5AQOB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
112
structure length
112
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqoB00
3FZKB 1T7SA 3FZHB 3M3ZB 5AQTB 1M7KA 1UGOA 4HWDA 5AQNB 5AQGB 3FZLB 2D9DA 1HX1B 1UK5A 5AQVB 3FZMB 4HWIB 4HWFA 5AQIB 1I6ZA 5AQHB 4HWCA 5AQFB 3LDQB 5AQOB 3A8YC 5AQLB 5AQPB 3FZFB 5AQSB 1M62A 5AQQB 5AQKB 5AQJB 4HWHA 5AQUB 5AQMB 5AQRB
chains in the Genus database with same CATH superfamily
3ZKRA 3ZMVB 4KP3C 1MMNA 2HPJA 3ZN0B 2PG8A 3PUXF 1VOMA 4CI2B 4KMCA 3FHNA 4DR7T 3LK42 2WAUA 3BQLA 3W15B 3ZSSA 4LMKA 1D1CA 2VASA 3MJXA 2L9QA 2LOPA 4HTEA 5CA1E 1HF8A 3ZMTB 3GN5B 2BG9C 4H9QC 2BG9B 3WI3A 1D1AA 1OEDA 3UU4A 1HFAA 2A72A 2HN2A 2QGSA 4B3ST 2BVMA 2MYSA 4C90A 5LHHB 3TLWA 2KZ7B 4AKRB 4BJNA 3UTKA 5AQNB 3JC6D 1W0BA 3PUYF 1N34T 1OEDE 1UK5A 1WR0A 2WQYA 5ABHA 4NUUA 5LGNB 1IBKT 3P4SA 5FXVA 2CCQA 5AQRB 1YQ4A 1ZV4X 4L9IA 4QXHB 3RRWA 4LF9T 2YINA 2IDOB 3C4XA 3KBTA 4QWNB 3VHLA 5BR8T 4EYUA 3N2GE 3VKHA 2J62A 4CN6A 4PFOA 4EEBA 2YN6A 3MK7C 1G73A 1WR6A 4H9NC 2FBWA 3UU8A 4EZ4A 3PJAJ 3TLSA 2K3WA 2VL0A 5ABFA 2F4VT 2JRKA 3KV6A 2V26A 4ZEYA 4TNVA 2ZMAA 4Z90A 3AE1A 3OYXA 5AQQB 5HCMA 2E8IA 1Y64B 3RHWA 3ZYLA 3AE4A 4CZZB 3AVSA 2YDRA 2Y8DA 2LM2A 4AQFC 4TWHA 2J47A 2MAWA 3RPUA 2MPKA 4ZZCA 1MNDA 5L3FB 1D0YA 2BVLA 3LSVA 2LSGA 4O2AE 2XAFB 4YJ2E 5F3JA 3Q2MA 3DTOA 4AQGA 1WRDA 3I1AA 5M4YA 2LRLA 2CWOA 4CN4A 5AQUB 4PJJA 4JI3T 3P7IA 4M1PA 2WWUA 2CBIA 3J9X1 3NRYA 3KDSE 4O2BE 1KK7A 5LG4A 3CPZA 1Z0PA 3VR8A 5HEJA 2RPAA 2XQ3A 2YDSA 3MA9A 5CGMA 5JQGE 4AKGA 4TX5A 4ERRA 2VK9A 2XAJB 2HH7A 2XY8B 3ZYMA 3NVOA 2B1EA 4KBMB 3UULA 4HE8A 4GKJT 3ONXA 3VRAA 5FVKA 2EHOB 4H9PC 2MBGA 5JTGA 2W0GA 2XQYA 4XAXB 3JC6C 2WU5A 5DQVA 4AKIA 4QH1A 3LBXB 1YQ3A 1UURA 2WDQA 3A5XA 5F5WA 3U78A 2KMFA 2XQAA 2FJAA 3RIUC 5AFUL 2CA5A 3FXDB 3ZJ1A 4X64T 2OLTA 4LF6T 1OEDC 3ZCIA 2E9XA 2SPCA 3AE8A 3C4WA 3S4UA 2WS3A 3I9YA 2JPFA 4HFVA 1UX5A 4EXTA 2KINB 3I0OA 4XBFB 2KWHA 5HEOA 3Q5WA 4EZHA 3VU7H 4DV0T 4F8HA 2VKDA 2XTLA 2WDRA 3M3ZB 2H7OA 2FJDA 1N36T 4H63H 4MBQA 1QUUA 5H6RB 4HN9A 2E9XD 1ZKEA 4DR4T 2UU9T 2NR4A 2NTYA 2DNXA 5L3DB 4P1NA 5IWAT 5JREA 1HNXT 3HL6A 2KSRA 3ESLA 3EUHA 2JQ9A 3LJCA 2YK0A 1SHZC 3GN5A 2LM9A 5JH7E 3ETVA 4JUYA 3EAMA 1XDPA 2MOZA 4I0UA 5IUXA 2H7VC 2BG9A 5HAXA 3J7Yq 4DR3T 2WU2A 2FJBA 3VR9A 4UF0A 1YKEB 4DR5T 3PV0F 2BG9E 5ETWA 4P0BA 5EK4A 5L47A 1FEWA 2M6BA 3KV4A 4KUMB 4LMJA 4ZOLE 2LHNA 5LMNT 2XQ8A 2M6IA 1YKHB 3EDUA 3ETUA 4PK5A 2XQ7A 2JMKA 2CHOA 4ZI3D 2XAQB 2LKHA 4AQYT 3RC8A 4DBRA 4L5GA 4CQIA 2CPTA 5LOVE 3RH3A 2X0LB 4U72A 5J0ZA 2PJQA 2V7LA 2D0TA 4DMWA 1JNRA 4JEUB 2XM1A 2W67A 3F2EA 1L0VA 4NPPA 5L2LA 3HR0A 2VQET 3N5LA 3KVBA 2VKHA 3RYHE 1QSDA 4COFA 2IC6A 2PFVA 4JLEA 4AQFA 2L8KA 4X65T 3CX8B 4IL9A 4JI6T 2NWBA 3KVAA 1YXRA 3KV5A 4L0RA 3AE2A 1IBMT 1KNRA 1YW0A 3ABVA 1IAPA 2RA1A 2UXDT 4MLKA 5AQHB 2LOSA 4UVAB 3CQGB 4GYRA 5FY0A 2WCAA 5CA0E 5LJNA 3IF8B 4KI0F 2E9XC 3OBVE 1XMOT 3KINB 1W09A 4GYSA 3IHRA 2E9XB 2D5UA 2C5JA 1GQEA 3L8RA 5KMGP 3FB2A 5CFBA 5L3BB 3JADA 1SUMB 1W9RA 4K0KT 4ILAA 2BBHA 3TLTA 4AKLA 5EZYE 3BQKA 3EHZA 3RIAA 3A8YC 2V6XA 2XQ4A 4YY3T 4UVCB 3UUMA 2EHOA 3K3OA 2JIWA 3N2OA 2ZM8A 1BR2A 2QYWA 4I43B 3LBXA 5AQVB 4DV2T 2UXBT 2M67A 2I59A 3O1JA 5CJ5A 4EEDA 4I50E 2ZM2A 1H7CA 3PTRB 2QRXA 1I94T 3C50A 3ZC1A 2XM2A 3ZEFB 1HX8A 3K3NA 2NW9A 3RI5A 4YTMA 2ODUA 3ZPOA 4GIWA 1BR4A 5FYMA 3RIUA 5JDHA 4ZI3C 5C3JA 3LDQB 5EK2A 5AQPB 1XNQT 4DNDA 2BDEA 2EHOD 1NAFA 2H3RA 2JQKA 4UF0B 4Z91A 1HS7A 1D0ZA 4EV6A 2UXCT 2NW8A 2WY2A 5FL1A 3H3MA 1D0XA 4IDQA 5LMUT 1VCSA 4IREA 5L3EB 5J2TE 3PJAA 2Q9QB 4UEMA 2D2SA 1NENA 2ES0A 4H63V 1BR1A 3FZHB 4PJNA 4YFSA 2HHHT 4PK6A 4YT0A 2LHRA 1X79A 5IHYA 3CQXC 5C8YE 3B5MA 4IIJE 5AQLB 5L4EA 1NEKA 2J1DG 3AA1B 4LF4T 4TZ4C 2WMNA 2IW5B 1T7SA 4I55E 3ZJ2A 4B6XA 4WBNE 3PUGA 3NKZA 5HXRA 4I4TE 4DV5T 2BZBA 1VRBA 3ZLIA 2V8SV 3IEEA 3QK6A 4QX8B 1MMGA 5JDFA 4IE7A 2W66A 3DP7A 3CQCB 3E0ZA 1X9BA 1XNRT 1UUSA 3AXJB 3L3PA 5HEGA 4A97A 2UUBT 4LF7T 2UXXB 4YTPA 3PUWF 4PJLA 5H6QB 2XJ7A 4X62T 3UU3A 4YXDA 3PUSA 4LMLA 2LLYA 3EI0A 2WB5A 3O9XA 1US7B 2HPLA 4UR9A 5FP3A 4JI0T 5LA6E 1MIVA 4YSZA 3C51A 3QOFA 4JI1T 5HWYA 1VCTA 1U5PA 2XQ5A 1G8XA 2WWVA 3OKQA 1WYCA 4YSXA 4TWFA 5FXWA 3HKCE 2XAGB 4Q25A 4DV7T 2OA5A 4IT4A 2CWYA 4FJOA 2KLQA 5J1GA 2N1GA 4UV8B 4IHJE 4UV9B 2H88A 3K1SA 5GONE 1EZ3A 2ZM6T 1AJ3A 2X9YA 4O4HE 4IDOA 4BA9A 4WBOA 1XDOA 3ZT6A 2YU1A 3B57A 1FJGT 3ONJA 3GA8A 4QHOA 3UUBA 2DWKA 1WYBA 2LT3A 2EHOC 4XZCA 4MFRA 5FNVE 3AEDA 2VVSA 2CMRA 1QLBA 5ABGA 3GWHA 1S94A 4TWDA 4P0AA 2K5BB 4GKKT 1HG2A 2LRKA 3M65A 4JYAT 5FKYA 3AVRA 4U33A 5HCJA 3CKDA 3C98B 3P50A 3RYCE 3FZFB 4ILUA 3RC3A 4BJMA 1KF6A 3ZN1B 2LSJA 3F31A 5AQKB 1LRZA 2ZM0A 1ZP0A 3UFGA 3F57A 2V7MA 3AEGA 5HXSA 3DJBA 4DR2T 2DCFA 4U2YA 3EDVA 3PDYA 5JRCB 5L3GB 3A7MA 2ZLYA 2X66A 2LSKA 4TNWA 1U4QA 1J5WA 2IIUA 1N32T 5LGTB 1KNZA 4CI1B 2NTXA 2WZHA 4YJ3E 4DV3T 1IJ6A 3V5UA 2DWGA 4OX9T 3ANWB 2X68A 4PNIA 3ZSTA 2W63A 2X0HA 1D1BA 3Q5DA 2CLYC 4QH4A 1E1HB 3UQ7A 2CLYB 4PK4A 1UCUA 2XASB 2ACZA 4HKAA 5LP6E 4LFCT 3KFWX 2YKSA 1M7KA 2VKOA 2K24A 1ZEEA 1WFDA 2V1DB 3NZQA 3CK6A 3UU5A 4YHHT 4IE4A 4PAGA 4YHJA 3SWHA 3N9LA 2X51A 3N9PA 5HEUA 2YU2A 4WNKA 4ILCA 1XZYA 2WBLA 1ZOYA 2XPKA 2VKJA 4IDNA 3RRCA 3TLVA 4GOUA 3B13A 3Q9DA 4HFBA 4U31A 3UFEA 4X1KE 1MIYA 3AEEA 2WM9A 5CB4E 2LSIA 2Q9QA 2DI4A 2K9AA 3CX6B 3SRZA 4QH5A 2WMOA 2XQ6A 4ISSA 5JR9C 2MTQA 4QX7B 2LJLA 5JR9B 2E2AA 2CHNA 4J2CA 1HX1B 4X66T 3N9QA 2IAKA 3P4PA 1DU2A 3ZYKA 3CVRA 4HFCA 5LBQB 3PURA 4YLHA 3MACA 3T1YT 5DQWA 3QB5A 1KEYA 2J4GA 4A5XA 3ZCJA 2OV9A 4GK0E 2UUAT 2H89A 3FZMB 4X1IE 3T1HT 4HWIB 5LCYA 2Q9QD 2BKPA 4HFIA 1MMAA 3SOLA 4NIQA 4WYVA 5LHIB 3SFDA 2V6YB 2D9DA 1MNEA 5FVLA 1V9DA 1LVKA 5JDLA 2KXPB 4O4IE 5HXHA 3AA7B 4CXWA 3AXJA 4EYYR 3PE0A 5AQSB 5JDGA 2N9DA 3LFMA 1MMDA 1W0AA 4ZI2D 4G63A 1HNWT 5AQGB 2YDQA 1HG5A 5LGUB 4V1Av 2NP9A 3AEAA 2A9UA 3CX7B 1BR0A 3U3IA 3L09A 3I0QA 3BQIA 2XAHB 3NZPA 3H37A 4JI5T 2JQQA 3CWZB 4JV5T 3K3QC 3RF1A 5KDMC 2CBJA 5C2TA 3SFEA 5BMVE 3TLUA 3OPCA 4GK5E 1B7TA 3EVYA 4NUVA 4WZXA 1CUNA 3AEFA 3HI2A 2JQHA 2AXDS 4PFPA 5E0OA 5AQIB 1FIOA 2X0YA 2IUBA 2XZEA 4IE5A 5AQJB 4K0UA 2X67A 4A98A 3HKEE 4DR6T 3LG7A 1WCRA 3WAKA 2C0SA 2XSAA 4ASKA 4ZHQE 5EK3A 4YTNA 3X1DA 5JVDE 3RIFA 3P4QA 1M62A 2W2UA 3ZC0A 4JI4T 4O4JE 3KBUA 3AE7A 4ZXLA 4ZS3A 4HEAA 2VB6A 1XMQT 4QKNA 1N33T 4AI6A 5JRCA 3AECA 3UUXB 5AQMB 2YOEA 3P4RA 1UGOA 4G2AA 3R84B 2YEVC 4AKHA 4EOZB 2Q9QC 4CI3B 2BKNA 2G0UA 4P09A 3PUQA 3ANWA 2IMLA 2E5LT 2DLRA 5HXEA 4B3RT 2CRBA 1J1JA 1MIWA 2A2FX 4ISTA 3FBLA 3N2KE 4H9SE 4HWCA 2BS3A 2KNDA 3AE3A 3MZKB 4HGAA 4ZI2C 4UELA 3IA3A 4WW0A 3VKGA 2CXFA 5FXZA 3ZT5A 5FL0A 4EB6E 5AQOB 3AEBA 2B76A 4DUZT 3FXEB 5F8PA 4N78D 1NWMX 4EGWA 2IC9A 3AB3B 4YSYA 3AAAB 4NXMT 4IGUA 2JJ9A 2QVAA 1HR0T 3I9WA 5AQFB 4JI2T 3E08A 1IJ5A 1UX4A 2NOXA 4B3TT 2AE9A 5JR9A 1JNZA 3FZLB 5LBMA 2I0MA 2LKGA 3BK9A 5LJMA 2GK9A 3O4XE 5FXXA 4X20E 1T72A 4DV4T 1E2AA 4MALA 4LFBT 2V7KA 4BAYB 1XWMA 3RLFF 2V7JA 4DVDA 5L4HA 2PTFA 4OHFA 4MHCA 2V5DA 3SS1A 2WP9A 5HXCA 2X9WA 2Y6XA 2CE7A 5TAOA 2HN1A 3NWIA 4ILBA 2LEHA 4U2ZA 3D0TA 2V6YA 3V5SA 2DL1A 4U7IA 5FY7A 3RKOA 2BBJA 3JAEA 3VRBA 2CXDA 4HFDA 4U3CA 1KFYA 3Q5XA 2VURA 1HCIA 4JI8T 2IHR1 2WZIA 4IE0A 5KX5E 5AQTB 2VVNA 3N9MA 2BS4A 2JMHA 2W00A 1CHUA 3CMLA 4ZZBA 5LYJE 1OWAA 3Q5EA 3JCFA 3MKDA 3ZMSB 1Z8UA 3OYZA 5HYAA 2LE8A 3HA4A 4ADZA 4DO0A 2BKOA 5HWXA 3QUJA 4O8SA 4IE6A 4F6RC 2L3LA 1T98A 1SE7A 3C4ZA 3P4WA 1IBLT 3OVUA 4U74A 5ABEA 4FI5A 2XHEB 5HEHA 1SA0E 3PU3A 4DUYT 4LFAT 1ZHCA 2W4XA 4CN1A 1IZNB 3H3AA 2X9XA 3AE6A 2WSSV 1FMWA 1OEDB 2N2NA 2XSBA 2A3DA 3UQ4A 4NXNT 4OYJA 2VWAA 3NRXA 2Y48B 4HFHA 4IL4A 4EAHA 2RP4A 4AXPA 3PUVF 1I6ZA 1R8IA 3IBPA 3ZMZB 4KHZF 3NBXX 4QXCB 1YD8G 3C64A 2R6GF 1WLXA 3QB5K 1T8BA 2Z6EA 5LHGB 4JEHB 3FZKB 3AE5A 2FUPA 4H9RC 3LK2B 2E5VA 2XUEA 4LF5T 4OFZA 3KV9A 4PW8A 4TN7B 4ZS2A 2I6HA 3RKGA 2V7IA 3E22E 4A56A 3OTOT 1O3XA 4OYKA 4DMVA 4H9OC 3O1HA 4EIWA 3UUNA 3HKDE 2UXNB 3ZMUB 3R6NA 5ABFB 3ONLC 5L3CB 4X5TA 2ACXA 4IDPA 3RQWA 3LK3B 3MXZA 4KX6A 4C91A 3AAEB 4AIUA 5JDNA 3GMIA 2PBIA 4TV8E 4ANJA 3P8CD 3K8PC 4PJMA 4DV6T 5ADXL 4IDZA 2C5IT 1E7PA 3ZT7A 2VL8A 4OK0A 2DHRA 5DABA 3WAJA 3T8OA 4LF8T 3JAFA 2CXLA 4CXYA 2QA7A 3OJAA 2BS2A 4E7SA 2XQ9A 5LXTE 2LSYA 4KHPT 3RYIE 1HTJF 4X1YE 5KXJA 1S35A 3QNUA 5LB7B 4JI7T 3CIRA 4TV9E 4CXXA 3TKLB 4U7YA 3RGLA 4JBWF 2D0UA 3RYFE 1LVFA 3AAIA 2P9BA 2K48A 4ZI7E 3G06A 3PU8A 5JDQA 4B3MT 3O1IA 5LG3A 3PUAA 4AISA 4DIDB 1HNZT 5DJQC 3AA6B 2UUCT 5LNKA 3EABA 4DR1T 5A1LA 4UVBB 2X9HA 3FBZA 3AA0B 2CEAA 2W62A 3L39A 5FMNA 3RQUA 4TUYE 3UT5E 2KT9A 4HWDA 3RX6A 2ODVA 5JDMA 1FMVA 2C5KT 2WDVA 2FJEA 3UU6A 4DBQA 5IYZE 5J2UE 1J5ET 2NW7A 3QC9A 2V5CA 2CM0A 4DV1T 1LKXA 2VQFT 3HKBE 4Z8XA 5FY1A 4HFEA 4HWFA 3N9NA 1OXZA 4O4LE 4UIGA 4UXNB 3N9OA 3PUZF 1Y01A 2KWIB 2W61A 4E7ZA 4QXBB 4HWHA 3AE9A 1KNPA
chains in the Genus database with same CATH topology
3FZKB 1T7SA 3FZHB 3M3ZB 5AQTB 1M7KA 1UGOA 4HWDA 5AQNB 5AQGB 3FZLB 2D9DA 1HX1B 1UK5A 5AQVB 3FZMB 4HWIB 4HWFA 5AQIB 1I6ZA 5AQHB 4HWCA 5AQFB 3LDQB 5AQOB 3A8YC 5AQLB 5AQPB 3FZFB 5AQSB 1M62A 5AQQB 5AQKB 5AQJB 4HWHA 5AQUB 5AQMB 5AQRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZK B;  1T7S A;  3FZH B;  3M3Z B;  5AQT B;  1M7K A;  1UGO A;  4HWD A;  5AQN B;  5AQG B;  3FZL B;  2D9D A;  1HX1 B;  1UK5 A;  5AQV B;  3FZM B;  4HWI B;  4HWF A;  5AQI B;  1I6Z A;  5AQH B;  4HWC A;  5AQF B;  3LDQ B;  5AQO B;  3A8Y C;  5AQL B;  5AQP B;  3FZF B;  5AQS B;  1M62 A;  5AQQ B;  5AQK B;  5AQJ B;  4HWH A;  5AQU B;  5AQM B;  5AQR B; 
#chains in the Genus database with same CATH topology
 3ZKR A;  3ZMV B;  4KP3 C;  1MMN A;  2HPJ A;  3ZN0 B;  2PG8 A;  3PUX F;  1VOM A;  4CI2 B;  4KMC A;  3FHN A;  4DR7 T;  3LK4 2;  2WAU A;  3BQL A;  3W15 B;  3ZSS A;  4LMK A;  1D1C A;  2VAS A;  3MJX A;  2L9Q A;  2LOP A;  4HTE A;  5CA1 E;  1HF8 A;  3ZMT B;  3GN5 B;  2BG9 C;  4H9Q C;  2BG9 B;  3WI3 A;  1D1A A;  1OED A;  3UU4 A;  1HFA A;  2A72 A;  2HN2 A;  2QGS A;  4B3S T;  2BVM A;  2MYS A;  4C90 A;  5LHH B;  3TLW A;  2KZ7 B;  4AKR B;  4BJN A;  3UTK A;  5AQN B;  3JC6 D;  1W0B A;  3PUY F;  1N34 T;  1OED E;  1UK5 A;  1WR0 A;  2WQY A;  5ABH A;  4NUU A;  5LGN B;  1IBK T;  3P4S A;  5FXV A;  2CCQ A;  5AQR B;  1YQ4 A;  1ZV4 X;  4L9I A;  4QXH B;  3RRW A;  4LF9 T;  2YIN A;  2IDO B;  3C4X A;  3KBT A;  4QWN B;  3VHL A;  5BR8 T;  4EYU A;  3N2G E;  3VKH A;  2J62 A;  4CN6 A;  4PFO A;  4EEB A;  2YN6 A;  3MK7 C;  1G73 A;  1WR6 A;  4H9N C;  2FBW A;  3UU8 A;  4EZ4 A;  3PJA J;  3TLS A;  2K3W A;  2VL0 A;  5ABF A;  2F4V T;  2JRK A;  3KV6 A;  2V26 A;  4ZEY A;  4TNV A;  2ZMA A;  4Z90 A;  3AE1 A;  3OYX A;  5AQQ B;  5HCM A;  2E8I A;  1Y64 B;  3RHW A;  3ZYL A;  3AE4 A;  4CZZ B;  3AVS A;  2YDR A;  2Y8D A;  2LM2 A;  4AQF C;  4TWH A;  2J47 A;  2MAW A;  3RPU A;  2MPK A;  4ZZC A;  1MND A;  5L3F B;  1D0Y A;  2BVL A;  3LSV A;  2LSG A;  4O2A E;  2XAF B;  4YJ2 E;  5F3J A;  3Q2M A;  3DTO A;  4AQG A;  1WRD A;  3I1A A;  5M4Y A;  2LRL A;  2CWO A;  4CN4 A;  5AQU B;  4PJJ A;  4JI3 T;  3P7I A;  4M1P A;  2WWU A;  2CBI A;  3J9X 1;  3NRY A;  3KDS E;  4O2B E;  1KK7 A;  5LG4 A;  3CPZ A;  1Z0P A;  3VR8 A;  5HEJ A;  2RPA A;  2XQ3 A;  2YDS A;  3MA9 A;  5CGM A;  5JQG E;  4AKG A;  4TX5 A;  4ERR A;  2VK9 A;  2XAJ B;  2HH7 A;  2XY8 B;  3ZYM A;  3NVO A;  2B1E A;  4KBM B;  3UUL A;  4HE8 A;  4GKJ T;  3ONX A;  3VRA A;  5FVK A;  2EHO B;  4H9P C;  2MBG A;  5JTG A;  2W0G A;  2XQY A;  4XAX B;  3JC6 C;  2WU5 A;  5DQV A;  4AKI A;  4QH1 A;  3LBX B;  1YQ3 A;  1UUR A;  2WDQ A;  3A5X A;  5F5W A;  3U78 A;  2KMF A;  2XQA A;  2FJA A;  3RIU C;  5AFU L;  2CA5 A;  3FXD B;  3ZJ1 A;  4X64 T;  2OLT A;  4LF6 T;  1OED C;  3ZCI A;  2E9X A;  2SPC A;  3AE8 A;  3C4W A;  3S4U A;  2WS3 A;  3I9Y A;  2JPF A;  4HFV A;  1UX5 A;  4EXT A;  2KIN B;  3I0O A;  4XBF B;  2KWH A;  5HEO A;  3Q5W A;  4EZH A;  3VU7 H;  4DV0 T;  4F8H A;  2VKD A;  2XTL A;  2WDR A;  3M3Z B;  2H7O A;  2FJD A;  1N36 T;  4H63 H;  4MBQ A;  1QUU A;  5H6R B;  4HN9 A;  2E9X D;  1ZKE A;  4DR4 T;  2UU9 T;  2NR4 A;  2NTY A;  2DNX A;  5L3D B;  4P1N A;  5IWA T;  5JRE A;  1HNX T;  3HL6 A;  2KSR A;  3ESL A;  3EUH A;  2JQ9 A;  3LJC A;  2YK0 A;  1SHZ C;  3GN5 A;  2LM9 A;  5JH7 E;  3ETV A;  4JUY A;  3EAM A;  1XDP A;  2MOZ A;  4I0U A;  5IUX A;  2H7V C;  2BG9 A;  5HAX A;  3J7Y q;  4DR3 T;  2WU2 A;  2FJB A;  3VR9 A;  4UF0 A;  1YKE B;  4DR5 T;  3PV0 F;  2BG9 E;  5ETW A;  4P0B A;  5EK4 A;  5L47 A;  1FEW A;  2M6B A;  3KV4 A;  4KUM B;  4LMJ A;  4ZOL E;  2LHN A;  5LMN T;  2XQ8 A;  2M6I A;  1YKH B;  3EDU A;  3ETU A;  4PK5 A;  2XQ7 A;  2JMK A;  2CHO A;  4ZI3 D;  2XAQ B;  2LKH A;  4AQY T;  3RC8 A;  4DBR A;  4L5G A;  4CQI A;  2CPT A;  5LOV E;  3RH3 A;  2X0L B;  4U72 A;  5J0Z A;  2PJQ A;  2V7L A;  2D0T A;  4DMW A;  1JNR A;  4JEU B;  2XM1 A;  2W67 A;  3F2E A;  1L0V A;  4NPP A;  5L2L A;  3HR0 A;  2VQE T;  3N5L A;  3KVB A;  2VKH A;  3RYH E;  1QSD A;  4COF A;  2IC6 A;  2PFV A;  4JLE A;  4AQF A;  2L8K A;  4X65 T;  3CX8 B;  4IL9 A;  4JI6 T;  2NWB A;  3KVA A;  1YXR A;  3KV5 A;  4L0R A;  3AE2 A;  1IBM T;  1KNR A;  1YW0 A;  3ABV A;  1IAP A;  2RA1 A;  2UXD T;  4MLK A;  5AQH B;  2LOS A;  4UVA B;  3CQG B;  4GYR A;  5FY0 A;  2WCA A;  5CA0 E;  5LJN A;  3IF8 B;  4KI0 F;  2E9X C;  3OBV E;  1XMO T;  3KIN B;  1W09 A;  4GYS A;  3IHR A;  2E9X B;  2D5U A;  2C5J A;  1GQE A;  3L8R A;  5KMG P;  3FB2 A;  5CFB A;  5L3B B;  3JAD A;  1SUM B;  1W9R A;  4K0K T;  4ILA A;  2BBH A;  3TLT A;  4AKL A;  5EZY E;  3BQK A;  3EHZ A;  3RIA A;  3A8Y C;  2V6X A;  2XQ4 A;  4YY3 T;  4UVC B;  3UUM A;  2EHO A;  3K3O A;  2JIW A;  3N2O A;  2ZM8 A;  1BR2 A;  2QYW A;  4I43 B;  3LBX A;  5AQV B;  4DV2 T;  2UXB T;  2M67 A;  2I59 A;  3O1J A;  5CJ5 A;  4EED A;  4I50 E;  2ZM2 A;  1H7C A;  3PTR B;  2QRX A;  1I94 T;  3C50 A;  3ZC1 A;  2XM2 A;  3ZEF B;  1HX8 A;  3K3N A;  2NW9 A;  3RI5 A;  4YTM A;  2ODU A;  3ZPO A;  4GIW A;  1BR4 A;  5FYM A;  3RIU A;  5JDH A;  4ZI3 C;  5C3J A;  3LDQ B;  5EK2 A;  5AQP B;  1XNQ T;  4DND A;  2BDE A;  2EHO D;  1NAF A;  2H3R A;  2JQK A;  4UF0 B;  4Z91 A;  1HS7 A;  1D0Z A;  4EV6 A;  2UXC T;  2NW8 A;  2WY2 A;  5FL1 A;  3H3M A;  1D0X A;  4IDQ A;  5LMU T;  1VCS A;  4IRE A;  5L3E B;  5J2T E;  3PJA A;  2Q9Q B;  4UEM A;  2D2S A;  1NEN A;  2ES0 A;  4H63 V;  1BR1 A;  3FZH B;  4PJN A;  4YFS A;  2HHH T;  4PK6 A;  4YT0 A;  2LHR A;  1X79 A;  5IHY A;  3CQX C;  5C8Y E;  3B5M A;  4IIJ E;  5AQL B;  5L4E A;  1NEK A;  2J1D G;  3AA1 B;  4LF4 T;  4TZ4 C;  2WMN A;  2IW5 B;  1T7S A;  4I55 E;  3ZJ2 A;  4B6X A;  4WBN E;  3PUG A;  3NKZ A;  5HXR A;  4I4T E;  4DV5 T;  2BZB A;  1VRB A;  3ZLI A;  2V8S V;  3IEE A;  3QK6 A;  4QX8 B;  1MMG A;  5JDF A;  4IE7 A;  2W66 A;  3DP7 A;  3CQC B;  3E0Z A;  1X9B A;  1XNR T;  1UUS A;  3AXJ B;  3L3P A;  5HEG A;  4A97 A;  2UUB T;  4LF7 T;  2UXX B;  4YTP A;  3PUW F;  4PJL A;  5H6Q B;  2XJ7 A;  4X62 T;  3UU3 A;  4YXD A;  3PUS A;  4LML A;  2LLY A;  3EI0 A;  2WB5 A;  3O9X A;  1US7 B;  2HPL A;  4UR9 A;  5FP3 A;  4JI0 T;  5LA6 E;  1MIV A;  4YSZ A;  3C51 A;  3QOF A;  4JI1 T;  5HWY A;  1VCT A;  1U5P A;  2XQ5 A;  1G8X A;  2WWV A;  3OKQ A;  1WYC A;  4YSX A;  4TWF A;  5FXW A;  3HKC E;  2XAG B;  4Q25 A;  4DV7 T;  2OA5 A;  4IT4 A;  2CWY A;  4FJO A;  2KLQ A;  5J1G A;  2N1G A;  4UV8 B;  4IHJ E;  4UV9 B;  2H88 A;  3K1S A;  5GON E;  1EZ3 A;  2ZM6 T;  1AJ3 A;  2X9Y A;  4O4H E;  4IDO A;  4BA9 A;  4WBO A;  1XDO A;  3ZT6 A;  2YU1 A;  3B57 A;  1FJG T;  3ONJ A;  3GA8 A;  4QHO A;  3UUB A;  2DWK A;  1WYB A;  2LT3 A;  2EHO C;  4XZC A;  4MFR A;  5FNV E;  3AED A;  2VVS A;  2CMR A;  1QLB A;  5ABG A;  3GWH A;  1S94 A;  4TWD A;  4P0A A;  2K5B B;  4GKK T;  1HG2 A;  2LRK A;  3M65 A;  4JYA T;  5FKY A;  3AVR A;  4U33 A;  5HCJ A;  3CKD A;  3C98 B;  3P50 A;  3RYC E;  3FZF B;  4ILU A;  3RC3 A;  4BJM A;  1KF6 A;  3ZN1 B;  2LSJ A;  3F31 A;  5AQK B;  1LRZ A;  2ZM0 A;  1ZP0 A;  3UFG A;  3F57 A;  2V7M A;  3AEG A;  5HXS A;  3DJB A;  4DR2 T;  2DCF A;  4U2Y A;  3EDV A;  3PDY A;  5JRC B;  5L3G B;  3A7M A;  2ZLY A;  2X66 A;  2LSK A;  4TNW A;  1U4Q A;  1J5W A;  2IIU A;  1N32 T;  5LGT B;  1KNZ A;  4CI1 B;  2NTX A;  2WZH A;  4YJ3 E;  4DV3 T;  1IJ6 A;  3V5U A;  2DWG A;  4OX9 T;  3ANW B;  2X68 A;  4PNI A;  3ZST A;  2W63 A;  2X0H A;  1D1B A;  3Q5D A;  2CLY C;  4QH4 A;  1E1H B;  3UQ7 A;  2CLY B;  4PK4 A;  1UCU A;  2XAS B;  2ACZ A;  4HKA A;  5LP6 E;  4LFC T;  3KFW X;  2YKS A;  1M7K A;  2VKO A;  2K24 A;  1ZEE A;  1WFD A;  2V1D B;  3NZQ A;  3CK6 A;  3UU5 A;  4YHH T;  4IE4 A;  4PAG A;  4YHJ A;  3SWH A;  3N9L A;  2X51 A;  3N9P A;  5HEU A;  2YU2 A;  4WNK A;  4ILC A;  1XZY A;  2WBL A;  1ZOY A;  2XPK A;  2VKJ A;  4IDN A;  3RRC A;  3TLV A;  4GOU A;  3B13 A;  3Q9D A;  4HFB A;  4U31 A;  3UFE A;  4X1K E;  1MIY A;  3AEE A;  2WM9 A;  5CB4 E;  2LSI A;  2Q9Q A;  2DI4 A;  2K9A A;  3CX6 B;  3SRZ A;  4QH5 A;  2WMO A;  2XQ6 A;  4ISS A;  5JR9 C;  2MTQ A;  4QX7 B;  2LJL A;  5JR9 B;  2E2A A;  2CHN A;  4J2C A;  1HX1 B;  4X66 T;  3N9Q A;  2IAK A;  3P4P A;  1DU2 A;  3ZYK A;  3CVR A;  4HFC A;  5LBQ B;  3PUR A;  4YLH A;  3MAC A;  3T1Y T;  5DQW A;  3QB5 A;  1KEY A;  2J4G A;  4A5X A;  3ZCJ A;  2OV9 A;  4GK0 E;  2UUA T;  2H89 A;  3FZM B;  4X1I E;  3T1H T;  4HWI B;  5LCY A;  2Q9Q D;  2BKP A;  4HFI A;  1MMA A;  3SOL A;  4NIQ A;  4WYV A;  5LHI B;  3SFD A;  2V6Y B;  2D9D A;  1MNE A;  5FVL A;  1V9D A;  1LVK A;  5JDL A;  2KXP B;  4O4I E;  5HXH A;  3AA7 B;  4CXW A;  3AXJ A;  4EYY R;  3PE0 A;  5AQS B;  5JDG A;  2N9D A;  3LFM A;  1MMD A;  1W0A A;  4ZI2 D;  4G63 A;  1HNW T;  5AQG B;  2YDQ A;  1HG5 A;  5LGU B;  4V1A v;  2NP9 A;  3AEA A;  2A9U A;  3CX7 B;  1BR0 A;  3U3I A;  3L09 A;  3I0Q A;  3BQI A;  2XAH B;  3NZP A;  3H37 A;  4JI5 T;  2JQQ A;  3CWZ B;  4JV5 T;  3K3Q C;  3RF1 A;  5KDM C;  2CBJ A;  5C2T A;  3SFE A;  5BMV E;  3TLU A;  3OPC A;  4GK5 E;  1B7T A;  3EVY A;  4NUV A;  4WZX A;  1CUN A;  3AEF A;  3HI2 A;  2JQH A;  2AXD S;  4PFP A;  5E0O A;  5AQI B;  1FIO A;  2X0Y A;  2IUB A;  2XZE A;  4IE5 A;  5AQJ B;  4K0U A;  2X67 A;  4A98 A;  3HKE E;  4DR6 T;  3LG7 A;  1WCR A;  3WAK A;  2C0S A;  2XSA A;  4ASK A;  4ZHQ E;  5EK3 A;  4YTN A;  3X1D A;  5JVD E;  3RIF A;  3P4Q A;  1M62 A;  2W2U A;  3ZC0 A;  4JI4 T;  4O4J E;  3KBU A;  3AE7 A;  4ZXL A;  4ZS3 A;  4HEA A;  2VB6 A;  1XMQ T;  4QKN A;  1N33 T;  4AI6 A;  5JRC A;  3AEC A;  3UUX B;  5AQM B;  2YOE A;  3P4R A;  1UGO A;  4G2A A;  3R84 B;  2YEV C;  4AKH A;  4EOZ B;  2Q9Q C;  4CI3 B;  2BKN A;  2G0U A;  4P09 A;  3PUQ A;  3ANW A;  2IML A;  2E5L T;  2DLR A;  5HXE A;  4B3R T;  2CRB A;  1J1J A;  1MIW A;  2A2F X;  4IST A;  3FBL A;  3N2K E;  4H9S E;  4HWC A;  2BS3 A;  2KND A;  3AE3 A;  3MZK B;  4HGA A;  4ZI2 C;  4UEL A;  3IA3 A;  4WW0 A;  3VKG A;  2CXF A;  5FXZ A;  3ZT5 A;  5FL0 A;  4EB6 E;  5AQO B;  3AEB A;  2B76 A;  4DUZ T;  3FXE B;  5F8P A;  4N78 D;  1NWM X;  4EGW A;  2IC9 A;  3AB3 B;  4YSY A;  3AAA B;  4NXM T;  4IGU A;  2JJ9 A;  2QVA A;  1HR0 T;  3I9W A;  5AQF B;  4JI2 T;  3E08 A;  1IJ5 A;  1UX4 A;  2NOX A;  4B3T T;  2AE9 A;  5JR9 A;  1JNZ A;  3FZL B;  5LBM A;  2I0M A;  2LKG A;  3BK9 A;  5LJM A;  2GK9 A;  3O4X E;  5FXX A;  4X20 E;  1T72 A;  4DV4 T;  1E2A A;  4MAL A;  4LFB T;  2V7K A;  4BAY B;  1XWM A;  3RLF F;  2V7J A;  4DVD A;  5L4H A;  2PTF A;  4OHF A;  4MHC A;  2V5D A;  3SS1 A;  2WP9 A;  5HXC A;  2X9W A;  2Y6X A;  2CE7 A;  5TAO A;  2HN1 A;  3NWI A;  4ILB A;  2LEH A;  4U2Z A;  3D0T A;  2V6Y A;  3V5S A;  2DL1 A;  4U7I A;  5FY7 A;  3RKO A;  2BBJ A;  3JAE A;  3VRB A;  2CXD A;  4HFD A;  4U3C A;  1KFY A;  3Q5X A;  2VUR A;  1HCI A;  4JI8 T;  2IHR 1;  2WZI A;  4IE0 A;  5KX5 E;  5AQT B;  2VVN A;  3N9M A;  2BS4 A;  2JMH A;  2W00 A;  1CHU A;  3CML A;  4ZZB A;  5LYJ E;  1OWA A;  3Q5E A;  3JCF A;  3MKD A;  3ZMS B;  1Z8U A;  3OYZ A;  5HYA A;  2LE8 A;  3HA4 A;  4ADZ A;  4DO0 A;  2BKO A;  5HWX A;  3QUJ A;  4O8S A;  4IE6 A;  4F6R C;  2L3L A;  1T98 A;  1SE7 A;  3C4Z A;  3P4W A;  1IBL T;  3OVU A;  4U74 A;  5ABE A;  4FI5 A;  2XHE B;  5HEH A;  1SA0 E;  3PU3 A;  4DUY T;  4LFA T;  1ZHC A;  2W4X A;  4CN1 A;  1IZN B;  3H3A A;  2X9X A;  3AE6 A;  2WSS V;  1FMW A;  1OED B;  2N2N A;  2XSB A;  2A3D A;  3UQ4 A;  4NXN T;  4OYJ A;  2VWA A;  3NRX A;  2Y48 B;  4HFH A;  4IL4 A;  4EAH A;  2RP4 A;  4AXP A;  3PUV F;  1I6Z A;  1R8I A;  3IBP A;  3ZMZ B;  4KHZ F;  3NBX X;  4QXC B;  1YD8 G;  3C64 A;  2R6G F;  1WLX A;  3QB5 K;  1T8B A;  2Z6E A;  5LHG B;  4JEH B;  3FZK B;  3AE5 A;  2FUP A;  4H9R C;  3LK2 B;  2E5V A;  2XUE A;  4LF5 T;  4OFZ A;  3KV9 A;  4PW8 A;  4TN7 B;  4ZS2 A;  2I6H A;  3RKG A;  2V7I A;  3E22 E;  4A56 A;  3OTO T;  1O3X A;  4OYK A;  4DMV A;  4H9O C;  3O1H A;  4EIW A;  3UUN A;  3HKD E;  2UXN B;  3ZMU B;  3R6N A;  5ABF B;  3ONL C;  5L3C B;  4X5T A;  2ACX A;  4IDP A;  3RQW A;  3LK3 B;  3MXZ A;  4KX6 A;  4C91 A;  3AAE B;  4AIU A;  5JDN A;  3GMI A;  2PBI A;  4TV8 E;  4ANJ A;  3P8C D;  3K8P C;  4PJM A;  4DV6 T;  5ADX L;  4IDZ A;  2C5I T;  1E7P A;  3ZT7 A;  2VL8 A;  4OK0 A;  2DHR A;  5DAB A;  3WAJ A;  3T8O A;  4LF8 T;  3JAF A;  2CXL A;  4CXY A;  2QA7 A;  3OJA A;  2BS2 A;  4E7S A;  2XQ9 A;  5LXT E;  2LSY A;  4KHP T;  3RYI E;  1HTJ F;  4X1Y E;  5KXJ A;  1S35 A;  3QNU A;  5LB7 B;  4JI7 T;  3CIR A;  4TV9 E;  4CXX A;  3TKL B;  4U7Y A;  3RGL A;  4JBW F;  2D0U A;  3RYF E;  1LVF A;  3AAI A;  2P9B A;  2K48 A;  4ZI7 E;  3G06 A;  3PU8 A;  5JDQ A;  4B3M T;  3O1I A;  5LG3 A;  3PUA A;  4AIS A;  4DID B;  1HNZ T;  5DJQ C;  3AA6 B;  2UUC T;  5LNK A;  3EAB A;  4DR1 T;  5A1L A;  4UVB B;  2X9H A;  3FBZ A;  3AA0 B;  2CEA A;  2W62 A;  3L39 A;  5FMN A;  3RQU A;  4TUY E;  3UT5 E;  2KT9 A;  4HWD A;  3RX6 A;  2ODV A;  5JDM A;  1FMV A;  2C5K T;  2WDV A;  2FJE A;  3UU6 A;  4DBQ A;  5IYZ E;  5J2U E;  1J5E T;  2NW7 A;  3QC9 A;  2V5C A;  2CM0 A;  4DV1 T;  1LKX A;  2VQF T;  3HKB E;  4Z8X A;  5FY1 A;  4HFE A;  4HWF A;  3N9N A;  1OXZ A;  4O4L E;  4UIG A;  4UXN B;  3N9O A;  3PUZ F;  1Y01 A;  2KWI B;  2W61 A;  4E7Z A;  4QXB B;  4HWH A;  3AE9 A;  1KNP A; 
#chains in the Genus database with same CATH homology
 3FZK B;  1T7S A;  3FZH B;  3M3Z B;  5AQT B;  1M7K A;  1UGO A;  4HWD A;  5AQN B;  5AQG B;  3FZL B;  2D9D A;  1HX1 B;  1UK5 A;  5AQV B;  3FZM B;  4HWI B;  4HWF A;  5AQI B;  1I6Z A;  5AQH B;  4HWC A;  5AQF B;  3LDQ B;  5AQO B;  3A8Y C;  5AQL B;  5AQP B;  3FZF B;  5AQS B;  1M62 A;  5AQQ B;  5AQK B;  5AQJ B;  4HWH A;  5AQU B;  5AQM B;  5AQR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...