5AUMA

Crystal structure of a fab fragment with the ligand peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
209
Chain Sequence
AVQLVESGGGLVQPKESLKISCAAFGVTFSNVAMYWVRQAPGKGLEWVARIRTKPNNYATYYADSVKGRFTISRDDSKSMVYLQMDNLKTEDTAMYYCTAEVATDWGQGVMVTVSSAETTAPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords Heavy chain of Fab fragment
publication title Crystal structure of a Fab fragment with the ligand peptide
rcsb
source organism Rattus
total genus 43
structure length 209
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aumA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aumA01
3BAEL 5BRZE 3MV9E 3Q1SH 5KVEL 2BDNL 3MNWB 5KG9A 4G6FD 5DEZA 1UCBL 5DHVA 4RGOL 3MRIB 1UH4A 4PJEF 2FJHB 3SDXB 3DYMA 1JPFA 4U6VH 1TCRA 4OLXH 4KHTL 3SDCB 5L8LB 1X5HA 1JTOA 4K71B 1F6AA 2ZSWB 4N5ED 3SJVE 43C9B 2AXFA 4OIIH 1FO0H 5C71A 32C2B 5D7IF 5IROA 3WNNA 1DBKH 3TWCL 1LD9B 4WEUD 4HS8L 2AK4B 3KXFA 4MAYC 4DOHE 2JELL 3GO1L 3IYLW 3MLXL 4D3CH 4KTEL 4XPHH 2HJKB 4M5ZH 5CP3A 3GHBL 2Q3AA 3V8CA 2ADJB 3T0AA 3DGGB 5DA4A 3V79C 3NCFB 4WCYL 4NPYA 5J9PB 1G9MC 4MJ4A 1C5DA 2JCCF 4UQ3A 2YPKA 4YK4B 2X4RA 4M00A 4QNPE 1MCHA 3O4LE 4LK4A 1CXIA 5E1AA 5B21A 2RCSL 3BT2L 3BD3A 5IWLC 2MQCA 1JGEA 1WTGT 4LU5H 5FYLH 5F96L 2WQ8A 1C1EH 4P23C 1U2HA 1T5WB 2XRAL 4U33A 3RY4A 4C57C 1BQHG 3QDGB 3WN5B 4FFZH 3PDGA 1FGNL 4R4ND 3NZ8B 2GEEA 4MNGA 4N0FA 5BRZB 1PSKL 2CO6B 3MV9B 4X7DC 1AE6L 2F54A 3HI6H 3OAUH 2HKFH 1NLBL 1NFDF 4OBSA 1B2WH 3KYNB 4KHXH 5DRWB 5AWNL 4J1UB 3QUMA 3OKMA 4NN7C 1LO5B 3VXQB 1IM9D 4L3CB 5HGBB 3MRRB 4JFDA 3SJVB 2NY1B 3TNMA 2GTZB 3HRZB 3DRQA 1L6ZA 4IOSD 3QFJE 3RX7A 5EZJA 1X6LA 4M4RA 4DOHB 3RZCA 2DMKA 4L4VD 2I07A 1JWSB 2FHBA 2XWBA 3S36X 5HDOA 2CK0L 4P3DB 3NCJH 1QBMH 1CGXA 3BP4B 3P9MB 2NY4B 3PP3K 2NLJA 2WANA 1UM6L 1A6UH 2VR4A 3BE1H 3UBXA 3FQNA 1DVFD 3X13B 4HKBB 2P8PA 4LLDA 4PLOB 4D0DB 3ETBF 3L3IB 2E9JA 3O4LB 3U4EA 4JFPA 4C83B 3KHOA 1A0QL 1TZHB 5F1NA 4MS8D 1KLUA 1J88A 3L3JB 4NC1E 5EORL 4POYA 2CIIA 5IESH 5HVHC 2QHRL 1CICD 1IZKA 1BX2B 3BW9A 1QYGH 3EYFA 2WUCL 2B0SH 4FQPA 3WMSA 2ARWA 3FQUB 2GTWA 2NY6D 4XCYA 4XT1C 1A1MB 4P9MH 2CGRL 2O5ZH 4KZDL 2YK1H 4WTXA 5H35A 5IIEB 1MHCB 4WI5A 1S3KH 4YR6B 2P48B 3PL6C 3VGBA 2CJUL 4JPVH 5TE6L 1TPXC 3GJFH 3JXAA 3QFJB 3SY0B 1F3DJ 2YD3A 4PG2A 3TT3L 2O5XL 3FQRA 4Z0XB 3GKZA 5KSVA 2FX9L 4I0KA 5E8PA 2I9TA 4W68A 2AJ3B 3GSXA 3B9AA 4XNYH 3DO7A 4I4WA 1LK3L 3SPVA 3MUGA 3K8MA 1YMHA 2DM7A 4JZJB 1OWWA 5E95B 3EIFA 1DN2A 3DSFH 3QO1B 4J8RB 4P0DA 5HJ3A 1ROWA 4KVNL 2J4WL 3PQYE 3RTQD 3RPKA 3TN0C 1CD1B 3T3MF 2HKHH 4RMTA 1U8LA 1XZ0B 2J6EH 2W9EL 5J1SC 3MYJB 3PWPE 1TCMA 5DEGB 2BNUA 1BFOA 3GSOB 2ORBL 1NC4A 4JG0H 1JTTA 2DQFB 3QIBA 1BOYA 1V3LA 4L4JA 4NYLA 2BRRH 4Z7QE 3EDJA 4D9QD 4Q9QL 1CR9L 1RUKH 4KRNA 5IOPA 1SJHA 3ROLA 2FZ3B 5IFHH 1RIVL 2DBLL 3B9KB 1YPZF 1RZKC 3WKMH 1QSVA 4MJ2A 4NHUA 3X3GL 4L5FH 3U9PH 3ZHLA 3KJ4C 5EO9A 4S1SH 3CZFA 2J88L 4JQVC 5BXFA 3TCXA 3S3PA 3QPQC 3GMMA 3MV7D 3MRFA 2ZWLT 4O2FA 1UVQA 5F9OL 4MX7B 4BKLB 3P77A 4FN0A 3EHBC 5CWSB 2PTTA 4RGMC 4JM2B 3CMGA 1FCGA 2JJSA 5C9JB 1OVZA 5I8CB 4PJCF 4M7JH 1X4YA 2VE6B 4MB5A 4PJDA 1U8KB 4FQ2L 3QEGL 2J1KA 3IDXH 2VISA 2F53D 5IBUG 4RZCB 1SYVA 1WTLA 5TGBA 4ZXBB 1T2JA 3KXFE 3PV6A 1CLOH 1DL7H 1VERA 4OZGA 5L2KB 5CZVH 1TJGL 1ORQB 3ULVD 3PQYB 4PGDB 3IFNH 4FA8A 3O8XC 4WV1B 1UENA 3LRGA 4JO3H 5D9SB 2N4IA 2NR6D 3L7FA 3PWPB 5DD5H 2BY0A 4WWKA 1AXIB 5ADPH 4H20H 1RVFL 3CNKA 3GI8L 4JDZA 2DD8L 5B38A 1RD6A 2YEZA 2JK5B 3LAFA 1Q9OA 4MXQD 1EGJA 1FNHA 4NT6A 1V3MA 2DQHH 2V9QA 3NOIA 3VXPA 5FEBA 2ED9A 3VFRB 4Y4KC 2X4OA 4KKBD 1A02N 3QWOA 1T20B 4EIGB 1WT5A 3A6CL 1HILB 2AJUL 2FEDD 4XBPA 4X9BA 2OMBA 4QRTB 3QUYB 3MLVH 5SWZA 2Y07L 1NCUA 5KG9B 5DHVB 4UT7H 1F2QA 2Q87A 1MFEL 4NO0A 1JPFB 5HHVH 5ISZA 3REWA 4NCDA 5K93A 1MCNA 5FUZL 1IGIH 1YNLL 4JFDE 1F6AB 2AXFB 1TENA 1EX0A 2DQTL 2MJWA 4PJ5D 4PRNA 1KXVC 3EDDA 3MRQA 1YJDC 1FVEA 3QPXL 1YEGH 4P2YA 3PGFH 1VPOH 3KXFB 3QNYA 2GIYA 4XCCL 4FQ1L 4FQCL 3VG0L 1YEEH 3L5HA 1SYSA 2V6HA 4EBQL 3ARDA 4G6KH 4M93B 5E2TH 2HA1A 1UA6L 1FBIL 3BDXA 4BSVB 5KSAA 1WAAA 1J12A 5C92A 4JHAL 4PV9A 5DJ8A 4NPYB 1T80A 5I18L 1C5DB 2YPKB 1MRFL 2R1WA 5I6XC 4I3SL 2HG5B 2X4RB 3ARUA 2FD6H 3CK0H 2IBZX 5E08L 2G5RA 1IQWL 4R26H 2FGZA 4HEME 4RMVA 2EXYD 1BZ7B 5E1AB 1ZLVK 2Z93B 3MRGA 5EU6A 2E7HA 1SJVA 4S1QH 1UC6A 5FO8B 5KAQF 2F58H 1JGEB 4KRPB 1I3VA 5E99H 3WEXA 1NUNB 4JFFE 4YBLC 2JLLA 1F4YL 2VZ1A 1OHQA 1BGXH 5IEHA 4HBCH 4N0FB 3KVQA 4OD1H 1R24A 2BJML 1KCKA 3TFKC 3NIGF 2ILLA 4P2QE 5JORA 3WKNA 1N6QH 3OKMB 2VB5A 2BSSA 4HCRA 4UNUA 3O2WL 3B9DA 4YHIA 1LEIA 1KN2H 1QHOA 2PO6D 4KROB 4LLWB 3BKCH 4U1GB 4JFDB 2XOTA 1NKOA 2EXWD 4NQDD 3TNMB 2GAZA 3DBXA 4OCWH 3DRQB 1A2YA 1VADA 1FORL 3UO1H 1UH2A 1ZHNA 1CG9B 4M1DL 5EZJB 1KEGH 5EPMA 1HSAA 3EGSA 2I07B 4IHOA 2YN3A 1ND0A 4Z18A 2DF3A 3CU1A 2XWBB 2NNAA 1ACYL 2GHWB 4JGJA 1MQKH 1IRAY 2ESVD 4ODXA 4WFFE 4ONFL 4APQD 1JE6A 1I7RA 1GRWA 2IPUK 4WW2B 2OS7A 3UBXB 1QSEA 3FQNB 1H5BC 4F7EB 2P8PB 1GZPA 2NXYB 4JQXC 4LLDB 1ZT7A 4LAQH 3GM8A 5DD0L 2OMNA 5IVZA 4ZNEA 4XNMA 3U4EB 1QFPA 2PR4H 1VFAB 4E41E 1WIOA 4MJ5A 1KLUB 5KOMC 5J12B 3LV3A 1I1AB 1NJ9A 3F7QA 1SY6H 4TSCH 2CIIB 1I1CA 1A1OA 3LH2H 5CJOH 4S2SB 1ZEAH 3FL7A 5DZNA 1GHFL 1ORSA 1C8PA 5M95B 1MJ7H 1MY5A 4CUCA 5E5MA 4QHKI 1L7IL 4JRXA 1G9NL 2GTWB 4M7LT 4XCYB 5DK0A 4Y19D 2VKXA 5JXEC 3TVMC 4P2QB 3W81A 4NRYA 3RL1A 4TVPL 1KCSH 2SEBB 5H35B 2ZSVA 3ZT5A 1YMMA 5D93C 5HHXL 1MCBA 4G6JH 1H3UA 2VLMD 3RVUD 3DOSA 4LBEA 5IBLC 5MEPA 4HIEA 1N7ML 3ZZ1A 4Q7DA 3RDTC 5KSVB 2RQ8A 4MA7L 5E8PB 5C7XH 4ELMA 3GSXB 2HTKD 1OOAA 4DFIA 1AP2A 3I2CL 4I4WB 2Y7QB 4ZO9A 5F7KC 3G5ZA 3MUGB 3MZTA 3RY6C 3SPVB 4F58H 2BNRA 4M1CC 3V4UL 5HJ3B 5EUKA 1EEUA 1YQ2A 1JZ2A 1XIWB 4N90E 4HFUH 2MTPA 2AXGA 1MI5A 3MRBA 4JM2F 4O2EB 1Q0XL 4E41B 4J3WA 5E00A 3QAZB 3CFBA 3VFWB 2BNUB 1BFOB 4NKDA 1A1NB 3T1FA 1MNUH 1NC4B 5GGTH 3QIBB 3PDDA 2QQKH 4BSWA 3S5LA 1KYOJ 2VXUH 4TVSa 4NYLB 5HYFA 2W65B 3WNLA 1JRHH 1YYLL 4XXDA 5IOPB 4EDXB 1SJHB 5KZCD 3ROLB 1J1XH 4KGLA 4NUJA 5FHBL 4HC1L 1BJMA 4NHUB 5GS1B 2EDKA 2LU7A 3ARYA 3C6LC 3CZFB 5EO9B 2X4NA 1ITCA 3AY4C 3BP6A 1KPRA 5BXFB 4LLMA 3U36B 2VYRE 3KS0H 3GMMB 2JJTA 3MRFB 4L9LB 4O2FB 5HI4C 5I16A 5JOEA 5J89A 3S35L 1UG9A 3VI3E 1UVQB 4OJFL 5E9DE 2WMPA 3P30L 2VLKD 3P77B 2PTTB 4LGPB 3E8UL 3IU4H 1A64A 4O51A 5CSBA 5MEND 1EK3A 3IDGA 3ESUF 1QNZH 4KMTL 3FOMA 5DO2C 5IMOA 5E8DH 2VISB 1NGYA 5FA4A 4LCWA 3C87A 1SYVB 3FT4A 5TGBB 4M6AA 4AH2A 3D6GA 4EIZC 3PV6B 4MZ2A 4P57A 4OFVA 4WUUA 3CDGA 4W81A 1NMCC 3SE4C 1WAAE 4PJ8D 1E0OB 1IGCH 5E6ID 1NLDL 4DEPB 2PW2B 3WIFA 3CFCL 4Q97A 2XZAH 3WO4C 4WWKB 2QADB 5FO7B 4YHZH 4KJQC 4JDZB 1YY9C 2XG4A 5B38B 2YEZB 2LU4A 1Q9OB 1FL6B 4NN5C 3CXHK 3OX8A 4RGND 2AP2A 3QXDA 5C2BH 4NT6B 2VH5L 3FO0H 3DHMA 3VXPB 1EERB 3BH8A 2V17H 5IEKB 3GNML 1KC5H 2X4OB 3ARVA 1U92A 5J1AA 3QWOB 4UB0H 4Y4HC 5GGUA 2DTML 1JGUL 3TF7C 5D2NA 1P7QA 4MNHA 1ZHBA 4G5ZL 4XBPB 2PCPA 4YBQC 5HSFA 2GJJA 5DRZB 4F57H 2VAJA 5T3XD 4W6WB 3WFZA 3HE6D 1OTTC 4X8JA 5SV4A 4DQOH 3U30B 4LASH 3IT8D 5DR5H 2HN7A 5D2LF 2N56A 3DETD 2XQBH 4G7YH 1OTUD 5ICXB 4XTRC 1A4JB 3REWB 4LP4A 4V2BA 2EZ0C 2D3VA 1S7VA 4LLAA 5E8NA 5LXGL 5CJBA 1KB9K 1GXEA 4XX1E 4LRIC 1DSFL 4PRNB 3G6AA 2MPAL 2R4SH 3MRQB 3ULUC 1S5HA 1EFQA 3NABL 5HYEA 2AEIT 3MXVL 1SYSB 3RWCA 3CFIC 3ARDB 4GG8A 3F5WA 4YHPA 4R2GC 4LIQH 3RL2A 4QRQA 1MCKA 2DTSA 5KSAB 1P4BH 5KSBF 4PV9B 1HHHA 4KTDL 3FB6A 5KBNC 2R1WB 4XC3H 5TPWH 1NGXA 4OF8A 3REVA 5FM4A 3GB7A 4Z7OE 4QXTA 5DD1H 5HDBE 4ZNEE 3MRGB 3LRSA 3C8KA 2IGFH 4LF3A 3RWGA 2EH8H 3TPKA 3MUHL 3WEXB 3S7GA 4ONGL 3U7WL 2AEPL 2CR6A 3V52H 3KPQA 2DJSA 1DBML 2VTFA 5I8OL 3E6HB 4JRXE 3ZHDA 3WJJA 1R24B 3OZ9L 3X17A 4Z7NE 3VCLA 3FRPA 3D0LA 5JORB 3DNKA 4YBHA 2BSSB 4FP8L 4YHIB 3O3DA 1LEIB 1YMME 2XA3A 1EUTA 1MJUL 3FO9A 2R4RH 4LPUA 4LSPH 3CMOL 3VE0A 2AI0L 2EDRA 4YDVA 4KQ3L 1C5BH 3DBXB 4R7DA 1BZ9A 4N0YH 1A2YB 1CXLA 1DQML 1QHPA 1VADB 1WGOA 4Y2DD 3LIZL 5EIQA 1ZHNB 1EBAA 4EN3D 1HSAB 3EGSB 1BMGA 4ELME 1RZJC 3OSKA 1P5VA 2NNAB 2JIXD 4S11A 3MLRL 1AKJD 1MCIA 5ADOH 4ODXB 4KWUA 4OZIF 1I7RB 4Y4FC 1FFRA 4GMSL 1QSEB 4CKVX 4M02A 4GG6F 1ZT7B 1GGIH 5C0AA 4F15B 4XNMB 4OLEA 1C7SA 1BVZA 2DMCA 2VXQH 4K7PY 3ARFD 4MJ5B 5EU7E 4IMKC 1OB1B 1NJ9B 2DS4A 4U1IA 2OM5A 4OT1H 4ODBD 5HYQA 5TE4H 5JPMA 1ADQA 3MC0A 4LCYA 3RFZC 2NY3B 1RAMA 5E5MB 4U1KA 1QSFD 4I77H 4JRXB 3MUJA 2AW2A 4R0LA 5DK0B 1A7BA 5EN2A 4AENA 1AIFA 1RZKH 2J5LB 2D7NA 4NRYB 3U0TA 1NANH 3PNWA 5IQ9A 1NMBH 5F3HA 3RL1B 4QYOA 3C2AH 4YXKL 3P4NB 5DURD 4LOUC 2WWMD 3TYGH 1YMMB 1JPTL 1NC2A 1QFWM 3RX5A 5MI0C 4NUGH 5EH1A 3QO0A 1J8HD 1V8HA 3EYQC 5EOTA 2XYCA 3QG6A 4KUZL 4LBEB 1CXEA 3UBXG 1MHHA 5MEPB 5HTSA 3NFSL 1TJIL 3O0RH 1YUHA 3OKEA 3KYAA 1E4WL 4ELMB 1IC4L 4GBXC 1LHZA 4LCWE 1AP2B 1NGQL 1IC7L 3FZUC 3G5ZB 3T4AB 4JGMA 1YEFH 1VFMA 1J1PL 4PJAA 4WUUE 5DI8A 5EUKB 4FQHA 1JUFA 3TT1L 4NQEE 3EYUL 4JDTL 1FYTA 1NCWL 2AXGB 3MRBB 3RU8H 2LE9A 2J8UE 4PJDF 5TFSL 4HKXA 1NFIB 1BAFH 1CIDA 5E00B 3CFBB 4F7PA 1SM3H 4NKDB 1S5IL 3T1FB 4P99A 4OLYL 4BSWB 2ZKHH 1G7MA 3S5LB 3TNNA 5JHDE 3KYOA 3TZVC 3TBVB 1CFNB 4OZGF 3O9WC 1TETL 4HLJA 1N5YH 1HKLH 3JSSA 2H3NA 2G75A 5LWYH 3QHZH 4P46A 3GBLA 4RX4A 1P9MC 3WIHH 3JV4A 1QLFA 3DARA 1Q0YH 5JW4M 1EHLL 2DQUH 5D2NE 5L6YH 4M6MH 3RKDD 4RA0C 1H3TA 4S1RL 3FFCD 3A6BH 4ENEC 2KUTA 2X4NB 1HIML 1VHPA 4LVNB 4MGXA 3WLBB 1KPRB 3CDFA 4LLMB 4OLZH 5K59E 1X5FA 3BKYL 3FTGA 5I16B 3ARBB 5D71L 5A40E 3QXWA 1U8MA 1T22A 5CBEA 2C1PA 4HK0A 4XPTH 1DP0A 4G8GA 4NZTL 3P0VH 4K9EC 3GJFA 3IDGB 5DRXA 2IALA 3BN3B 1U36A 1MIEH 3B2VL 5IG7A 5IMOB 5FA4B 1NGYB 3ZTNL 1YJDH 4LCWB 3FT4B 2Q8BH 3VFGH 2WM0A 4AH2B 2X1WL 5JOPD 4P57B 4WUUB 1HYRC 3CDGB 1R6VA 4Z7WA 2Q20A 1AR2A 3MJ6A 4F2MB 3BKML 2CKBH 3LY6A 3S88H 2HLFD 5D1QA 5ID0A 1TZGH 2X1PA 4UMGA 1OAUH 4YDLB 1DN0A 4A6YH 1K4CA 4EZMA 1U2CA 3EOBA 5E2UL 5SV3A 1UJ3C 1FC1A 1NAMA 3IS0X 3T2OA 2WINA 4XHJC 3UJTL 2UV3A 2OSLA 5HI5D 3TA3D 3WUWA 3OX8B 3SDAA 4J6RL 3KGRA 4IS6A 4QOKA 1U93A 1U92B 5J1AB 4DVBB 5GGUB 3QWRA 3MGAA 2UWEF 1LO4H 3OPZH 5D2NB 1EPFA 1P7QB 2X89D 1ZHBB 5EO0B 1LO0L 3HUJE 4JPIA 4ZS7H 2XT1B 2WBJD 2ZG3A 4XP5L 5I8KL 2NXZB 3CXDL 3QXUA 1A7OL 3NPSB 3GK8H 2HN7B 1F8TH 1Q1JH 4LHUD 5DVOA 4JFOA 1L0XA 1KIRA 3IDUA 3HG1D 5JXAL 4JAMA 5E8NB 1H8NA 4XVUC 1MF2L 1M05A 1N59A 3V0AC 1R3HB 3MROA 4GXVL 3G6AB 4XXCC 5TQ0H 4OFKA 3CH8A 5JIHA 1ZVYA 1F6LL 4IDJH 1CGWA 1S5HB 2HT3D 4L3ED 4TSBH 2B4CH 3WIIL 4FQXC 2CMRL 2HFGH 3HZYA 3PXHA 3P4MA 3RWCB 4YHPB 2H32H 4GG8B 3U0WH 1UWXH 3RL2B 5B38G 1LEGA 4K3DH 4QRQB 2R0KH 1AXSB 4DZ8A 1G7QA 3PV7A 3ECBA 5BZDA 2IQ9L 2DQJL 5FV2A 3O45A 5GPRA 5JPNA 1HHHB 3FB6B 2MSPA 3GJEB 4UAOB 3G6DH 4WUKH 1FL3A 1NGXB 2BHZA 1AGBB 3H3PH 4U7SA 3REVB 3SGEI 5FDWA 4M7LH 3STLA 3GB7B 5C0AE 4QXTB 5IFAH 3OKDA 4Q6IA 3LRSB 3VXSA 1GGCH 5A2KH 3C8KB 4LF3B 2D03L 4FMFA 3BIKA 4I3RL 4XP1L 3RWGB 5C1MB 2FATL 2AK1H 1AO7E 3UC0H 4JFZH 4M62L 1J0ZA 4Y5XA 1G6RH 2MCPH 3KPQB 4RDQG 1B9ZA 2D9CA 3HUJB 1OARL 1JNLH 4RWYL 4Y88A 3L3GA 5HYJD 1JMZA 4YHML 2DLEA 3VCLB 2XTJC 5CZXC 3QI9A 3MJ8A 1JHKH 5T33H 5L0QC 1EO5A 2LV4A 3O3DB 3QIUD 1WEJL 5FIEA 3FO9B 3TESA 1M6OA 4JPWL 1IC5H 2Q8AH 3VE0B 3WFCH 1LQSR 1F2XK 3D69A 4YDVB 4JN1L 3HHRB 4RFNC 1NGZA 2M2DA 4R7DB 1BZ9B 5ENWA 4HWZB 2VR5A 1D5XB 1U91A 1CIUA 3U82B 4M48H 5C6TL 2HWZH 4ZUUA 2AV1A 3LCYA 1KEML 4QRRA 4QGTA 3N85L 5IVNA 3MCLL 2B1AL 2PN5A 4PJAE 5HD8C 4YXLL 4AMKH 3CSGA 1FYTE 2ZCHH 5GGQL 1OT2A 5C0AB 2B1HL 4KI5F 4MA8H 4HQQL 4UTAH 1RZ8A 3UYPA 4AQ1B 2VZ3A 5DVNA 4OCLC 4LL9A 5DJ0A 4UU9A 1OM3L 3AU1A 2OK0H 1AO7B 5I9QB 4AIXA 2EYSA 1IQDA 1VA9A 3K7UA 5HYQB 5JQ6L 3QJFA 4XP6H 3JVGA 2VXTH 5JPMB 2R9HD 4LCYB 5GS0D 2HFEA 1JBJA 4H1LA 1I7ZA 1G7HB 4K3JH 4U1KB 5CEZD 4YO0A 4XX1G 4P48A 4R0LB 4YUEH 5A2IH 4AENB 1AIFB 4M8QA 4O02H 4PLJC 3V6BR 2DQGL 4Z76A 2XWJB 3PNWB 5B8CC 5IQ9B 1J9CT 5F3HB 4QYOB 4Z8FL 3K2UH 2QQNH 5J6HA 4DW2H 5K9KA 1NC2B 4MQXD 1GAFL 1QVOA 2QSQA 3QO0B 4M6NH 1H9VA 5EBWA 5EOTB 3QG6B 3BAEH 3D3VE 4G8GE 5FM8A 5CJXC 1IGML 2BDNH 5DJCA 4Z7UA 2BZDA 4FQQA 1UCBH 1YUHB 4RGOH 3OKEB 3KLAA 2F5BL 2R2BA 3F7VA 4PRPE 3W0WD 3ZKNC 4AZ8A 3N06B 1DBBL 4PJAB 2FH8A 2M8XA 5E4EB 5DI8B 4GAFB 4Z7WE 4ZUVA 1HHGA 1T03L 4FQHB 4UT6L 3GIVA 1JUFB 3IGAA 1A47A 3VXUE 1FYTB 3TWCH 4P5KA 4HS8H 2B2XL 4Z0BL 1JFQL 2JELH 3GO1H 3MA9L 7CGTA 1JWUA 1IM9A 1T89A 3MLXH 5ECJE 4QKXB 4HKXB 5KN5A 4XC1H 1QA9A 3OMZA 1BF2A 3DXAE 4U49A 1P6AB 4HCRL 2PXYD 3GHBH 1FFPA 3AMLA 1G7MB 3ES6A 4ONHB 3KYOB 4ZPVA 2IJ0C 1FLTX 2G5BA 1CFSA 3FAWA 4Y5VC 5IV2A 4F7MA 2BMKA 2G75B 2VDKH 4L4VA 4P46B 3BDYL 1CXFA 5D1XD 2VDNL 3AGVA 3OTTA 2OLDA 2NY0D 4QOKE 3JV4B 3O11A 1QLFB 4AEIL 2RCSH 3BT2H 1CBVL 1F4AA 2IBGA 3MACL 1BREA 1KGCD 1F11A 1DVFA 4Q74A 5IGXL 3MRLA 3MRPA 5F7EL 4KC3B 4O5LL 4RFEA 5EA0L 1J86A 3C5JA 1D9KD 3FTGB 2FBJL 4F33B 1FGNH 1U8MB 3T0BA 1T22B 5CBEB 4OCMC 4HK0B 3TIDA 3BPCB 4G8GB 1PSKH 4B50A 2W9LA 1AE6H 3PUCA 4JZJC 1NLBH 5IMLA 3AS0A 5HYIA 4AIOA 4MQ7A 4JEGB 1CICA 2IALB 4HEPG 2R39A 2ZUWA 1V7NL 4NZUL 5AWNH 1L9NA 1OGTA 1F4XH 1TJHL 5LGHL 3EBAA 4TSAL 4J3XA 3X11A 4OD2A 4YEFA 1AQDA 1AH1A 3R06A 4QWWC 5EBGA 4Z7WB 1HHKA 3S5LG 1H15A 3MNZA 1RIHL 3VXUB 1WBYB 4R90L 1TQCC 4DZBA 2BY2A 2FECL 3S4SA 3WHXA 4P2RD 1YN6A 3NTCH 3UTSD 4HKZA 1DN0B 5M94B 1K4CB 3EOBB 3DXAB 2CK0H 2DN7A 4BSJA 3TBSA 5LAXB 1NAMB 2GT9B 5T5FL 1V5JA 3IAQA 3D39D 1UM6H 3MUZ1 2HFTA 3WUWB 1DBAL 3SHSA 2X4PA 4U1SA 2DAVA 2NY7L 2YD5A 4WU7B 1DQJB 1DFBL 3SDAB 1U9KA 5TF1L 3ZE0E 3SCMA 4G8EA 4QOKB 1U93B 1K6QL 4MAYD 4NJ9L 3FB8A 3GRWA 4P4KC 1BQUA 4JPIB 3L5IA 2LFGA 3OR6A 4JM2C 2VQ1A 4XI5D 3RTQA 5A1AA 3M17A 4GKSA 4MNQD 2E7LC 2KKQA 2X05A 3IFOA 3GKWL 2WUCH 1ZLUH 3OB0K 4JFOB 1KIRB 5L7XL 3QUXC 4PJGF 1OGAD 3HE7C 4JAMB 2VL5B 2CGRH 1FH5L 1M05B 3BKJL 1N59B 4ZFOA 1UB6A 1ZS8B 3MROB 4GT7A 3LS5H 5ALCL 4KZDH 1WUNT 3QDGD 3BHBB 5D8JH 4PJHF 2VL4A 5E5RB 3HZYB 3P4MB 2BVYA 4QRRE 1BWWA 3UPCA 1FFNA 1LEGB 1YEJL 4QLRA 5TE6H 5GGRY 5I1CL 4R97C 4DZ8B 4D9RE 2F19L 2LU3A 4KUCD 4NKMA 5BZDB 2OTPA 3TT3H 3MOAH 1QFHA 2O5XH 1ITBB 2FX9H 4LGSB 3MV7A 1XGQA 4N1CA 3WXWL 2R2EA 3LKNB 3OF6D 1FL3B 5FDWB 4I0PC 1WCBA 3STLB 4Z5RB 4PYGA 4IRJD 5GRZA 3OKDB 5J3HC 4JREC 1QFWI 3KYMA 1HH6A 2ED8A 5F9WC 3BIKB 4KVNH 4S10A 5FUOL 1OP5H 4WI3A 1A9BB 2F53A 1KCUL 2FJGB 4Y5XB 2W9EH 4NFCA 7FABH 5CJQL 3JWOC 1U6AH 2PNDA 5T3ZD 1NBVL 1CD9B 3T65B 3L3GB 3O4LD 5TQ2L 1M7DA 1KXQE 4QRPD 3VI4F 4Q9QH 1CR9H 3AVEA 2OR7A 1MLCA 1XF2A 3M8OL 1G7IA 3V4VL 2DBLH 3J8F7 2D2OA 3ZE2E 4AT6A 1M6OB 1XMWA 5CMAA 2YN5A 3X3GH 4M93C 1X5XA 3IJHA 4HLZG 5DVLA 3S96A 4TUOB 5ENWB 4Q9RH 1U91B 2J88H 2RB8A 3BD4A 4Z7UE 1JV5A 3Q5OA 4LSVL 1GGBL 1H3PL 2AV1B 4QRRB 1JNNL 3B43A 1A7RH 4NCC2 5DC4B 1C16B 2V9TA 1EHNA 4OZHA 2I5YL 4QTIL 3T4YB 4G6FB 4FQ2H 1OSPH 4C56D 5B3NA 2UVEA 3QEGH 4H8WC 3AS2A 4KZEH 3UZQA 2D0GA 1HEZB 2B8OT 4JVPA 2EKJA 3QFJD 3G5YA 1RZ8B 2P24A 4NGHH 5GRUL 3ULSA 1CGTA 1TJGH 4NM4L 5DJ0B 4UU9B 4PJ5A 1A7PL 3S34L 3FRPG 1A7NH 5E94A 2EYSB 1IQDB 4K07A 3QJFB 5GGVL 5IBTL 5AEAA 3O2DA 3V6ZA 3ET9F 3MRKA 2HFEB 4H1LB 1I7ZB 4I3GA 3JBG7 1RVFH 3GI8H 4YO0B 2DD8H 4KROC 4HXBH 4NZDA 2R2CA 2YA1A 3WE6A 3QHFL 2C3WA 2FEEI 5C86A 4M8QB 1R3JA 3TV3L 2E7BA 4Z76B 3BPNC 1TLKA 4URTB 5J6HB 1EA9C 5ACMA 5K9KB 1R5VA 3RZCC 5EG6C 4XNXL 3TN0D 3A6CH 1QVOB 2FGWL 2AJUH 8CGTA 5EBWB 1FQ9C 2ZPKH 4UDUB 3B5TA 2VXSL 5I71B 4RIRA 4PYHA 2Y07H 4OCYL 3TO4C 4Z7UB 4C55A 3B9KD 3KLAB 2R2BB 1KENL 1MFEH 5GGSY 1T66C 5I73C 4LVHB 1EAJA 1AD0A 4RSVA 3UYRL 1QFWL 2R2HA 1KF9B 4LKXA 3S8WA 5FUZH 1UM5L 4ZUVB 2DQTH 1HHGB 3W9EA 5J12C 2VLRD 4WFGD 5CJ5A 2AJZA 3IGAB 1J0KA 3QPXH 4P5KB 2DI7A 4JY5H 4IRSB 1LEKA 5KN5B 1JWUB 1IM9B 2PO6A 4FQCH 3RVTC 3VG0H 3UTZA 5DGQA 4EBQH 1QA9B 1YA5A 2V2XB 2Y23A 3GMRA 3PJSA 5IVOA 4NQDA 1FBIH 1FFPB 4AYFA 4TNWF 4ZUSA 5AG9A 3EHBD 3ES6B 1NH6A 4JHAH 2G5BB 1KB5B 4OLUH 4F7MB 2BMKB 4D0CA 4I3SH 4L4VB 1WFOA 2WSKA 1FJ1B 2DB8A 5E08H 1G1YA 1IQWH 3O11B 3QQNA 4XBGA 4U2YA 4X9IA 2FWOA 5DSCA 3VFPA 2ESVA 5EDXA 4APQA 3C60B 5D96B 1A3RL 1F11B 1DVFB 1X44A 4FQLH 4XVSH 3MRLB 3MRPB 2ED7A 1ZGLA 3MFFA 4YHLH 1EJ6A 4RFEB 5CS7A 2ZG1A 1JCKA 4I48A 1F4YH 3C5JB 3O8XD 4LDLB 4KDTA 2OZ4H 1MCWM 3TIDB 2D0HA 2EDJA 4P4RA 3L1OL 1SJEA 1KPUA 2BJMH 1YEDB 2BVPA 3OJMB 5IMLB 4X6DE 4PJIA 4MQ7B 4PREB 1CICB 3RBGA 4ELKA 4NJAH 3PWNA 4N1EA 4D9QE 1OGTB 2KL6A 3O2WH 5MP6H 2RAMA 3MRHA 3GBMH 4DGYL 1FNAA 3NIDE 3QUYD 4NKQB 2AERT 4Q2ZA 4OD2B 4PG9A 1J10A 2NY6B 4Y4KD 3NCYS 4XP9L 1AQDB 3QAZC 4Y19A 5JW4N 1ADQL 1EUUA 1MIML 1JYVA 1HHKB 3NH7H 4TQEL 4D0BB 1P2CA 3MNZB 4ONOA 1BFVH 5DUML 1MCPL 4XPFL 3S4SB 3WHXB 1YN6B 4M1DH 3RY5A 3E0GA 4OFIA 1CL7I 1YC7A 1ACYH 3TBSB 5GZNC 1FGVL 3U48A 3I6LE 1NDMA 3QIWC 4ONFH 3ZL4L 1KJMA 3LSOB 3UTQA 5HHMD 1I85A 4U1SB 3IDYC 1JVKA 3S37L 2K7QA 2MQ3A 4G8EB 5FUCC 4NNYA 5DMYA 2RIKA 1KOAA 3CLFL 4KK9D 5B39G 3LEVL 2EEDA 3QG7H 3BOVA 4J4PC 2CUHA 1CE1L 4L8SC 4I8DA 3OR6B 3ULVE 3KWWA 1ZA6A 3VU2A 2VQ1B 3RTQB 4HIXH 3HB3D 4GKSB 1GHFH 3IF1A 3IFOB 1KJ3L 3UXFA 1L7IH 4OF0A 3BIAX 4GAJL 4X6DB 3W82A 1CD8A 4JM4L 1GJIA 2QQQA 3ABZA 1UB6B 4ZFOB 5ICYB 3CX2A 2RFXB 4O00A 2A73A 4X6FA 4TVPH 2P5WD 4DEPC 1T83A 4PJXF 4HGKC 2FR4A 4N68A 4OV5B 4CBPA 1FFNB 5EWIL 5E56A 4NKMB 4NP4L 3SKOA 1NMAL 3WUWG 1VB9A 2EDWA 1D5ZB 1JF5A 1N7MH 3WHE0 4MA7H 4K7FA 3MV7B 1XGQB 1A21A 3S37X 2R2EB 3TFKD 4HUVA 1WCBB 2VLKA 4NQSB 3TBTB 1JZ5A 2E7MA 4NQXA 3MXWL 1HH6B 4IJ3B 3V4UH 3I50H 2ARJB 3NCBB 5I66A 3DJ9A 3SGKC 4FFYH 4PJ5E 2NW3A 2EIEA 2F53B 2WUBL 4V2CB 3U30C 3MR9B 4M1GL 1OSZA 3OAYK 4YHOL 4OGXL 3X12B 3GSNA 1JYNA 1J1OL 4WEBL 2CLRB 1MCSA 4PJ8A 5E6IA 1OW0A 3QULA 1M7DB 4YFDB 4UDTB 5SX4H 5JDSA 4O4YL 1FZJA 1M7IB 1MFAL 5JW5A 1GC1C 1MLCB 1XF2B 4JFED 3MV8D 3SO3B 5FHBH 4JFFD 5CMAB 3L5WA 2XIDA 1S7UB 4X7EC 4DN4H 3IJHB 4HWEL 2BC4B 1YNTB 3S96B 5HHQA 1NAML 3DMMA 1CU4L 4UT9H 4M6OL 4ZFZA 1F3JA 3S35H 1UT9A 3OL2A 4GXUN 3P30H 5I1GL 3UPAA 5D5MF 4P2QD 5FO9A 1A6TA 4Y5YC 3C2SA 3FQTA 3E8UH 3VRLE 3Q2CA 3SBWA 3VFMA 3HE6A 1T7VA 1UACL 3H9SD 1CFVH 4KMTH 1UWGL 1HCFX 2P43B 2UY7A 3TVMD 5LJYH 5CIPA 3CGTA 4HMDA 1IKNA 4KK8C 4NFDA 5F7YC 4BH7B 4GRWE 3NMEA 3ARPA 4GLRH 2H6PA 3G5YB 1I1FA 4PJ9C 2I24N 2P24B 3ULSB 3V7MA 5IW6B 4NQDE 5IMMA 4PJ5B 2V5TA 3T8XA 1NLDH 3SGDI 4XWOC 3RJQB 4K94L 5IBLD 5IT2L 4WFFD 1EV2E 3A67H 3V6ZB 1L9MA 3I3DA 3MRKB 4QF1A 1OAYL 4HGWA 1PY9A 1V05A 1E4KA 4LSQL 5C0BD 1LMKA 5JW4R 2LAGB 3WE6B 1JIBA 2VITA 5EOCL 1X5YA 1MLBB 1EAPA 2VH5H 3VDAA 4M1CD 3MODL 4E41D 3ZKXC 4M7ZB 5KW9L 1U41A 3GNMH 1HZHL 1JGUH 1R5VB 2GY5A 4YZFF 3HNVL 4WJ5A 1P7KA 1P4LB 4G5ZH 5CUSL 6FABH 3STBA 2IBZY 3DIFB 3RVWC 2Y06L 4XAKD 4OZFA 4NM8L 5DHYB 2DRUA 5HBBA 1INEL 3UCRA 1AD0B 1MFCL 5LXGH 2H9GA 3MRCA 2UYLA 1MCRA 1C08A 4NHCL 2R2HB 4LKXB 4Y19E 1NDGB 1DSFH 4X9HA 2MPAH 1GVIA 4HFWB 5BCAA 3CVHA 4J3UA 5E8OA 3NABH 4GRWB 1LEKB 2A9ML 1I7UA 3MXVH 4H1LG 3PJSB 3GMRB 4KKNA 4OB5L 3X3FL 5HI4D 4NQDB 3HMXA 2VLME 1QBBA 1NUDA 1OP9A 5FGRA 4Y2DA 5AZ2L 2CXGA 2HH0L 2J5LC 4EN3A 4DCQA 5I1EH 4D0CB 1Z3GL 2F5AH 1UGNA 3FJTA 4NQUA 2DQCL 2EYTA 2JIXA 4DN3L 3NCCB 4XBGB 3KPLB 1AKJA 3VFPB 5DSCB 1N8ZB 2ESVB 4APQB 3IFPA 3DGCR 3V2AR 1ERNA 3NZHL 4KKCD 4AL8L 5F93C 4NQTA 4ONGH 3U7WH 1WCQA 1ZGLB 3MFFB 4KI5C 4I48B 1ZHLA 3NIFE 3FFDA 1DBMH 5I8OH 3ARFA 4J23A 4P4RB 4ESKA 5F44A 1SJEB 5AYUL 4MYWB 4PJ7F 5SX5K 5T1KD 3OZ9H 4KJQD 2BVPB 4AM0A 5F7LB 4UIKL 4EI5C 4ELKB 3P73A 2K9UA 3EUUA 4FP8H 1CDYA 1PLGL 4Q2ZB 1MJUH 1BQSA 4PG9B 4HPOH 3CMOH 1WQVT 3CLEL 4Y19B 1SVZA 2KH2B 4KQ3H 5C09E 1P2CB 3LKQA 4GMTL 1DQMH 4YBQD 3LIZH 4HS6B 5DWUL 5E9DD 4Y8DC 1WISA 4YFEA 4CADB 2UZXB 3MRMA 1OTTD 5DFVC 3H3KA 4QHUA 4XPAH 5C08A 3MLRH 1J8HA 1HWHB 2FJFA 1IT9L 3OKNA 4PJBF 1NDMB 1U8NA 1KJMB 4LSUL 1XGUB 1XF1A 3UP1A 1NBZA 3UTQB 3VFNB 2VWEE 5MENE 2J3SA 4Z77A 1I8KB 5BVPL 3U7YL 1BOGA 3D9AL 1E6OH 2IBBA 4NNYB 4RRPA 3ULUD 1FVDB 5DHVH 4NCC1 1N0XL 8FABA 3IVKB 3LVEA 3KWWB 1ZA6B 3RWDA 3K2MC 1OT1A 1ZXQA 4LPXA 1G84A 1IVLA 2AQ2A 3HC3L 4KY1H 4LFHD 1KCRL 4XMPL 4LPWA 1IEAA 3D5OF 5B4MC 3QEHA 4RGNE 2ICWA 1REIA 3ISWA 4V1DE 3S4SG 4X6FB 5CP3H 5KTEL 1ONQA 3Q5TA 4YXKH 3NA9L 1WFNA 5KZCB 1JPTH 1CDUA 4YDLC 3A6OA 3QQ4A 2FR4B 1KB5L 3MCKA 5C0DA 3FFCA 4KUZH 5C09B 3ALXA 3UROR 2YPLD 5T3XE 3RUGF 3NFSH 1LK2A 4HUKB 3AFLA 4E0RA 1E4WH 4K7FB 1IC4H 4H8WH 4AIZA 4HUVB 2WQRA 1NGQH 2G60L 4DAGL 2VLKB 5GRVL 4RMQA 4JCLA 4EQ2A 4NQXB 1J1PH 3EO9L 1VKXA 5MENB 3VMOA 1BVKA 4DKEL 5GJTL 5IVXE 3TT1H 5D72L 3EYUH 4JDTH 1NCWH 2NW3B 1KELL 4UOW0 1CGSL 4UQ2A 4HS3A 2CLVA 4GUPA 4OZHF 3P4LA 1OSZB 2XG5A 3D87B 3GSNB 1S5IH 3IDJB 1GOGA 3MGOA 3LN5A 4OLYH 2ICEA 4PJ8B 3SE3A 1KCLA 5E6IB 3MCG1 1ZWIB 4LVOC 2YRLA 5JDSB 1XF5A 5D7JA 4Y4FD 5CGYC 1B3JA 5JW5B 3DX8A 4OD3L 2IG2L 1JYXA 3LPGA 1K8DB 1EHLH 4OM0L 1F58L 3L5WB 3SKJH 1RZ7L 2YOCA 3TA3A 4S1RH 4RGNB 1P6FA 5L2JB 5C0FA 1CGYA 4PJFF 4MAUL 3U4BL 1MCJA 3GMQA 1HHJB 2CLZA 1HIMH 1I8MA 2NY3D 5F9JA 4CVUA 2XXMB 3N9GL 3BKYH 5ANMA 2JB5L 3GDBA 4ZFZB 3CSPA 1F3JB 3IS1X 3MOBL 1K8IA 2HRLA 2X89A 1UB5A 1CWVA 4HT1L 5FO9B 1A6TB 4PP2A 3FQTB 3QEQA 2HRPH 1RV6X 4NZTH 4NQVB 3SO5A 2WBJA 3HE6B 3WBDA 1WK0A 4K8RC 3SGJA 3GRWL 3HN3A 3BEWA 2MCG1 1IC1A 5IHUH 2ZOLA 1YYML 2OBGA 5CIPB 3ZTNH 2H45A 4LHUA 4Z95H 3HG1A 3LQAC 4M8VA 4LOUD 4POZC 2H6PB 4HULB 3Q3GA 4UBDD 1U8OA 5IW3A 5CJ8A 3T8XB 3WJJC 3EYQD 4WY7L 4ZD3L 1LNUA 4XH2B 5C0NC 4L3EA 4ZFOL 5E2UH 4QF1B 2DM3A 4IIQA 4HGWB 3G6JA 4GBXD 1CXKA 1D6VH 5HVGB 1UQSA 3FZUD 4DTGL 2XA8L 2VITB 4HF5L 1BVLA 4F9LA 4J6RH 3K81A 3LDBB 3EJZC 2OYPA 1PBYA 1UZ6F 3WFBL 4BM7A 4CMHC 3L7EA 4HH9A 4WJ5B 1P7KB 4PLNC 1FDLL 2MKLC 4S1DC 4L8BA 5I74B 4XP5H 5I8KH 4L4TD 43CAA 4G7VL 3CXDH 3KHQA 1S9VA 1A7OH 4OZFB 3NCEB 3TZVD 3O9WD 5JZ7C 4O9HL 3AMKA 3O41A 2IADA 3FCTA 4OCNC 2KQNA 5JXAH 1QSFE 2H9GB 3MRCB 2UYLB 4FHBD 2EDTA 1SBSL 5HYJA 1MF2H 1N2RA 1FSKB 1ED3A 4GXVH 1IL1A 4R96A 4YQXL 3WS3A 3ARBD 3I6GA 5DT1L 4JHWH 5E8OB 5F9AC 3ULVL 4ODTH 5C8JA 4BFBD 3QIUA 1XEDA 2ERJB 4JPKH 1I7UB 1E4XI 4PJIF 3BUYA 4WW1A 4PR5A 2FL5A 3GMOB 5I17A 4YHYC 4YWGL 4TOYH 2FIKA 4HK3N 2Z8SA 1J8HE 1K5NA 4UILL 3QRFM 2A1WL 4R0LC 2IQ9H 1AGCA 2DQJH 4Y2DB 3W39A 1H0DB 4EN3B 4HHAA 1JPSL 4DCQB 3MFGB 5DF0A 1IAOA 5ESVA 2EDHA 2YRZA 2EYTB 2JIXB 2B20A 2ZG2A 2F74A 4PRID 5HPMB 4NQED 1HH9A 4MMZC 4U1JB 3IFPB 2D03H 4I3RH 4ZSOA 4XP1H 5J0BA 2FATH 1B4JL 3F6IA 3HR5A 5EIVA 1CDIA 1QEWA 3KDMA 4M62H 5EBLA 1ZHLB 5BMFH 5JHDD 3FFDB 3BISA 4RWYH 1OARH 1GL4B 2WP3O 3ARFB 1WV7T 5FCUH 1HNGA 2AEWA 2MKWA 4GRMA 3LB6C 3GSRA 5INDA 2R0LL 4FABL 5CGMA 2GSGA 4AM0B 4GW5A 2VDOL 1AJ7L 2V5RA 4XHJD 3OGCA 2P7TA 3P73B 1SEBA 2ZCKL 3HI5L 1BHGA 5F6IB 1R3IL 1HWGB 1A5FH 3JWDL 1AD9A 1WEJH 1QSFB 3DURB 3HLAA 35C8H 3GJFK 3QCVH 1PGRB 1U3JA 4JN1H 1W0WA 3FFCE 3C5ZB 3LKQB 3UTPD 4PRAA 4TNWK 3N1PC 5EZOL 1EGJH 5DURB 4KKLC 5C6TH 5F7DA 5IQ7L 4HMCA 3MRMB 3CVIL 3O3BB 4FZ8H 1KEMH 3VGGA 5ICZA 4M3KB 1TZIA 1J8HB 3N85H 3MCLH 2FJFB 3PP4L 4ZOCA 4M7KL 5F1KC 2B1AH 1U8NB 2F8VA 3AREA 3I84A 5LCVL 1NBZB 3QDJD 1QLEL 1UJTA 1EO7A 1ZANL 4PP1C 4XVUD 1BOGB 1DE4B 5GGQH 5HXMA 2B1HH 3QXTA 3W0WA 2B5IB 2D9QB 4FQXD 5HDQL 1N6VA 4GRLD 1DZBA 2EC8A 1OM3H 8FABB 1BD2E 5C2UB 5FGBC 3RWDB 2ADFL 2IEPA 4I13B 5DMIH 3T0EA 5JQ6H 1EDQA 4U1LA 3T0DA 4AJ0A 1R5IA 2NYYC 1GC1H 4YC2C 4BK4A 2A6DA 2PXYA 1X5IA 4MA3A 1FL5B 3QNZA 2YSSA 5GJSH 1IEAB 1DEEA 2DMBA 2ICCA 2NTFA 4ZUTA 2DQGH 3QEHB 2ICWB 1RZIB 1DEDA 4QTHA 3VXRE 4OFYD 4Y89A 3KLSA 2VXVL 4Z8FH 3WV0A 2A6JA 5D1XA 5D1QC 5DEFB 5ANME 3MLTA 4QXWA 1GAFH 3QQ4B 1I4FA 3MCKB 2Y5EA 2DL2A 3CX5K 5C0DB 1I8LC 3FFCB 5AZEL 4LQFL 3CCHA 4YGVB 4NN6B 3K8KA 1MUJB 1LK2B 3FN0L 4LCCC 3HPLA 4TNVK 4E0RB 1RUAH 2F5BH 1D9KA 3AAZA 5DD6A 3P40A 2XTJD 4AIZB 1VFOA 5SWQA 2AGJL 4DGIL 4K3GA 2BVTA 4I18A 5IJKA 5ALBH 1VKXB 4KRMB 1BVKB 4OQ1A 4MD4B 4PUBH 3D48R 4R9HA 4TUKH 4UQ2B 5FFLA 4Z0BH 1JFQH 2CLVB 4HS3B 3MA9H 4L3EE 3VWKD 4XGZA 4WFHE 1S78C 4YLQT 1X3DA 1YY8A 4TUJA 2AKRA 4HCRH 3MGOB 1BD2B 3LN5B 2ICEB 4BZ1L 1OQXA 3DVFA 2FJHA 3SDXA 1OPGL 4K94C 4DUVA 2AJYL 4GAGL 12E8H 3UTSA 1XF5B 4H5SA 1K3ZA 1PG7L 1WBXA 2IANE 3WS6C 5HGGS 3ZDXE 3BDYH 2FLBT 5EFIA 1F4HA 5HD8D 3SDCA 2VDNH 3P11H 5A16A 3DX8B 1PD6A 4PLKC 3F7YA 4AEIH 3R4DA 32C2A 2OL3A 2C3GA 1CBVH 1AO7D 2Q7YA 3D39A 1IAII 3MACH 3EOTH 3TA3B 3ARXA 1G7JB 5C0FB 5IGXH 3O4OB 2CLZB 1LILA 4OCRL 1I8MB 2EE2A 5F9JB 5JUEH 5F7EH 5A2FA 1WWAX 4O5LH 1ULVA 2OJEA 2VABA 5EA0H 5ANMB 2QJDA 3VMPA 2O93L 2WIMA 4MAYA 1QTYT 1K8IB 2ADJA 3DGGA 4P5TC 5A3ID 4IBLT 1G0XA 3BUTA 5CBAA 4Q6IC 2WBJB 4KVCH 1CDJA 4YNYA 3ELAT 4MNQA 3BEWB 5EZLA 4NZUH 4H0IA 4PLJD 2ZOLB 1TJHH 3K4ZA 4LHUB 5LGHH 4TSAH 3HG1B 1OGAA 5B3JF 3ARZA 3Q3GB 1U8OB 2X2YA 4ODWA 3ZLQC 1RIHH 5IWLA 3QDGA 1AC0A 4PD4K 2W59A 4R90H 1LNUB 1BBJA 1PG7X 4L3EB 3QI9C 5BRZA 2DKSA 1ZLWH 3WFEL 4IIQB 2FYYB 3G6JB 4QEGA 1JNJA 4OI9A 5DRWA 1UQSB 3EZJB 2NY7H 2W0KA 3VXQA 1T1WA 4U6XA 1CGUA 5TF1H 4KJYB 3OF6A 2RHEA 1K6QH 4IRJA 3HRZA 2CDGA 4HH9B 4MA1B 1B88A 1W8OA 4RNRA 3RPIA 3RKPA 1CTNA 1W0VB 4HC1A 4DK3A 4L8BB 2KQMA 43CAB 1H3GA 4HSQA 3K0WA 4P3DA 1S9VB 1G0DA 3GKWH 1CDHA 3AB0B 15C8H 1MAML 5L7XH 4FOMA 1Q38A 3BXNA 3O41B 3UPRA 2IADB 3FCTB 4OM1H 5CEZE 1INDL 1ZTXL 1FH5H 5HYJB 1TNNA 3L3IA 1N2RB 3O4LA 2VDRH 1ED3B 4R96B 1IL1B 2XV6B 4LDEB 2M26A 3GSNL 3IDNA 1CZ8L 4QRPA 5ALCH 3WS3B 3I6GB 4I9WE 3D3VD 3QIUB 1NCBL 3FMGL 1IGYA 3BUYB 3JVGC 4WW1B 3L3JA 3LN4A 1GGUA 5I17B 1YEJH 1BJ1J 2FIKB 1SQ2N 5DYOA 4NZJA 1J0HA 1K5NB 5FF6A 2F19H 1DQDL 4W4OC 4NBXB 1AGCB 1CVRA 3FQXA 4PRPD 4AG4L 3H8NA 4G6MH 4CVWA 3HC0A 4HHAB 1T0NA 2VZUA 3L3KA 1X6NA 3WXWH 1IAOB 1T21A 5ESVB 5ITBL 5I1JL 3ME0A 4L9DA 4NZRH 3VXUD 3W0WE 3WUZA 3B9VA 3O6KL 4PRHD 4X7FC 4QT5A 4FFVC 4C56A 5J7CC 4HX1B 1NCAH 4QWWD 1G1CA 5FUOH 3HR5B 1QKZL 3DXAD 5T3XL 4OZFG 1QEWB 4LPTA 3KDMB 1KCUH 4NC2B 5EBLB 2YPVH 3U4AA 2PYFB 3QFJA 1KTKE 1O7SA 5C0CE 4Z7VA 2H8PB 4I2XE 1HOCA 4Z0XA 5ELIA 5INDB 3GSRB 2GSGB 5TQ2H 3PGDA 4X9GA 3OGCB 2P7TB 5SWSE 1A6ZA 4Z78A 3QO1A 2ZNWA 3W11D 3M8OH 3V4VH 1AD9B 5TJWK 3HLAB 1T89C 5JW3H 3S6CA 4PFEA 4OI7A 3QDHA 5LBSL 3C6SA 1U42A 3PABA 1MAJA 2K3TA 1CD1A 2W0FA 1W0WB 5IJVA 1KGCE 4P4KD 4PRAB 1E6JH 4J3OC 2DIJA 5I1HL 4LSVH 3WNMA 1GGBH 5F7DB 5DJAB 1PDKA 5KVGH 1H3PH 2PETA 2L7UA 1JNNH 3NA4A 5ICZB 1T4KA 2FNBA 1NCNA 4JR9H 1TZIB 1RHFA 2VZTA 3B8SA 3BMWA 1CLCA 1PFCA 3H2WA 4RA3A 3ZE1F 2EO1A 3E3QE 1RURL 1L6XA 2R29L 3QUXD 2E8YA 2I5YH 3HE7D 4QTIH 3EZ8A 3O3EA 3KR3L 3H7BA 4GFTB 2MOVA 3B9KA 4X5XA 3MV01 3W0WB 2B7DT 4OSUL 1MCQA 1DBKL 1J11A 5GRUH 4MS8C 4D9LL 5BV7B 2IMMA 4D3CL 2VLRA 2X40A 4ZTOL 1A7PH 3EFDH 3S34H 2X70A 2H1PL 2L4OA 3MJGX 4G3YL 4P2RE 5GGVH 3UTSE 4U1LB 4JQVA 1DCLA 3OKKB 1RUPL 3MNVB 3BIBX 1PX4A 3VD5A 2A6DB 2PXYB 4I0PD 3QNZB 2YSSB 3QHFH 1QRNE 3D39E 3D25A 1DEEB 3TV3H 4ZUTB 1W72A 4QTHB 3BJLA 5TDPB 3UZEA 3HMXL 2A6JB 5ESAA 5D1XB 4HLZH 1HINL 4HXAL 2NY0B 3ARWA 1FNEA 3MLTB 4DWHA 1I4FB 2FGWH 4NIKB 4JFQB 4WHYH 4KKAC 5A43C 4OCYH 3CCHB 5BQ7A 3BPLB 2APWA 3HPLB 1EJOL 1D9KB 1KENH 3AAZB 3B2UC 3O8XA 4MNQE 2JK5A 3HI6L 4RRPG 3BFOA 3BD5A 5SWQB 3SCMC 1FIGL 4Q0XH 4KMQA 2CRIA 4U6TA 3UYRH 2NMSA 3UTTD 3EOAA 1JNHA 4I18B 4KJPC 5GS2H 1UM5H 3THML 4HKJA 4OKVB 1XAUA 2D7TH 1HILA 1WSST 3RTQC 1Q9KA 3QUYA 3Q48A 4XGZB 4Y4KA 1YY8B 4TUJB 4LLVB 1DQTA 4MJID 2AKRB 3P9WB 2YBRA 1IM3A 1JZ6A 3Q5YA 5EBMA 2NTSP 1QBML 4P2RB 4KDVA 3UTSB 4G9DA 4H5SB 2R8SH 1WBXB 2BK8A 5EFIB 4XCNA 4YDKL 3L5JA 1G6VK 5A16B 4WIQA 4LMQI 3O6LL 4BFGA 2ADGA 3F7YB 3KYKL 3MMEB 3K4DA 2OL3B 4CDHA 2Q7YB 1F00I 3D39B 1T1XA 1I7TA 3G6JF 4J7RA 3MA7A 4Q58C 5INCA 5DC9B 2OJEB 2VABB 1ZGLP 3MQIA 3WNOA 2BNQE 2F54D 1RHHA 5E6YA 2P44B 4NFBA 4BSVA 3GZKA 4MAYB 2NY5L 2PUQT 4YDIH 4XNZB 1DANT 3L1OH 5T3ZE 5CBAB 4LIQE 2HG5A 2RGSA 5C0IA 3F7PC 5HY9A 4IJ3C 4ZQKA 5FCSH 4YNYB 2VERN 5C70A 3KPPA 5KVMC 3RGVC 4MNQB 1BZ7A 4QRPE 5F21B 5EZLB 2Z93A 4P9ML 4GSDL 5FO8A 1OGAB 4LAJH 4OQTA 4XP9H 3SQBA 1ADQH 1MIMH 3QCTL 4TQEH 4ODWB 1K85A 3ARGC 1MCPH 1PZ5A 4ODHH 4XPFH 2KZWA 2P5WA 1BBJB 2UZIL 2JJWA 3TO4D 4BUGA 1KYOK 1ES0A 2FX8L 3P2TA 4S0SD 4CN1A 1T66D 3D0VA 3ZL4H 3SO3C 1NKRA 2HVJA 3EYOA 2DI9A 3ZDYF 2E8ZA 3DLQR 4IRSD 1T1WB 4D94A 5GRXG 2UY6A 4U6XB 1RUML 4LLWA 4C56E 4EUPA 4ZUWB 3S37H 5HHPA 2B39A 2BOBA 4RBPH 3CLFH 3I02B 4IRJB 5DUPL 2CDGB 3LEVH 4NN7B 3MSPA 2Z8WC 4Z7VE 2HKHL 3RVTD 3CX5J 1CG9A 2YC1A 4RNRB 2J6EL 3RPIB 1CE1H 3PF2A 2MWCA 3AS3A 1EZVX 4GKZA 4JG0L 4NO5A 4LHUG 2GK2A 3C60D 1JPST 4WW2A 1KJ3H 2O61A 3HFML 2AJXL 3BXNB 3UPRB 5FB8A 1OTSD 2BSTA 4F7EA 1RUKL 2JB6B 4GAJH 3V7AE 4JM4H 3LQZA 5IFHL 3DO3A 3IDNB 4QRPB 1T3FA 3VG9C 1VFAA 1A9EA 3B8YA 4JFEA 2YR3A 3RHWF 3NACL 1I1AA 1IGYB 2P46B 4M9PA 4XBEL 3LN4B 4JFFA 1GCFA 4S2SA 5I2IA 5EWIH 5F3BA 5DYOB 5I75C 5FF6B 4NP4H 4LNRA 4ORGA 4FXKA 3SE9L 5DJDA 3FQXB 4BYHA 4BQCA 1WZ1L 5D7SL 1HYSC 3HC0B 2YXMA 1T0NB 3L3KB 2GW5A 5HVHB 1T21B 3VD7A 4M7ZC 2XZCL 4P2QA 1HI6A 2EXYC 3MLYL 2SEBA 4QT5B 3LHPL 1CYGA 4C56B 5D1ZC 1VGEL 4HIJA 2VLRE 4WFGE 3TVMA 1FAIL 4M1GH 4B7IA 3S98A 1U8IA 4YHOH 4OGXH 4Z7VB 4HUXA 1J1OH 1BPVA 1HOCB 4ODUB 4WEBH 2YMXL 2XNAA 4A2LA 5GZND 1P69B 4H20L 5ADPL 2XFXA 3LN9A 3RRQA 3QIWD 3PGDB 2Y7QA 4O4YH 3WO3B 1G0YR 1MFAH 3BESR 1A6ZB 1WLHA 4Z78B 1TQBB 4X80L 2PO6C 1XIWA 2IFFL 5C0BA 3T3PE 4G42A 3C6SB 4O2EA 3PABB 1FPTL 4HWEH 1AR1C 2W0FB 4AEFA 2EXWC 3C09C 5IJVB 4J4PD 1NAMH 3DECA 4PD4J 2DQIL 4E41A 4OCXL 3NFPA 3VFWA 1CU4H 4NWUH 4ZMAT 5F1SA 1A1NA 4FG6C 2AV7A 3WDIA 3TN0B 3QYCA 1T4KB 1MCOL 1JI1A 2W65A 2X41A 4DUXA 5HHVL 1UACH 4EDXA 3O3EB 3H7BB 1UWGH 4J12A 4X5XB 1IGIL 1U8QB 3OXRA 3WCYA 5GS1A 5E2VL 4HW6A 3F65A 3KAAA 2C1OB 3Q6GL 3U36A 3B4NA 1RZFL 1AI1L 4L9LA 4MCYA 2VLRB 5IHLB 4JKKA 1LP9A 2X70B 4P9HL 5E2TL 4XVTL 3KJ4B 4K94H 1IFHH 5IT2H 3HNSH 3OKOA 3I6LD 2EYRA 3AY4A 1RK1B 3VD4A 1OAYH 3HNTH 4ZAKD 1PJ9A 4LSQH 5FHAL 1VFUA 1NBYA 3RIFF 5GGVY 3D25B 2P8MB 5EOCH 3ZDZF 3WYRA 5HHME 4MXVE 1W72B 3MODH 3KNBA 5KW9H 5ESAB 2A74B 3QSKB 3GUTB 3SDXF 1HZHH 1FNEB 5JO5A 5SWZD 3UJJH 3HNVH 5FYKD 5FV1L 1I9IL 3TLRA 1MFNA 1JP5A 5CUSH 1OQOA 4NRXA 2PW2A 2C26A 5DHXB 5T1MA 4LSTL 5DD3L 1Z5LA 4B7LA 3SE4A 5ISZD 5BQ7B 5FO7A 2Y06H 1HCVA 1I85C 1CCZA 4NM8H 5F7MC 3O8XB 5EZIH 1FL6A 1FYHB 2X9YA 3ALPA 3DTXA 4PRBB 1JRHI 1MFCH 3L3OB 4BK5A 1N6QL 2YRPA 2W1NA 4NHCH 3EFFB 1T7YA 5HHOD 3EOAB 1JNHB 5DVMA 5T1KA 5IEKA 2JF1A 4DGVL 5J06A 4GS7B 1KN2L 1ZVSA 4HKJB 1A3LL 2P5WE 1Q9KB 1Z2KA 2A9MH 5DRZA 4E9LA 3OJ2C 3QFDB 1CDCA 4Y4KB 4OB5H 3LKSA 3UO1L 3VDCA 2YBRB 1IM3B 5GS0L 4MD0A 5K9QI 5CEZL 1VCAA 1C7TA 3LKOB 5EBMB 1X4ZA 5E9DA 5AZ2H 5EC2A 5ICXA 1A4JA 5EU6D 4G9DB 3DVGA 4KV5F 3GBNL 4X7SL 1Q9WA 1Z3GH 4XCNB 4HUWA 3V0WL 4LLYA 2R0WL 2DQCH 4GW4A 1T83C 2AQ1A 2ADGB 4DN3H 4K7PL 5JDJA 4G6AC 4N5UA 1GGYA 4ZPTB 1CFTA 4LAQL 3VWJC 1T1XB 5HHMB 1GPOL 1I7TB 2LTQB 3NZHH 4PJ9D 3MA7B 3TBYA 3NFNA 5INCB 1C5CH 2RR3A 3WSQL 3TO2A 4XWOD 1SY6L 1RHHB 2K1MA 5DQDL 4XB8A 4NNPH 2XQYK 2R56L 3BRGC 5C0IB 4NSKA 5HY9B 1FRGL 4ZQKB 3H0TB 2IH1A 4W6YB 3KPPB 3BWAA 4BQ6A 1QZ1A 5BV7L 4IM8A 1INQA 1WC7A 1PLGH 2C4FU 1I8IB 1UWXK 4JFEE 2HJLB 3MV8E 2BP3A 1XGYH 3CLEH 5FKPB 1U3YA 4H1LH 4GMTH 4LKCA 2DDQL 1PZ5B 3RIAF 5DWUH 5L8KB 2P5WB 2ZUSA 3IXAA 4QNPF 2FLRT 4YGAB 3E6HA 4YBLB 1LE5A 3RVWD 5ID1A 2VSCA 1ES0B 2QV2A 3DV4A 5E2JA 1AXTL 1IT9H 4M9OA 4C54A 5KVFL 3D0VB 4JANA 4Y16D 2ENYA 2HVJB 3EYOB 4LSUH 4PGCB 1IBGH 1MCEA 4F58L 1P4IL 3H9SE 3PWLA 4DUWA 4EUPB 3KS0J 5HHPB 3DMMC 3D9AH 2BOBB 4LEOA 2HMIC 1BEYL 3IAGC 5IHZB 1HHIA 1TVBA 1TVDA 2AAVA 2B4CC 2OTWA 1N0XH 2YC1B 4OTXL 1T0MB 2R23A 4IEFB 3JWNC 4GKZB 3DVNA 1MNUL 4RMSA 5GGRB 4NO5B 2QQKL 2WBWB 5EUOA 3RNKA 2VXUL 4MB3A 1MJ8L 2O61B 5FB8B 2BSTB 5KS9E 1KCRH 5C0BE 4XMPH 1PX3A 1A6AA 3LQZB 1T3FB 5KTEH 4M43L 1XR8A 3NA9H 2H2PC 1A9EB 4P2OD 4PJEA 4M3JA 3FRUA 4JFEB 1OB1A 3MV8B 3O6FC 1A8JH 3OGOE 4KI5D 2CO7B 4JJ5B 4JFFB 1P1ZA 5I2IB 5F3BB 3QQ3A 5AG8A 4AEHL 4LNRB 2VUOA 3ALWA 4ORGB 4ETQA 4FXKB 1TMCB 5DJDB 3BX7C 2OL3L 5JIKA 2BNRD 1DANU 4XAKE 5EB9A 3VD9A 1SHMA 4EI5D 2G60H 3LDBC 4DAGH 1HI6B 1BZQK 1MI5D 2HT2C 3EO9H 3P4NA 3BPOB 3H9SB 3O3UN 9CGTA 4DKEH 5GJTH 3BVNA 4FMKA 1YN7A 5D72H 4HIJB 1KELH 1CGSH 2JCCA 1LP9E 3TVMB 1KG0A 3FB5A 4LP5A 4YDJA 1U8IB 4ZTPL 3BGFC 3RI5K 5D93B 1NCCH 4HUXB 3JV5A 5DFVD 1AGEA 1G9ML 4U0QB 2XNAB 2XZAL 1RY7B 3EDEA 3WXVL 2XFXB 2BSED 3ZKMD 3ROOA 4PV8B 3T4AA 2EDEA 3P3YA 3UYOD 3RDTB 4XZUB 5F88A 1JWMA 1I3RB 5C2BL 3L5XL 3DUHA 2IG2H 4OD3H 1F90L 5KS9B 1GGTA 5JHLL 4GBXA 5C0BB 1X9QA 4OM0H 4JHZA 4G42B 1UKQA 1F58H 1RZ7H 3CFJA 5C0JB 2ATKA 4MAUH 3QDMD 1NFIA 3ESVF 3NFPB 4Y2DC 1FV1A 4X5WA 3UEZA 1DR9A 2E9BA 3N9GH 3IAPA 1Q9LA 2AV7B 1EFXD 2JB5H 4EN3C 3OAZH 3MOBH 3V9FA 4U1NA 3TBVA 1CFNA 4HT1H 5DMKA 5TH2A 1K3IA 4UV4L 3E2HB 3QNXA 3TJHD 2XQBL 4G7YL 4L4TA 3QEUB 2OI9C 3R1GL 4XB7A 1YEHL 1NCDL 2DOCA 3GRWH 2EDDA 3TZVA 3KPNA 1VEOA 2X09A 1YYMH 5B4MD 3OXRB 3IRZA 1NANI 1JL8A 5C09D 5IF0A 1W2KT 4M61A 3WLBA 1N5AA 3IDIB 4MCYB 3ARBA 1LP9B 4WY7H 4Z7QF 5T3ZL 4ZD3H 2VDQH 3IDMA 3C6LB 1HN1A 3OKOB 5BS0D 1P4BL 2EYRB 3BSZH 2NY2C 5C0RL 4X6CE 3V7AG 4L1DA 2KPNA 1NBYB 4YX2L 1XF3A 2XA8H 3GSWA 4K23H 5GGSB 1PW3A 3B3IA 4HF5H 3KNBB 4GQ9L 4F9PC 1JZ3A 1HE7A 4P3CL 2C7UA 2P49B 2JKXA 5LVEA 2WWMC 1UXSA 1NQBA 4PRIA 5JO5B 4F2MA 3ULUE 4NKOA 4NQEA 5I1DA 1NAKL 1T7ZA 4DK6A 5ACZA 3TCLA 3VA2C 1I9EA 2CUMA 1O5DT 1FDLH 3AUVA 1IEHA 2P45B 2J8UA 4NRXB 4N9GB 5T1MB 4G7VH 1Z5LB 5AAWA 5F72S 3KPMB 1LO2H 5JHDA 1U58B 2H2SC 3VA6A 3CFEA 4O9HH 5FYJD 3DTXB 3BYYA 4V1DD 4ZS6D 3WO4B 3VD3A 1SBSH 5T1KB 4YQXH 1ZVSB 4IMLA 4DVBA 2EDQA 4LSPL 4NN5B 3S35X 5DT1H 4UUJA 3SOBL 4PTUA 3ULVH 3N1MC 1BP3B 2C3VB 5C0EA 5EO0A 3TM6A 1T1YB 2F15A 1A6WL 4F37K 3LKSB 4Y4HB 4YWGH 3BZ4A 4DVRH 1RU9H 4LCIL 2A1WH 1L0QA 2QR0A 4MD0B 4O2CB 2YPLE 5E9DB 3S3JA 5EC2B 1JPSH 3DVGB 4UV7L 2Z31C 1Q9WB 4HUWB 4LLYB 1KN4L 1Y0LA 4H88L 4K8RD 3ZO0A 3D2UD 1VFBA 4H25B 4GW4B 4X6CB 4CRPA 1R3HA 1CFTB 4FZEH 1GGIL 4CW1A 4JCMA 4Y0GA 4BH8B 4WTZA 4POZD 4MDIA 1B4JH 1JHTA 5FOJA 2XICA 3TBYB 3NFNB 3M45A 2VXQL 5EU4A 4XXCA 4MXWL 3TO2B 2DLTA 1QO3A 3EJYD 1ZLUK 1AXSA 5EUOE 2V9RA 5C0ND 4RFOL 1YPZA 4FQXA 4GRLA 3GJEA 1QR4A 2NCMA 4FABH 2R0LH 3KPSD 4NSKB 1AGBA 1MFDH 2VDOH 1AJ7H 4I77L 2IH1B 1N64L 3BWAB 4ZYKA 3DUUB 3P0YL 3HI5H 2ZCKH 4X4ME 1R3IH 4WGVB 1RZKL 4PJEE 1INQB 1WC7B 1OP3H 3O2DH 4PY8J 3TYGL 4PJCA 4WW2F 4U6YB 4NUGL 1OLZA 4OFYA 3FAXA 4LKCB 2WBKA 1DUYA 5EZOH 4EKXA 2FO4A 4S1DD 3IXAB 5D7IE 2HLFC 4YEEA 3HUJA 5IQ7H 3CVIH 4FQJL 5D7JC 4PTTA 5F8RC 1LE5B 1KTDA 1W72L 2HTLC 5ID1B 3BI9X 3LS4H 3MTRA 1FZOA 2OXGA 5L9DL 3DV4B 1KT2A 3PP4H 5GSVB 5JZ7D 5LQBL 4M7KH 5E6ZA 1WIPA 4JANB 1OL0A 2YPLB 5LCVH 1OP5K 1FCCA 1WZMA 1T04A 4OLVL 3TA3C 1ZANH 5T5NG 3PWLB 2BFVH 3VJ6B 1RJLB 4X8XA 2JCCE 4LEOB 4WENB 5H37G 4X4XB 1MHPL 4HWZA 1HHIB 1D5XA 1R3KA 1TVBB 2OTWB 3MLUL 5FYLD 2R23B 1PZUB 3P0GB 3TPUA 1BAFL 2LQRA 5KJRL 2ADFH 3DVNB 3NGBB 1D5MA 5EUOB 3VWKA 3WNPA 3RNKB 4LCUA 2P5ED 3GI9L 3I9GL 4KJWC 4GRWH 3HI1B 4OLWL 1KLGA 1IARB 3RAJL 1A6AB 3WIHL 5KVDL 4B53A 2VXVH 4FFWD 4Y4FB 1XT5A 1NFDE 5ABDE 5L6YL 2X1OA 1XR8B 2XWTA 1HSBB 4PJEB 5DMGC 1U8JA 3FRUB 3QR2A 1QPPA 2HT3C 2HLAB 1AO7A 2PKDA 4ZG1A 3S9DB 1P1ZB 4EOWH 2XN9D 4MHHI 3QQ3B 3SDDC 4ETQB 3SDYL 5GISH 2OXHA 2FBOJ 4L4TE 3PG2A 5D7IB 2QSTA 4HJ0C 1G7HA 4EUPG 4CMMA 2VNCA 2G9HA 2QKIA 4F9LC 4TTDC 3FO1A 4DGIH 3C5ZD 2XWJA 3MLWL 2BSRB 3O3AA 4MD5A 1YJDL 4E42B 4QHLB 2XQYG 1XF4A 1PKOA 2COQA 3BVNB 4ACPA 1YN7B 2JCCB 2VZOA 1UH3A 1KG0B 3FB5B 1MVUB 3V0VA 1FNLA 4P2CG 5B8CA 2Y1VA 4YDJB 3B5GA 4KKLD 3TJEL 4U1HA 1TZGL 3BEVA 2IMNA 1M1SA 1AGEB 2IAMC 5MI0B 1R0AL 4OQTL 2AJYH 4GAGH 2HP4A 3UDWA 5CJXA 1PG7H 3ROOB 1DLFL 3F7RA 5F88B 1JWMB 4KPHH 2OJZL 3OG6B 4HJJL 1J7VR 3JTSA 4KTYA 4U3CA 1U3HC 3K46A 4GBXB 4PRIE 3RHWK 4UOJA 1PEWA 1F02I 3CFJB 1S7WB 2MQ0A 1NCTA 2KZ1B 4XWGL 5E70A 1OD7A 2ATKB 2G2RA 1F6FB 1HXMA 4OCRH 3C08L 1FV1B 4X5WB 1Q9LB 2BVOB 1WZKA 4MHHG 4ONHA 4U1NB 4K55A 5DMKB 5TH2B 3GK8L 3QNXB 2DQEL 5DFWH 2HT4C 3VGFA 2X4TA 4L4TB 5DQJA 4DKFL 5D7KD 3TZVB 3KPNB 1IAKB 4RCAA 3O9WB 4UTBL 4NO2A 5GRJL 5IF0B 1T5XA 2IPUG 3FB7A 1AHWA 1R3LA 4M61B 2DLHA 5J11B 1N5AB 1YZZA 4TSBL 1J05A 1DJSA 3D18A 4XCFL 4CDGC 2P4AB 4X5LA 2DWDB 4F33A 4L29B 1NSNH 3UTPE 4AEEA 4U3XA 3U6RB 5B39A 3BRDA 3IDMB 3BPCA 1A22B 3D3VA 4R3SB 3T3ME 3U83A 2FRGP 5JIPA 4MCZA 4Z6AT 1B4RA 1BIIA 4M5YL 4B5EA 3MLZH 2O5YL 2YZ1A 5JTWA 1XF3B 4PRPA 3GSWB 1KTRL 3B3IB 4WO4C 2UUDH 3QDJE 1D7FA 2ID5A 2C7UB 4LVEA 3VI3F 3GSQA 2A0LC 5T1LD 1UXSB 1TTGA 1BD2D 4PRIB 4MQXC 4RDQF 3VXUA 4NKOB 4NQEB 1WBYA 5I1DB 5ACZB 4LEXL 4PRHA 3TCLB 1Y18A 1YPZE 3IU3B 1S78D 2J8UB 4XMKL 1HXYA 1NUFA 4OKDA 3AREC 3DXAA 3G04A 3QUZC 5LAXA 1BF8A 2GT9A 1XCQA 5JHDB 1MAMH 3CFEB 1XFPA 3VXRD 4WU7A 1DQJA 3LEYL 3HZVA 1CS6A 5T33L 3BQUC 4PLKD 4JG1H 1W0YT 2A77L 1EO8L 5ACLA 1WAAF 1WBZA 3GSNH 4PJCE 1CZ8H 4IMLB 3VH8B 1X7QA 4UUJB 3WFCL 4PTUB 3U9UB 3GSVA 1FFOA 5KOVC 3T0EC 4QGYA 5C0EB 1NCBH 3FMGH 4EI6A 5DC0A 5J8OA 2BXYA 4M48L 2JE8A 3BZ4B 2PYED 2X4QB 4Q9CA 5IMKA 4P5TD 5LG1A 1DQDH 2QR0B 3C8DA 4AG4H 3PIQA 2BOCA 4WWID 3RIFK 5D7LD 3VFUA 5HYSB 1G9EA 3VXSD 4ZFGL 2VL5A 5H2BA 5IFJB 1Y0LB 2XTJE 4JY4A 5BOPA 1VFBB 5I1JH 1EHXA 1QD0A 1NGPL 5HHNB 1ZS8A 3C9NA 4XCEA 2PF6A 5F9DC 1QFUL 3BHBA 4CW1B 4EEEA 3QUXA 4K3HA 1I3UA 3HE7A 3QDJB 3VXOA 1EH9A 1MPAL 2E3VA 2ENSA 1JHTB 4MDIB 4WFHD 5DTFA 1QKZH 1Q94B 5T3XH 5EU4B 3BPLC 4TVPE 1QO3B 2DLIA 2OK0L 1D9KC 2J2ZA 4X7CC 5D6DA 1YPZB 4FQXB 4GRLB 5CIPH 2IAND 4LSRL 3LKNA 1KCVL 1S7TA 4I18C 4K3JL 5IJKC 4Z5RA 1FZMA 4XAWL 4ZYKB 3UAJC 3H6JA 4JKWA 2YD2A 2W07A 3IB4A 2Z4QA 2NZ9C 1H3XA 4EDWL 3CZJA 5DK3A 4I0PA 4OBRA 5LBSH 1A9BA 4PJCB 3QISA 2Z9TA 1YQVH 4GXUM 3MREA 5B22A 2FJGA 4NDMA 3V6OA 4M6NL 1DUYB 2FO4B 1HQ4B 1MWAB 2GJ6D 3TYFA 5I1HH 4Z7OF 3GEWB 4PTTB 1BQLH 3T65A 1KTDB 1U8HB 5HDBF 3SDCC 5JOFB 5HI3C 4K71C 1FZOB 1JPGA 1CFQB 2Z35A 1KT2B 4MWFA 2CXKA 1RURH 2R29H 4GO6B 1OWRM 4KXZH 1T04B 3KR3H 4UINL 1G9NC 1NL0L 5JIIA 4FTVE 1MVFA 3SQOL 4WDIA 4XRCA 3WLWC 4YFLF 4O58L 2D4FA 2XTJB 3ZYIA 4OSUH 4TUOA 5L0QB 1XR9A 4OZFH 2XY2A 4PGEA 1R3KB 3UTTA 2ICWJ 3IETA 3U46A 2NW2A 1IZJA 1R5WB 4D9LH 4XNZC 4Z7NF 2AJSL 4XC1L 4ZTOH 3TPUB 2H1PH 4OAWA 4YK4C 4BJLA 5I1LB 4RFNB 3SKUD 4XI5C 2CRZA 4G3YH 5JNYB 5F6HI 1D5MB 2Q7NA 3VWKB 5GSRA 4LCUB 1C16A 1I1RA 1RUPH 3CVHH 3T4YA 5DK2B 4LFHG 4MJIA 2VDKL 5IB3A 1EBPA 3C5SA 3OJDA 2C3HA 1KLGB 2QSCH 1N3NA 2QQLL 3OG4B 5I76B 3S36L 5FM5M 1HEZA 3BZFA 2EDBA 4HV8A 3HMXH 3VFVA 2X9XA 3NIGE 3WN5C 2XWTB 2WNGA 4FFVD 1HINH 1U8JB 4HXAH 5D2LA 3RIAK 4ELMF 3BGMA 3GFUA 3G5XA 1KLFA 4QXGL 3CH1A 1AY1L 4L3AA 2QEJA 4CMMB 1EJOH 4OF7A 3EOYG 1EEQA 2G9HB 5HGDA 5BO1L 1G7PA 2QKIB 5I15L 3W9DA 4XMLL 3RVXD 2DQDL 1FIGH 2LVCA 2NY1C 1UXWA 3FO1B 4IRJC 3O3AB 1SEQL 1F4XL 4MD5B 3ULUL 3NPZB 4I9WD 1TNMA 2GK0B 4KQ4L 1XF4B 4C4KT 3THMH 5KSBA 2I9LA 2I60L 4FTVB 1X5AA 4JB9H 3V0VB 2GKIA 4GQPH 3MBED 1KFAL 1WVZA 2YD7A 4MSWB 5DLML 5B8CB 4UDUA 5KVEH 2BHYA 5JLZA 2NY4C 4U1HB 3NTCL 3BEVB 5TE7L 1JF6A 3DUSA 3V5KB 1MCCA 4FQIL 2EEBA 1CQYA 2EIBA 5HGHA 4QRSA 2Y6SD 3TO4A 4ERSL 4KHTH 4YDKH 3C8HA 2ADIA 3O6LH 4HAFA 3KYKH 3JTSB 2FHCA 3CU7A 4PRHE 5F6HJ 4PY7A 4IRSA 2G2RB 1HXMB 5C0CD 3W2DL 4KTEH 2V2XA 1RULL 1JGVL 3HPJB 2MMXA 3H9HA 1YEKL 3UMTA 2V7NA 1MEXL 1Z0MA 2NY5H 1J8KA 4WCYH 3QUKA 1I1YA 1T2QL 1KB5A 4Y8AA 5SWSD 2X4TB 1FJ1A 1MREL 5DQJB 4CU7A 1BWMA 4KFZC 4ZDHA 1UZ8B 2J8UF 4Y5VB 3QWQB 4GSDH 5KSUA 3C60A 2ZP0T 3H9ZA 4NO2B 1SJXA 3T2NL 3LS5L 2YXFA 4QRUA 1T5XB 5D8JL 3CUPA 3FB7B 1AHWB 1R3LB 5F96H 1B0GA 2BVQB 1J05B 2I26N 2XRAH 3D18B 3QCTH 4OZIA 1TXKA 4NQCD 5L88L 3STZA 4OF5A 1MH5B 4GG6A 1RZJL 4KKAD 5B39B 1UEMA 2N7AA 2UZIH 4KAQL 3D3VB 1QR1B 3MOAL 5F7WC 4PRDA 1YEDA 4QXUL 2FX8H 3RBSA 2VLLA 3B2UD 3T08A 2Z91A 1TQBC 2X44D 4H0HB 3GMNA 4MCZB 4PREA 1BIIB 1NEZG 4CN6A 3SCMD 4PRPB 3L9RA 4KK6C 1RUMH 4KJPD 5K59F 5CILL 1RK0A 5L2KE 5DUPH 2EO9A 3GSQB 1D5IL 4D0BA 4NC1C 4RAUA 2VAAA 2I27N 4PRHB 1Y18B 4IDLA 4WFED 1JF1A 1HXYB 5I8EB 1RJZA 7FABL 1EHAA 1U6AL 2CRMA 2R0ZL 3G04B 4QCIA 3ILQC 2Z8VC 1TQCB 3B9KC 1XCQB 1LE9B 1QRND 3LSOA 1MCDA 2AJXH 3HFMH 4XNQA 2AVGA 3ARRA 3HZVB 3BZEB 2LABA 3EDKA 5FKAA 1WBZB 3QIWA 2DYPD 1X7QB 2EE9A 3DPBA 3V6OE 1A0QH 3GSVB 1FFOB 3IRPX 4EI6B 2WIIA 3NACH 4OF6A 4Q9RL 4XBEH 5J13B 5H8DA 5EORH 5DJYA 4R8WL 5C9KA 2QHRH 5IMKB 2AS5M 1FN4A 3SE9H 4J4PA 4P4KB 3PIQB 4JRWA 2BOCB 1A7RL 1EEYA 3BP7A 3VFUB 1WZ1H 5D7SH 4L8SA 4ZXBC 2NX5D 3MLSL 5H2BB 3QXVA 3RGVD 4X6DA 2XZCH 4JY4B 1IEBB 1OSPL 5ICYA 3KJ6L 3C9NB 4XCEB 1CQKA 2RFXA 4KZEL 3HUJF 3MLYH 3QUXB 3UTTE 2GFBA 3HE7B 4WV1C 2D7QA 3VXOB 3LHPH 1VGEH 1ZT1A 4P23D 1FNFA 5DTFB 2Q76A 25C8L 4NGHL 4OV5A 2CJUH 1FAIH 3GMLA 3ARGD 4NOBA 1FP5A 1OAKL 4FNLL 2DIBA 1A7NL 3VRJA 1D5ZA 4F3FA 3MO1A 3MBXL 3EYSL 3TH2T 4MJIE 2YMXH 2IPTL 5CCKL 2R69L 1S7TB 4GS7C 4R97B 3VH8G 1ZKAA 1LK3H 4HGMA 4HXBL 4NQSA 1FZMB 4IRZL 3TBTA 3GMPB 1AFVL 5I30L 3V5DA 2Z4QB 2EDNA 2ARJA 4ZAKA 1YEIL 2P42B 5D2LE 4X80H 2J4WH 3QUYC 2IFFH 2WWKT 4HPYL 3WJLA 1GH7A 4I0PB 4JY6B 1WICA 1QQDB 5DS8A 1FNGB 5J57B 1FPTH 4YPGB 3TIEA 4JREB 2BNQD 4JKPL 3Q6FA 4TRPL 3MR9A 1F97A 3MREB 4NDMB 2DQIH 5F9WB 5HYSG 2AXHA 4OCXH 3X12A 3RVVC 3SGKA 3TYFB 3L6FA 2EE6A 1ZSDA 2ORBH 2ZPKL 4MNGE 3QXAA 2CLRA 3IJSA 2F54E 5EO1A 4K9EL 1JPGB 4N8CL 2Z35B 4UDTA 1MCOH 3O6ML 4JRYD 4WEMB 1KJ2A 4MWFB 2MNUA 1PYWA 3N50A 3ARQA 1FG9C 1LDPL 1M7IA 3PDOA 4LDOB 1TCRB 5IROC 4WTZG 1F3DH 1II4E 5KSBE 1RIVH 5C0GA 2LTQC 4WDIB 4XRCB 4B41A 4BELD 3T2QA 1S7UA 3MV11 5E2VH 2BC4A 1KBGL 1YNTA 4UIMA 1XR9B 4KK9C 2XKNA 4PGEB 5HHOA 3UTTB 3QRGL 3Q6GH 4JY5L 3IETB 3U46B 2NW2B 3CFDA 1AGFA 1RZFH 1AI1H 2HYMA 4OAWB 4P9HH 5F9OH 3GIZL 4XVTH 4HIHA 2APVA 3HB3C 4Y1AD 2QHLA 5GSRB 3QP3A 1HYSD 2LVEA 2Y36L 2UWEA 2FX7L 5FDYA 4UQ3B 4N8VA 3HTLX 4MJIB 4OLUL 5GIRA 5IB3B 5FHAH 2BVEA 3C5SB 3OJDB 1N3NB 2W60A 4KRPC 4BZ2L 4Y5YA 4BH7A 3R0NA 1Z0NA 3BZFB 4YJZL 4HV8B 4I5BA 3VFVB 1ZA3A 5J1TC 5D1ZD 4KK5C 5D2LB 3BGMB