HEGA 1YKEB 2UXNB 3RKGA 3X1DA 4DR1T 2E5LT 4GKJT 3AAIA 4E7ZA 4GOUA 3ZT7A 1BR0A 2PBIA 3C51A 3UULA 1BR1A 3UUXB 4AI6A 4EZHA 4TWFA 2LT3A 4HFIA 5J1GA 4AIUA 1IJ6A 2IC9A 3G06A 4TX5A 3AE7A 2YN6A 3Q5XA 1O3XA 4EYUA 2CHOA 1MNDA 3EUHA 2NW8A
chains in the Genus database with same CATH topology
5AQIB 3FZKB 5AQTB 1M7KA 5AQRB 1UGOA 1T7SA 3M3ZB 5AQJB 5AQQB 3LDQB 5AQHB 5AQOB 3FZHB 4HWHA 3FZLB 5AQMB 5AQGB 5AQNB 5AQLB 5AQUB 5AQSB 1M62A 1I6ZA 5AQVB 3FZFB 5AQFB 1UK5A 5AQKB 3FZMB 4HWCA 3A8YC 4HWDA 2D9DA 5AQPB 4HWIB 4HWFA 1HX1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQI B;  3FZK B;  5AQT B;  1M7K A;  5AQR B;  1UGO A;  1T7S A;  3M3Z B;  5AQJ B;  5AQQ B;  3LDQ B;  5AQH B;  5AQO B;  3FZH B;  4HWH A;  3FZL B;  5AQM B;  5AQG B;  5AQN B;  5AQL B;  5AQU B;  5AQS B;  1M62 A;  1I6Z A;  5AQV B;  3FZF B;  5AQF B;  1UK5 A;  5AQK B;  3FZM B;  4HWC A;  3A8Y C;  4HWD A;  2D9D A;  5AQP B;  4HWI B;  4HWF A;  1HX1 B; 
#chains in the Genus database with same CATH topology
 4ERR A;  2BVM A;  4AQY T;  3M65 A;  3OJA A;  3OPC A;  3Q5E A;  2UXB T;  3B57 A;  2VKH A;  4HFV A;  4CXY A;  3PUG A;  4PAG A;  1NEN A;  3ZMZ B;  4JV5 T;  2KMF A;  5JQG E;  1MIW A;  4LFC T;  3UFE A;  1KNP A;  3N9O A;  2C0S A;  2CCQ A;  3E08 A;  2G0U A;  2LSJ A;  3CPZ A;  5FKY A;  5L4H A;  1OED A;  2E8I A;  2ODV A;  2XQ6 A;  2WWU A;  4XAX B;  1WLX A;  3JAF A;  2N9D A;  5HEU A;  3N9N A;  5AQV B;  2L9Q A;  4ZI3 D;  4LF9 T;  3ZMU B;  4DR4 T;  4MFR A;  2KLQ A;  2XAJ B;  2BS3 A;  2ZMA A;  1T98 A;  3QNU A;  4HFB A;  5FXX A;  3VR9 A;  5JDF A;  5IUX A;  5JDG A;  4FI5 A;  4DV4 T;  3RYH E;  3AVS A;  2XQ9 A;  1AJ3 A;  3Q9D A;  3ZLI A;  4IL4 A;  4AIS A;  4JI8 T;  3GN5 B;  3BQL A;  1HNZ T;  4QWN B;  2LRK A;  5LJN A;  2LHN A;  5AQI B;  4Z90 A;  5AQT B;  2CXF A;  2V7K A;  2BBH A;  2WM9 A;  3BQI A;  4HE8 A;  1NEK A;  3AEE A;  2XSA A;  2QA7 A;  4X1K E;  3RX6 A;  3CX7 B;  3ZSS A;  4YXD A;  5CGM A;  2JMK A;  4B3M T;  3CML A;  2UXD T;  2KND A;  4BA9 A;  1KNZ A;  2H89 A;  3NWI A;  2K5B B;  4DR2 T;  4UEM A;  4TN7 B;  1IBL T;  5L4E A;  4LF4 T;  3AE9 A;  1E1H B;  4HTE A;  4MBQ A;  3UU4 A;  5C3J A;  4HFC A;  5AQS B;  3D0T A;  2X9Y A;  2VKO A;  5KDM C;  3I9W A;  4OHF A;  4YSZ A;  3PDY A;  2SPC A;  4ISS A;  4OFZ A;  5LJM A;  4NUV A;  3PU8 A;  3FBZ A;  4Z91 A;  4YJ2 E;  1OXZ A;  2YU1 A;  5EZY E;  3K8P C;  4ZOL E;  5HEH A;  3SS1 A;  1VCT A;  2GK9 A;  5L3G B;  2QVA A;  3JAD A;  3RKO A;  1W9R A;  5LGU B;  3HA4 A;  1HG5 A;  2ES0 A;  2V6Y B;  3B13 A;  4B3R T;  3LBX A;  4ZI2 C;  2OLT A;  2WSS V;  3C64 A;  3L39 A;  3VKH A;  4MAL A;  3RQU A;  4DBQ A;  2VVS A;  2CXL A;  1W0B A;  3R6N A;  1XWM A;  3I9Y A;  3QC9 A;  3ZEF B;  3OYZ A;  2E9X A;  2XAH B;  2PJQ A;  5CJ5 A;  4U7I A;  3RC8 A;  4UR9 A;  1FMW A;  2H7O A;  2WU5 A;  2NWB A;  4A98 A;  2NTX A;  2EHO C;  5IWA T;  1QLB A;  4QH5 A;  2XTL A;  2LHR A;  2WCA A;  3ONJ A;  3AB3 B;  4NIQ A;  2V7L A;  3N9M A;  5JR9 A;  3FHN A;  3SFE A;  1FMV A;  2WQY A;  2X9H A;  4P1N A;  3W15 B;  2XZE A;  5KXJ A;  5J2T E;  5LBM A;  2WB5 A;  2Q9Q D;  2V7M A;  4PJJ A;  4K0U A;  4E7S A;  5F5W A;  1MMD A;  2H3R A;  4X5T A;  2PFV A;  2L8K A;  3IA3 A;  3KVB A;  4H9Q C;  4YJ3 E;  1J5E T;  4I0U A;  1WFD A;  2WDQ A;  5JVD E;  5DQW A;  5AQR B;  4O2A E;  3TLT A;  4X62 T;  2BG9 A;  4PFO A;  1HNX T;  3HKC E;  2HH7 A;  4DV6 T;  2ACX A;  4N78 D;  1IBM T;  4X64 T;  2WZH A;  2RPA A;  3ZKR A;  4BJN A;  3FB2 A;  4GYR A;  1IBK T;  5JRC B;  3ABV A;  5M4Y A;  2DLR A;  1S35 A;  3ZPO A;  3WI3 A;  5J2U E;  5L3B B;  2I6H A;  1KNR A;  3CQX C;  5AQL B;  1XNQ T;  2CBI A;  3AE4 A;  3ANW B;  4UF0 A;  3SRZ A;  2LM9 A;  4OK0 A;  4ZZC A;  5HXE A;  3NRX A;  4IDQ A;  2YIN A;  5BR8 T;  4ASK A;  4ZS3 A;  4IDN A;  2XAF B;  4UVA B;  3ONX A;  3VR8 A;  4CXW A;  2LKG A;  2KT9 A;  4JI1 T;  4ZI7 E;  3EAB A;  2CEA A;  2DHR A;  2XQ3 A;  1OED E;  4UVC B;  4HKA A;  3VU7 H;  1BR2 A;  4U74 A;  2R6G F;  2P9B A;  2E9X D;  2BVL A;  2VUR A;  3FZK B;  4ILB A;  1ZOY A;  1T72 A;  1M7K A;  2UU9 T;  1HF8 A;  5LA6 E;  1D0X A;  2WBL A;  5L3F B;  3RIU C;  5LHI B;  3AE1 A;  5AQQ B;  5LGN B;  4HGA A;  3R84 B;  4O4J E;  4U72 A;  3UUB A;  3ZT6 A;  5FL1 A;  3ZN0 B;  2CBJ A;  3NVO A;  2UUA T;  4YT0 A;  3PUY F;  2XQ8 A;  3UQ4 A;  5ABG A;  2J62 A;  1J5W A;  3AA1 B;  3PTR B;  1EZ3 A;  2L3L A;  1T8B A;  4IIJ E;  2V26 A;  1Y64 B;  2MBG A;  4X65 T;  1V9D A;  2V6X A;  4YTM A;  5AQU B;  1B7T A;  1I6Z A;  3QK6 A;  4JUY A;  1HS7 A;  2B76 A;  3B5M A;  3IEE A;  3AXJ B;  2W63 A;  3F31 A;  1ZHC A;  1E2A A;  4QXH B;  3FZM B;  2C5J A;  4AQF C;  4DR5 T;  4YHJ A;  4DV0 T;  2A3D A;  4HFE A;  4H63 V;  5F8P A;  1SA0 E;  3N9P A;  2NOX A;  3RF1 A;  3FBL A;  4A97 A;  2XQ7 A;  4PJN A;  4L9I A;  2D0U A;  3AE3 A;  2KSR A;  3O1H A;  3N2G E;  3ZYK A;  2EHO D;  3BQK A;  3RLF F;  4EED A;  3IBP A;  5JTG A;  1NWM X;  2H7V C;  3VHL A;  3N9L A;  4YLH A;  3RRW A;  4DV2 T;  3SFD A;  3HI2 A;  3UTK A;  3AEB A;  5LBQ B;  4KBM B;  3UUM A;  4H9P C;  5FYM A;  2WAU A;  4CZZ B;  3AA0 B;  4UEL A;  3VRB A;  3GA8 A;  4P09 A;  4UV8 B;  3KV6 A;  4UVB B;  2IDO B;  2XUE A;  3L09 A;  3K3Q C;  3LG7 A;  2NP9 A;  2C5I T;  2WZI A;  3P4W A;  4G2A A;  4IE5 A;  3MJX A;  2NTY A;  4WNK A;  4EXT A;  4X1Y E;  5JDQ A;  3OTO T;  5BMV E;  1H7C A;  3AE8 A;  2ZM0 A;  2LSI A;  2XY8 B;  4O8S A;  4IE4 A;  2Q9Q B;  3KV5 A;  1FIO A;  5CFB A;  3P50 A;  2X67 A;  5LXT E;  5JDH A;  2YDQ A;  4EB6 E;  2D9D A;  4YSX A;  4MHC A;  4ILU A;  3CK6 A;  4U2Z A;  3V5S A;  2JQH A;  5LGT B;  2FUP A;  3TLU A;  5CA0 E;  2DL1 A;  2BG9 C;  1UUR A;  2BDE A;  2Y48 B;  2Y8D A;  3M3Z B;  2IAK A;  5LG4 A;  4DV1 T;  2IML A;  1D1C A;  2VKD A;  4NXN T;  3KBT A;  4IE7 A;  2M6B A;  4LML A;  5IYZ E;  2KXP B;  3PUQ A;  4HWH A;  2X0L B;  1OED B;  1ZKE A;  2A2F X;  3EHZ A;  1X9B A;  2LSK A;  4IHJ E;  4JI2 T;  5HWX A;  4IL9 A;  5JDL A;  2UUC T;  2XPK A;  2ZLY A;  4AKL A;  2N2N A;  4YFS A;  2W66 A;  5CB4 E;  4ZZB A;  1VOM A;  2W61 A;  5LG3 A;  2DWK A;  5F3J A;  3OBV E;  2YOE A;  3H37 A;  4MLK A;  3WAK A;  3TKL B;  4EAH A;  2BG9 B;  3SOL A;  3V5U A;  3BK9 A;  1WR6 A;  4UXN B;  3RC3 A;  2OA5 A;  2YU2 A;  3CX8 B;  4HFH A;  4X1I E;  3J9X 1;  3RRC A;  3AAA B;  2JRK A;  4A56 A;  3TLV A;  4AKR B;  3N9Q A;  3P4S A;  4B3T T;  2MTQ A;  4DR7 T;  5E0O A;  2CWY A;  2WP9 A;  1YKH B;  4V1A v;  3AA7 B;  3OVU A;  3P4P A;  2BKN A;  4I50 E;  3JC6 D;  2W2U A;  2XAS B;  3DTO A;  3NBX X;  4HFD A;  4ANJ A;  5C2T A;  1MIV A;  5FVL A;  1WR0 A;  4YTN A;  3F57 A;  4BJM A;  5HXH A;  3FZL B;  3O9X A;  3PU3 A;  4EYY R;  3AE2 A;  2VK9 A;  5FXZ A;  2D2S A;  3CWZ B;  1XDO A;  3PUW F;  3PJA A;  2LSY A;  3QB5 A;  4QHO A;  3CVR A;  3ZCI A;  1WRD A;  2VL8 A;  4TWD A;  1D1A A;  2CRB A;  4PK4 A;  3FZF B;  2I59 A;  4PJL A;  1US7 B;  4EEB A;  2D0T A;  4ILA A;  2MYS A;  2BS4 A;  2B1E A;  3LK2 B;  4CN4 A;  3N2O A;  3RH3 A;  1XMO T;  4O2B E;  2J1D G;  3AEG A;  2Q9Q C;  5AQK B;  1XMQ T;  3C98 B;  4O4L E;  3UU3 A;  5HCM A;  4LF7 T;  2IIU A;  3EAM A;  1SE7 A;  1SHZ C;  3AAE B;  3N2K E;  3Q5D A;  4IGU A;  1YD8 G;  4ZS2 A;  1IZN B;  3TLW A;  4O4I E;  3LBX B;  2V6Y A;  3UUN A;  4ZI2 D;  2RP4 A;  3FXD B;  2YDS A;  4LMK A;  1UGO A;  2CXD A;  2XQ5 A;  3KBU A;  5A1L A;  2EHO B;  4M1P A;  2MPK A;  2VQF T;  5HXC A;  4WZX A;  3P4R A;  2XAG B;  4AKH A;  3MA9 A;  1ZV4 X;  2NW7 A;  2V1D B;  3FZH B;  3JC6 C;  5ABH A;  1XDP A;  2VB6 A;  1JNR A;  5JDN A;  4P0A A;  3S4U A;  3T1Y T;  2OV9 A;  1HR0 T;  2CE7 A;  2Q9Q A;  1DU2 A;  3AE6 A;  4G63 A;  5FP3 A;  3ZMV B;  4BAY B;  1W0A A;  2JJ9 A;  2I0M A;  4DID B;  1E7P A;  2N1G A;  4KX6 A;  4OYK A;  1HCI A;  4WW0 A;  2V5C A;  3UU5 A;  3JCF A;  3HKB E;  4ZHQ E;  3KDS E;  4TNV A;  4AQG A;  2W67 A;  4IDO A;  1G73 A;  2C5K T;  4LF6 T;  3OYX A;  4TWH A;  3UFG A;  4EGW A;  2A72 A;  2BZB A;  2NR4 A;  1KEY A;  2IC6 A;  3KV4 A;  5DQV A;  4LF8 T;  4PW8 A;  4DND A;  2K3W A;  4KUM B;  4QKN A;  5FY0 A;  4YHH T;  4AKI A;  5LMN T;  4H63 H;  1D0Z A;  2KWH A;  2LEH A;  3RHW A;  3DJB A;  1UX5 A;  4GK5 E;  4EV6 A;  4EZ4 A;  5JRC A;  5AQH B;  4ZXL A;  3NZP A;  5IHY A;  3ZC1 A;  4IT4 A;  3L3P A;  3DP7 A;  2XQ4 A;  3AE5 A;  2EHO A;  3A5X A;  4DVD A;  4DV7 T;  3EDV A;  4KHP T;  3AEF A;  3ETU A;  4CN6 A;  3HKD E;  4DUY T;  4JBW F;  2BKO A;  3CIR A;  4OYJ A;  3ZN1 B;  3ZST A;  3LK3 B;  3ZMT B;  3I0O A;  1G8X A;  4PFP A;  3RIU A;  5LYJ E;  4AXP A;  2QYW A;  1S94 A;  5JH7 E;  2E9X B;  1N34 T;  3PE0 A;  4YSY A;  3KVA A;  3GMI A;  3E22 E;  4TUY E;  2FJE A;  4HEA A;  2V7J A;  3ZJ2 A;  3A8Y C;  3PUS A;  1LVF A;  2IUB A;  4HWD A;  4KI0 F;  5GON E;  3RIF A;  3ZMS B;  2XAQ B;  1UX4 A;  4IE0 A;  4HWI B;  2RA1 A;  5HXR A;  5HXS A;  1MNE A;  4LMJ A;  5KMG P;  2XQA A;  4X20 E;  4DR6 T;  3UQ7 A;  2LE8 A;  2UXX B;  5TAO A;  4FJO A;  4JEH B;  3RGL A;  1IJ5 A;  2W00 A;  1XNR T;  5AQJ B;  1WYC A;  1UUS A;  1LRZ A;  2VAS A;  3ETV A;  3QUJ A;  4L5G A;  4YTP A;  2K24 A;  4PK5 A;  4U33 A;  3NRY A;  4Q25 A;  4NPP A;  4F6R C;  5ETW A;  1CHU A;  4H9S E;  3RYC E;  2VQE T;  1N32 T;  1OWA A;  4B3S T;  2V8S V;  5AQG B;  3P4Q A;  5FVK A;  1XZY A;  5HEJ A;  4OX9 T;  1FJG T;  3LSV A;  3PUR A;  3QOF A;  3ZJ1 A;  3VKG A;  2XHE B;  1ZP0 A;  4IRE A;  5DAB A;  1HG2 A;  3AED A;  4IDP A;  4GYS A;  4H9N C;  1L0V A;  5AQF B;  1BR4 A;  1UK5 A;  3LFM A;  4I55 E;  4TV9 E;  5FY7 A;  2WWV A;  3U78 A;  2WDV A;  2X66 A;  3A7M A;  4QH1 A;  3C50 A;  5H6Q B;  3RYF E;  2A9U A;  4JI6 T;  4XBF B;  4KMC A;  1X79 A;  1N33 T;  2FJB A;  2BBJ A;  2FJA A;  3PUZ F;  2CMR A;  2HPL A;  2V5D A;  4TV8 E;  4ADZ A;  1Z8U A;  4CI1 B;  1UCU A;  3NZQ A;  4GIW A;  2X0H A;  2FJD A;  3EVY A;  3RPU A;  2CA5 A;  4A5X A;  3HKE E;  5ABF A;  3HR0 A;  3IF8 B;  4AKG A;  1LKX A;  2FBW A;  4C90 A;  4AQF A;  2AE9 A;  3K1S A;  2K48 A;  3P7I A;  4L0R A;  1KK7 A;  4JI4 T;  1J1J A;  4LF5 T;  4U31 A;  5L47 A;  3WAJ A;  5AQN B;  1HTJ F;  2X68 A;  3ZC0 A;  4JLE A;  3F2E A;  2XM1 A;  4NUU A;  5LCY A;  2XJ7 A;  3Q5W A;  3MXZ A;  4KP3 C;  4IDZ A;  3ZYM A;  4JI3 T;  3AEA A;  1U4Q A;  1W09 A;  4KHZ F;  4CXX A;  2Y6X A;  4J2C A;  3N5L A;  1D1B A;  4NXM T;  5DJQ C;  5HYA A;  5L3E B;  5J0Z A;  3PUX F;  2ZM6 T;  5H6R B;  2YEV C;  5LB7 B;  2PG8 A;  2LLY A;  3CKD A;  2X9X A;  5JR9 C;  5EK4 A;  2W62 A;  2JQ9 A;  2X51 A;  5LHG B;  4GKK T;  5ABE A;  1OED C;  2WDR A;  2WY2 A;  4O4H E;  4QX7 B;  5L2L A;  3I1A A;  2WU2 A;  4PNI A;  5JDM A;  5LMU T;  2HN2 A;  4DUZ T;  4LFB T;  3CQG B;  2BKP A;  1VCS A;  2BG9 E;  2W4X A;  2J47 A;  4CI3 B;  3C4X A;  4WBN E;  2X0Y A;  1HFA A;  1KF6 A;  2IHR 1;  2LSG A;  2YDR A;  3GN5 A;  2CLY C;  3MK7 C;  4IE6 A;  2DWG A;  5HEO A;  5AFU L;  2VWA A;  5LOV E;  3AVR A;  1YQ4 A;  5HWY A;  5JR9 B;  1Z0P A;  3MAC A;  3EI0 A;  1Y01 A;  2DNX A;  2BS2 A;  2CPT A;  4WYV A;  4X66 T;  3K3O A;  2E2A A;  3RYI E;  5HAX A;  4HWC A;  4QXB B;  3CQC B;  4H9R C;  3PV0 F;  3T1H T;  3ONL C;  2LM2 A;  3I0Q A;  1IAP A;  5AQP B;  5FXV A;  3J7Y q;  4CI2 B;  1HX1 B;  2ZM2 A;  4DBR A;  1HX8 A;  2JMH A;  3PUA A;  3H3A A;  4JEU B;  3HL6 A;  4PJM A;  4Z8X A;  3RIA A;  1MMA A;  3JAE A;  4ZEY A;  4DR3 T;  1KFY A;  1SUM B;  1T7S A;  3E0Z A;  3KFW X;  4DO0 A;  3QB5 K;  5FY1 A;  4C91 A;  4H9O C;  2V7I A;  2LOP A;  2M67 A;  4I4T E;  1MMN A;  1CUN A;  2D5U A;  2VVN A;  4PK6 A;  5FXW A;  2MAW A;  1YW0 A;  1ZEE A;  3EDU A;  3MKD A;  3T8O A;  2AXD S;  4XZC A;  1QUU A;  5L3D B;  2KWI B;  3ESL A;  2XQY A;  5AQM B;  4EOZ B;  5EK3 A;  4JI7 T;  3ZT5 A;  1LVK A;  4GK0 E;  1M62 A;  3O1J A;  3UT5 E;  3AA6 B;  3SWH A;  2CM0 A;  3KV9 A;  3LJC A;  2NW9 A;  5FNV E;  3UU8 A;  4JI0 T;  4K0K T;  1D0Y A;  2HN1 A;  2W0G A;  2YK0 A;  2WS3 A;  2VL0 A;  5HCJ A;  2JQQ A;  4B6X A;  2DI4 A;  4UIG A;  3L8R A;  2MOZ A;  3C4W A;  3K3N A;  2WMO A;  1JNZ A;  3KIN B;  3OKQ A;  4UV9 B;  2CWO A;  2E9X C;  2YKS A;  3CX6 B;  2CHN A;  4CQI A;  4ZI3 C;  2PTF A;  4DMV A;  5C8Y E;  1R8I A;  4YY3 T;  3FXE B;  4HWF A;  5KX5 E;  1YQ3 A;  5L3C B;  2M6I A;  2JPF A;  4DV3 T;  4TNW A;  4COF A;  1FEW A;  4JYA T;  4U7Y A;  2DCF A;  3LDQ B;  1MMG A;  4ILC A;  4EIW A;  1QSD A;  3UU6 A;  2X9W A;  2QGS A;  3C4Z A;  5AQO B;  1WCR A;  4U3C A;  2ACZ A;  3O4X E;  4P0B A;  4U2Y A;  5JRE A;  4DMW A;  2VKJ A;  3LK4 2;  3ANW A;  4UF0 B;  2CLY B;  3Q2M A;  4I43 B;  2UUB T;  1HNW T;  2ZM8 A;  5LP6 E;  4WBO A;  3NKZ A;  3AXJ A;  1I94 T;  1U5P A;  3PUV F;  2IW5 B;  1WYB A;  5LNK A;  4TZ4 C;  5ADX L;  2F4V T;  4CN1 A;  3AEC A;  2KIN B;  2ODU A;  4F8H A;  3GWH A;  4QH4 A;  4HN9 A;  5ABF B;  3U3I A;  3ZCJ A;  2HHH T;  1VRB A;  3RI5 A;  2J4G A;  1GQE A;  1YXR A;  4LFA T;  2KZ7 B;  3PJA J;  2XSB A;  3P8C D;  2JQK A;  3TLS A;  3ZYL A;  2QRX A;  3IHR A;  3MZK B;  2LOS A;  2LJL A;  2LKH A;  5FL0 A;  1MIY A;  2K9A A;  3H3M A;  3VRA A;  5EK2 A;  4DV5 T;  3RQW A;  2Z6E A;  1N36 T;  5CA1 E;  2HPJ A;  2JIW A;  2WMN A;  3O1I A;  4IST A;  2XM2 A;  2H88 A;  2LRL A;  4QXC B;  1NAF A;  5FMN A;  4QX8 B;  5LHH B;  4JI5 T;  2UXC T;  2E5V A;  5HEG A;  1YKE B;  2UXN B;  3RKG A;  3X1D A;  4DR1 T;  2E5L T;  4GKJ T;  3AAI A;  4E7Z A;  4GOU A;  3ZT7 A;  1BR0 A;  2PBI A;  3C51 A;  3UUL A;  1BR1 A;  3UUX B;  4AI6 A;  4EZH A;  4TWF A;  2LT3 A;  4HFI A;  5J1G A;  4AIU A;  1IJ6 A;  2IC9 A;  3G06 A;  4TX5 A;  3AE7 A;  2YN6 A;  3Q5X A;  1O3X A;  4EYU A;  2CHO A;  1MND A;  3EUH A;  2NW8 A; 
#chains in the Genus database with same CATH homology
 5AQI B;  3FZK B;  5AQT B;  1M7K A;  5AQR B;  1UGO A;  1T7S A;  3M3Z B;  5AQJ B;  5AQQ B;  3LDQ B;  5AQH B;  5AQO B;  3FZH B;  4HWH A;  3FZL B;  5AQM B;  5AQG B;  5AQN B;  5AQL B;  5AQU B;  5AQS B;  1M62 A;  1I6Z A;  5AQV B;  3FZF B;  5AQF B;  1UK5 A;  5AQK B;  3FZM B;  4HWC A;  3A8Y C;  4HWD A;  2D9D A;  5AQP B;  4HWI B;  4HWF A;  1HX1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...