5AUQA

Crystal structure of atpase-type hypb in the nucleotide free state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
245
structure length
232
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLRKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
publication title Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb
source organism Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Hydrolase
total genus 71
structure length 232
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5auqA01
3KJGA 1RJ9B 3TUZC 2ZRJA 3MJHA 1Q0UA 3D8BA 1FP7A 2WJYA 4PHHA 4KFSA 4O3MA 2J0VA 2XNSA 3PUWA 2BHRA 1SZPA 1RIFA 1KJYA 1XFAA 4HLCA 1X1RA 3KFXA 2IYWA 4MDFA 3QEOA 3THYB 1IN5A 4GOJA 2ZRNA 3VHLB 2Q0HA 2ZSEA 4LJAA 1WB9A 2WWFA 3QF4A 1P2TA 3GMTA 1Q1QA 1VPLA 1T8UA 1DBSA 4PAOA 4Q1EA 4LOAA 1ZVQA 2ZRGA 1TF5A 3W6PA 5BYKA 2DBYA 2VF8A 4OK5A 3OESA 1H8HA 1TQ4A 2XTNA 2ZVPX 2C2HA 4OK3A 5AUNB 2OT3B 4O25A 2W6ID 3D6TB 4ASUD 1UKEA 1YRAA 1N5LA 2W83A 2HUPA 1OHHA 3W6NA 1U8AA 3MJRA 3AB3A 4N3NA 2QN6A 4OHXA 2EFGA 2EFHB 3KKNA 3BK7A 1R0ZA 4PX9A 4URWR 3TK1A 4LJYA 2Q3HA 3Q7PA 1FPMA 4HB3A 2NO0A 4PHGA 2C9YA 1CJTC 3WXMA 5BN3A 4HAWA 1XTRA 1P2VA 1X86B 2CJWB 4C7OB 1OIWA 1XMVA 3BB1A 1LTQA 1ZCAA 1Q3HA 4D4KA 1Z0AA 3OE7D 1SHZA 1NP6A 2CLDX 1E2PA 2OESA 5EZ6B 1P62B 2BKEA 4L16A 4YXWD 4C0HA 2RKOA 3ND8A 2GESA 2W00A 1TQDA 5EP3A 1TU4A 4BFUA 1SXJC 5A5GA 1Z08A 4D4MA 4LYFA 1XX6A 1W5SA 1QBKC 2QM8A 2UVQA 1Z0KA 2VP5A 2OFXA 2Z4RA 5FPKA 3B9PA 3GFOA 3SJBA 4C0JA 2J7KA 3CIOA 1WP9A 3RS7A 1Y3AA 1HYQA 4ZDKA 5AJYA 1GL7A 1ZNWA 4JVMA 1IN7A 4OHVA 1OKKA 1JR3D 4QM7A 2QMUA 3UXMA 4LX0A 1YZLA 4EPVA 3GJXC 1IJEA 3SBDA 4A2PA 1SVMA 1SVLA 4DHEA 4GL2A 1GIAA 4TMVA 3AF3A 3QBVA 4PC2A 4W5WA 4HAVA 3AKCA 3GJ3A 1W47A 2FFAA 4M9QA 5J47A 2R2AA 1E0JA 3D31A 4P32A 3BBPA 1GNQA 5EUQB 2FEOA 1D2MA 1FMJA 1JXMA 5K8TA 2IXGA 2IWHA 4Q1AA 1WA5A 3U6BA 3GLFA 3L8ZA 3QQ5A 2LKCA 4NYIR 2WOOA 2H1LA 4ZIRB 2IYSA 3LBIA 2UZIR 3RAPR 1N6HA 2G1JA 4B43A 4TLBA 3L2OB 4OJQA 3IO3A 2IYUA 3A1TA 3VR5A 2JA1A 1OXSC 4V0MA 3RHFA 5TVKA 4M53A 4AI6A 3DZDA 1SHKA 4IHQA 4PC3A 4A36A 4TYPA 3AVOA 4OQFA 1NN0A 2CL7X 1D9ZA 1S9HA 2OCAA 1W2HA 4A0GA 3A4NA 3EA0A 1X8LA 3X1XA 1S1CA 2RGGA 4NHOA 2JJ8A 2F1HA 3C4JA 3EPKA 3BS4A 3I5XA 1XBTA 4BEBA 1LFDB 2IYQA 2W58A 1SXJD 3NBXX 2QAGC 1N6OA 5TXGA 1QHNA 2PMDA 1OF1A 2WV9A 1CJMA 4FXPA 4IXMA 1F48A 3EIQA 3I92A 1LF0A 1NN5A 2VA8A 2VSOA 3MWJA 4K46A 3TGPA 2NZJA 4JJZA 2XSZD 1KDPA 1KTVA 3H0KA 4CF7A 3CWZA 3T5DA 4JJKA 1U8ZA 1L8QA 2VP4A 1KO1A 1KI1A 3C5CA 1NBME 3B8HA 2WJHA 1TUIA 4JIMA 2R44A 1IONA 4K8OA 3CNOA 1YU9A 1GSIA 2YWFA 1Z3IX 3FVQA 2ZI3A 1I4TD 2A5JA 1JEEA 4O2RA 3SFVA 4AYXA 5KSYA 1JALA 3PEWA 4IVPA 2JLRA 4GSYA 3B78A 1G8PA 1Z6AA 3L0IB 821PA 3TLXA 1E2IA 2Q9AA 3UIEA 3IILA 4ZO4A 4G5RA 1XD9A 4Q18A 4J0QA 3W90A 2FSIA 1T3SA 3IPYA 5DSZA 3P4XA 4I1UA 5CITA 3ZVMA 4ACBA 4BFZA 5JCPA 3OIWA 2QRNA 4A0FA 4RD1A 2P6NA 5JEDA 4FW9A 2XZLA 3DVLA 1OXTA 1D9XA 2J59A 4FWTA 1YZGA 3JZAA 3W6OA 4E09A 2WTUA 1YKSA 2ZYWX 3AVWA 1II9A 4N1AA 4ZI2A 1KKLA 4EQ6B 4LJ4A 2QT1A 3EWSA 5G3ZA 3R8CA 2OILA 3KQKA 2CVFA 3TR5A 2WJVA 3QPVA 4KFUA 1UDWA 3NTUA 4HUQA 3ZIAD 1QG4A 3K70B 2PLRA 3REGA 3CO5A 4PPGA 1HT2E 4DB2A 1AGPA 1DE0A 2EFEB 1IN4A 3C15C 4ZDJA 5DH9A 4BECA 4XTRA 2G3YA 3SJCA 2ORVA 1MABB 1XEWY 3UWOA 2QPTA 3A36A 1EGAA 1YZQA 1CLUA 2CVHA 3KJIA 3A37A 3R7WB 2H5EA 2ZR9A 1P7CA 5DI9A 4GI7A 1NKSA 1LF5A 1HURA 2GZHA 4TZ0A 3SI7A 1ZC4A 3GPLA 3AF1A 4Q47A 4D2IA 2BEJA 2X2FA 3BERA 4TTQA 4W7SA 3RRNA 2FPLA 4CT4B 3KB1A 3TAHA 2ZSAA 2EQBA 2JATA 2C98A 4BZPA 1A1VA 4PXAA 2HT6A 4Q1BA 1JB1A 3GD7A 1GKUB 3WMFA 2IS1A 3B1WA 3W3AA 2IYVA 1P75A 3EWAA 4U5XA 2C99A 4M9SA 5EXTA 3MUFA 4HYYA 4TZ6A 3KB2A 1GVNB 1NIJA 4MKIA 3I8SA 1NVXQ 4Q9HA 4Y0VA 1IN6A 4P4SB 4DZZA 4D0NA 3ETLA 1IXSB 2XXAB 1F3OA 2QGZA 3QXJA 4C9BA 4YMUA 3AF0A 1E99A 1E9SA 2XB4A 2P6RA 4OQXA 2RGCA 2ZITA 3CW2A 1TF2A 3EZ6A 4HZUB 4HB2A 3GLHB 4TYNA 1GWNA 1QZXA 2PMKA 1S3SA 3I73A 1W7AA 2YWGA 2Q3FA 1CJVC 3BIFA 1RRPA 4C0QC 4QBFA 3SJAA 4WVFA 3U6KA 1XEWX 2XZOA 4JZKA 3Q5DA 4KAXA 1AZTA 4A9AA 1II8B 1V43A 2BV3A 1Y63A 2V1XA 4X8OA 4B3BA 1KOFA 1QHIA 2DFKB 4NE2A 4TYWA 2JCSA 2YJTD 3U3OA 1IBRA 2IYLD 3ZD6A 2X8AA 2NQ2C 2ATVA 3KQUA 1XXHB 4CEHB 1KSFX 3RSLA 3AUXA 3KUDA 3D7MA 3I8XA 4BZXA 1IOZA 2GF9A 5F9HA 5JEEA 4FMDB 1US8B 3REFA 1NSFA 2O5VA 4PZLA 3G0HA 1XJ0A 1BKDR 1Z5ZA 5J4LA 1GM5A 2BDTA 2ZRKA 2FFHA 2QTFA 3QJYA 3C16C 2OXCA 3LBHA 3X1ZA 2BM1A 2WPDA 4CGZA 2Q9CA 3VR4A 1N5IA 3QF4B 1NBMD 4O2LA 3U7HB 3GCGA 3U7GA 3W8RA 1NNEA 2YKGA 1FNNA 2ZRBA 4MGZR 3KXIA 5FI1B 5IF9A 1SULA 3FMOB 4Q9KA 5EE5B 4A2WA 3KKPA 3THXA 2FGJA 2GCOA 4I99A 3SHWA 2R6DA 5DN6D 3QIAA 5FUWA 3MLEA 3QUSA 4B3XA 1SVKA 4U02A 4BQSA 4HSEA 1KO7A 3VR1A 5M04A 4PHTA 3TVTA 1NBMA 4QBGB 3VKGA 3H4MA 1ETUA 3R9IA 1D8TA 3A4LA 2PL3A 4IKEA 2DB3A 2VRWA 2B8WA 4JLDA 3WYGA 1NMZA 2IYYA 4B34A 1E9AA 3EW9A 2DFNA 4OQLA 1AA9A 2YC4C 5K8LA 1Z83A 1H8ED 3KJHA 1W46A 4Q21A 4EUNA 3ICEA 1COWA 2QQEA 4TLDA 5F9FA 3LFUA 1YR8A 4HZIA 5CDFA 4Q1DA 2FFBA 2A5GA 5EZ5A 3SE0A 4L5BA 1ZD1A 3T35A 5EXSA 4XWOA 1YE8A 3IHWA 1NL3A 3H1TA 1OFIA 3DL0A 3CKLA 1X1SA 3EPJA 5IHPA 3DO6A 3WHKA 4A6XA 4EPTA 3U61B 2A2ZA 3SBEA 1IY2A 3RS3A 4QNRA 4RCZA 4V0LA 1I4DD 2C95A 5F2EA 4LHZA 3QKRA 3LXRA 2ZREA 5H68A 2VHUA 3KFVA 421PA 4Q4JB 2WWWA 2D3WA 5L3RA 4UKDA 2WWHA 2P5SA 4JSYA 1M6NA 1P4SA 3ICQB 4M21A 1N6NA 3MAAC 1D2EA 1LB1B 2EVWX 1T3LA 3MD0A 3OEHD 2JLSA 1NY6A 4KCGA 5FTJA 3SC3A 4Z54A 5B57C 3PJRA 1DTSA 3GLGE 2XNDD 2C8VA 1ZC3A 3DMNA 3N2EA 2OFWA 2ZI6A 4G5GA 4JLKA 3SOPA 2BBWA 3GLFB 4JBYA 5FH9A 4LCBA 2CCKA 2YNMA 1X6VA 3RWMB 3ECCA 2H17A 2IA5A 2G88A 1NMYA 3Q85A 1PUIA 4MH0R 4A1FA 3QOFA 4TSFD 5KOYA 1C1YA 2FSHA 4PC6A 4TMXA 5AUPB 3LQRA 4LDJA 4BRWA 2AR7A 4DLSA 3EPHA 4QKQA 2CK3D 4ZV4A 4ZCMA 2QSYA 5GVSA 2VHQA 4EKDA 2LKDA 2PEYA 2C9OA 4UQOA 1W4RA 2W6JD 3L8YA 4AYTA 1OW3B 4RZUA 1AM4D 4DLRA 1E2MA 4IFEA 4YDSA 4BLOA 1P72A 2V9PA 2VQSA 1NVVR 4XH9B 2O8BA 1IM2A 4MKFA 5F3WB 4URYR 4CYMA 2YWHA 3IIJA 3PXGA 2HF9A 2GVDC 1N0VC 2BMFA 1PLKA 2ZTSA 1P2UA 1XD8A 5CJPA 3T5GA 3TW8B 2BMJA 2A5YB 1OXVA 4D80A 2ODNA 5E3HA 1Z6GA 3HR8A 4RY2A 1UM8A 3RS5A 4TQAA 2DFLA 3GEIA 3K9LA 1DADA 3DM9B 4NU0A 1Q1EA 4OQNA 4HAUA 1YVDA 1WBDA 4WAUA 5J4HA 4US0R 4Q9LA 3GJ7A 4QNMA 1KNXA 4WBSA 5FBVB 4TQUS 1W36B 5FOWA 5KDLA 2ZPTX 5KPJA 1TF7A 1M8PA 4CDGA 1NLZA 1W48A 3LBNA 2DWQA 1VYTA 3KKMA 4EFLA 2FPKA 1ESNA 3U3JA 1R6BX 4TLEA 1C4OA 4EJSC 3EG5A 3KQNA 1Z0DA 1RFLA 2DWPA 1ZIPA 2CDNA 4CEIA 2AX4A 3VR2A 3I5YA 3AH8A 4X8MA 3QXSA 4B73A 1E1QA 2REXB 2OLJA 3LWNA 3FDIA 2HDNB 2N42A 3IQWA 3I4LA 4LYHA 2V6JA 2QE7D 5EXXA 1OFTA 3IGFA 2TMKA 2IX3A 1XMJA 3C5HA 1E94E 2PBRA 3OIUA 2BMDA 2RAPA 1AK2A 1Q3TA 1XRJA 3GJ5A 2QUZA 1GRNA 4TMWA 4DDVA 5HR5A 3CX7A 3JZMA 1DG1G 5LPNA 4HUQB 1E2NA 5FUVA 1E2EA 2JIZD 4XWAA 3ZH9B 1MO4A 5KDOA 2F9MA 2ATXA 2QE7A 4B33A 3TBKA 3FGNA 4H9GA 4RZ3A 1R0WA 2CLCX 4BFYA 2NPIA 1E0AA 2F7SA 4JT4A 2A9KA 2MMGA 4QM6A 4KFTA 4PSKA 4XTCS 4NYMR 2FEMA 3CX8A 5FL7D 2D4HA 2J5XA 4ARZA 1ZM3A 5KTYA 1T9HA 4IOKA 2JIZA 3DDCA 3IEVA 1Q1ZA 4AWXA 1OYYA 3FHOA 1OIVA 1UBCA 4URUR 1TEVA 1MV5A 3HPRA 3EZ7A 1HV8A 2WBLC 1NVWQ 1FP6A 1LY1A 2QI9C 4D0GA 2MSEB 2ZJYA 5TDHA 2ZSBA 2VHCA 1Z06A 4K81B 4Q7JB 3L0PA 1W0JD 3CRW1 5FBWB 3CUEF 1G9XA 2CHQA 1V5WA 1CR4A 3DEFA 4PZYA 2EW1A 5H70A 4EDHA 4QBHA 3OEEA 2QPAA 4DVGA 5JZVA 2FZ4A 3AKEA 3FE2A 4TT3A 4XVRA 5LD2B 4US2R 3CONA 1UKZA 2J3EA 4Q00A 3ZZ0A 4A0HA 1L2TA 5IK2A 4I1SA 3QKSB 3BOSA 3GQBA 1VIAA 2Y8EA 4MQBA 1E3MA 1ESMA 1DAHA 2JJ2A 4U00A 5FPHA 1U2RA 1ZIOA 4PSAA 4LC1A 2GHIA 4EJSA 3R8FA 4JLNA 5ELXA 5H1YA 5FPSA 4KU4A 4RCYA 2VF7A 2A7QA 3UK6A 3J81k 2H57A 4JT2A 3RNLA 4DCNA 1W4BA 1XTJA 2QP9X 3LX5A 4LV6A 1YZKA 2H18A 3JVUA 3V4FA 1N0UA 3FOZA 1UADA 4WOPA 2EYUA 1E2FA 2VTKA 2IHYA 1CU1A 2OO7A 3LW8A 4WA7A 2J9RA 4G0NA 4TLAA 4BLTA 2BBOA 2FNAA 5C4MA 1ZU5A 1GAJA 2JLZA 1G291 1U0LA 4DLZA 5J5CA 1NLYA 4IOJA 3A1SA 2J87A 3AGPA 4II7A 4Z1MA 2IUSA 2PZGA 1JNYA 4AURA 2IYTA 4DCUA 3RC8A 3DPUA 5KDDA 3U3KA 5HE8A 5DI3B 3QBTA 2QZ4A 3U2QA 5D3QA 3S1AA 2QT0A 2ZANA 1ZUHA 1E6CA 3T61A 4DEXA 2WOJA 1VTKA 2OM2A 4WZBE 3WYFA 3I61A 1TU3A 3O47A 4M9ZA 1CR0A 1SXJE 3W3ZB 3THXB 4B3CA 2GCOB 2IXEA 2JLUA 2FG5A 1UEIA 5KSZA 1QVAA 2AFHE 2PCJA 8OHMA 4TL6A 2AFIE 2KSQA 4M22A 1W0KD 1G17A 2WJJA 1CULC 3LV8A 3SYNA 2AK3A 5JCZA 5GJCA 4MYTA 2GRJA 4PQYA 3ZLJA 4XD7A 3RRYA 1OIXA 2MSDB 4URZR 5KU1A 4LRWA 1R4AA 1UJ2A 4BEJA 2V8OA 3WHLA 4S35A 4AKEA 3IIKA 5JMTA 4ZCIA 3EX7C 1Z6TA 2XGJA 1XEXA 3TQFA 3P20A 1Z6YA 3RANA 1OSNA 3ND9A 4R2HA 3WMEA 5EQTA 1KSJA 1LS1A 1B23P 3GFTA 2ZRIA 3PG5A 1NN1A 2QY9A 4M0LA 1WF3A 4URVR 2VHJA 1I2MA 1U0HC 4JLJA 2FSGA 1SGWA 3SQXA 3MFYA 1E2HA 1ELOA 1SKYE 2YHSA 3PEVA 4YDHB 4EPRA 4DLUA 5CLQA 1XMSA 4DKXA 3CF0A 2OBNA 4P4TA 2J46A 3L82B 2V55B 3DM5A 1G41A 2O8EB 1KI9A 1CR1A 5FBQB 4IRUB 4RFSA 1OXXK 1NRJB 2QU8A 4LC0A 1HE8B 1OB5A 4DXAA 3B2EA 4B3FX 3ZZUA 4IDOA 3T1OA 2WMOB 1XWIA 3BAFA 2HLDD 1F2UB 1G18A 3OFND 3E1SA 2W6IA 1XMIA 3K0EA 4ASUA 1C9KA 3U5ZB 2G1KA 4WXPA 4HDQB 2AK2A 3Q3JB 4D6PA 5G53C 4EAQA 4HB4A 4A8JB 1G7CA 4A6PA 2HYDA 1LVGA 4P33A 5AUOB 3AVXA 2QMHA 2F6RA 3FKSD 4GP6A 1BMFD 3HDTA 4P3YA 2AKAB 1DO2A 4DLXA 1XJQA 3NWJA 4QC2A 3EZ9A 3OFNA 4B75A 1CRQA 4AKGA 3AP2A 4KVAA 5IDVA 4B3GA 2FMXA 3NHBA 2FJUA 3OE7A 3RS2A 1JJVA 3GLIE 2WMNB 2PX3A 5FTKA 1DELA 4QGHA 4M4SA 3W5IA 4BZQA 3EZFA 1N3BA 4YXWA 2H16A 2ZRHA 4DT1A 2D7DA 3M0EA 5D3MB 3O8RA 3K0CA 1HA3A 2GCNA 3LAWA 4TMKA 2QEQA 2QENA 1QHHA 1VHLA 5BYJA 4NONA 5FOUA 4C0AC 1U90A 1MKYA 4F93B 1NVVQ 1XEFA 2NG1A 3ADKA 3GFPA 1EK0A 4BWYA 2Q6TA 3L43A 2F9LA 2ZE8A 721PA 3TVDA 2OZEA 4Q48A 1JR3A 2W0SA 3QPWA 3PUXA 1UF9A 4XIGS 4ZDWA 3PEYA 3LH5A 3PENA 1JBKA 2O8BB 2ODEA 3A58B 3LNCA 3VQTA 4A0RA 4JYBA 4V02A 1G3UA 3RS4A 3WNBA 2GTPA 4NBSA 2VH5R 2ORWA 5JWOA 2A3RA 4NYJQ 2GJSA 2QMEA 1CJUC 1M34E 3OIVA 4KLZA 1CRPA 4C2TA 3GEEA 2C78A 4JLPA 4JLMA 2JDID 3U60B 1HY3A 2XOKD 3PFIA 5L3SA 2F1RA 4HDCA 1R5NA 1KO5A 3LO5A 1JAIA 1BOFA 2FZLA 2R8RA 2BVNA 1G4UR 1LW7A 1P6XA 1OH6A 1KHTA 1ZINA 5FI0B 4ZPXA 5GJVC 1R0XA 5EXPA 1KAGA 4CZ2A 1DO0A 2ONJA 2O0HA 1G64A 2ZRDA 4L4UA 2F1JA 2W2TA 1G6HA 4BLSA 4DJTA 2WAYA 5JFGA 2ZU6A 1Z63A 3FPAA 1T3HA 5FOVA 3NC0C 3QVUA 3THWA 2X19A 2O0KA 5KNBA 1OLOA 3CRRA 1TQ6A 4PO8A 3CRMA 1Z0IA 4RZXA 5JS7A 3AKYA 5JI3E 5BWMA 4FCTA 4FD2A 1SXJA 3CBQA 4NKRA 2GXAA 3LDAA 4RVCA 2BBSA 1IAQA 4CW7A 1S2MA 2LCFA 3LRPA 1DARA 1M7BA 4GMXA 4CVNA 1ZYUA 2GETA 1Z07A 1G7SA 2VP2A 4ZI3A 1E2KA 4PC7A 1AIPA 2AXPA 2XSZA 4MUBA 1TTTA 2F3TA 1WRBA 4BLQA 1DPFA 2OUKA 1E1RD 4TL7A 5DE3A 2ZE5A 1QHXA 4BRUA 1EX7A 1Z47A 4F4CA 2GEVA 4HLUC 1QVRA 2NTYC 3FKQA 3KDSE 4X8LA 5FTMA 3EXAA 3U4QA 2V7QD 3W34A 3WYAA 4B6EA 4GRAA 4JYCA 5FTNA 2OXRA 2YOHA 1OB2A 5E7JA 2D2EA 1VG1A 1OFHA 3E70C 1VG9B 5FPTA 5HE9A 1L4UA 1LS6A 4WZAE 1HTWA 1H65A 1TEXA 1T8TA 4A4DA 4M1SA 4Q4LA 2WWXA 1P61B 1G3QA 1BYIA 1KO8A 2ECKA 1ZCBA 2GJKA 2HCJB 5TARA 2J0UA 1G6OA 1I4LD 4D4JA 3ADDA 2XB2A 2EWWA 1GG2A 1KK1A 4JL6A 1L4YA 2HV8A 3WNCA 2KBFA 5JBQA 4NCHA 1XB2A 3O8DA 4QGAA 3WMGA 3KXLA 1WQ1R 5CJ2A 5E7MA 1BYUA 1KK0A 3ZYCA 2IT1A 2BC9A 5TB5A 3W9YA 1O3YA 2IEZA 3K0SA 4PO9A 4TMTA 1N6KA 3ZZTA 3SU8A 2IF2A 2O8FA 3OIYA 3ZIAA 3B85A 3QXHA 3AVUA 4V03A 2QAGA 1U9IC 4A92A 2WWYA 2R6AA 2EU8A 2RGEA 4FMBB 4AD8A 3IKJA 3KTAB 4MITA 5HPYB 3I62A 1PLJA 1S3GA 1VG8A 3IO5A 3LVRE 1J70A 1T5LA 1E4YA 3KQLA 1VECA 4PAMA 4JVNA 4IDQA 4JLVA 5ANRB 3V9PA 3K1JA 1KO4A 4L9SA 1SKQA 2ZJ8A 1R8SA 1W5TA 5CIQA 4KVGA 4JBXA 1PVOA 3K09C 4M1YA 1FX0A 3SN6A 3MWLA 5GJWC 4OBEA 5FPYA 3UMFA 5HKKD 2REBA 5F98A 1BH2A 3UANA 4IOLA 4JLOA 4RD2A 2VIIA 4HAYA 1Z2CA 5AJXA 2I4IA 4AK9A 4CT5A 2NGRA 1E79D 3U44A 2GEUA 3S1AB 4FMCF 4E22A 4ZCLA 3E2IA 4Q4AA 4V0KA 4B2LA 2D62A 1JJ7A 3MWKA 1CBUA 4RJLA 5HKKA 2ZRCA 1TUEA 2CCGA 1CF4A 3NBYC 5LDDC 4UNNA 3CZPA 1HH4A 2E9SA 2ERXA 3H2YA 3TJZA 4TYYA 4LWZA 3CH5A 1TX4B 2GKSA 1S0UA 2ZJOA 3UMRA 1KSHA 4TN1A 3EC1A 1Q44A 1K5GA 1XEXB 5B2ZA 2QP4A 4CEJA 2OSBA 2PJZA 5FTLA 5KSOA 3BXZA 2BKUA 3PIRA 3THOA 1G8YA 2WSMA 2XJ9A 4LHWA 5JS8A 3UG7A 2FWRA 2YZ2A 3LQQA 4LYJA 2ZRFA 5CB8A 521PA 3ZGXA 5KNDA 3LVQE 1P9NA 4AIIA 2PH1A 1FUUA 2F1IA 2ZI5A 3KZ1E 4W9MC 2FDCA 3CNLA 3SYLA 4Q5IA 4NZYA 3CM0A 1DG3A 4MGIR 4TYQA 3Q72A 1Q12A 4ZKEA 2A78A 1RW4A 2IUTA 3B82A 1U9IA 1JI0A 2CBZA 2B7BA 2OE2A 4BE7B 1N6RA 2AL7A 2QP3A 2ZAMA 4C0SA 3IUYA 1P5ZB 2AKYA 2GILA 3K9NA 3WRXC 4BFXA 2JLXA 1M7GA 4I4LA 2QNRA 3DOEA 2PZFA 2V3CC 3RVBA 1XPRA 5SZKB 2WAXA 4UNSA 5DN6A 3UWKA 4DSNA 5AK0A 1N6PA 2X1VA 4DWJA 1M2OB 5C1BA 2IK8A 5KNCA 2VL7A 2X77A 2ZIAA 5DIFA 4JBWA 4P31A 2ONKA 3MGCA 2P6UA 4IVRA 1AS0A 4RZ2A 1P2SA 4BASA 3UMSA 3RWOA 1Q57A 2PZEA 1E0KA 1RJ9A 3TSWA 4Q1CA 3AP3A 3G82C 2ZRMA 1TQ2A 1E2JA 4JL5A 1H8EA 3ASZA 1SVIA 4TL9A 2KWIA 4HLQB 5G41A 5G40A 4GZLA 3OHMA 1Z0JA 4F4IA 2I1VB 3TAUA 2ZUBA 4AYWA 4YMSA 4JSTA 2D7CA 3B7GA 4DT1B 3CRVA 1JAHA 3CX6A 2A30A 4RFVA 4F38A 2IF0A 3R20A 4Z51A 4AKIA 2AHOA 4OQMA 1QHHB 121PA 4C0LA 1FNMA 3CH4B 4FN5A 2C96A 4M9XA 3CNNA 2IW3A 3AVTA 4TWZA 4NYIQ 4KV9A 3LXXA 4PPQA 1NJGA 2NOAA 5JJLA 3MG9A 3LD9A 2ZUCA 3DZ8A 3OZXA 3QVVA 3SZRA 4HAZA 5GJBA 4B6FA 2L0XA 2REOA 2CJWA 1AZSC 3MWYW 4C7OA 3EARA 4B76A 2QMOA 2QQ0A 1GOTA 2XX3A 1KK3A 1TPZA 1ONBA 4YMWA 2N1BA 1E9RA 1ZM2A 4QBIA 1E2QA 3OEHA 1ZUIA 1WE2A 2PEZA 5L3SB 3V00A 4LZZA 5AWFC 3L0SA 2XNDA 4MA4A 5G3YA 2XTMA 2JLQA 1DS6A 5CK4A 5E7IA 3ASYA 4G5SA 4BPBA 1Z6XA 2ZSDA 5CM8B 1VCMA 2WSSD 2D2FA 4W5HA 4TSFA 3A1VA 4W5JA 2BWJA 1JQLB 2VSXA 3GP8A 1TMKA 5FUYA 2DCUA 2YC2C 2ZUDA 4G01B 3RSOA 2CK3A 2NO9A 5FOSA 4UXIA 4E03A 3Q9LA 2ZSFA 1VDZA 3B6EA 4KFRA 2YOFA 4CEHA 1DVRA 2WIBA 4PSVA 1KMQA 3A6PC 4LHVA 1NG1A 1QHYA 2MMCA 2W6JA 3TW4A 3KX2A 1GNRA 3BB4A 4Q01A 1N6IA 2FPMA 3F3YA 2Z0MA 4GBMA 2BJVA 3QSYA 1EG7A 1HEIA 2J0QA 1SXJB 2IC5A 4LHXA 4TQ9A 4AC9A 1GL9B 1UFQA 4PHFA 3GLHE 4JKYA 5JHHB 1G8FA 5BW8A 3F5FA 4RD3A 3AVYA 1XTKA 1Q20A 3FYHA 4MYHA 1E98A 1YR6A 4NP6A 3PR1A 4V0OA 1NN3A 4OHWA 4JVLA 1DAKA 2ZI9A 3K70C 1ZRHA 3VMFA 4IOMA 1WCV1 5DISB 1QHGA 1W44A 3U4QB 1PZNA 3SEAA 3CR8A 1QRAA 1XXHE 2R6GA 1KGDA 1XJCA 1OJLA 3NDPA 1MO3A 3GJ6A 4M1MA 4TTRA 5A0FA 3VAAA 2VPPA 3B60A 2HJVA 4Q02A 1P60A 4I1VA 2OBMA 1R5OA 4PC1A 2J7PD 3RLFA 3BH6A 1VHTA 3BFVA 3OAAD 4DUGD 4IFBA 4R98A 2H8KA 2WVJA 4GMDA 2J0UB 1W4AA 3CPEA 3W8NA 2OCBA 4GZMA 3VU9A 4LBWA 4BGDA 3K9HA 4IVQA 2J7PA 5KPDA 1DAGA 4YMTA 1RKBA 3P27A 2QA5A 2CXXA 1GP2A 3HJNA 3B1ZA 2QBYA 1AS3A 3WP1B 4QJ5A 5K8IA 2FSFA 2OAP1 4PTLA 1KY2A 2PT5A 1G3MA 3GJ0A 1XD2A 1FMLA 2ZXUA 1KI2A 2QAGB 1AKYA 4LUCA 3GJ4A 1BIFA 5FOXA 4BUJA 4KYUA 4N0EA 4ESVA 5GADl 3GJ8A 5HCNA 1K6MA 3RRMA 5FL7A 1JPJA 1R0YA 2DHRA 3CF2A 3U3RA 1N5JA 1T5IA 2RH5A 2WKQA 3FFAA 2A5FA 2RGAA 4G5OA 4IJMA 2QTHA 1M74A 5AUQA 2D06A 4WW0A 3K70D 1KJWA 3NDBB 1UDXA 1ZU4A 5DYGA 3A1UA 1WBBA 2CNWD 2RMKA 3T06B 1OPXA 1FX0B 2ORIA 2YOGA 4DSOA 4E5UA 5EUMA 2ZVQX 3NH9A 4EQ6A 4LY6A 4URXR 1MH1A 1VYVA 1W0JA 4FI3C 4KI0A 3GLGA 1NSTA 3FWYA 1KSGA 3ZVLA 3ZS8A 1K8RA 1WDTA 5BN5A 3IDQA 1JXOA 1T0HB 3U44B 4PQFA 1KZ7B 1A2KC 2W2VA 4JS0A 2AXNA 3CPJB 4Q4AB 1ZMXA 4B44A 1KI7A 2MSCB 3N5CA 2ZS7A 3HU1A 3QY0A 1E96A 4OHYA 2F43A 2FF7A 4L8GA 2OHFA 1X3SA 2BM0A 4QJ4A 2VP0A 1KDRA 1GITA 3LX8A 3R7WA 4MDEA 1DOAA 3GLFE 5L3QA 3KJEA 2PX0A 4DRZA 1KI4A 1A82A 1GZSA 1U81A 4GNKA 3FMIA 4C2UA 3F8TA 4MKGA 1OH5A 2JAQA 5JJIA 1GNPA 4BLPA 1S1MA 4V0ME 3QKUA 2UZ3A 5J40A 3C8UA 4OI2A 1UPTA 4GP7A 1A5TA 1ZNXA 2ZQ5A 4CEJB 4EPXA 4OK6A 1NLFA 2GXSA 5FBLB 4DLVA 1N25A 2EFCB 4LSGA 3ADBA 4R71A 3WBKA 1YJ5A 4M8NE 4N0DA 5DGXA 2XAUA 3TIFA 2GVZC 3U3MA 4P0TA 1PUJA 2QGNA 1F5NA 5JLJA 3QI2A 3VR3A 1YR9A 3PITA 2ZS8A 2P5TB 2GNOA 3A1WA 4QHYA 2ZI7A 4HEJA 4WZ6A 2PCLA 3FHCB 1E2LA 4US1R 3GLHA 1RVDA 1XCMA 1PV4A 4RKEA 2JGNA 1RYFA 2GJ8A 1G3RA 3KL4A 4Q7MB 1P3JA 4NCIA 1EXMA 4NH0A 3VKHA 2BOVA 1E9BA 4XWKA 1KNQA 3NKVA 3HR7A 1DAFA 2GZDA 1AN0A 3CRQA 4Q19A 2R6CA 5L8VA 1II8A 2Q9BA 1J2JA 4IDNA 4BFVA 3O8CA 1W0KA 2B92A 4DLTA 3QPUA 5FR1A 2YINC 3MSXA 4RD4A 4KSBA 2JEOA 2YWEA 4AG5A 2GJAA 2OCPA 5LB4A 2IHBA 2JLWA 5JSZA 4BFSA 5J4KA 2J0SA 1E2GA 4Q9IA 1FTNA 2ZRAA 4MGKR 1EWQA 2Z43A 1US8A 2G6BA 3TR0A 3L0OA 1WXQA 1TADA 5KUTA 3IIMA 1H8HD 2E87A 2VP6A 2BEKA 3M4YA 2I3BA 1Z8FA 1OYWA 1G4AE 4YQFA 5C18A 3VNVA 4GFDA 5SZIA 1OHHD 5KO2A 1XP8A 2FN4A 4PPFA 3SR0A 3E5HA 4GDFA 1WMSA 2RCNA 1KMHA 4IXNA 4PO1A 5C2JB 4HI0E 2EWVA 3QKRB 4OKSA 2CE7A 3RC3A 4NCKA 4QRHA 3VKWA 3VHXA 4DBLC 1JPNA 4ILEA 2WZQA 4R7ZA 3PQCA 4ITRC 2HCBA 5P21A 3GEHA 2ZI4A 3PEUA 3T15A 1N5KA 4LBZA 4C4PA 3AVQA 4Q7LA 2ZR0A 4MYCA 1JQJC 1T91A 1EFUA 1EESA 3QE0A 2G77B 1OFUX 1U0JA 5JRJA 1T0JB 1Z28A 2FX3A 3A4MA 2HLDA 3M6AA 5KSPA 1F60A 1G5RA 4DLYA 2B6HA 2BMEA 2EYQA 2ZRPA 4Q7KA 1XDBA 2VP9A 3EC2A 3IBYA 2QM7A 2BBTA 4FIDA 4QFMA 4C0BA 1ZP6A 5JWRA 1S8FA 1VIYA 2AD1A 3PVSA 2OCYC 2ZETA 4ABYA 4ACAA 1OKKD 2RGBA 4QL3A 3FKSA 1BMFA 3PV0A 4YLGA 5EP4A 1IXZA 2C5LA 3OF5A 3B9QA 4DIEA 3UKDA 3AEZA 4BFWA 3TE6A 4Q9JA 1RRCA 4D25A 1G19A 2DWOA 2VHTA 3QG5A 3SQWA 1CIPA 2Q21A 4X8HA 4WXRA 4NTZA 4B32A 1W36C 4LK2A 5HTKA 4KXFB 5CM9C 3FB4A 4Z8XA 1SQ5A 4KHZA 1A7JA 4LPKA 4M1OA 5DHFA 2BCGY 3WY9A 5A4JA 4V0NA 3T1VA 3TQCA 1MO5A 3HU3A 4O0MA 4BLRA 1CEEA 2CHVA 2OLKA 4Q4JA 1R5BA 1Q1BA 4B3DA 3ZQJA 1NG9A 3ZJYA 1YHNA 3Q8XB 1MR3F 3NHAA 1ZM9A 4Q03A 3I3SR 3WBJA 4EIWA 2RGNC 1QHSA 2R6FA 1G16A 6Q21A 4DCTA 2C04A 1MRSA 1S4QA 3KXKA 5EP1A 3BH0A 4LJ9A 3T12A 4DC9A 2SHKA 2A5DA 4AY2A 1NI3A 1FOEB 1T4GA 1U8YA 5E4FA 3BD9A 2JDIA 2OEPA 2XOKA 4FMDF 2O0JA 4Q4HA 4UNQA 1J8MF 3D3QA 3PUZA 5JHGB 1MOZA 1OE0A 3QKTA 1VMAA 4PAQA 3O8BA 4CEIB 5EP2A 3UATA 5CIWA 3K8YA 2VEDA 1XU4A 3DKVA 1E9CA 3K0FA 4FINA 4P4UA 4DEYA 4H1UA 2OBLA 2HF8A 1R8QA 2GXUA 1N0WA 4LBYA 2O52A 5AR1A 5CYOA 4DSTA 1E69A 2IYRA 2NIPA 4POAA 1EFRD 4HAXA 4KODA 3R9WA 2ZJBA 2QPOA 3EZ2A 3EPLA 3AVVA 3TMKA 1VCOA 2Q3MA 2DY1A 1R2QA 4A15A 2Z6VA 1W36D 4NYMQ 2B21A 4KBFA 1KYIA 3I1FA 3T1TA 3VU9B 2ZR7A 2D74A 4YONB 1I2DA 1M7HA 1E0SA 1EFRA 1CXZA 4RKFA 2QROA 4CIDA 1GKYA 3KUCA 3K0AA 1W4CA 4U7DA 2QBYB 1E4VA 4TLCA 4TTPA 2W2XA 5LD2C 3DOFA 2HJGA 2ERYA 4ARZB 1D2NA 3Q5EA 4H1VA 2R9VA 4KSCA 2V4ZA 1N6LA 1IY0A 2V6IA 3B5JA 3PUYA 4Z8YA 1E1RA 1XD2B 2QORA 3P1JA 1AQYA 4D82A 5EJEA 4NCJA 4QOSA 1UAAA 3NXSA 1R7RA 3QENA 1ANKA 4TL8A 1AS2A 1KI6A 2RGDA 3NEJA 4JMPA 3X2SA 3RS0A 4LJ7A 2CHGA 3CF6R 2V7QA 4DSUA 2WM9B 2O8DA 2IYXA 1QG2A 4OYHA 5HCIA 4LV8B 2C03A 5CDFE 2N46A 4UXHA 4XVUA 5J4VA 5B64A 1CR2A 1Z2AA 2RGNA 1RRFA 2OAQ1 3SFZA 4UNRA 1RC8A 1E9FA 3AF2A 4G5QA 2GCPA 2WJIA 1J90A 3IQXA 2V1UA 5BN4A 1RE0A 5FOTA 1G3IA 3ZQ6A 1XF9A 4KITB 2BIFA 1UBFA 1ZBDA 1RYHA 3GLGB 3SNHA 4EJSB 2E1RA 4F4JA 1TNDA 2FH5B 1YZTA 4D26A 2HXSA 3NBZC 1S96A 5GVRA 4DDTA 4EPYA 1E32A 3GLIA 3AGQA 3HYTA 2KB0A 2VBCA 2YV5A 2ZJ2A 1IN8A 4WIAA 3ZDQA 2PT7A 2NMVA 2O8CA 1ZNYA 2ANBA 4RD6A 2HT1A 2F43B 3VFDA 4XOIA 2AN9A 2GXQA 1DAMA 1RRGA 4QG7A 3ADCA 1G21E 3TNFA 5L3QB 1KDTA 3AUYA 3U7EB 2ZE7A 3AP1A 1UBEA 3HWSA 1PJRA 3EIEA 1KZGB 4HUTA 3FHTA 2IL1A 1GDDA 1CJKC 3HPQA 3NH6A 4JLBA 4PZZA 1G7TA 4PQRA 5FR2A 2JJ1D 4HLUA 4R2IA 2P0EA 2QAJA 4UXJA 2VLIA 2ZS9A 2AWOA 3TSOA 1OV4A 3C7KA 2I1QA 4FWIB 1ZD8A 1X8JA 5JECA 1MRNA 4KBGA 1ZUNB 5DLQC 3QKSA 3MRSA 2QTVB 3A8TA 5FBRB 4DDWA 3BGWA 3C41J 4JLAA 2JJ1A 3H86A 1G5PA 1XZPA 2AD5A 1XCPA 4QGFA 3QEJA 1E9EA 1GRRA 5LB2A 1E79A 3V4RA 3ZVNA 2XTZA 4DCVA 2WICA 5FL3A 3LW7A 1M1YE 2GK6A 3NVAA 4JKIA 2ASEA 3QNUA 4L9WA 1HQYE 3DKPA 3NIBA 1AKEA 1GL6A 1GUAA 2FU5C 3TH5A 1P9WA 4B2IA 1XTQA 2XEXA 1KI3A 3K9GA 1AJEA 1D5CA 3C14C 5JWHA 5LBIA 3JVVA 1QF9A 5B30A 3B1XA 1OH7A 2KJQA 2JASA 2WPDD 3N70A 3B13B 4B74A 2HYIC 4B47A 5JSZB 1OH8A 621PA 1W2GA 1J99A 1QDEA 1GTVA 4A8JC 1IXRC 1UKYA 1EX6A 1SVOA 4GT1A 1VCNA 3BWDD 1NY5A 5J4YA 3P4YA 4D81A 4E07A 4C3ZA 4C0KA 1MT0A 1O87A 3BB3A 3LLUA 5KYKA 4B48A 4RFSB 2DYKA 2BCJQ 2CEAA 5DI3A 4PANA 5JI2E 1IJFA 5FFMA 2WWGA 2IS4A 1SVSA 2QL6A 1KMHB 4I81A 2NO7A 3LY5A 5HZHA 1Q21A 4UJ3A 1A4RA 5E95A 1B0UA 4IEEA 3QXXA 3MMPA 1F2TA 4ERNA 1N2CE 4LJ8A 5SZHB 1W49A 2GAAA 1RPZA 4OI1A 4DLWA 2C9CA 2HEIA 2VO1A 1U94A 3SYKA 3K09A 4AKHA 1COWD 2V54A 4OJKA 4YC7A 4EPWA 1ZM7A 1NF3A 1G8GA 5BXQC 2ZYUX 1ZW6A 2KI5A 2UKDA 4L15A 2G9NA 1SVWA 2WIAA 4LV5B 5CLLA 3T34A 1T6NA 1EFHA 2ZRLA 2YVUA 3EASA 5EE3A 2OFOA 2ZJAA 1U98A 3THYA 2KE5A 4MYUA 2JLYA 1GILA 1AGRA 1P73A 3SS8A 1CS4C 2IYZA 3HU2A 5KHOC 4B71A 1KAOA 4DIDA 4CRWB 4D0LB 3N2IA 2XZPA 1NVUQ 4IW3B 1EFCA 3SJZA 1KI8A 1G8HA 3T1QA 1Q22A 3B1VA 2G0TA 4OHZA 3HP1A 3BRWD 4B2PA 1CP2A 2NZ8A 1D6JA 2Z83A 3B1YA 5TMPA 3FTQA 2O8EA 2ZAOA 2VYFA 3F0TA 1ZM4A 5UKDA 3BH7A 3EIHA 5TY0A 1IHUA 3VR6A 5AJZA 4LBVA 3TSZA 2XJ4A 3BORA 2EFDB 4MUAA 4ON9A 5EE1A 1KJZA 2G0NA 2ZROA 2XITA 1F2UA 1LV7A 1HE1C 4FCVA 2ZYTX 3M1IA 4Q1FA 2AWNA 2IWRA 2ZEJA 2J45A 1NKTA 3CB4A 2GZAA 2K5UA 5C46F 4DCSA 5HZKA 1F6BA 2FV8A 4A8JA 1R10A 1VG0B 2DPXA 3BFXA 4M1TA 3AQ4A 4XSGA 4M1KA 1E9DA 2GBLC 1NIPA 4PR0A 1JECA 2FFQA 1UKVY 1YZUA 1ZNZA 2GDJA 3BE4A 1IQPA 3RABA 1AQUA 3QXCA 2CLSA 3ZS9A 4LGMA 2WKPA 3FMPB 2NPFA 3AM1A 5EE0A 4MKHA 4ZKDA 4YMVA 3FMFA 4PFSA 4Q4HB 1VYUA 3I72A 3EAQA 4ZDIA 5D3MA 3LLMA 2NO6A 5SZJA 3TRFA 3THWB 1K5DA 2J1LA 2KBEA 2QSZA 4GOXA 3K0FB 2WSSA 3NG1A 4TMZA 4MRVA 2JLVA 2B7CA 4RSGA 3P32A 3BC1A 2CL0X 1EFTA 1LNZA 2P2LA 3KKOA 3QF7A 3DMDA 3TKLA 4DB4A 1XZQA 4KO8A 1EWRA 3X1WA 2P3SA 2IS2A 1GKIA 2R62A 3IPXA 1JEDA 1KKMA 1NMXA 4HB0A 4ZIRA 3PCRB 4FMCB 2GJ9A 3VTKA 2IUUA 2BJWA 1J8YF 2X2EA 4G1UC 4UNPA 3K53A 4DDUA 1YRBA 3W5JA 4G3XA 5C4GB 3H84A 3K0AB 3BFKA 1YQTA 3LA6A 4NYJR 1DAIA 4NDZA 4NMMA 2GK7A 4XJXA 3SDZA 2CMKA 2QRZA 4GPTA 4MGYR 2GA8A 2IXFA 4IDHA 4S2EA 4QHTA 4A82A 3IHLA 3G5UA 4C30A 1KDOA 1E1QD 3MCAA 4D4LA 1MO6A 5TV2A 3RYTC 2IBMA 1SKYB 4LYAA 3WNDA 1KI6B 1Z22A 2RGXA 2C77A 2GWHA 2O8DB 4IDPA 5JJKA 4QGGA 4PPNA 1U99A 5AJWA 2B8TA 2CCJA 2GF0A 1PLLA 2RB4A 1XTSA 4B35A 1Z0FA 2J41A 5AJVB 1CTQA 1RZ3A 1TL7C 4LJ5A 5IRCD 3AKDA 3U7FB 3OAAA 5JRZA 4DUGA 3ZD7A 4LJ6A 2GBLA 2PLFA 2R65A 4F91B 2NO1A 1W1WA 2VSFA 2ZYVX 5DYIA 2RHDA 2OV2A 2ZM5A 1FUKA 1FTSA 1OT3A 1FQJA 1ZJ6A 1XPUA 1KK2A 2O8FB 3ONWA 3DHWC 3BJIC 3ZVRA 4LHYA 1S9DA 2WKRA 5DHAA 3WRYC 3NC1C 2GAOA 5BQ5A 5CB6A 1G20E 1OXUA 5K8UA 1X8KA 3AVPA 5IT5A 4OL0A 3RRZA 1J7KA 1E2DA 2WJGA 3GLIB 1YZNA 2IS6A 4HATA 3IBGA 2O8CB 4LPSA 4HDOB 4UJ5A 1ODFA 3AV0B 5FUXA 3KQHA 4KYIB 4Y0AA 2Z5FA 4OI4A 3WP0A 2FA9A 2H92A 4EFMA 2ZJ5A 4R9UC 2DFTA 2ZJZA 1IY1A 4NL4H 2ODWA 1II0A 4XSHA 3OEED 4ESHA 5CK5A 4OI0A 2P67A 4GOKA 4TT3D 5CYPA 2P65A 4AG6A 3X1YA 5IK2D 3VNUA 2HXYA 3CWQA 2WWIA 1VCIA 1XNJA 2JJ2D 1ZAKA 1DEKA 1Z29A 2YYZA 4JVSB 4F7WA 2ANCA 2CNWA 2CE2X 2F55A 3HYRA 2PJRA 4MRRA 1MABA 1FFHA 1JR3E 4F92B 1TAGA 1A2BA 3SHFA 4QXAA 4A2QA 3KKQA 3AF4A 3VX3A 3UPUA 2G83A 4FCWA 4XVQA 2ZE6A 2CL6X 1XTIA 2FGKA 4RD0A 4KJZA 2RHMA 1DAEA 2LWIA 5DO9A 1XPOA 4MRNA 1HT1E 3QG1A 1XCGB 3KTAA 4QJ3A 2Z4SA 5L3VA 4Q66C 1GRQA 1HUQA 1UBGA 5DNYB 1ZD9A 4Z1MD 1FQKA 1VKJA 2QG6A 3P26A 4M2LA 3VX4A 4HLDA 4EFNA 4P4SA 3EA5A 3PUVA 2ZU0C 2XXAA 2GEDA 4M1WA 4MRSA 5EE9A 2F3RA 1L7VC 4IEIA 3R9XA 1UEJA 2FOLA 3CLVA 3IEUA 4BFTA 1NJFA 1KY3A 1HQCA 2IEYA 4HZUA 3CPHA 2OG2A 4LI0A 1G7RA 4I1OA 1JR6A 1BO6A 3CZQA 2FE4A 2WHXA 1KIMA 4KLNA 3X1DA 1P9RA 221PA 1BS1A 3TUJC 4NCNA 3FFBA 4XD7D 4QHSA 1YR7A 3UG6A 1FW6A 3NEYA 3K0CC 2ODBA 1CKEA 1F2TB 2W0MA 4NPHA 3TUIC 3RDPA 1GFIA 3CR7A 1G5TA 4JL8A 1FL9A 5B58C 2DR3A 1FZQA 5H8WA 4MRPA 3I32A 1XXHA 2H7VA 1G1MA 3Q7QA 3NBFA
chains in the Genus database with same CATH superfamily
1RJ9B 4U1RA 3TUZC 3HB4X 4NNPA 4PHHA 4OQYA 4QQRA 4CM5A 2FDRA 2Q5LA 2UUBB 2HA0A 2J0VA 1EVJA 2BFPA 4RW0A 3NOQA 1XFAA 2CDCA 5CAEB 3GPCA 3DMTA 3QLTA 4ICIA 4MDFA 1Y3BE 2VR1A 4C88A 1UAGA 2WSIA 4QUDA 3THYB 2BI7A 1Z7WA 5IH7A 3CX3A 1WB9A 5H4HA 1YRQA 3GMTA 4GYYA 1VPLA 4DMCA 1MFZA 4D02A 1DBSA 4R84A 1XXLA 1T1EA 3II6X 5BYKA 1M0SA 2NU7B 5DLYA 4OA5A 4MQMA 2VF8A 4ZQHA 3TSYA 4ZYWA 3U3XA 3OESA 3UBTA 2ZDGA 4CUJA 3AEUA 1TQ4A 2XTNA 5LNK6 1L7RA 1CIVA 4H60A 2OT3B 2W6ID 4PGHA 4ZAXA 3W06A 3T3EA 1UKEA 2RARA 1WR8A 5HG0A 2IZ0A 5LOVF 3K8ZA 5CT5A 2HUPA 2EF1A 1UXJA 3W6NA 4BN4A 4C29A 1U8AA 4GXNA 5BUZA 4G2NA 4LI3X 1DBVO 1ZKDA 3RJ9A 3W6UA 5LXTB 2EFHB 4XDGA 4X1IB 4FQ7A 4W9NA 2RHLA 1NHWA 2H5LA 1GQFA 3Q7PA 2QVYX 4PHGA 4GWGA 3FF4A 4HAWA 1XTRA 2LGJA 4KGXA 4C7OB 5CD1A 3FNQA 3UB2A 3EGEA 3IVCA 1DEOA 1GGJA 1Q3HA 3IH5A 2XUGA 3JRWA 4UHFA 5DKFA 1Z0AA 4D4KA 2I9KA 1TO2E 4KN5A 5AHWA 4BAGA 1J00A 4YVFA 5BRNA 5FBKA 1P62B 2BKEA 5BSEA 3OP4A 1Y8RA 3FJ1A 2RKOA 4YXWD 4ZTZB 4WXMA 5HFJA 2GESA 4EHNA 3PD1A 2D0OB 2AG0A 3MCVA 2DPGA 4LF4B 1XUOA 3BX1A 3VJMA 3ZWPA 4B6GA 4P7JA 1XX6A 1EQ2A 1QBKC 1MB9A 2QM8A 2UVQA 2YXDA 4KQWA 4IMIB 5I8ZA 3UCXA 2NTEA 3B9PA 5ER9A 4C0JA 2J7KA 3RS7A 5JADA 3RYHA 4A23A 5AJYA 3S27A 5FXMA 4HUJA 5F7OA 2QG9A 4JVMA 1P1CA 1UBTS 1ORTA 2D1QA 2QMUA 4EZIA 1YRLA 4JP1A 4UTXA 1X9IA 1A5ZA 3KR0A 3EZYA 4YYZA 4ZHSA 4UAUA 4QUIA 4DHEA 3OD1A 4GR4A 1FFYA 3BGOS 4HXFB 3V1LA 3P9QA 1GIAA 1IEWA 1ZH4A 3OE5A 4TMVA 5F21A 4YPFA 4PC2A 1JHAA 4J0EA 5D3ZA 4HWTA 3AHEA 4N6OA 3GJ3A 5ALJA 1C3EA 1HX7A 2FFAA 3EAFA 3KZKA 4UHDA 5SYMA 4L08A 4R4JA 4Q34A 1EWTA 3O8QB 3RIMA 4C6TB 4RWEA 5BWBA 4RVFA 1QVZA 1X0XA 2WTXA 3BTUA 2E5WA 3C3EA 4G24A 1RM4A 4PQGA 2IWHA 4WVLA 3GLFA 2PRSA 3QQ5A 2LKCA 3KOOA 3I9OA 3A4YA 4CF5A 2WA2A 2AC2A 3DOCA 1INLA 2G1JA 2VDLB 4AAYA 4TLBA 4PLHA 3MWEB 2CXPA 3IUSA 5AJHA 5EWLB 3IO3A 2V58A 4ND3A 2IYUA 3A1TA 4PQEA 4BNZA 1NUPA 3RHFA 1OXSC 4V0MA 1UQUA 4MV1A 2WTBA 5D8DA 1C4WA 2YRWA 4N8EA 4Q3BA 1T36A 2D59A 5U4XA 1Y4UA 4KQJA 4OQFA 5IJXA 1Z6QA 4ZMRA 5KNCH 2ZIWB 2C97A 5EERA 3LCVB 2CL7X 1H1LB 3LUJA 4MUXA 3V7FA 3PQDA 5LBUA 4EBBA 1C7RA 3B3FA 1V47A 4AUEA 4XVHA 1S1CA 1EHYA 2A8YA 3I2FA 4NHOA 3PGVA 3D02A 2XWPA 4U4AA 5ESRA 2BTQA 4XLZA 5B3JA 3WOHA 4WPGA 3INTA 4G2TA 4BEBA 3QX7A 3VRHA 3WGLA 3S81A 2QAGC 4M60A 3B1KA 1QHNA 3OKFA 2Z1NA 2B6NA 5CP8A 5EMNA 3MGAA 2EJVA 4OSOA 2WV9A 1ORIA 2PUAA 1G6Q1 4KREA 1ADGA 1JKMA 1WDLA 3SAJA 5ESXA 3I92A 1PTKA 1LF0A 1NN5A 3L5KA 3MWJA 3DA8A 4OOEA 4K7JA 4BV8A 1T1IA 4JJZA 2O2ZA 1LZLA 3C6KA 1F3LA 3H0KA 3H2BA 3CWZA 2HQRA 1HLPA 2Y1XA 4JJKA 1PD1A 2AOUB 3GW8A 2HH9A 5B2FA 2VP4A 2H4JA 1U9YA 1KOLA 1WCIB 3A6LA 6AT1A 4HGRA 3IDAA 1KI1A 2XA2A 4KXQA 4KMOA 3R5HA 4ZICA 4LJRA 1VSUA 2WJHA 1RJFA 2Z5VA 3AINA 1XU9A 3K8QA 4D8XA 4JIMA 3SZLA 2R44A 3NOOA 3ZDBA 3UCEA 3MAJA 4YCNA 3M5CA 1JHDA 1GSIA 4INZA 1Z3IX 3EOZA 2NXCA 3HEAA 2CVOA 1IWOA 1YB5A 1MNQA 4JJ4A 1I4TD 2ZSUA 4RYLA 4DPKA 4EABA 1GT6A 3OZTA 3WGHA 4AYXA 2VA9A 1OV6A 5LZ7A 1I6LA 5GGXA 1BN6A 1R3DA 3CGWA 3GEDA 4IVPA 3ZLVA 821PA 2ZIZA 3PS9A 3U0VA 1E2IA 2Q9AA 3GFQA 4YWJA 3UAGA 3V1NA 3WGMA 4P5DA 2ID4A 4Q18A 1T3SA 3ZVMA 5CITA 2NT4A 5HW0A 3AETB 2G7ZA 4OBXA 5F77A 2J3DA 1NW7A 4PLYA 4QULA 3OIWA 2Y0PA 3WNQA 4RD1A 4FW9A 3GVPA 3EWNA 5I48A 4LQCA 4MO2A 2BUBA 2ZB7A 1OC2A 3COSA 3LCRA 3QXGA 5FFNA 2AF3C 3AESA 2FZGA 3WL7A 4CG0A 3DWIA 4ZI2A 4EQ6B 2GEFA 3HEMA 1NQ5A 3AUJB 2QT1A 2ZDHA 3OOEA 1JDTA 1KMIY 3PWZA 5G3ZA 1UH5A 2OILA 2CVFA 4UTPA 1SUSA 1V9SA 4MS4B 1JP7A 2H2HA 3QPVA 3VGJA 1RWKA 4HUQA 3B89A 2PWPA 1IG0A 3PJEA 1BE1A 2WVHA 2SBTA 4KXWA 1USVA 3CO5A 5A2QA 3L7KA 4DTCA 2RH4A 4TV8B 2EFEB 4HYEA 3RW9A 3DD5A 4ZDJA 2IEGA 2ZWVA 1GEGA 2IDKA 4XTRA 4JJFA 2J5RA 2Y6VA 4XOUA 1XEWY 4W1QA 1LPPA 2Q5JA 4PZEA 1YZQA 4FEYA 4GLOA 3RUAA 3KJIA 2OXIA 2JGIA 5DZSA 1OUMA 2VRCA 1P74A 1LF5A 3H9UA 2DM6A 4FHCA 1ZC4A 3E0QA 3AF1A 4D2IA 2I2CA 4NAVA 2X2FA 3BERA 3PCTA 1XVTA 1VPDA 1NUHA 4YJGB 2OP0A 3AJRA 3GZ4A 3Q11A 5K8CA 3KB1A 4MA0A 3TAHA 1NBEA 3DL2A 3UM9A 1J0AA 1QM5A 2C98A 1A1VA 1JYFA 5CT9A 4BLVA 3WNZA 2BZ1A 1HETA 3GLTA 3JQFC 3EDMA 3I04A 3VYTB 4EYOA 2IJGX 1GKUB 1JFVA 4EB0A 1NUAA 2BLLA 4RDIA 4EYKA 2Y1LA 1P75A 2ZPAA 4QYIB 2F62A 3KFLA 4M9SA 5IYZB 1Y6FA 4Y0VA 1PIWA 1Z4OA 1MDBA 3DEYX 3JZFA 4MLDA 4MKIA 5HGJA 4DZZA 3O3OB 2PKWA 3JQEA 4NENB 4D0SA 2W9XA 1M76A 1IXSB 4YRZA 5EGNA 2O4CA 4ES6A 4HYTA 4C9BA 1WB5A 1HDCA 4G26A 1NZDA 4OQXA 3DMGA 3FSEA 3BYZA 5EYPA 2ZITA 2IHTA 2PFGA 5F2KA 5CT6A 4YLYA 5A9RA 4GUAA 3E3LA 2O3SA 5L45A 3JSAA 4BMNA 3FNHA 3NV9A 3ZQ4A 1QZXA 3IAS1 2PMKA 3I73A 3QVMA 4AP5A 4EX7A 2Q3FA 1DTWB 2VXOA 2PRIA 3BIFA 4QBFA 5EINA 5KQMA 3LXMA 2DJIA 3BKXA 2W2MA 4KAXA 3Q5DA 5KQPA 1W6UA 4U6QA 1UDRA 1AZTA 1XAIA 2BV3A 2PN1A 5I7FA 1U02A 4MI6A 2AMFA 1KOFA 5H02A 3AI7A 3MWDA 1ISMA 1DB3A 2YJTD 2NZUG 5KTKA 1P2DA 2LIVA 3ZE1B 2NQ2C 1F4LA 2P5YA 3CKKA 3GCDA 4YJHA 1GZUA 1WOMA 1Y7LA 3B70A 5DYWA 4DGSA 4TTJA 3IEIA 3D7MA 1B73A 3ER9A 1VJ1A 4FMDB 4QLOA 1US8B 4ZI5A 3C1UA 2AXEA 2O5VA 3UW3A 1V0JA 1T2UA 1H2XA 5F64A 2FFHA 1NBIA 4BS9A 4MUNA 4PO3X 2IBSA 3BAZA 3HUEA 1FA9A 4ZYXA 3P0EA 2C2ZA 1N5IA 2YNMC 3FDZB 3ZTTA 5JD4A 2O5CA 2KYRA 3W5DA 3UMCA 4X94A 5JYBA 1NNEA 2X9GA 2YHAA 4MGZR 5FI1B 3RKUA 3H8JA 1SULA 5EE5B 3VHXB 3HRKA 5C5IA 1ID8A 3RUDA 2FGJA 4KXYA 1NSYA 1RYDA 4I99A 4RZIA 4KEAA 1L4MA 4IIYA 3MLEA 2Z3VA 5C0OE 4G0OA 4B3XA 1H93A 4C4RA 4HSEA 1KO7A 1POXA 3ETGA 4GE0A 1WLYA 3VC1A 4EZEA 2ETVA 2PYZA 4IGAA 1NBMA 1WU7A 4QBGB 1EGHA 3H4MA 4Q0MA 1NF2A 1ETUA 1P1RA 2RHRA 5FBHA 3ZKWA 4GOND 1XHFA 3N2ZB 5THXA 2CFSA 2FWPA 4KQGA 4JI8B 4XR9A 4YS6A 3HXMA 1E9AA 3H1EA 3EW9A 1E4EB 2JGDB 3I6YA 2I6TA 2YC4C 1Z83A 1MHTA 1I1QB 2H4WA 3G0CA 3PHJA 1LU9A 1RYZA 3TOXA 1COWA 5TQVA 4BCCA 2QQEA 2NSYA 4TLDA 2UXBB 5F9FA 2BP7B 3LFUA 1TD9A 1UP7A 3OICA 2HA5A 4MP3A 4OQQA 1ZGGA 2BMAA 3I2YX 1JWBB 5CDFA 3CJRA 3UBMA 4REQB 1ZVVA 4M0DA 2A5GA 6REQB 3SE0A 4RAOA 1Z4PX 3IPRA 3U16A 4AUNA 2P77A 2DQSA 1ZD1A 3OIFA 2IYFA 5ERGB 2IXTA 2GH1A 1JHZA 1DI0A 3A7EA 5KTMA 4HQ6A 4BJ3A 5JCXA 3IHWA 4IMRA 1NL3A 1BCRB 1P0FA 4UOQA 3DL0A 3FBTA 3F6BX 1C0KA 2C9BA 3B8EA 5DNDA 4F84A 5IHPA 2VJBA 2UYQA 4QREA 4M7WA 2XODA 1UWLA 4GKJB 1K8YB 3FNFA 4RCZA 1I4DD 3O1JC 4M55A 2C95A 3SICE 1B93A 2VTEA 3KHUA 1W5FA 3TI7A 5IJ0A 3BHIA 3O1LA 1DBRA 3QKRA 4DNPA 2ZREA 4WA8A 3WICA 5AK6A 4B4VA 3OFVA 1Z5GA 5L3RA 3FZGA 3RAFC 1ONPA 2WJWA 1RABA 4HNQA 2AJCA 3CEJA 3OFJA 2G17A 2Q4BA 1CYEA 4KW7A 3H5LA 3B7WA 4RFLA 1T0UA 2JLSA 2WIDA 1BKSB 2EBWA 3MMZA 3OJXA 3Q0TA 3MJEA 5E9QA 5FTJA 3AUAA 2VJQA 3GLGE 2Z3ZA 2C3OA 3DZCA 3ROKA 2FEXA 4G5GA 1G21A 4JLKA 4XYGA 3GG2A 1IHXA 1DKQA 4AZSA 3O93A 3F1KA 5CFOA 2CSXA 1XZMA 1YB4A 1PZEA 1KXZA 2CCKA 2YNMA 3HFSA 2UUOA 4TXNA 2G88A 2WA1A 1PUIA 5CB4A 1Z88A 5KOYA 2G5TA 1TA0A 1SKUA 3TXXA 1K75A 4RTQA 4WBNB 1NE2A 2X0JA 4TX1A 4QYTA 4ZV4A 2XV1A 4B0OA 3WO0A 1KC3A 2QUAA 5ITVA 3MCWA 1I5EA 4BAZA 5EJGA 4X44A 1WDKA 2PEYA 4KHPB 4TVSA 1MP0A 4HGPA 5LU8A 1UPFA 3L8YA 5JLAA 4AYTA 1Y7HA 2VJMA 5A4DA 2D2IA 4RTKA 4RZUA 1IB0A 4XWYA 5AI0A 1FUEA 3BEOA 4YDSA 2VC2B 4GZ5A 4EDFA 1IM2A 2Q5OA 2QD4A 4MKFA 3E2PA 1PFUA 1Y1PA 1TCUA 1YXMA 4JUIA 4M8IA 5CLFA 3CINA 3ACDA 1SCJA 3BIWA 2FEAA 3CG4A 1X14A 2P68A 1PLKA 2YY7A 5AW9A 1P2UA 4AO6A 4WWHA 5CJPA 2CN1A 3WFIA 2BMJA 2A5YB 1OXVA 1YNSA 4UPDA 4MVJI 1JTFA 2BFEB 3KJNA 2ODNA 1BW9A 1GQYA 3HR8A 1P1HA 4RY2A 1NNUA 2H2GA 3GEIA 3K9LA 1YL6A 1ST3A 4P5PA 1D0IA 1YVDA 1GTL1 2WFMA 4QNMA 4YROA 2HBZA 5CYFA 1W85B 4EKIA 5JVDA 4D0RA 1W36B 3F74A 3VVCA 2C2MA 1Y4SA 4GPBA 5E4JA 1W52X 3LPAA 4XB6B 5KDLA 1Q0LA 1OI4A 1M8PA 2KHZA 3MGGA 1CNEA 4CDGA 1NLZA 3SIRA 1L7DA 2IHZA 2KLBA 2Q6LA 4LJKA 2SECE 3U3JA 4ZCRA 1QRTA 1NR7A 3UJBA 1C4OA 4EJSC 3EG5A 3ZWCA 2R47A 3QEMB 1I3NA 3T41A 3STVA 3Q3GE 1Z8HA 5KYUB 3W5SA 2D8MA 3KLOA 3VR2A 5T41A 2VAWA 2Y4OA 4X8MA 3HH8A 2O3UA 3EG9B 4RV4A 4B73A 4I5GA 3TQRA 4F2HA 4YRBA 1PFQA 3RGWS 3IQWA 1Y9DA 3I4LA 3BD8A 5A2GA 1FTWA 3UHPA 4AT1A 4F86A 1X1QA 4WXYB 3OZSA 3FJOA 3KELA 4XLTA 4B46A 3OOWA 1YBAA 1X3LA 4Y6OA 3OLVA 4OYLA 2Y66A 3BSYA 4JH0A 1PS8A 1NONA 4C43A 1XRJA 2GASA 1OLXB 4BQEA 3WZMA 2BKVA 4DGQA 3QUTA 3QE2A 4C7KA 5FLKA 1PL8A 1A27A 3JZMA 5IKEA 1XHLA 1FUIA 1T29A 4M0MA 2JIZD 3JVIA 3BE8A 5FUVA 3REQA 2PZLA 3FYUA 4QU9A 4DUPA 1BEEA 2EQ5A 2JGAA 3TBKA 4BPRA 4HNUA 5EJ5A 3UV7A 4R0NA 2UU9B 1R0WA 1UDBA 4MVJH 2F7SA 1LLUA 4JX8A 3UNXA 5CB4F 4QM6A 3C2QA 4ZJUA 1X80A 3NAQA 4XTCS 2GYVA 4BZWA 2FEMA 3CX8A 2WLSA 2D4HA 2ZWMA 5FL7D 2FW8A 2H59A 3NEAA 4ENSA 4KQCA 5FUBA 1U1FA 5IT0A 3LQYA 3RSSA 1KIFA 1J2UA 3OO1A 1Q1ZA 3EY9A 4YCBA 3V46A 2IH5A 3IEVA 5CCEA 2O8NA 5JH7A 1PG5A 5DT2A 1OASA 2MDTA 3HPRA 4OYRA 4PF1A 1KU0A 4YJFB 1LY1A 4ISBA 1X7WB 4MB6A 1V9CA 1VP9A 4N3BA 1RLOA 2ZSBA 1BDMA 3COZA 1Z06A 4FONA 1IIRA 4K81B 3WYBA 4RMJA 1W0JD 1ZL2A 1SZCA 3CRW1 3OOYA 4F12A 2P1ZA 1V5WA 5H70A 2WE8A 3L40A 3NM6B 1GGFA 2ZTMA 3AFOA 4XM1A 1C0EA 4HN9A 4DVGA 4CTMA 4FKZA 2EW2A 5TMEA 1UKZA 2ONZA 1YMQA 3QKSB 2V65A 1FRZA 3GQBA 1H0SA 3DGEC 5J1TB 1VIAA 2Y8EA 4JQSA 4N54A 1SUDA 3P52A 4BNDA 3L93A 1DAHA 2WUGA 2FLWA 1B8VA 3L4BA 5SY4A 1O6FA 1EDBA 3CLTD 1ZIOA 4KG7A 5FAKA 3C3PA 4JNCA 2P9QA 4QQNA 2H51A 4EJSA 5ELXA 1TU0A 3LBYA 2NTJA 5FPSA 3KPYA 3KYCA 4KU4A 4DQXA 3FYSA 5JAQA 5C8VA 4V1CA 2CLLB 3IVMA 5ITZA 1W4BA 2X7HA 3O92A 4QSHA 2PV0A 3K0BA 5H82A 4B4KA 2PS3A 1YZKA 5G4KB 1E59A 4A3SA 4YT5A 2FMIA 2FPSA 1SUAA 3GVXA 3IULA 4MX8A 3H9EO 1PT7A 1UADA 1O5IA 4PZPA 1Z13A 4WKNA 4WOPA 4NBLA 1FFBA 5AW1A 4FC7A 2OO7A 2MYUA 2VDMB 3NJRA 1T5HX 4GM4A 4A8PA 2O06A 3HXLA 3EMDA 1X92A 2FVXA 3ZXYA 4QPJC 2BBOA 1OVGA 4BLTA 5C4MA 1G5IA 4P34A 4ARIA 2XT6A 1U0LA 3KUKA 4IOJA 2O7NA 1G2PA 1EDEA 2J87A 3AGPA 3GGJA 2BFNA 4W1SA 2IUSA 4JJ7A 4HUTA 4DCUA 1TKAA 5LQNA 4E5NA 1NI4B 2P9YA 3OEYA 3U3KA 2QL5A 3O91A 2X2PA 1N7GA 5K8VA 1FJXA 1NTRA 3DCJA 1E6MA 5D3QA 1NV8A 3HJTA 2QT0A 1QLJA 1FMTA 2PRZA 2VK8A 3T61A 2WOJA 4JQZA 5TPWA 1JMVA 1KY5A 2OPHA 3ZJVA 3A2KA 1SIOA 1JEOA 4GO1A 4M9ZA 3GG9A 2GCOB 2IXEA 3EMBA 4QFDA 2JLUA 1OI7A 2IIPA 2IU3A 1QVAA 5KYGA 3ESCA 1XNHA 8OHMA 2AFIE 1QB8A 1RQ7A 3O7WA 4MVCA 4FVTA 4ECEA 2GN2A 2AN1A 2WJJA 2XBUA 4IIGA 3DXXA 4PE5B 2AK3A 2V96A 4QBTA 4UAGA 5ALIA 4N5LA 1NUUA 2VYND 4W1RA 4BUZA 4F46A 3ZLJA 3IX7A 3KVNA 4URZR 3W2TA 1FYEA 5DSTA 4NPCA 1HOTA 5E6RA 1ODLA 3F5DA 4Y6SA 3ROQA 4S35A 5H80A 3MAGA 4ZCIA 4KIFA 1Z6TA 4S1WA 1YCHA 3NW9A 4W82A 4J3NA 3S8YA 1JDNA 1B8OA 3ENWA 1OSNA 1JSZA 1G5HA 1U9JA 2H7YA 5LA6F 4LVOA 3QITA 3WMEA 5H9VA 3R5XA 3PUJA 4MK4A 1M67A 3PJDA 1URPA 2XUQA 3COPA 3PG5A 4ZALA 4ZI7B 1B23P 1FMCA 3QHPA 4LDQA 1I2MA 3DLPX 4IUCS 4MQEA 1RWBA 4FFSA 2PFSA 2HSJA 1AUQA 3MFYA 1V7ZA 3PWKA 4DMMA 2F59A 3GRPA 4DLUA 4BNGA 4DKXA 1LCIA 2B20A 3RUFA 2FWBA 3JYOA 1E7YA 2J46A 4LG1A 3C3YA 3L82B 2V55B 1KR5A 5EESA 2ZUWA 3TQHA 1ZZGA 3IIIA 4IRUB 3TFQA 1GNSA 1HEYA 2J4FA 3T9DA 2DLCX 1OB5A 2IOFK 3B2EA 4MV0A 1RXCA 1WUHS 4I46A 4O4IF 4Y6GB 2JLCA 4RSHA 2A57A 2OZPA 3TJRA 2GB4A 4KLRA 2O2IA 2W6IA 4LX8A 3S7TA 4NMXB 4LY3A 1Y37A 3FF1A 1JEAA 1M2OA 1U28C 1RS0A 3PHLA 4X6XA 3NRJA 3QK7A 5JISA 1BQ4A 2CVZA 2IKSA 3NDRA 4HB4A 4P4NA 5AXAA 3VKVA 2ODAA 5CDSA 1YV9A 3MBIA 1G7CA 2UUCB 1VL5A 3SK0A 1B8NA 2Q41A 4AMGA 1F2VA 1DMSA 3OH8A 1PGQA 1N7HA 3DKKA 5BXYA 5CT8A 3AHCA 4DLXA 3ZH2A 1L5ZA 2A35A 4FUTA 2WD8A 4RVUA 2K4MA 5BO5A 1K98A 2FJUA 2G4LA 1YOVB 1EX1A 3RS2A 3I4FA 3TYXA 3GLIE 4S1NA 1KBOA 3W5IA 1KEPA 1M8FA 2GZRA 3CN7A 1LNSA 4YXWA 2B5WA 4BZQA 2ZRHA 3T6KA 5IG2A 3SKYA 1NT2A 4L5YA 2D7DA 4LOKA 3BHJA 1YDEA 3LAWA 2A5LA 2QENA 2CBXA 2FQXA 1VHLA 4PSDA 5BYJA 3RAJA 1RSZA 2IQ5A 4NOLA 4BV2A 1NU8A 1NVVQ 2WSYB 3N28A 1W25A 3L7AA 3ADKA 4UHEA 3RAEC 5D5HA 4CMIA 2EAUA 3UGJA 3L43A 2AQHA 1RZRD 2ZE8A 3Q1LA 2Q2NA 4FUQA 2SICE 1PKXA 3MUOA 3DYVA 2H1VA 4UPVA 1JS1X 3PUXA 4Y2GA 1OD6A 2CNDA 3U4GA 4L72A 4EB6A 2ECQA 1PO7A 4JI4B 1TC2A 3A58B 3GZJA 3VOTA 2KS6A 4HVCA 4WUTA 4WE3A 1KE1A 1RLJA 5BMVF 3A2MA 3F3KA 3I83A 1F38A 3RU9A 5C7YA 4Z5XA 1UC9A 2A3RA 4NYJQ 4KLZA 1CJUC 1M34E 4P3PA 4C2TA 3GEEA 2PU7A 1OA0A 1BGVA 2MSNA 1M5RA 4KUHA 1SU4A 3WK7A 1J1IA 3IERA 2JDID 3B5EA 3UV6A 5L3SA 3U60B 4PCUA 4HDCA 2OCDA 2P4SA 4C4XA 5BV8A 3V7WA 4EJ2A 4Y1RA 4ER7A 1R9GA 2Q0XA 4F7DA 1GYRA 4B9EA 4UTRA 1YS4A 2W6OA 8AT1A 5ADUS 1SUEA 3ONVA 4ZPXA 5DYTA 5GJVC 3UUWA 1PFGA 3Q15C 3INYA 1UDCA 1TK3A 1QYDA 3WG9A 3IT3A 5TSDA 4MROA 4GYJA 4RF2A 4V3CA 3EEOA 1G64A 1SXIA 4JYMA 2VBFA 3ZV3A 4JLWA 5FULA 1PJLA 1BDIA 3K0HA 1DT3A 5A9SA 2ZU6A 3OCJA 2I7DA 2AT1A 4DLAA 3QPAA 3PE3A 3S99A 4YAKA 4E0BA 1T6BY 3IOBA 1VE6A 5H16A 1C9JA 2RB5A 4EB8A 5IVPA 1O2DA 4WINA 1K8ZB 3QWHA 2FJ0A 3DFMA 3E9EA 4OP2A 4RZXA 2ZGVA 3AKYA 3NGMA 2CHEA 2NU6A 3QVGA 1W1IA 3DBRA 1CE8A 2DZDA 4FD2A 4PRKA 5FJIA 1QGUB 1N2CB 3N2KA 4QOIA 5B2EA 1F0YA 2FX5A 2WJ3A 4RVCA 5CFMA 5SICE 1LK7A 1DDGA 1SCNE 1YVRA 2B36A 3JALB 3L05A 3LRPA 3M33A 4MCJA 3U9LA 2VHYA 1NQXA 1ACLA 2HNKA 3BN3A 1AUOA 1S01A 4KI7A 2XB6A 1NC1A 4PC7A 4YJ3B 5JPIA 2OQVA 4E3WA 1UK7A 1UBLS 2HQ1A 5DTJA 1I0IA 3L79A 4BLQA 1MX9A 3KQPA 5F3RA 2Q8PA 2ZE5A 1HDIA 3HU5A 3JW8A 1TQ8A 1QHXA 3NBUA 1EX7A 3O82A 3QMVA 2GEVA 4J0HA 1PJAA 1X8XA 2NTYC 4LMRA 5H81A 3TD2A 2VNHA 4BAUA 3C0KA 3ZK7A 3UHOA 2X8WA 3DMPA 5IZ4A 2O8VA 3ANSA 3W34A 2HSZA 1JGTA 1OBHA 4Y18A 3RSGA 3WYAA 3ZQKA 4EYGA 2HU2A 4V39A 4PYIA 1QH1B 4JQCA 3FZQA 3VDNB 3V48A 3FETA 2PZMA 2J9FB 3ZCVA 2DRIA 3EDOA 1T8WA 2YJGA 3L07A 3L9WA 4Q4LA 4HDSB 1BYIA 1WHTB 3B6ZA 4KBYA 2ECKA 4KOEC 1ZCBA 1ZH6A 2GJKA 5DP2A 3PWTA 1JHRA 4B2YA 4EUHA 2UUAB 2JEZA 5EZYB 4UUAA 2GNPA 1EE9A 1YDMA 4B79A 4LTNA 1L4YA 4OSPA 4B3MB 1Q7TA 4G0VA 3O8DA 4QGAA 1GQ2A 1WQ1R 2V6GA 5LDGA 1PYOA 1XROA 1UZUA 1EHCA 3ZYCA 4MVJF 3KG2A 3U2QA 5TB5A 3SQLA 4ER3A 1O3YA 1SBTA 5E9AA 2QM3A 5C1DA 3MWGA 3SU8A 1EA5A 2CB0A 2NUAB 1WEHA 2IF2A 2NWQA 4XFKA 1J42A 2MR6A 1F17A 4BN5A 3NMUF 4L02A 4N6GA 1WW3A 2M98A 3O4GA 5AVYA 1SRQA 3NZEA 4JC8A 2WWYA 1G9SA 2UXDB 1OAOC 4RF4A 1WO8A 4S2UA 2RGEA 2RJNA 4FMBB 1TA4A 4AD8A 2FVYA 5EKDA 3WDLA 5HPYB 5E8JA 5JT1A 5LIPA 1Q7BA 4R2WA 4U9IS 1LI7A 3N3BC 4L4YA 4ESEA 4GU5A 2BY4A 1J70A 3NBMA 5T4FA 3M6FA 5ILQA 1VECA 4IFTA 4HYQA 3T3PB 1X1EA 2Z9CA 3GCWA 3WFZA 1OZGA 4D9CA 4FHEA 4OGFA 1H3FA 2BONA 4K9LA 2PL1A 2NUTA 4CI0B 5F4ZA 1K0UA 1TYAE 2HU5A 3D6AA 4FNMA 1PVOA 3JVDA 3SN6A 5K6AA 3LVBA 4Z9BA 4L8WB 2V03A 3BD7A 4R31A 5FPYA 3UMFA 3TTWA 1DKPA 4ZQCB 3PGLA 4RD2A 4GLJA 4OGKA 4NDNE 1WUJS 4RYDA 4AXXA 4CMEA 4CT5A 1I9CA 4F4FA 5JJCA 4K3VA 1EUDB 5TLSA 2GTHA 1HL7A 3D6JA 4FMCF 1YQQA 3GFBA 4ZCLA 4TVBA 2C92A 3AJEA 3E2IA 4Q4AA 4W5NA 4UAVA 3Q7RA 3TG8A 4J03A 4TN5A 1IK4A 3UJPA 3D1LA 2PD6A 4HCJA 5T4HA 2ZRCA 1TUEA 2XCTB 1JA0A 1ECGA 4ETNA 3NBYC 4HS9A 3G2LA 3OY2A 2VTDA 3MK31 4EITA 5LDDC 1KZ9A 2Y1GA 1F06A 4UNNA 3QWFA 2FR8C 4V2UA 5ESWA 2AN3A 1R9JA 1CY8A 1HH4A 4WK2B 1X38A 4S1TA 1E8NA 4UVIA 5KNDD 3NTQA 4TYYA 2R8ZA 1FY2A 3BUSA 3T7IA 3TZKA 4FYMA 2F8SA 2GKSA 4PS1A 1QV9A 4G23A 1KSHA 4TN1A 2GERA 3EC1A 1MG0A 4HD8A 3C7CB 1XEXB 4K6OA 3IAM6 2QP4A 3LU1A 5FTLA 3BXZA 3J81A 1WY7A 2BKUA 3THOA 2WSMA 2XJ9A 1E1MA 3Q7IA 4YDRA 1NURA 3D7SA 4LCJA 4DREA 2RIRA 3LFHA 4ZT3A 4BZZA 4XLLA 2WJPA 4MVXA 4ZVQA 2F1IA 1YDWA 2EBUA 2J30A 4W9MC 2FDCA 4ZVLA 4Z7QB 4Y9TA 4AS1A 4IR7A 1DG3A 2QF7A 1Y8CA 5D7BA 4RVNA 3FDJA 1Q12A 1EBUA 2NYAA 1JZQA 3DBIA 2IUTA 2GO1A 3RO7A 3P2JA 1JI0A 2WHRA 4IIUA 4P53A 5CW2A 1CUJA 1RLTA 4R5MA 1YBFA 3Q0EA 5AICA 3LHSA 1I80A 1ECJA 3NTOA 5CNIA 3FM9A 1CDDA 3DAOA 3EXFA 5AOBA 3OOHA 3P5SA 2G9UA 4AJLA 4POOA 1M7GA 2QD3A 2JLXA 4PW0A 3DZHA 3ILYA 3RVBA 5K0LA 1K6XA 3AF5A 2VDPB 5JE8A 4KWEA 1LJLA 1EP9A 2IPOA 1K4KA 1P29A 1N6PA 2X1VA 2JKYA 2FP4A 2QL7A 2XOEA 4Y1EA 5BV7A 2PGOA 2X77A 3A1DA 2Q5QA 3H11B 5DIFA 2ONKA 1V95A 4IVRA 1RLIA 2O3RA 4OKIA 2WIJA 2V0NA 4OIFA 5EIBC 4E1AA 3SEZA 2D0PB 4KUGA 2WP0A 4WKPA 3AEQA 4JMLA 3KVYA 2ZRMA 1TQ2A 1S7CA 1BTOA 4O33A 4OEHA 3MBKA 4LGVA 4JL5A 5LBTA 5H3LA 2W22A 1M8KA 3B6MA 2I7CA 4B83A 2XDWA 3M6IA 2PVCA 3OHMA 2W2QA 4F4IA 1ZICA 4Y2PA 1E1CA 1I24A 5BYBA 4TS9A 3TAUA 2ZUBA 5K2OA 4YMSA 4JSTA 3B7GA 1TI7A 4NK4A 1JAHA 3JD2A 2IFTA 3GZTB 1FDUA 2A30A 2P4EA 2WHPA 2IF0A 1GEEA 3Q98A 1IJBA 1CQXA 3R20A 1MDFA 4Z51A 5A9SB 1RXSA 4D9MA 2QXYA 1DEXA 2AQ8A 3A4IA 1XELA 3LP5A 4FN5A 1C3LA 2C96A 4JUFA 2IHUA 3JRNA 4X7MA 2XGMA 1E61A 3D4OA 1A9TA 3GT3A 4RZHA 2QW0X 1OTYA 3VBEA 5MFPA 1W7AA 2GD2A 1E63A 3GRRA 2IPMA 2WK1A 3O2SB 2QB5A 5ITSA 4D8YA 3ZGZA 2XMPA 16PKA 1KZ6A 2CUKA 4CIYA 4Z4EA 3V55A 3DF9A 3DULA 2P2CA 2RDMA 3H9JA 4GP9A 3ZWQA 1I5RA 3KUXA 4RAQA 3SZRA 2XYHA 4EG0A 4JT8A 4QVIA 3A14A 2DHDA 4KH1A 4B6FA 2RFLA 2REOA 3OCZA 1QE5A 1B2RA 4YIHA 4B76A 1PEYA 4HNVA 3AU8A 2QQ0A 1VFNA 2JANA 2XX3A 1COZA 4HXYA 1KK3A 1FLDA 1OX4A 1TPZA 4YMWA 5A02A 1SEPA 3H6KA 4IIBA 5E6SB 3TZQA 4Z86A 4ER0A 3IELA 3CMMA 1WF6A 2X8JA 3MYRA 2Q62A 5JMWA 2Q1WA 2WM8A 3ANTA 1AC5A 3O74A 4LMBA 4IJVA 4RVGA 2ECOA 1ZN8A 4MA4A 2XTMA 4PLPA 3LKVA 4BMYA 4H7DA 5CK4A 4R3UC 4TKMA 1T5OA 1NVDA 1UODA 3U9SA 2OMKA 3I04M 2JGLA 4PYOA 2E3JA 1Z6XA 2D2FA 3NUGA 4U2GA 2WG1A 4OB6A 4PG6A 4W5HA 1Z0UA 4EY3A 4IHJA 1YR1A 5K1ZA 4Q3EA 1RWOA 3D64A 1JQLB 1TMKA 1WHSA 3H04A 1IY8A 2YC2C 1P31A 1JQ3A 2ZUDA 5DF1A 3RSOA 2NO9A 3WC4A 4E03A 1APBA 2AQKA 3GRCA 3IVRA 3PC8C 4RQAA 2ZSFA 1MX3A 4KFRA 1EEXB 4PSVA 1KMQA 1H2HA 1VL0A 5EKTA 3ZHYA 3VNAA 1NG1A 3CVYA 2MMCA 1W29A 1L9XA 2OC9A 4BKPA 2YIDA 3C7DB 4NG4A 2Z2JA 3E3NA 3KX2A 1JHPA 1VIDA 3GARA 1LC3A 2DQKA 4GXQA 1B8UA 1I3CA 2AC4A 2WC1A 4QPZA 1OZHA 1EG7A 3B53X 4PFKA 4H31A 1FDOA 1SXJB 1NW4A 1FRVA 2PS1A 2W2OA 4LHXA 4TQ9A 3ZEAA 5IS2A 5EMHA 1K2VN 3BMNA 1JTVA 1Y9ZA 1RBQA 1XAJA 4JKYA 4UUBA 2AA3A 1I1NA 1K7XB 5JFOA 1H2BA 2XDQB 1JDVA 3COVA 4G8DA 1EM8B 4N5NA 2W48A 1SWVA 3S2EA 2CJFA 5DM4A 3VOBA 3OQVA 4CKZA 2VDWB 5FNZA 4IWYA 3WFJA 4CNQA 2OTCA 2PG3A 3DTNA 3FI9A 1ZG3A 4UVDA 5BQOA 2M1XA 3PFNA 1UC8A 1NN3A 3CF4A 3D6MA 4OHWA 5DBEX 4A91A 3DVAA 3GGCA 4Y1GA 1L1EA 1ZRHA 3K70C 1FBNA 1WCV1 1W44A 1UP4A 3TS1A 3ZDDA 3S2YA 3ZHXA 3U4QB 3SEAA 1UK9A 2QX8A 3A10A 1XXHE 1DQNA 1X87A 3HLYA 2BR3A 1R16A 3NDPA 1H69A 1L5HB 4AXBA 4UULA 1Y34E 2DAPA 2HJVA 3B60A 4I1VA 2YMMA 5CHEA 3LSYA 5JSUA 3RLFA 3BH6A 1YTLA 4RBNA 2AFVA 1CR6A 1UPXA 2EBFX 4EVRA 4PFJA 3G2QA 4GS5A 3DL4A 3AOGA 4WLNA 5JOQA 5MN5A 2B4KA 4FNGA 3EXHC 2WVJA 4ND6A 1YQGA 4ZODA 4J16C 5A0VA 4D5EA 3OPXA