5AR8A

Rip2 kinase catalytic domain (1 - 310) complex with biphenylsulfonamide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
302
structure length
255
Chain Sequence
ALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLLREAEILHKARFSYILPILGICNLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGTIIYMPPENYASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
total genus 77
structure length 255
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar8A00
3F6XA 4GMYA 1IASA 4QQTA 5H3QA 2C47A 4H58A 4QTAA 4PV0A 4F6WA 3PRIA 3FXXA 4HZSA 5L8LA 2QKRA 5L6PA 2WD1A 3HEGA 4P5QA 3WARA 5A4CA 4RIXA 5HG5A 4L43A 5J1VA 1BMKA 1W0XC 3E88A 3QCXA 2BZHB 2IZUA 4I94A 4Y8DA 3RZBA 4ANLA 4BWXA 4CT1A 2QR8A 3QZGA 4FKIA 4TWCA 5IF1A 4E8AA 2WTIA 4LL0A 1PY5A 2FO0A 4C61A 3KVWA 4UYAA 2VRXA 2XYUA 3PP1A 4LGGA 5AR4A 4NJ3A 4L3JA 1H08A 4AZWA 3P0MA 2X6DA 4G17A 4QD6A 5CLPA 3RBWA 4BHZA 4EOMA 4EZ3A 4F4PA 4YUQA 2J0JA 1BL6A 2ZB0A 3Q60A 5F94A 5JSMA 5K5XA 5D7VA 3EYGA 5JT2A 3QTXA 3KCFA 3POZA 2J5EA 2E9OA 1Y57A 2ZM1A 3GXLA 5LQFA 3ODZX 1SZMA 4OT5A 3E7VA 4UZDA 2YLEA 3ORTA 4BDCA 5KO1A 5BUEA 4NJDA 4X3FC 3IK3A 3OCTA 4EOSA 5LOHA 1JNKA 4WNPA 5E8WA 5EDPA 4EH7A 4F63A 2P0CA 3EFWA 4QMLA 3D7ZA 4DEIA 2X9EA 5M51A 1EH4A 1XWSA 5AEPA 3TJCA 4AW2A 5LVPA 2YM6A 1WBOA 3ZZEA 5IEYA 2X81A 3T8OA 4CNHA 1AGWA 3II5A 4GEOA 5LMBA 3LJ1A 4LFIA 2AC3A 3JY0A 3MJ2A 3WOWA 5HLPA 4IZ5A 2XB7A 4FKPA 3MBLA 2BHHA 3C0GA 3KU2A 4JG8A 3AC8A 3QQUA 3HUCA 3K54A 5I9VA 4L46A 5JMSA 4TZRA 5IA2A 2QO7A 3HRCA 3VUDA 4NFMA 3SW4A 4IIRA 1XH4A 1PMNA 4V05A 5CF6A 4ZTMA 5HGIA 2ESMA 1XH9A 1H25A 4QYYA 2GDOA 4EOKA 2P55A 3D7TB 2BRGA 1AQ1A 3KULA 3BQCA 5HE2A 4BBFA 4BDHA 5G1XA 5KKRC 2QOCA 4Z55A 3BV3A 3TKUA 4MEDA 4RZWA 4OTQA 1PXMA 1M17A 1IA8A 3OS3A 4FUXA 4IM2A 3R8LA 1XR1A 3VQUA 4FYNA 4JRVA 5C01A 4RVTA 5AAGA 1QMZA 2Z7QA 4PF4A 5DVRA 1WMKA 3RAIA 2F7XE 2J0LA 4HZRA 5DHJA 3GI3A 4IHPA 5J79A 2WNTA 3UOLA 4QTCA 3GU6A 3K3IA 1PKGA 2QOHA 3KC3A 1FPUA 2ZM4A 2V55A 4C4IA 5FD2A 2ZB1A 4TYJA 2J50A 2ERKA 3GBZA 3PLSA 2JIUA 3W10A 2UW3A 4LYNA 4XG7A 5HD4A 5DT0A 3F5PA 5KUPA 3QCQA 3DS6A 4PUZA 1M14A 3KMUA 2IW9A 4K6ZA 3TIZA 3QALE 3MH3A 4QMYA 4U45A 4XG8A 4FSRA 4WNKA 2YWPA 3EB0A 2FGIA 3R9NA 4Q5EA 3KXZA 3DGKA 1Q24A 4M12A 3FJQE 4RLLA 3S3IA 2XIZA 4D5HA 4O38A 2XK4A 4II5A 2G2IA 3P1AA 3QRKA 2XM8A 4G5JA 4JXFA 5AAEA 1F0QA 2YIQA 3TJDA 3ZUVA 2W4JA 1TQIA 4J8NA 3THBA 2C6KA 5AUXA 4CFVA 4I5MA 5CI7A 2UW8A 4DGLC 1G5SA 2XKEA 4QNYA 3CD3A 2DYLA 3G5DA 3VJOA 4AE9A 1JWHA 4EK5A 2F7EE 3BPRA 3PVUA 1U54A 4D58A 4DGGA 4F9CA 2WQOA 5EI8A 3DB6A 4I3ZA 5EOBA 3T3VA 3JVSA 1O6KA 2VV9A 4DEGA 3EYHA 4WBBB 3KF7A 2GFSA 1ZARA 5K0KA 5JQ8A 1O9UA 3TV7A 1A9UA 2BRNA 4EK3A 4U8ZA 4I23A 2XRWA 3MY5A 4HPUE 4E6DA 4E3CA 3ZRKA 1KE5A 4BVUA 4C4GA 3VRZA 2XIRA 4YZCA 2QOFA 4J95A 3GU8A 4FV0A 4JDHA 2R3FA 4AX8A 2W1IA 5HCYA 3E64A 3UYSA 3VS0A 4X3JA 3NNUA 4O2PA 3UTOA 3W2SA 3O7LB 2QNJA 5DR6A 3PP0A 3RTPA 4DG3E 4FIHA 4UX9A 1SNXA 3CKWA 2VWVA 1GZOA 2B9FA 3P7AA 1U46A 4AGWA 1Q8TA 4QP3A 4M0ZA 4TYHA 4P5ZA 3ZC6A 3QL8A 4IAAA 4HGEA 4X21A 4YP8A 4A06A 2XNOA 3RJCA 4FKOA 3VF8A 2PSQA 3MVMA 5EM7A 2JC6A 2OFVA 4S30A 5ANIA 3FKOA 2VWIA 3AG9A 3TV4A 1QPDA 3DDQA 4RA4A 5CEMA 2C30A 4RSSA 5D11A 2JBPA 2UW4A 3VN9A 4DH5A 4E5AX 3SA0A 2YM3A 4KBAA 1H28A 2F2UA 2VO7A 5E8SA 3QUPA 5DFPA 3HMMA 4BDJA 3UQCA 1WZYA 2WTWA 4XOYA 4HOKA 5L2QA 1ZY4A 4E93A 4FMQA 3QD2B 5ANKA 4WKQA 4QMXA 3DJ6A 5IZFA 1UU3A 3NSZA 5CZIA 3S0OA 5L4QA 1P4FA 4EHVA 5AR3A 2JDTA 3UC4A 3S95A 3FLNC 1H1QA 2JKKA 3OT3A 3QAME 4K1BA 5AV2A 2VX0A 2WOUA 1KV1A 4TY1A 5E92A 4YSMA 5CNNA 3UP7A 4CZYB 5KMJA 3JYAA 4EZ7A 3BGZA 3V5TA 4QYEA 3Q5IA 3KB7A 5D9HA 4BGQA 2QONA 3CJFA 2H8HA 3ZFYA 2CLXA 4HVSA 3R04A 5KMMA 4U97A 4Y85A 5HTIA 2PMIA 2VTJA 4IADA 5C03A 2W1GA 2X1NA 4J97A 4BCKA 2JAMA 1OL7A 4WIHA 3ZZWA 4LGHA 1NVQA 3BQRA 4AXAA 4EJNA 2JFLA 2ZDTA 4HYIA 5GJFA 5DH3A 2BDFA 3SX9A 4N6ZA 2VWUA 3OBGA 3I7BA 4ZSJA 2WQEA 1QPEA 2OGVA 5EK7A 1MRYA 5EYCA 1NA7A 3R6XA 3A4OX 1WBPA 3UO4A 3RALA 2B53A 1W84A 3ZU7A 1JVPP 3QKMA 5HVYA 4S31A 1JAMA 5A3XA 2X6EA 3OHTA 5JZJA 4G6NA 2QR7A 3R0TA 4WA9A 4X6RA 3T3UA 2UZBA 4XG2A 2C6LA 4ZOGA 3DQXA 4BZOA 1OKWA 3GFWA 4MD7E 4BDGA 4KKHA 3P5KA 4BI1A 2YDJA 4CZTA 1UU7A 5AP6A 4PMMA 3ZTXA 4WUNA 3NYXA 4QO9A 4R7IA 4W8DA 3U4WA 2UW0A 5FP5A 4F9AA 4TT7A 3RCDA 3SC1A 2OIBA 3DAJA 3ITZA 4NEUA 3JXWA 4RIYA 5HHWA 2C4GA 4YURA 4ZJVA 2BFYA 2WMAA 4J98A 2PMOX 3DY7A 4M68A 4MX9A 5FXQA 1B39A 3A62A 3FMHA 3OEFX 4NH1A 3BYOA 3D9VA 3R9HA 5H8BA 4EQCA 2C3IB 3Q53A 1UNLA 3MI9A 4AA4A 5KBRA 3DFCB 3R9DA 4FKQA 3KXHA 3LCSA 3V5QA 2ZVAA 4OTFA 4ZLYA 4ANSA 4BKYA 1Q3DA 3GUBA 3QTIA 1XJDA 2XK6A 3ZRLA 5DEWA 5CEPA 5AP2A 2QURA 2XVDA 3MFTA 3PJ1A 2W1FA 4F09A 1B6CB 4TKSA 4MVFA 4RX7A 4L6QA 3OXTA 4ALVA 4XV1A 4E1ZA 3D5XA 2FUMA 2P3GX 3ET7A 2YERA 2QOKA 3OVVA 4I5CA 4K8AA 3TACA 1H00A 3PJCA 3E87A 4YC3A 2CGWA 3GU7A 5I3OA 2HELA 3P79A 4UMQA 2BROA 4FF8A 3TN8A 4AT3A 5HX8A 4Y46A 4C4EA 2XNPA 3D94A 4NM5A 4U41A 5DWRA 1GIIA 3A7FA 2A1AB 2OXYA 3CE3A 3VUTA 2DS1A 1Y6AA 4GVAA 1Q8YA 4C35A 4D5KA 5C26A 2GQGA 3EQIA 3PIZA 3WZDA 3MFRA 5L2TA 1JKTA 4QRCA 3P4KA 4YJRA 5GNKA 4R1VA 4BIEA 4C38A 4CTBA 4GFGA 1GZNA 3D14A 5AP1A 3UIMA 3ZLXA 5EDRA 2VAGA 4PRJA 5LXMA 3SVVA 2XKCA 3QFVA 4TTHB 2C5YA 2RIOA 5CEQA 3VHEA 2RG6A 4V01A 3BLRA 1OUKA 2ITTA 3MWUA 3NIEA 4YJPA 1H1RA 2C0IA 3SLSA 5KKRB 2XK7A 4DC2A 1YXSA 2GTMA 2R64A 3PXZA 4ITHA 4H3PA 3R1SA 2WQMA 4BKZA 1REJA 4D4YA 4FIEA 3DQWA 1OKVA 2VX1A 1FGIA 3KGAA 2XCHA 3VBYA 3S2PA 2ONLA 1R0EA 4UYNA 1OB3A 1T45A 2H96A 5KZIA 2J9MA 5I0BA 3Q52A 1KV2A 2PWLA 4ZS0A 4PX6A 5AV3A 4LI5A 4D28A 2YCRA 4OGRA 1KWPA 3W8LA 2H9VA 3W55A 3ZDIA 3N51A 5CSXA 3FMDA 5HLWA 2RFSA 4GIIA 5AV0A 1PHKA 2YM4A 5IH6A 4FZDB 5EM5A 3R73A 4BTKA 2Z8CA 1BYGA 2R3NA 4B7TA 1G3NA 1F3MC 4FKGA 4CV8A 2EB3A 4FTIA 3WZJA 2BRHA 3VUGA 4OLIA 3Q4UA 2XJ1A 3DOGA 3QTUA 4FL3A 3R9OA 4CCUA 4IAYA 2V0DA 2BR1A 4KRDA 2OXDA 2NO3A 2XIKA 3HDMA 5LWNA 5AADA 4DTKA 1Q62A 4JNWA 4IE9A 3LXNA 3VBTA 2DQ7X 4L42A 3FY2A 3PG3A 5FP6A 5AR7A 4NUSA 3E93A 3QBNA 2RFDA 4B99A 4B9DA 3KULB 4PDOA 3E8EA 2OZOA 3L8PA 3IPHA 3O7LD 2I40A 4KB8A 3FPMA 4MXAA 4RIXB 4LL5A 5CTPA 3IDBA 4JQ8A 3CLYA 4HVDA 1W98A 3TUBA 3RM6A 4Z9LA 1MUOA 4O96A 1WVWA 3CBLA 3D5UA 4CFMA 5IEXA 3OWKA 4D2PA 2IZSA 5L2IA 4F0IA 2HXLA 4EUUA 3A60A 1K3AA 3EQCA 3NNWA 3QQLA 4W4WA 2O3PA 4XCUA 3CY2A 5E8YA 3LFNA 3U4UA 5KNJA 5ANDA 5CF5A 2JKQA 1GY3A 4ITIA 4MWHA 2ERZE 5CSVA 3WIGA 4IJPA 5J9ZA 5FTQA 5CVFA 2VTOA 3EQHA 3TG1A 4ZXTA 5HE3A 2AC5A 3UVQA 3FAAA 1QPJA 5B7VA 3R7IA 2EVAA 4K18A 1PXLA 4PTGA 2OH0E 1WBTA 4JIAA 4E7WA 2C0TA 2PZRA 3Q6UA 5KMOA 3LFDA 4F99A 5DT3A 5HD7A 4ASZA 4E4MA 4ASDA 3AC3A 4DEBA 3T9TA 3FMMA 3KMWA 5E8XA 2G9XA 4KNBA 4R6VA 3H0ZA 4K2RA 1ZOEA 4C57A 4WHZA 5DT4A 3F3UA 3CQUA 2WTCA 2OZAB 4JRNA 3VS2A 2CGUA 4AF3A 3G6GA 2QOIA 3D5VA 4ANOA 4CMOA 3TT0A 4AA5A 2GHMA 2XNGA 3EN9A 4QYGA 5FXRA 2WTDA 2Y7JA 4C3PA 4NK9A 4FV4A 5CVHA 4ZJIA 4PQNA 3TUDA 2B1PA 4FKWA 4IVCA 3VUIA 3BBTB 4ITJA 3R7VA 3O8TA 3R63A 4RWLA 4W9XA 4QT1A 1ZOHA 2GSFA 2OW3A 3HP5A 2G2FA 2HK5A 2WGJA 3OCBA 4YLJA 1LR4A 1PMUA 5AM7A 5EYKA 3SXSA 3UG1A 4C4HA 4EL9A 4CLJA 3FBVA 4EORA 3EQBA 4J1RA 3TNIA 3FLSA 2C5OA 4FTNA 4WOVA 3RK7A 3ZYAA 4FG7A 4RIWA 4DEAA 1YRPA 2Y4IC 3DBCA 1FMKA 4A07A 4CEGA 2JITA 4DLIA 4X2FA 2UZEA 3GC7A 3TNWA 5DMZA 3R2YA 4QYHA 2WMXA 5CNOA 1H1PA 4AZVA 2BDJA 5HNBA 3KK9A 4I5PA 2Y0AA 3ZLSA 2F49A 1JKKA 4D0XA 4IDVA 4DFZE 4HCUA 4EOOA 4DAWA 4NKSA 4BDFA 4BZNA 1HCKA 1WCCA 4G9CA 5AP7A 3G9NA 5I5ZA 3OT8A 1K9AA 4M97A 3PXKA 2B52A 3TUCA 2YAKA 3I5ZA 3OTUA 4O22A 5BPYA 3EQDA 3GCSA 4CKRA 4ARKA 3L9NA 4CD0A 1NY3A 3O0GA 5IMEA 4IJ9A 4DITA 1CM8A 3NRMA 3NYVA 4FKTA 3RM7A 2E9PA 3GVUA 4JLCA 2A4LA 4ZP5A 4FV3A 1OGUA 3QUEA 2XK9A 3VW6A 4MXZA 2P2HA 4G1WA 4UMTA 5TF9A 3QTQA 4FT9A 4ZSGA 4ANBA 1F5QA 2PVLA 1CKIA 3DT1A 1CKPA 4AS0A 3KRXA 2XEZA 3C0HA 2I0EA 4YPDA 2W1CA 1UVRA 4TWOA 4IFGA 5E1EA 3UP2A 3OBJA 4C58A 4OW8A 5DOSA 2OK1A 3P86A 5HVKA 2I0YA 3TTJA 1VYWA 5HG9A 4NTTA 5HICA 4E20A 1WVXA 5HESA 3HRBA 2F9GA 3TKIA 3TL8A 3GNIB 4X7QA 3CPCA 3RAHA 4YHFA 4FSMA 1R0PA 5HIBA 3TCPA 4C4FA 1IG1A 4CFNA 2C6EA 2WMRA 5BX0A 3PVWA 3Q9XA 5BVKA 3LQ5A 1GJOA 3VS7A 4O0WA 4W9WA 4DFYA 4M69B 2OBJA 2BPMA 3VRYA 2V7AA 4L68A 4KIOA 3E3PA 1YQJA 3P78A 3ZBXA 3DTCA 4EHEA 4FVRA 2IWIA 3KKVA 4MF0A 3A7GA 2WMVA 5AP4A 4ZY4A 5IG1A 1M2PA 4ID7A 3R30A 4M14A 5G6VA 1TQPA 3L9PA 3VIDA 1H07A 3COHA 3QXOA 3BLHA 3VW8A 2XM9A 4QMTA 3BU3A 3CKXA 4F1MA 3ZFXA 1GIHA 2YCFA 5EFQA 5L8JA 3COMA 1YXTA 3DKFA 3K2LA 4GVJA 4I21A 1NVSA 4E4NA 2GHLA 2YIXA 3EZRA 2C5XA 2YDIA 3DK6A 3P7CA 5JZNA 3OZ6A 3NAXA 3BGPA 4ZTRA 1URCA 2HW7A 4UB7A 5I4NA 4F1TA 3HLLA 4Q9SA 4IX3A 3DK7A 5JK3A 4GW8A 4BI0A 4XBUA 4OTPA 4WG3A 5AUVA 5AUUA 3SW7A 2BMCA 3AC2A 2RKUA 4BWKA 5EHYA 4KIQA 3VS3A 4DH3A 1Q97A 4IZYA 5BVOA 3MTFA 1PXPA 2Z60A 5HEZA 5CZHA 4BCMA 5L8KA 2Y9QA 4RJ5A 4F08A 2XIXA 4BDAA 3GU4A 2PY3A 4NM0A 4KRCA 4KAOA 1OL5A 3MY0A 4AP7A 4J7BA 4GUEA 5TO8A 5CS6A 4EHZA 4YU2A 5I9UA 3CPBA 3ETAA 3UPXA 1Z9XA 3KRJA 5GZ9A 4FIFA 5K9IA 2X4ZA 3DU8A 4YC8A 3TZ8A 4MBIA 4FSWA 4JR3A 4FL2A 2WHBA 2XF0A 1IEPA 1ZWSA 4R3RA 5FBNC 3TZMA 2P33A 4I20A 1PXOA 3A7HA 4FZAB 5CF8A 5A6OA 5J7HA 3POOA 4QMUA 3HGKA 3QX2A 3IQ7A 1I09A 1Z5MA 3I4BA 1JBPE 2C3JA 3QCYA 5K0XA 4CCBA 1B38A 2I0VA 2VTLA 2Y4PA 4FL1A 4HGLA 2X8IA 3MS9A 3BRBA 4OBOA 2VUWA 1YHVA 4ACMA 1KE6A 4NCTA 3LAUA 2ZV2A 3ZOSA 3O96A 5J5TA 2VZ6A 4C34A 2J0IA 5IH4A 4A4LA 3COKA 2IW6A 1R3CA 3BWJA 1ZYCA 3NAYA 3PVBA 5DEYA 4UZHA 4ALWA 3BU6A 5A54A 4BL1A 4G3EA 4EK8A 4AT4A 1NVRA 3FZRA 2W5HA 2C68A 3QQJA 3BKBA 1YVJA 3V5PA 1RE8A 4ZSAA 3G0EA 4NM7A 2B55A 1M52A 3ALOA 3TZ7A 3C4WA 2VU3A 4K77A 4B6LA 5IISA 4EYMA 2XZSA 1DI8A 2PE0A 4QMZA 4Y83A 2CKEA 1ZZLA 3PY0A 2R3LA 3ZS5A 3QD0A 3OMVA 2BUJA 1OECA 5JFSA 1FVVA 2YZAA 4RWIA 3BU5A 5JEBA 3JUHA 3LLTA 2UZWE 2GCDA 4PP7A 5J7BA 5M56A 3MJ1A 4BHNA 3UPZA 3WI6A 3GCUA 4JI9A 4OR5A 5FGKA 4JBPA 1OVEA 3SD0A 3FSKA 5JKGA 3UMWA 5IDPA 2XIYA 3F3TA 4J8MA 4I41A 3W1FA 3MPAA 3NZ0A 1A06A 2BRBA 5CY3A 4MAOA 1YXVA 2OF2A 5AA9A 3NX8A 3LXLA 4KIPA 4F0GA 3RGFA 5J8IA 3H4JA 4EUTA 2X7GA 5AP0A 3RNIA 4EC8A 3MB7A 4I0RA 2PE2A 2CGVA 4YLKA 4WG4A 3PXRA 3Q9WA 4S32A 4BDEA 4IZ7A 2R3RA 3QHWA 4Y95A 3DPKA 2VO3A 4R1YA 2QOOA 1PYXA 3P9JA 4DFXE 4MD9E 4EYJA 5J87A 3W32A 3FMKA 5C8MA 3D0EA 1YWNA 4GUBA 4KBCA 4UBAA 5DE2A 1LPUA 1W82A 2W7XA 1PXIA 4YZ9A 4ACGA 4RRVA 3GC9A 3QQKA 2R3KA 2XS0A 3KRWA 5B2MA 3UO5A 5AUYA 2PVFA 4QTEA 3LW0A 3BHUA 4U79A 2JGZA 4AZSA 5AIRA 2ITWA 3G90X 2UW9A 3V5WA 4BYIA 1OIRA 5E7RA 1XBCA 3HV6A 5LMKC 3KY2A 3CEKA 3DKGA 4GK4A 5EW3A 3RPOA 3ZH8A 5BVNA 1YW2A 1Q4LA 3OXIA 1V0BA 2UV2A 2V5QA 4IAIA 2WTKC 4L00A 4W4XA 5EI2A 2QLUA 5GZAA 4GCJA 3OW4A 3FI3A 4RC4A 1Q8UA 4F7LA 4YTHA 1TKIA 2VWZA 4O27B 3HMIA 5ANJA 1H1WA 2A27A 4XRLA 4A9SA 2B9JA 2ZDUA 3PZHA 5KX8A 3PYYA 2VTSA 3ZLWA 4C62A 2ZV8A 3UNKA 3Q96A 5CQUA 1UWJA 2C0OA 3QWKA 4UXLA 4IWQA 4XV2A 3V04A 4V0GA 4PTCA 2WO6A 1YDSE 3HKOA 4JQ7A 4A9TA 4QP4A 5HU9A 3PIXA 5A4EA 4ANQA 3OY1A 3NUXA 4EK6A 5EH0A 2JDRA 3HV3A 3KVXA 4FX3A 3CXWA 5BNJA 3P23A 2C6IA 3G0FA 5K4IA 2Q0NA 2PVJA 4FI1A 4E6CA 2PZ5A 1Y6BA 2UZLA 3V8TA 2B9IA 1ZLTA 3DBQA 5DPVA 1H4LA 1S9IA 3F5UA 2FSOX 2HXQA 2QODA 2FB8A 3AMYA 4FEQA 4FZFB 4CYJA 5LMAA 1R39A 3QA0A 4ZTHA 3O71A 4M0YA 3E7OA 3QZIA 1YI6A 2C6TA 4GJ2A 4QQJA 2REIA 2WIPA 3HVCA 5JQ5A 1W83A 4RVLA 5HU3A 2C5VA 3PXYA 3FMLA 4RT7A 4EHGA 2ITYA 4XG3A 3U6IA 4DEDA 3E92A 4ZK5A 3E5AA 4NIFB 4FODA 1Q8ZA 1MP8A 2CN8A 3NUSA 4MNEA 2XYNA 4JJRA 4O6EA 1JKSA 4KA3A 2W0JA 4IM0A 2YM5A 3PZEA 3LXPA 3PPKA 5CYIA 2ITNA 1CMKE 3ZEWA 4XV3A 3FXWA 3OC1A 4F70A 2LAVA 1DI9A 5C8KA 4XMOA 4G6LA 3EN6A 4MCVA 3MH0A 3TI1A 2Y6MA 3O8PA 3R7EA 3KXNA 3HA8A 2HWOA 2WEIA 2GNFA 3HZTA 5CU6A 3LM5A 2QI8A 3HV5A 3LOKA 3HYHA 3VBXA 3KXGA 3SKCA 3O2MA 4O0VA 4O0UA 4QPSA 5I9WA 5FQDC 1WBWA 5CEIA 1GNGA 2O8YA 2OU7A 4CZUA 4YJTA 5JH6A 2BVAA 4ANMA 3A7IA 3ZMMA 3MFSA 3D15A 4GH2A 2R5TA 4FTRA 4YZBA 2UZTA 1ZRZA 5CU4A 3O17A 3C4EA 5TOZA 3E3BX 4DN5A 5IH5A 2W05A 4TN6A 4UMPA 3IW4A 1U5QA 4HNFA 2XP2A 4G9RA 4AW0A 1DM2A 4M15A 4JBQA 2GU8A 3ODYX 5M55A 3FZ1A 2F7ZE 1UA2A 2J2IB 3TTIA 3EN4A 3W16A 3WYYA 4TYEA 3DA6A 3PWYA 3Q04A 3KCKA 1HCLA 3TNHA 4XHKB 5KZ0A 2PK9A 2WMTA 4RG0A 2V7OA 3R21A 2R3IA 4O2ZA 4RVKA 3MH1A 4F9BA 4FKJA 3UBDA 4D4RA 3ZUUA 2W4OA 1OZ1A 5IUIA 2BCJA 4I0SA 5LJJA 4RQKA 2F4JA 3FV8A 4XG4A 4AW1A 4E4XA 5CALA 2VTRA 4X2NA 3NDMA 3BYVA 2ZMDA 3NNVA 3A8XA 3AD6A 1KOBA 4C3RA 2PUUA 4FYOA 3LFAA 4EBWA 5AIKA 5M53A 2VN9A 5DN3A 4MKCA 4QMQA 5AUTA 3H0YA 1JLUE 3PA5A 2FSMX 3ORLA 2X0GA 4XBRA 2O2UA 2R3QA 3LHJA 2C1AA 4FTCA 2H6DA 3A61A 4FOCA 4MBLA 4IVBA 3WZUA 5GJDA 5IDNA 5IPJA 1JPAA 3DXNA 1REKA 4NZWB 3LCOA 3DZQA 2KTYA 2ZMCA 3QD3A 3QQFA 3OUNB 3R8UA 1YKRA 4GJ3A 2R3HA 1KSWA 3OWJA 2QO9A 5M44A 4JDIA 4F1OA 2ZJWA 3I60A 3U9NA 1W7HA 2OF4A 3UODA 5DIAA 3IG7A 3NCZA 5BMSA 4ZIMA 3WZKA 4BDIA 3ORPA 2ONLC 2X2MA 2CDZA 2IVSA 5CU3A 5HKMA 5IA0A 2F2CB 5LVOA 4X3FB 3NW6A 4FT7A 3RVGA 3FUPA 3DK3A 4RJ4A 3RPSA 5IA5A 4I22A 2BZIB 2EXEA 3WF7A 3C1XA 4XP0A 4G3FA 4I93A 3FLQA 3HUBA 4IC8A 3ROYA 4RIOA 4XLVA 1RDQE 3B2TA 3AXWA 1ATPE 2IJMA 3VS6A 1JSVA 3M42A 5B2LA 2XA4A 3L9MA 4WSQA 2OJIA 3VC4A 2ITOA 4TNBA 3LJ2A 4DG2E 3R00A 3R8VA 4C3FA 3Q4TA 4AG8A 2HIWA 4LM5A 3QUDA 1RQQA 2X4FA 4IAFA 4C8BA 2VGPA 4F0FA 3EFLA 3FZSA 4I4EA 4PWNA 1WBNA 3I6UA 2O63A 2GNGA 2PZPA 2X7FA 5FRIA 5IA1A 2A19B 3L9LA 4YR8A 3QTWA 4GRBA 2ITPA 1UWHA 1V0OA 2GTNA 3G6HA 3SAYA 2WU6A 2X2LA 3EH9A 4FSYA 2E9VA 4PTEA 1Y91A 3TV6A 3EWHA 3NCGA 4JIKA 3BGQA 5BUIA 5J5SA 2W1ZA 3C4ZA 3FC2A 4GIHA 3RHXA 4AN3A 5EKNA 3F5GA 2O0UA 3BEAA 1YWVA 2VWYA 4TPTA 4E6QA 4TWNA 4U40A 4NTSA 4C59A 2W4KA 1WVYA 4QPMA 5CXZA 4PL3A 4RGJA 4AOIA 1GOLA 3PJ8A 5DNRA 3JVRA 1CKJA 2OJGA 5FM3A 4EH9A 1P5EA 2OXXA 3AGLA 4YGAA 4EQMA 4FIGA 3GCQA 1K2PA 4QP1A 4E6AA 3KFAA 4QMNA 2VWXA 3L1SA 4YNEA 5H9BA 4Z7HA 5E8TA 4USDA 2JBOA 3VHKA 4RX5A 3OOGA 4UN0C 4CYIA 3OTVA 3SQQA 1KE8A 4FZ6A 4WRSA 5L2WA 2YHVA 4PNKA 3MA3A 4DG0E 2PVKA 4CQGA 3G9LX 4AGUA 3QHRA 2WMUA 4GG7A 3LCTA 5LARA 5M4UA 3R1QA 4JT3A 4ACDA 5CSPA 5LCJA 2R3GA 5M57A 3KXXA 5FEEA 2H34A 3EQGA 4EZ5A 1WBVA 2OJ9A 2XNMA 4H39A 1YXXA 3DNDA 3LVPA 2IZTA 3GC8A 4FSQA 3CS9A 3UVRA 4CFXA 3Q32A 3WYXA 3F82A 3UIXA 4UWCA 3DBFA 3NR9A 3OEZA 4M7IA 4RVMA 3PSCA 5GJGA 1PW2A 4DHFA 3EFJA 4QMPA 4IC7A 4H1MA 5A46A 3SRVA 1OIYA 3UGCA 1SVHA 5M4IA 1SM2A 2ITVA 5LVNA 4O1OA 3GB2A 2HENA 5KMLA 4L52A 3NGAA 2NP8A 2J5FA 4MTAA 3ACKA 1W8CA 4JX3A 4PL4A 4XJ0A 5DLSA 1XBAA 3OUKA 3V51A 4AQCA 4FVQA 4G3GA 4F7SA 4B8MA 4RJ8A 4ERKA 4GU9A 1M2RA 3GC0A 3MH2A 3Q4CA 4IVAA 1DAWA 2XEYA 1VEBA 2VTAA 1XKKA 4L01A 4TWPA 4MXCA 4X6QC 3FMEA 5DA3A 4K0YA 3Q4ZA 3W2OA 2YCQA 4XOZA 3EFKA 2EU9A 5HG7A 5TR6A 4F65A 3LFSA 2WEVA 4CV9A 3DBEA 2WMQA 4HCTA 5IKWA 3RAKA 3BHTA 3FQSA 4U80A 2BAKA 4YJUA 3PVGA 1DS5A 2FH9A 3OG7A 5JN2A 3EZVA 3V8WA 4IEBA 1H24A 2PVNA 4FTAA 2CHLA 2IVUA 3QRUA 5D7AA 2QD9A 3Q6WA 4IWPA 3F61A 4N70A 4OTRA 5ETIA 3L8SA 3V6SA 4APCA 5T68A 4FKLA 3QGYA 2UZNA 1FGKA 4TXCA 4P7EA 5GHVA 3ELJA 1I44A 1BI8A 3EOCA 3O23A 4YJVA 5HOAA 3UO6A 3GU5A 3I7CA 5F1ZA 3F3VA 4UWBA 4KKGA 2BALA 4WD5A 2X8DA 1H27A 3OF0A 3UOJA 2UW5A 4AZTA 4BB4A 3LZBA 3JS2A 2XCKA 4XUFA 1E1XA 4K11A 2XK3A 4YJNA 3OROA 4KD1A 3UJGA 4XG6A 3C0IA 3DCVA 4EKKA 2HOGA 2QOQA 4L3PA 4CRLA 4YBKA 5AR2A 5BVFA 3L8XA 2OKRA 3S1HA 2W99B 3DBDA 2BTRA 1OKZA 2YLFA 2HZ4A 5C9CA 3F88A 4MH7A 2Z7RA 4CLIA 4D1ZA 3F7WA 3V01A 3ZRMA 2WKMA 3S4QA 3MIYA 1FQ1B 3CGFA 4U9AA 4FV5A 4ZLZA 3VUKA 4HW7A 4WUAA 2JIVA 3EL7A 4MYGA 3GCVA 3RMFA 4Z3VA 5CAPA 4W4YA 3A8WA 4KS7A 1HOWA 3UVPA 3MDYA 3BHYA 3AC5A 4FTMA 4YHTA 1R1WA 4XH6A 2C6MA 2FVDA 2YITA 3NS9A 3QWJA 4FTOA 4GT5A 4PNIA 4XX9A 5EI6A 3UOHA 4ALUA 5KCVA 4L9IA 3L8VA 3VS1A 4XEYA 1NXKA 2YEXA 3GOPA 4M84A 1FVRA 5EKOA 3QTZA 3AC4A 5DRBA 5CASA 4Y5QA 3R02A 3W33A 1J1BA 2IN6A 4MHAA 3C7QA 4F7NA 2PVRA 4QP6A 2QOLA 3NUUA 1XBBA 3O50A 3RINA 3UG2A 2YM8A 5F95A 4ZY5A 5HNGA 3KL8A 3C4XA 4X3FA 5AMNA 2J6MA 5B2KA 3F2AA 3LMGA 4GU6A 2ZV9A 5A9UA 4JDJA 3DNEA 3GQIA 2GS7A 2GFCA 3ORKA 3QYWA 2QVSE 4DEEA 3PA4A 3RI1A 1H1SA 4QMSA 2Q0BA 4RFZA 5B0XA 3WE8A 4ACCA 2W1DA 4XP2A 1XQZA 3FWQA 2I0HA 2OIDA 4MQ2A 1GAGA 3UIBA 4BDKA 4W8EA 4D4VA 4YZMA 4QMVA 3DAKA 3HNGA 4I6QA 3HMPA 4KSPA 3NYNA 1ZXEA 3ACJA 5BYZA 4FV9A 1J3HA 4F9YA 4Y73A 3ZO4A 2PZIA 4ZLOA 3P7BA 1Y8YA 3C4FA 3R7GA 4FSUA 4KWPA 4ZY6A 5CQWA 3ROCA 4BCHA 5I9YA 5L3AA 3PE1A 2HCKA 3NUPA 2O64A 2GNIA 5AR5A 4N0SA 4C2VA 2QLQA 4IXPA 3MIAA 2WQBA 1XH8A 2JAVA 2R2PA 3AMAA 4OAVB 5ANGA 4EK4A 5FEQA 2PVYA 4H3BA 2IVTA 3QKLA 2W5BA 3H9RA 4FV2A 4XS2A 4GL9A 4BZDA 1YOLA 5E8VA 5K4JA 2QO2A 3PE2A 3QXPA 1QPCA 4DFNA 2CCIA 1OMWA 4Q5HA 5IA3A 1OL1A 3JY9A 3I6WA 4EH3A 1OI9A 3ZXTA 5BVWA 4ZJJA 4OTHA 2J0KA 4FTKA 4BFMA 3F66A 4ZSEA 3RK5A 3DKOA 4E5WA 3G33A 2VNWA 3MGYA 4BTMA 1ZMWA 3W18A 4IVDA 3CTHA 1YI3A 5DRDA 3V5JA 3FY0A 4RC2A 2QHMA 4RJ7A 3F9NA 5CT7A 2BAJA 3O51A 3ZSHA 3LFBA 3ULZA 4CMUA 1V0PA 3M1SA 5T6KA 3LFQA 2HZIA 2FSLX 3FLWA 4IDTA 4IB5A 3FLZA 3NUNA 3LXKA 4IX4A 3W8QA 4ANNA 5D10A 3C51A 3PY3A 2R4BA 3IW8A 2BKZA 5HCXA 3FQEA 4F9WA 3AT4A 2RG5A 3OW3A 3AT3A 5CXHA 2HYYA 4AGCA 4FKUA 4RC3A 3DJ7A 3AMBA 4QMOA 1JQHA 2XNNA 3R01A 3D2KA 3CQWA 3FI2A 2WTJA 3EJ1A 3FL5A 4R8QA 3ZXZA 4BCFA 2OFUA 3BYSA 4G16A 4FZ7A 5A4QA 4W4VA 5AUZA 2WAJA 3FKNA 4OAUC 3VWAA 4FV1A 3QKKA 4FTJA 2HY81 3FZTA 3MFUA 5F20A 3I0OA 4MXOA 1GIJA 3WILA 4D0WA 5A14A 4BKJA 3ANQA 3FE3A 4NIFA 4BCPA 4D9TA 4D2WA 1MQ4A 2Y6OA 1XH6A 3FC1X 3R7UA 5AV4A 5ACKA 4GS6A 3ZSIA 5AWMA 2ETKA 2BZJA 5TKDA 4BCOA 3R83A 4C4JA 3PFQA 3A4PA 3DJ5A 3KN6A 4HCVA 3OCSA 4DGMA 2VNYA 4WT6A 3CIKA 4G2FA 4LMUA 3BIZA 5D12A 2YIWA 4QTBA 3IW6A 4EC9A 2RGPA 4BICA 4GV1A 1YHSA 3Q9YA 5J9LA 4QOXA 4WNMA 4K33A 1QL6A 3P08A 3AD5A 4IFCA 4FV6A 2CSNA 5E1SA 5AAFA 3V3VA 3R2BA 3DB8A 4AZFA 4WSYA 4FC0A 4LUEA 3UC3A 4PL5A 5C8NA 3QCSA 4NKAA 3ZBFA 4FA2A 3NPCA 3EN5A 4HYHA 1V1KA 4YHJA 4DGOA 5ETCA 4UV0A 5M4CA 3NYOA 3QQGA 4OBQA 4ZAUA 4CSVA 2QHNA 2YFXA 3PUPA 4BTFA 2OO8X 4MQ1A 3ZHPC 1JKLA 1ZYJA 2CPKE 2C3LA 4EH5A 2VO0A 4A4OA 4D9UA 4LOPA 2C1BA 3NUYA 3PG1A 4FT0A 3WF8A 5CANA 4Z7GA 2JKMA 1Q8WA 1U4DA 5CU2A 2E2BA 3IGGA 3QRTA 4RLKA 3UDBA 4CVAA 4LQMA 5HORA 2CCHA 3LQ8A 3QC9A 3RCJA 5TT7A 1PJKA 3H30A 4C0TA 3K3JA 4OBPA 5CT0A 2GPHA 2ZV7A 3COIA 5E8UA 5HTBA 4TYIA 3PPZA 3EHAA 3ENHA 4AN9A 1UKIA 4LG4A 2CMWA 3PIYA 1PXKA 3F3ZA 3PXQA 4L7SA 4MNEB 3SV0A 3UIUA 3TZ9A 4D2RA 4EBVA 3MSSA 4IH8A 2ZYBA 4CKIA 2X9FA 2XH5A 2YAAA 2ZAZA 4U3ZA 4HVHA 2W1EA 3ORIA 3VBVA 3VNTA 4JVGA 2YABA 4CFWA 2VTTA 1O6YA 4P4CA 3OXZA 4CQEA 4FGBA 5I9ZA 3HL7A 2RFEA 4A9RA 4FKSA 1QCFA 2NRUA 4UXQA 4X0MA 5JRQA 3AGMA 1OIQA 4FSNA 2UZDA 1Y8GA 3EIDA 3ORNA 4GT4A 2BILB 3IOPA 5A6NA 4C37A 4AOTA 3I79A 3ERKA 4EOPA 4U81A 4F6SA 2Z2WA 3NNXA 4NT4A 4JG7A 4TRLA 2B9HA 2XUUA 4L8MA 2YN8A 4O0TA 5CWZA 1M7QA 4IBMA 5EHOA 3CTJA 2XK8A 3QA8A 4BCIA 1BLXA 3H10A 4FG8A 2WTVA 3Q5ZA 4ZTLA 2VGOA 2BFXA 1SYKA 4LV8A 3OD6X 3KQ7A 1XHAA 4ENYA 4CXAA 1E9HA 3KF4A 2VTMA 2CJMA 2VTHA 4EI4A 2W17A 3RP9A 5T3QA 4BIBA 2V62A 4F6UA 4EQUA 4YTIA 4R7HA 3B8QA 3DDPA 3LE6A 4B8LA 3KN5A 1LEWA 3CY3A 3MW1A 1SMHA 4YJOA 4NCTC 3R8PA 3R1NA 4MNFA 5EW9A 3NWWA 3SOAA 4AUAA 4I4FA 4MWIA 5CAOA 1U59A 3GGFA 4U44A 4YTCA 2UW6A 4FV7A 4PMTA 5H8EA 1GZKA 1R78A 4C2WA 5ITAA 1APME 4D2TA 2UVYA 4I6BA 5HO7A 2ITXA 4EWHA 4XNEA 4KKEA 3O8UA 3MB6A 5CAUA 3IGOA 2HAKA 4G3CA 3OOMA 3OY3A 3FSFA 1WFCA 3FDNA 5AP5A 1VJYA 4RA5A 4LGDA 4KABA 4MXYA 3ZONA 4EH2A 1JSUA 2QCSA 1DAYA 3EQFA 4LOOA 3FHRA 1TVOA 2OIQA 1GZ8A 4NFNA 4KIKA 2DUVA 3W2QA 1BUHA 1TQMA 4OTWA 4Q9ZA 5CU0A 5HE1A 4RWJA 3A7JA 5ANOA 5BVDA 4TW9A 3BLQA 3V6RA 4R3PA 5ICPA 4QQCA 4A9YA 2G15A 1U54B 1UNHA 4FT3A 3BWFA 4GK3A 1H0VA 1OPJA 1O6LA 5BMMA 5HO8A 5CAVA 4FNYA 2X39A 2GNLA 1WAKA 3TIYA 4YTFA 2WU7A 4RWKA 2QOBA 1YI4A 2QU5A 2R7IA 3DV3A 3ANRA 1UV5A 2FSTX 4WBOA 5TE0A 3UE4A 3VBQA 1IRKA 5LVLA 3RPYA 4CMTA 5HIDA 3TXOA 3MPMA 4DGNA 4YZDA 2UZOA 1OL6A 3NW5A 3LPBA 5CENA 4D2SA 4DINA 3E8CA 4QP8A 1Q41A 3C9WA 4LRJA 2W9ZB 4PPBA 3RK9A 2W1HA 5DR9A 1UNGA 4HNIA 3VBWA 4DH1A 3E63A 5EM6A 3BYUA 1UU9A 2XRUA 3FZOA 4FK6A 3QRIA 4FTUA 5BQ0A 3UQFA 3IS5A 4NSTA 3R71A 3M2WA 4E5BA 5GZ8A 2VTNA 3W2RA 3FYKX 5CEKA 5FTOA 3BV2A 3D4QA 4YNOA 3CCNA 3SHEA 4ZTNA 4AFEA 4DH7A 5HBHA 3R22A 3BELA 3OCGA 4O91A 3AQVA 3QD4A 3PWDA 4YBJA 3RHKA 4QNAA 4NW6A 3MVJA 5FLFA 4AFJA 4RQVA 3ALNA 4O21A 2XJ0A 5AR8A 2G01A 4DEHA 5IUHA 3VS4A 4LRKA 2FA2A 1RJBA 2WPAA 3I81A 4QP9A 4USEA 5HIEA 3AC1A 2WMBA 2VTIA 3Q9ZA 3UNJA 5KMNA 3LFFA 2P2IA 5K5NA 4MD8E 4LV5A 1OPLA 5FDPA 4ZTSA 5EDQA 4QP7A 2PHKA 3TKHA 5CEOA 4RMZA 5LMKA 2A2AA 4TYGA 3HMOA 4KIKB 2ACXA 3EN7A 1UU8A 3VVHA 2B4SB 2C69A 4U5JA 2YA9A 4D1SA 3QU0A 2C6DA 2O65A 4F64A 4HJOA 1PMVA 3QTRA 4IAZA 4IB1A 4N6YA 4DFLA 1LUFA 4CRSA 3BI6A 4A9UA 4GT3A 4QP2A 4OT6A 4I1ZA 4IX5A 2UZVA 3AD4A 3QYZA 4PPAA 4FG9A 2I1MA 3QZFA 4I6FA 3BZ3A 5DR2A 2J90A 4L53A 4BWPA 2BZKB 3V5LA 5KHWA 4G31A 4MK0A 4LRMA 4WO5A 3BE9A 4GFMA 4NM3A 4AA0A 3QRJA 2R7BA 5HBJA 4J71A 4RX9A 1P2AA 4JAJA 3U8WA 3FLYA 3GEQA 2X7OA 4GG5A 2VTPA 1ERKA 5IMXA 3PSDA 4YZNA 4IWDA 3U6JA 4HYSA 1JOWB 4EOQA 3VUHA 5J9YA 1KE9A 2HWPA 2RF9A 5HG8A 3GQLA 2J51A 3EQPA 3LIJA 3OP5A 2UUEA 4LMNA 3WZEA 5BUJA 2UZUE 4H36A 1BX6A 4S33A 4BGGA 2QG5A 3FQHA 3H3CA 5FBOA 3CC6A 3E8NA 5JFVA 1VR2A 4TNDA 4FKVA 2WXVA 2J7TA 3FMNA 5AX3A 1SVGA 4MXXA 5CSWA 2WFYA 1MRUA 4G6OA 4EOIA 3I1AA 2WQNA 3BBWA 2PVMA 3BHVA 4U7ZA 2YM7A 4OTDA 4EH4A 1ZMUA 2PMLX 3DAEA 3SXFA 3CTQA 3TWJA 4O1PA 2JEDA 3PXFA 3R7YA 1ZY5A 4JDKA 4E26A 4OTGA 1YDRE 4RIWB 2OI4X 4CKJA 1PMEA 3TEIA 4ERWA 4CFUA 3QLGA 5FWKK 3WF9A 1ZYDA 3HX4A 5LVMA 4QTDA 5HX6A 3N9XA 4P2KA 3WF6A 3OFMA 4X2JA 2Y4IB 3BE2A 2ETRA 3Q2MA 3Q3BA 1ZMVA 4G5PA 4RFYA 5FEDA 3CP9A 4WRGA 3DFAA 5I3RA 4UMUA 3S00A 4MBJA 2YACA 3AT2A 4YJSA 2WELA 4IACA 2WZJA 3HV7A 4YPSA 5KBQA 3MY1A 2Z7LA 4RZVA 4B4LA 1S9JA 1OPKA 4RIYB 1OUYA 5FDXA 2R3PA 5JFXA 3FL4A 3QQHA 5KE0A 1MQBA 4DCEA 2CLQA 2O5KA 2OH4A 5E8ZA 3JPVA 3MA6A 3C4CA 2JFMA 2JKOA 2X2KA 2YCSA 2QU6A 4ZTQA 4GYGA 5LCKA 4BI2A 4IQ6A 3MPTA 1PF8A 4FUYA 3VUMA 3CR0A 4DLJA 5C1QB 2OG8A 3C13A 3K5VA 3H9FA 2OJJA 4AW5A 4FBXA 1SVEA 4B0GA 5BVEA 5JFWA 4JG6A 5A4LA 2BIYA 2EXCX 4BTJA 2NRYA 1CTPE 5EHLA 3I0QA 4M13A 3FXZA 4FNZA 2GS2A 1H8FA 4IMYA 3F2NA 4XYFA 3K5UA 2NPQA 4I5HA 4ZZOA 1Q99A 2PTKA 2YDKA 2W96B 4V04A 3IW7A 4ZSLA 4HGSA 4IB0A 4H3QA 4QQ5A 4JQEA 1FINA 2W5AA 1H26A 2EUFB 3MVHA 1Q61A 3ORZA 1RW8A 5EG3A 1AD5A 4FNXA 1YWRA 4BCNA 3GCPA 3R28A 3QGWA 1XO2B 2Z7SA 3IONA 4PMPA 4IW0A 4JBOA 4L67A 4L45A 4FNWA 4JAIA 3CGOA 3UOKA 1X8BA 1LEZA 3EL8A 4F7JA 4ZZMA 2OWBA 2LGCA 3MYGA 4NW5A 5BYYA 4J52A 4QMWA 4TL0A 4CFFA 2YIYA 2GNHA 3KA0A 4EEVA 2VWWA 5EM8A 4M8TA 4ZEGA 2IW8A 1P14A 3AOXA 4PPCA 3ZO2A 4IM3A 2AUHA 5D41A 3ZO3A 4JR7A 4FSTA 2XNEA 4U0IA 2GMXA 3E8DA 4AOJA 4C7TA 4KBKA 4UALA 4UEUA 3C5UA 2UW7A 1ZYLA 2UVZA 4ASEA 2YJSA 4LOQA 4V0GB 4XLIA 5CI6A 5J95A 2HZNA 2G2HA 4BDBA 3EMGA 3KRRA 2GS6A 3A2CA 4YO4A 3CJGA 3G2FA 3PJ3A 4U3YA 5AJQA 4IX6A 3LM0A 4CTCA 2JDOA 2GHGA 4HVIA 2BRMA 2OZAA 4P90A 4JBVA 4JS8A 2XKFA 4N4SA 1OITA 3QC4A 2ITUA 3VAPA 4APPA 4DYMA 4XG9A 2WMSA 5ETAA 4NU1A 4M66A 4RJ6A 5DGZA 4J96A 5EYDA 3DTWA 3REPA 3U6HA 2CGXA 3DLZA 3GOKA 4XV9A 3A99A 3LFEA 4WNOA 4IAKA 5DBXA 4HVGA 1J1CA 1PXNA 5F9EA 4BIDA 3R8ZA 2XBJA 3QLFA 4USFA 4BN1A 1CSNA 3HP2A 2R0UA 2I6LA 3QZHA 4YO6A 1ZZ2A 3UZTA 2ETMA 2XNBA 4L44A 2EB2A 1FVTA 4G34A 4IANA 2CN5A 4IZAA 5J1WA 2QC6A 1J91A 1YOJA 4R3CA 2RL5A 3RKBA 3TNQB 4I92A 2FYSA 5CVGA 3TNPC 4FSZA 4DBNA 5HNIX 2Y8OA 4FT5A 3KEXA 3LCKA 2EXMA 3LFCA 3QF9A 4AU8A 3BEGA 1KOAA 3FPQA 5ACBC 4ZZNA 1Z57A 2R0IA 2VWBA 1ZYSA 3RWPA 4MF1A 1OM1A 1YOMA 3DZOA 5F4NA 4Z16A 2GNJA 2UVXA 5D1JA 3T9IA 3B8RA 5CF4A 4QPAA 3I5NA 4HGTA 4RX8A 4AT5A 1KE7A 3PRFA 3OWLA 3FZPA 5HQ0A 3PJ2A 2PE1A 1LP4A 3HMNA 2EWAA 1P4OA 3ZLYA 4IWOA 1CDKA 3U9CA 2JDSA 2VD5A 3IOKA 5IUGA 2BIKB 2RSVA 3MVLA 3ZEPA 1XH7A 4AWIA 3G51A 5L6OA 3ZC5A 3PY1A 2KULA 2YIRA 3F5XA 3V8SA 3VS5A 4J99A 4BBMA 4ENXA 4AAAA 2ZM3A 3SDJA 4PY1A 3IW5A 1YHWA 5JGBA 3NIZA 2J0MB 2BHEA 4M67A 3IDPA 4GK2A 5KHXA 3CD8A 5CSHA 3BHHA 5L6WL 3VF9A 4FOBA 4K9YA 3R7OA 4RJ3A 2PVHA 1Q5KA 2IVVA 1WBSA 4FV8A 3F3WA 3RAWA 4EONA 1T46A 3EQRA 3MN3A 4PMSA 5H2UA 4AGDA 2WB8A 4D55A 3OWPA 3C50A 5HBEA 4AZEA 2JLDA 4R5SA 3WF5A 2C6OA 1BI7A 4EOJA 2XMYA 2WTKB 2IZRA 4M3QA 4A4XA 2ITQA 5EW8A 1ZOGA 4J53A 4YSJA 1PXJA 3DLSA 2WMWA 4E4LA 3BCEA 4O0XA 2BTSA 3D2IA 3SXRA 1UKHA 3UMXA 5E91A 3FYJX 3PSBA 3ORXA 4Y72A 3UYTA 2E9UA 2AYPA 4LUDA 1L3RE 5HLNA 1U5RA 3NLBA 3W2PA 3QTSA 2B7AA 3RZFA 2RFNA 5LWMA 2ZOQA 3ZO1A 4EH8A 3VO3A 1SNUA 2E9NA 4M69A 4GSBA 3UZPA 5AX9A 4O0YA 4XP3A 2QKWB 3D7TA 3KK8A 5EOLA 4FR4A 1OL2A 5HVJA 2IO6A 3DKCA 5DI1A 4EKLA 3ZCLA 1M2QA 2XKDA 2BDWA 1XH5A 3U87A 3R1YA 3D5WA 4JL9A 2WIHA 3RWQA 4OUCA 3HV4A 3CQEA 3VULA 2YJRA 4FICA 3H9OA 5AA8A 4YJQA 4D1XA 5IEVA 4BYJA 3VQHA 4FIIA 4S34A 4BBEA 1FMOE 4UMRA 5FM2A 4KSQA 3RPRA 3E62A 2WOTA 2R3JA 2JDVA 2QQ7A 3B2WA 1URWA 3NEWA 4O0SA 2HY0A 1BKXA 4BF2A 4PP9A 3RNYA 5CAQA 3FKLA 3GFEA 4H1JA 2A0CX 4NWMA 4R5YA 5JRSA 3UQGA 4BCGA 3FHIA 2HW6A 2V22A 4JOAA 1M7NA 2PL0A 3M11A 4GYIA 2OJFE 3ULIA 5ANEA 3ZFMA 1STCE 2F57A 4UY9A 5M4FA 3U51A 1YXUA 4EOLA 5JGDA 3IKAA 4S2ZA 4FKRA 5HI2A 1PYEA 2XJ2A 4U6RA 2JIIA 5A4TA 5E90A 2VTQA 4QYFA 4QMMA 4RBLA 1MRVA 3EKKA 5L2SA 4O0RA 3ENMA 4I0TA 4BRXA 3D83A 3ZM4A 5IU2A 5KMIA 1OKYA 3MV5A 5AP3A 5C27A 4Q2AA 3UNZA 4CT2A 4Y5HA 5AM6A 4AE6A 3HRFA 5DG5A 2P4IA 4ONAA 2W06A 3KXMA 3PPJA 4IB3A 3SOCA 4E73A 3PTGA 2J4ZA 2OSCA 3GT8A 3LCDA 4PDSA 4BCQA 1IR3A 2XBAA 5HE0A 1PKDA 1JSTA 4FK3A 1OIUA 3GENA 4C02A 1FOTA 4FTTA 2VX3A 2YISA 4G3DA 4GFOA 4YMJA 3IECA 4D2VA 4XRJA 3LJ0A 4U43A 3F69A 1E1VA 5EYMA 3WBLA 4BCJA 2W9FB 4L3LA 2G1TA 3HDNA 4YC6A 4TYHB 4RFMA 5FG8A 4BC6A 4JX7A 2VO6A 3KRLA 3BYMA 4A7CA 2ITZA 3HA6A 4BDDA 3EKNA 4U42A 4RPVA 4WG5A 4D4SA 4KS8A 3IDCA 4C33A 1BL7A 1H0WA 2R3OA 3W2CA 1VZOA 4UWYA 5AV1A 2BAQA 3ZSGA 4AN2A 5HTCA 5JGAA 3SRVB 5IA4A 5HCZA 4KINA 1Q3WA 2R3MA 5AUWA 4HYUA 3WE4A 4C36A 4X2KA 4BGHA 4HPTE 5I9XA 2JD5A 4YLLA 4FTLA 4EWQA 3IO7A 3MTLA 3HECA 4L7FA 4DH8A 2C5NA 1YDTE 3VJNA 2PZYA 3WIKA 2OICA 2R9SA 4I6HA 5FXSA 3FI4A 2PMNX 3BX5A 4FIJA 1H01A 4O6LA 3R8MA 5K3YA 4EH6A 2HZ0A 4FVPA 3ZDUA 5HZNA 3RPVA 1ZAOA 2C3KA 5CX9A 4ACHA 3ZUTA 2X8EA 3FMJA 3KMMA 4I24A 2DWBA 3F7ZA 5ETFA 3QX4A 4FTQA 5H8GA 1VYZA 3PA3A 4AACA 3GP0A 4X2GA 2B54A 3ORMA 2SRCA 4ASXA 3NW7A 5KMKA 4OTIA 5HO6A 4PDPA
chains in the Genus database with same CATH superfamily
3F6XA 4GMYA 1IASA 4QQTA 5H3QA 2C47A 4H58A 4QTAA 4PV0A 4F6WA 3PRIA 3FXXA 4HZSA 5L8LA 2QKRA 5L6PA 2WD1A 3HEGA 4P5QA 3WARA 5A4CA 4RIXA 5HG5A 4L43A 5J1VA 1BMKA 1W0XC 3E88A 3QCXA 2BZHB 2IZUA 4I94A 4Y8DA 3RZBA 4ANLA 4BWXA 4CT1A 2QR8A 3QZGA 4FKIA 4TWCA 5IF1A 4E8AA 2WTIA 4LL0A 1PY5A 2FO0A 4C61A 3KVWA 4UYAA 2VRXA 2XYUA 3PP1A 4LGGA 5AR4A 4NJ3A 4L3JA 1H08A 4AZWA 3P0MA 2X6DA 4G17A 4QD6A 5CLPA 3RBWA 4BHZA 4EOMA 4EZ3A 4F4PA 4YUQA 2J0JA 1BL6A 2ZB0A 3Q60A 5F94A 5JSMA 5K5XA 5D7VA 3EYGA 5JT2A 3QTXA 3KCFA 3POZA 2J5EA 2E9OA 1Y57A 2ZM1A 3GXLA 5LQFA 3ODZX 1SZMA 4OT5A 3E7VA 4UZDA 2YLEA 3ORTA 4BDCA 5KO1A 5BUEA 4NJDA 4X3FC 3IK3A 3OCTA 4EOSA 5LOHA 1JNKA 4WNPA 5E8WA 5EDPA 4EH7A 4F63A 2P0CA 3EFWA 4QMLA 3D7ZA 4DEIA 2X9EA 5M51A 1EH4A 1XWSA 5AEPA 3TJCA 4AW2A 5LVPA 2YM6A 1WBOA 3ZZEA 5IEYA 2X81A 3T8OA 4CNHA 1AGWA 3II5A 4GEOA 5LMBA 3LJ1A 4LFIA 2AC3A 3JY0A 3MJ2A 3WOWA 5HLPA 4IZ5A 2XB7A 4FKPA 3MBLA 2BHHA 3C0GA 3KU2A 4JG8A 3AC8A 3QQUA 3HUCA 3K54A 5I9VA 4L46A 5JMSA 4TZRA 5IA2A 2QO7A 3HRCA 3VUDA 4NFMA 3SW4A 4IIRA 1XH4A 1PMNA 4V05A 5CF6A 4ZTMA 5HGIA 2ESMA 1XH9A 1H25A 4QYYA 2GDOA 4EOKA 2P55A 3D7TB 2BRGA 1AQ1A 3KULA 3BQCA 5HE2A 4BBFA 4BDHA 5G1XA 5KKRC 2QOCA 4Z55A 3BV3A 3TKUA 4MEDA 4RZWA 4OTQA 1PXMA 1M17A 1IA8A 3OS3A 4FUXA 4IM2A 3R8LA 1XR1A 3VQUA 4FYNA 4JRVA 5C01A 4RVTA 5AAGA 1QMZA 2Z7QA 4PF4A 5DVRA 1WMKA 3RAIA 2F7XE 2J0LA 4HZRA 5DHJA 3GI3A 4IHPA 5J79A 2WNTA 3UOLA 4QTCA 3GU6A 3K3IA 1PKGA 2QOHA 3KC3A 1FPUA 2ZM4A 2V55A 4C4IA 5FD2A 2ZB1A 4TYJA 2J50A 2ERKA 3GBZA 3PLSA 2JIUA 3W10A 2UW3A 4LYNA 4XG7A 5HD4A 5DT0A 3F5PA 5KUPA 3QCQA 3DS6A 4PUZA 1M14A 3KMUA 2IW9A 4K6ZA 3TIZA 3QALE 3MH3A 4QMYA 4U45A 4XG8A 4FSRA 4WNKA 2YWPA 3EB0A 2FGIA 3R9NA 4Q5EA 3KXZA 3DGKA 1Q24A 4M12A 3FJQE 4RLLA 3S3IA 2XIZA 4D5HA 4O38A 2XK4A 4II5A 2G2IA 3P1AA 3QRKA 2XM8A 4G5JA 4O4DA 4JXFA 5AAEA 1F0QA 2YIQA 3TJDA 3ZUVA 2W4JA 1TQIA 4J8NA 3THBA 2C6KA 5AUXA 4CFVA 4I5MA 5CI7A 2UW8A 4DGLC 1G5SA 2XKEA 2X0OA 4QNYA 3CD3A 2DYLA 3G5DA 3VJOA 4AE9A 1JWHA 4EK5A 2F7EE 3BPRA 3PVUA 1U54A 4D58A 4DGGA 4F9CA 2WQOA 5EI8A 3DB6A 4I3ZA 5EOBA 3T3VA 3JVSA 1O6KA 2VV9A 4DEGA 3EYHA 4WBBB 3KF7A 2GFSA 1ZARA 5K0KA 5JQ8A 1O9UA 3TV7A 1A9UA 2BRNA 4EK3A 4U8ZA 4I23A 2XRWA 3MY5A 4HPUE 4E6DA 4E3CA 3ZRKA 1KE5A 4BVUA 4C4GA 3VRZA 2XIRA 4YZCA 2QOFA 4J95A 3GU8A 4FV0A 4JDHA 2R3FA 4AX8A 2W1IA 5HCYA 3E64A 3UYSA 3VS0A 4X3JA 3NNUA 4O2PA 3UTOA 3W2SA 3O7LB 2QNJA 5DR6A 3PP0A 3RTPA 4DG3E 4FIHA 4UX9A 1SNXA 3CKWA 2VWVA 1GZOA 2B9FA 3P7AA 1U46A 4AGWA 1Q8TA 4QP3A 4M0ZA 4TYHA 4P5ZA 3ZC6A 3QL8A 4IAAA 4HGEA 4X21A 4YP8A 4A06A 2XNOA 3RJCA 4FKOA 3VF8A 2PSQA 3MVMA 5EM7A 2JC6A 2OFVA 4S30A 5ANIA 3FKOA 2VWIA 3AG9A 3TV4A 1QPDA 3DDQA 4RA4A 5CEMA 2C30A 4RSSA 5D11A 2JBPA 2UW4A 3VN9A 4DH5A 4E5AX 3SA0A 2YM3A 4KBAA 1H28A 2F2UA 2VO7A 5E8SA 3QUPA 5DFPA 3HMMA 4BDJA 3UQCA 1WZYA 2WTWA 4XOYA 4HOKA 5L2QA 1ZY4A 4E93A 4FMQA 3QD2B 5ANKA 4WKQA 4QMXA 3DJ6A 5IZFA 1UU3A 3NSZA 5CZIA 3S0OA 5L4QA 1P4FA 4EHVA 5AR3A 2JDTA 3UC4A 3S95A 3FLNC 1H1QA 2JKKA 3OT3A 3QAME 4K1BA 5AV2A 2VX0A 2WOUA 1KV1A 4TY1A 5E92A 4YSMA 5CNNA 3UP7A 4CZYB 5KMJA 3JYAA 4EZ7A 3BGZA 3V5TA 4QYEA 3Q5IA 3KB7A 5D9HA 4BGQA 2QONA 3CJFA 2H8HA 3ZFYA 2CLXA 4HVSA 3R04A 5KMMA 4U97A 4Y85A 5HTIA 2PMIA 2VTJA 4IADA 5C03A 2W1GA 2X1NA 4J97A 4BCKA 2JAMA 1OL7A 4WIHA 3ZZWA 4LGHA 1NVQA 3BQRA 4AXAA 4EJNA 2JFLA 2ZDTA 4HYIA 5GJFA 5DH3A 2BDFA 3SX9A 4N6ZA 2VWUA 3OBGA 3I7BA 4ZSJA 2WQEA 1QPEA 2OGVA 5EK7A 1MRYA 5EYCA 1NA7A 3R6XA 3A4OX 1WBPA 3UO4A 3RALA 2B53A 1W84A 3ZU7A 1JVPP 3QKMA 5HVYA 4S31A 1JAMA 5A3XA 2X6EA 3OHTA 5JZJA 4G6NA 2QR7A 3R0TA 4WA9A 4X6RA 3T3UA 2UZBA 4XG2A 2C6LA 4ZOGA 3DQXA 4BZOA 1OKWA 3GFWA 4MD7E 4BDGA 4KKHA 3P5KA 4BI1A 2YDJA 4CZTA 1UU7A 5AP6A 4PMMA 3ZTXA 4WUNA 3NYXA 4QO9A 4R7IA 4W8DA 3U4WA 2UW0A 5FP5A 4F9AA 4TT7A 3RCDA 3SC1A 2OIBA 3DAJA 3ITZA 4NEUA 3JXWA 4RIYA 5HHWA 2C4GA 4YURA 4ZJVA 2BFYA 2WMAA 4J98A 2PMOX 3DY7A 4M68A 4MX9A 5FXQA 1B39A 3A62A 3FMHA 3OEFX 4NH1A 3BYOA 3D9VA 3R9HA 5H8BA 4EQCA 2C3IB 3Q53A 1UNLA 3MI9A 4AA4A 5KBRA 3DFCB 3R9DA 4FKQA 3KXHA 3LCSA 3V5QA 2ZVAA 4OTFA 4ZLYA 4ANSA 4BKYA 1Q3DA 3GUBA 3QTIA 1XJDA 2XK6A 3ZRLA 5DEWA 5CEPA 5AP2A 2QURA 2XVDA 3MFTA 3PJ1A 2W1FA 4F09A 1B6CB 4TKSA 4MVFA 4RX7A 4L6QA 3OXTA 4ALVA 4XV1A 4E1ZA 3D5XA 2FUMA 2P3GX 3ET7A 2YERA 2QOKA 3OVVA 4I5CA 4K8AA 3TACA 1H00A 3PJCA 3E87A 4YC3A 2CGWA 3GU7A 5I3OA 2HELA 3P79A 4UMQA 2BROA 4FF8A 3TN8A 4AT3A 5HX8A 4Y46A 4C4EA 2XNPA 3D94A 4NM5A 4U41A 5DWRA 1GIIA 3A7FA 2A1AB 2OXYA 3CE3A 3VUTA 2DS1A 1Y6AA 4GVAA 1Q8YA 4C35A 4D5KA 5C26A 2GQGA 3EQIA 3PIZA 3WZDA 3MFRA 5L2TA 1JKTA 4QRCA 3P4KA 4YJRA 5GNKA 4R1VA 4BIEA 4C38A 4CTBA 4GFGA 1GZNA 3D14A 5AP1A 3UIMA 3ZLXA 5EDRA 2VAGA 4PRJA 5LXMA 3SVVA 2XKCA 3QFVA 4TTHB 2C5YA 2RIOA 5CEQA 3VHEA 2RG6A 4V01A 3BLRA 1OUKA 2ITTA 3MWUA 3NIEA 4YJPA 1H1RA 2C0IA 3SLSA 5KKRB 2XK7A 4DC2A 1YXSA 2GTMA 2R64A 3PXZA 4ITHA 4H3PA 3R1SA 2WQMA 1W2CA 4BKZA 1REJA 4D4YA 4FIEA 3DQWA 1OKVA 2VX1A 1FGIA 3KGAA 2XCHA 3VBYA 3S2PA 2ONLA 1R0EA 4UYNA 1OB3A 1T45A 2H96A 5KZIA 2J9MA 5I0BA 3Q52A 1KV2A 2PWLA 4ZS0A 4PX6A 5AV3A 4LI5A 4D28A 2YCRA 4OGRA 1KWPA 3W8LA 2H9VA 3W55A 3ZDIA 3N51A 5CSXA 3FMDA 5HLWA 2RFSA 4GIIA 5AV0A 1PHKA 2YM4A 5IH6A 4FZDB 5EM5A 3R73A 4BTKA 2Z8CA 1BYGA 2R3NA 4B7TA 1G3NA 1F3MC 4FKGA 4CV8A 2EB3A 4FTIA 3WZJA 2BRHA 3VUGA 4OLIA 3Q4UA 2XJ1A 3DOGA 3QTUA 4FL3A 3R9OA 4CCUA 4IAYA 2V0DA 2BR1A 4KRDA 2OXDA 2NO3A 2XIKA 3HDMA 5LWNA 5AADA 4DTKA 1Q62A 4JNWA 4IE9A 3LXNA 3VBTA 2DQ7X 4L42A 3FY2A 3PG3A 5FP6A 5AR7A 4NUSA 3E93A 3QBNA 2RFDA 4B99A 4B9DA 3KULB 4PDOA 3E8EA 2OZOA 3L8PA 3IPHA 3O7LD 2I40A 4KB8A 3FPMA 4MXAA 4RIXB 4LL5A 5CTPA 3IDBA 4JQ8A 3CLYA 4HVDA 1W98A 3TUBA 3RM6A 4Z9LA 1MUOA 4O96A 1WVWA 3CBLA 3D5UA 4CFMA 5IEXA 3OWKA 4D2PA 2IZSA 5L2IA 4F0IA 2HXLA 4EUUA 3A60A 4O4EA 1K3AA 3EQCA 3NNWA 3QQLA 4W4WA 2O3PA 4XCUA 3CY2A 5E8YA 3LFNA 3U4UA 5KNJA 5ANDA 5CF5A 2JKQA 1GY3A 4ITIA 4MWHA 2ERZE 5CSVA 3WIGA 4IJPA 5J9ZA 5FTQA 5CVFA 2VTOA 3EQHA 3TG1A 4ZXTA 5HE3A 2AC5A 3UVQA 3FAAA 1QPJA 5B7VA 3R7IA 2EVAA 4K18A 1PXLA 4PTGA 2OH0E 1WBTA 4JIAA 4E7WA 2C0TA 2PZRA 3Q6UA 5KMOA 3LFDA 4F99A 5DT3A 5HD7A 4ASZA 4E4MA 2IF8A 4ASDA 3AC3A 4DEBA 3T9TA 3FMMA 3KMWA 5E8XA 2G9XA 4KNBA 4R6VA 3H0ZA 4K2RA 1ZOEA 4C57A 4WHZA 5DT4A 3F3UA 3CQUA 2WTCA 2OZAB 4JRNA 3VS2A 2CGUA 4AF3A 3G6GA 2QOIA 3D5VA 4ANOA 4CMOA 3TT0A 4AA5A 2GHMA 2XNGA 3EN9A 4QYGA 5FXRA 2WTDA 2Y7JA 4C3PA 4NK9A 4FV4A 5CVHA 4ZJIA 4PQNA 3TUDA 2B1PA 4FRFA 4FKWA 4IVCA 3VUIA 3BBTB 4ITJA 3R7VA 3O8TA 3R63A 4RWLA 4W9XA 4QT1A 1ZOHA 2GSFA 2OW3A 3HP5A 2G2FA 2HK5A 2WGJA 3OCBA 4YLJA 1LR4A 1PMUA 5AM7A 5EYKA 3SXSA 3UG1A 4C4HA 4EL9A 4CLJA 3FBVA 4EORA 3EQBA 4J1RA 3TNIA 3FLSA 2C5OA 4FTNA 4WOVA 3RK7A 3ZYAA 4FG7A 4RIWA 4DEAA 1YRPA 2Y4IC 3DBCA 1FMKA 4A07A 4CEGA 2JITA 4DLIA 4X2FA 2UZEA 3GC7A 3TNWA 5DMZA 3R2YA 4QYHA 2WMXA 5CNOA 1H1PA 4AZVA 2BDJA 5HNBA 3KK9A 4I5PA 2Y0AA 3ZLSA 2F49A 1JKKA 4D0XA 4IDVA 4DFZE 4HCUA 4EOOA 4DAWA 4NKSA 4BDFA 4BZNA 1HCKA 1WCCA 4G9CA 5AP7A 3G9NA 5I5ZA 3OT8A 1K9AA 4M97A 3PXKA 2B52A 3TUCA 2YAKA 3I5ZA 3OTUA 4O22A 5BPYA 3EQDA 3GCSA 4CKRA 4ARKA 3L9NA 4CD0A 1NY3A 3O0GA 5IMEA 4IJ9A 4DITA 1CM8A 3NRMA 3NYVA 4FKTA 3RM7A 2E9PA 3GVUA 4JLCA 2A4LA 4ZP5A 4FV3A 1OGUA 3QUEA 2XK9A 3VW6A 4MXZA 2P2HA 4G1WA 4UMTA 5TF9A 3QTQA 4FT9A 4ZSGA 4ANBA 1F5QA 2PVLA 1CKIA 3DT1A 1CKPA 4AS0A 3KRXA 2XEZA 3C0HA 2I0EA 4YPDA 2W1CA 1UVRA 4TWOA 4IFGA 5E1EA 3UP2A 3OBJA 4C58A 4OW8A 5DOSA 2OK1A 3P86A 5HVKA 2I0YA 3TTJA 1VYWA 5HG9A 4NTTA 5HICA 4E20A 1WVXA 5HESA 3HRBA 2F9GA 3TKIA 3TL8A 3GNIB 4X7QA 3CPCA 3RAHA 4YHFA 4FSMA 1R0PA 5HIBA 3TCPA 4C4FA 1IG1A 4CFNA 2C6EA 2WMRA 5BX0A 3PVWA 3Q9XA 5BVKA 3LQ5A 1GJOA 3VS7A 4O0WA 4W9WA 4DFYA 4M69B 2OBJA 2BPMA 3VRYA 2V7AA 4L68A 4KIOA 3E3PA 1YQJA 3P78A 3ZBXA 3DTCA 4EHEA 4FVRA 2IWIA 3KKVA 4MF0A 3A7GA 2WMVA 5AP4A 4ZY4A 5IG1A 1M2PA 4ID7A 3R30A 4M14A 5G6VA 1TQPA 3L9PA 3VIDA 1H07A 3COHA 3QXOA 3BLHA 3VW8A 2XM9A 4QMTA 3BU3A 3CKXA 4F1MA 3ZFXA 1GIHA 2YCFA 5EFQA 5L8JA 3COMA 1YXTA 3DKFA 3K2LA 4GVJA 4I21A 1NVSA 4E4NA 2GHLA 2YIXA 3EZRA 2C5XA 2YDIA 3DK6A 3P7CA 5JZNA 3OZ6A 3NAXA 3BGPA 4ZTRA 1URCA 2HW7A 4UB7A 5I4NA 4F1TA 3HLLA 4Q9SA 4IX3A 3DK7A 5JK3A 4GW8A 4BI0A 4XBUA 4OTPA 4WG3A 5AUVA 5AUUA 3SW7A 2BMCA 3AC2A 2RKUA 4BWKA 5EHYA 4KIQA 3VS3A 4DH3A 1Q97A 4IZYA 5BVOA 3MTFA 1PXPA 2Z60A 5HEZA 5CZHA 4BCMA 5L8KA 2Y9QA 4RJ5A 4F08A 2XIXA 4BDAA 3GU4A 2PY3A 4NM0A 4KRCA 4KAOA 1OL5A 3MY0A 4AP7A 4J7BA 4GUEA 5TO8A 5CS6A 4EHZA 4YU2A 5I9UA 3CPBA 3ETAA 3UPXA 1Z9XA 3KRJA 5GZ9A 4FIFA 5K9IA 2X4ZA 3DU8A 4YC8A 3TZ8A 4MBIA 4FSWA 4JR3A 4FL2A 2WHBA 2XF0A 1IEPA 1ZWSA 4R3RA 5FBNC 3TZMA 2P33A 4I20A 1PXOA 3A7HA 4FZAB 5CF8A 5A6OA 5J7HA 3POOA 4QMUA 3HGKA 3QX2A 3IQ7A 1I09A 1Z5MA 3I4BA 1JBPE 2C3JA 3QCYA 5K0XA 4CCBA 1B38A 2I0VA 2VTLA 2Y4PA 4FL1A 4HGLA 2X8IA 3MS9A 3BRBA 4OBOA 2VUWA 1YHVA 4ACMA 1KE6A 4NCTA 3LAUA 2ZV2A 3ZOSA 3O96A 5J5TA 2VZ6A 4C34A 2J0IA 5IH4A 4A4LA 3COKA 2IW6A 1R3CA 3BWJA 1ZYCA 3NAYA 3PVBA 5DEYA 4UZHA 4ALWA 3BU6A 5A54A 4BL1A 4G3EA 4EK8A 4AT4A 1NVRA 3FZRA 2W5HA 2C68A 3QQJA 3BKBA 1YVJA 3V5PA 1RE8A 4ZSAA 3G0EA 4NM7A 2B55A 1M52A 3ALOA 3TZ7A 3C4WA 2VU3A 4K77A 4B6LA 5IISA 4EYMA 2XZSA 1DI8A 2PE0A 4QMZA 4Y83A 2CKEA 1ZZLA 3PY0A 2R3LA 3ZS5A 3QD0A 3OMVA 2BUJA 1OECA 5JFSA 1FVVA 2YZAA 4RWIA 3BU5A 5JEBA 3JUHA 3LLTA 2UZWE 2GCDA 4PP7A 5J7BA 5M56A 3MJ1A 4BHNA 3UPZA 3WI6A 3GCUA 4JI9A 4OR5A 5FGKA 4JBPA 1OVEA 3SD0A 3FSKA 5JKGA 3UMWA 5IDPA 2XIYA 3F3TA 4J8MA 4I41A 3W1FA 3MPAA 3NZ0A 1A06A 2BRBA 5CY3A 4MAOA 1YXVA 2OF2A 5AA9A 3NX8A 3LXLA 4KIPA 4F0GA 3RGFA 5J8IA 3H4JA 4EUTA 2X7GA 5AP0A 3RNIA 4EC8A 3MB7A 4I0RA 2PE2A 2CGVA 4YLKA 4WG4A 3PXRA 3Q9WA 4S32A 4BDEA 4IZ7A 2R3RA 3QHWA 4Y95A 3DPKA 2VO3A 4R1YA 2QOOA 1PYXA 3P9JA 4DFXE 4MD9E 4EYJA 5J87A 3W32A 3FMKA 5C8MA 3D0EA 1YWNA 4GUBA 4KBCA 4UBAA 5DE2A 1LPUA 1W82A 2W7XA 1PXIA 4YZ9A 4ACGA 4RRVA 3GC9A 3QQKA 2R3KA 2XS0A 3KRWA 5B2MA 3UO5A 5AUYA 2PVFA 4QTEA 3LW0A 3BHUA 4U79A 2JGZA 4AZSA 5AIRA 2ITWA 3G90X 2UW9A 3V5WA 4BYIA 1OIRA 5E7RA 1XBCA 3HV6A 5LMKC 3KY2A 3CEKA 3DKGA 4GK4A 5EW3A 3RPOA 3ZH8A 5BVNA 1YW2A 1Q4LA 3OXIA 1V0BA 2UV2A 2V5QA 4IAIA 2WTKC 4L00A 4W4XA 5EI2A 2QLUA 5GZAA 4GCJA 3OW4A 3FI3A 4RC4A 1Q8UA 4F7LA 4YTHA 1TKIA 2VWZA 4O27B 3HMIA 5ANJA 1H1WA 2A27A 4XRLA 4A9SA 2B9JA 2ZDUA 3PZHA 5KX8A 3PYYA 2VTSA 3ZLWA 4C62A 2ZV8A 3UNKA 3Q96A 5CQUA 1UWJA 2C0OA 3QWKA 4UXLA 4IWQA 4XV2A 3V04A 4V0GA 4PTCA 2WO6A 1YDSE 3HKOA 4JQ7A 4A9TA 4QP4A 5HU9A 3PIXA 5A4EA 4ANQA 3OY1A 3NUXA 4EK6A 5EH0A 2JDRA 3HV3A 3KVXA 4FX3A 3CXWA 5BNJA 3P23A 2C6IA 3G0FA 5K4IA 2Q0NA 2PVJA 4FI1A 4E6CA 2PZ5A 1Y6BA 2UZLA 3V8TA 2B9IA 1ZLTA 3DBQA 5DPVA 1H4LA 1S9IA 3F5UA 2FSOX 2HXQA 2QODA 2FB8A 3AMYA 4FEQA 4FZFB 4CYJA 5LMAA 1R39A 3QA0A 4ZTHA 3O71A 4M0YA 3E7OA 3QZIA 1YI6A 2C6TA 4GJ2A 4QQJA 2REIA 2WIPA 3HVCA 5JQ5A 1W83A 4RVLA 5HU3A 2C5VA 3PXYA 3FMLA 4RT7A 4EHGA 2ITYA 4XG3A 3U6IA 4DEDA 3E92A 4ZK5A 3E5AA 4NIFB 4FODA 1Q8ZA 1MP8A 2CN8A 3NUSA 4MNEA 2XYNA 4JJRA 4O6EA 1JKSA 4KA3A 2W0JA 4IM0A 2YM5A 3PZEA 3LXPA 3PPKA 5CYIA 2ITNA 1CMKE 3ZEWA 4XV3A 3FXWA 3OC1A 4F70A 2LAVA 1DI9A 5C8KA 4XMOA 4G6LA 3EN6A 4MCVA 3MH0A 3TI1A 2Y6MA 3O8PA 3R7EA 3KXNA 3HA8A 2HWOA 2WEIA 2GNFA 3HZTA 5CU6A 3LM5A 2QI8A 3HV5A 3LOKA 3HYHA 3VBXA 3KXGA 3SKCA 3O2MA 4O0VA 4O0UA 4QPSA 5I9WA 5FQDC 1WBWA 5CEIA 1GNGA 2O8YA 2OU7A 4CZUA 4YJTA 5JH6A 2BVAA 4ANMA 3A7IA 3ZMMA 3MFSA 3D15A 4GH2A 2R5TA 4FTRA 4YZBA 2UZTA 1ZRZA 5CU4A 3O17A 3C4EA 5TOZA 3E3BX 4DN5A 5IH5A 2W05A 4TN6A 4UMPA 3IW4A 1U5QA 4HNFA 2XP2A 4G9RA 4AW0A 1DM2A 4M15A 4JBQA 2GU8A 3ODYX 5M55A 3FZ1A 2F7ZE 1UA2A 2J2IB 3TTIA 3EN4A 3W16A 3WYYA 4TYEA 3DA6A 3PWYA 3Q04A 3KCKA 1HCLA 3TNHA 4XHKB 5KZ0A 2PK9A 2WMTA 4RG0A 2V7OA 3R21A 2R3IA 4O2ZA 4RVKA 3MH1A 4F9BA 4FKJA 3UBDA 4D4RA 3ZUUA 2W4OA 1OZ1A 5IUIA 2BCJA 4I0SA 5LJJA 4RQKA 2F4JA 3FV8A 4XG4A 4AW1A 4E4XA 5CALA 2VTRA 4X2NA 3NDMA 3BYVA 2ZMDA 3NNVA 3A8XA 3AD6A 1KOBA 4C3RA 2PUUA 4FYOA 3LFAA 4EBWA 5AIKA 5M53A 2VN9A 5DN3A 4MKCA 4QMQA 5AUTA 3H0YA 1JLUE 3PA5A 2FSMX 3ORLA 2X0GA 4XBRA 2O2UA 2R3QA 3LHJA 2C1AA 4FTCA 2H6DA 3A61A 4FOCA 4MBLA 4IVBA 3WZUA 5GJDA 5IDNA 5IPJA 1JPAA 3DXNA 1REKA 4NZWB 3LCOA 3DZQA 2KTYA 2ZMCA 3QD3A 3QQFA 3OUNB 3R8UA 1YKRA 4GJ3A 2R3HA 1KSWA 3OWJA 2QO9A 5M44A 4JDIA 4F1OA 2ZJWA 3I60A 3U9NA 1W7HA 2OF4A 3UODA 5DIAA 3IG7A 3NCZA 5BMSA 4ZIMA 3WZKA 4BDIA 3ORPA 2ONLC 2X2MA 2CDZA 2IVSA 5CU3A 5HKMA 5IA0A 2F2CB 5LVOA 4X3FB 3NW6A 4FT7A 3RVGA 3FUPA 3DK3A 4RJ4A 3RPSA 5IA5A 4I22A 2BZIB 2EXEA 3WF7A 3C1XA 4XP0A 4G3FA 4I93A 3FLQA 3HUBA 4IC8A 3ROYA 4RIOA 4XLVA 1RDQE 3B2TA 3AXWA 1ATPE 2IJMA 3VS6A 1JSVA 3M42A 5B2LA 2XA4A 3L9MA 4WSQA 2OJIA 3VC4A 2ITOA 4TNBA 3LJ2A 4DG2E 3R00A 3R8VA 4C3FA 3Q4TA 4AG8A 2HIWA 4LM5A 3QUDA 1RQQA 2X4FA 4IAFA 4C8BA 2VGPA 4F0FA 3EFLA 3FZSA 4I4EA 4PWNA 1WBNA 3I6UA 2O63A 2GNGA 2PZPA 2X7FA 5FRIA 5IA1A 2A19B 3L9LA 4YR8A 3QTWA 4GRBA 2ITPA 1UWHA 1V0OA 2GTNA 3G6HA 3SAYA 2WU6A 2X2LA 3EH9A 4FSYA 2E9VA 4PTEA 1Y91A 3TV6A 3EWHA 3NCGA 4JIKA 3BGQA 5BUIA 5J5SA 2W1ZA 3C4ZA 3FC2A 4GIHA 3RHXA 4AN3A 5EKNA 3F5GA 2O0UA 4O4BB 3BEAA 1YWVA 2VWYA 4TPTA 4E6QA 4TWNA 4U40A 4NTSA 4C59A 2W4KA 1WVYA 4QPMA 5CXZA 4PL3A 4RGJA 4AOIA 1GOLA 3PJ8A 5DNRA 3JVRA 1CKJA 2OJGA 5FM3A 4EH9A 1P5EA 2OXXA 3AGLA 4YGAA 4EQMA 4FIGA 3GCQA 1K2PA 4QP1A 4E6AA 3KFAA 4QMNA 2VWXA 3L1SA 4YNEA 5H9BA 4Z7HA 5E8TA 4USDA 2JBOA 3VHKA 4RX5A 3OOGA 4UN0C 4CYIA 3OTVA 3SQQA 1KE8A 4FZ6A 4WRSA 5L2WA 2YHVA 4PNKA 3MA3A 4DG0E 2PVKA 4CQGA 3G9LX 4AGUA 3QHRA 2WMUA 4GG7A 3LCTA 5LARA 5M4UA 3R1QA 4JT3A 4ACDA 5CSPA 5LCJA 2R3GA 5M57A 3KXXA 5FEEA 2H34A 3EQGA 4EZ5A 1WBVA 2OJ9A 2XNMA 4H39A 1YXXA 3DNDA 3LVPA 2IZTA 3GC8A 4FSQA 3CS9A 3UVRA 4CFXA 3Q32A 3WYXA 3F82A 3UIXA 4UWCA 3DBFA 3NR9A 3OEZA 4M7IA 4RVMA 3PSCA 5GJGA 1PW2A 4DHFA 3EFJA 4QMPA 4IC7A 4H1MA 5A46A 3SRVA 1OIYA 3UGCA 1SVHA 5M4IA 1SM2A 2ITVA 5LVNA 4O1OA 3GB2A 2HENA 5KMLA 4L52A 3NGAA 2NP8A 2J5FA 4MTAA 3ACKA 1W8CA 4JX3A 4PL4A 4XJ0A 5DLSA 1XBAA 3OUKA 3V51A 4AQCA 4FVQA 4G3GA 4F7SA 4B8MA 4RJ8A 4ERKA 4GU9A 1M2RA 3GC0A 3MH2A 3Q4CA 4IVAA 1DAWA 2XEYA 1VEBA 2VTAA 1XKKA 4L01A 4TWPA 4MXCA 4X6QC 3FMEA 5DA3A 4K0YA 3Q4ZA 3W2OA 2YCQA 4XOZA 3EFKA 2EU9A 5HG7A 5TR6A 4F65A 3LFSA 2WEVA 4CV9A 3DBEA 2WMQA 4HCTA 5IKWA 3RAKA 3BHTA 3FQSA 4U80A 2BAKA 4YJUA 3PVGA 1DS5A 2FH9A 3OG7A 5JN2A 3EZVA 3V8WA 4IEBA 1H24A 2PVNA 4FTAA 2CHLA 2IVUA 3QRUA 5D7AA 2QD9A 3Q6WA 4IWPA 3F61A 4N70A 4OTRA 5ETIA 3L8SA 3V6SA 4APCA 5T68A 4FKLA 3QGYA 2UZNA 1FGKA 4TXCA 4P7EA 5GHVA 3ELJA 1I44A 1BI8A 3EOCA 3O23A 4YJVA 5HOAA 3UO6A 3GU5A 3I7CA 5F1ZA 3F3VA 4UWBA 4KKGA 2BALA 4WD5A 2X8DA 1H27A 3OF0A 3UOJA 2UW5A 4AZTA 4BB4A 3LZBA 3JS2A 2XCKA 4XUFA 1E1XA 4K11A 2XK3A 4YJNA 3OROA 4KD1A 3UJGA 4XG6A 3C0IA 3DCVA 4EKKA 2HOGA 2QOQA 4L3PA 4CRLA 4YBKA 5AR2A 5BVFA 3L8XA 2OKRA 3S1HA 2W99B 3DBDA 2BTRA 1OKZA 2YLFA 2HZ4A 5C9CA 3F88A 4MH7A 2Z7RA 4CLIA 4D1ZA 3F7WA 3V01A 3ZRMA 2WKMA 3S4QA 3MIYA 1FQ1B 3CGFA 4U9AA 4FV5A 4ZLZA 3VUKA 4HW7A 4WUAA 2JIVA 3EL7A 4MYGA 3GCVA 3RMFA 4Z3VA 5CAPA