5AUQA

Crystal structure of atpase-type hypb in the nucleotide free state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
245
structure length
232
Chain Sequence
b'IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLRKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
publication title Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb
source organism Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Hydrolase
total genus 71
structure length 232
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5auqA01
2WSSD 3WHKA 3ZIAD 5FBVB 1PV4A 1UADA 1CULC 1VG9B 1YJ5A 1JXOA 5J40A 2IYRA 3W5JA 2D2FA 1W0JD 3W9YA 3GLFB 1BOFA 1S4QA 1TNDA 4WIAA 2ZE7A 3U2QA 3N2EA 3MWKA 2P3SA 4C30A 4C0JA 3AV0B 2JJ1D 1R5BA 1RYHA 3N70A 5J4LA 1X86B 4HEJA 3NEYA 4OQNA 4LSGA 2NZJA 1W0KD 1J99A 2IYYA 5K8TA 2WICA 2TMKA 3B85A 1KK2A 3KDSE 4BASA 3L8ZA 1KSJA 3U60B 1RRCA 3CZQA 2FOLA 4IDQA 4IEEA 4PANA 1EX6A 1ZP6A 5CLLA 3TQCA 2R6GA 3QVVA 4CIDA 2IYZA 3KQHA 5C46F 2RGNA 3KKQA 1E9CA 3QKSA 1N6LA 4Q4LA 2BCGY 1F6BA 4TQAA 2ZS8A 5J4HA 2AX4A 4DT1B 4IFBA 1FL9A 2KSQA 2YOGA 3L0PA 3RC3A 3GPLA 3K0AA 2FFHA 2CEAA 2ZJAA 5AWFC 2ONKA 4AYWA 4RVCA 2GJKA 2EFHB 5DYIA 1H8HD 1U99A 4LK2A 2H17A 1DELA 1P2VA 2OXCA 4C0HA 3FMPB 2HJGA 1QHGA 3W90A 2QA5A 3T5DA 4L9SA 1GSIA 4HSEA 1KO4A 4OKSA 4Q1FA 2WAYA 1XTRA 4R71A 1NY6A 3ZS9A 2G77B 3C5CA 5G40A 4HLDA 3K0FB 2QTHA 3L82B 1OF1A 5L8VA 4DDTA 1S0UA 3I61A 2PZFA 5GVRA 1MABA 1OFIA 4HZUA 1OJLA 4X8OA 5FPYA 3PEWA 4Q4AB 4W5JA 4QKQA 2QMHA 1IXSB 3VMFA 3FMOB 2AXPA 4B2LA 4CF7A 1HQYE 2RMKA 1GUAA 3HR7A 4PC7A 4FWTA 3THOA 3CWZA 2OO7A 1OXVA 1F48A 2WIAA 5F98A 4RCYA 3C7KA 3UKDA 1IY0A 2IL1A 3RS5A 1R6BX 4B3DA 3I72A 4I99A 1CRQA 1CLUA 4DLRA 3SU8A 1AIPA 1E9SA 1G7TA 3I8XA 5FFMA 3NTUA 5DYGA 3BXZA 1FP7A 1KDRA 1VHTA 3EPHA 4B6EA 1KMQA 2CDNA 2X2FA 4A15A 2FX3A 5KNBA 4PQFA 4N1AA 5SZKB 4YMUA 5KSPA 1X3SA 3HWSA 3LX5A 2VEDA 4D4MA 3I92A 3E70C 1G18A 3QI2A 4O0MA 2EYUA 3RYTC 2Z4RA 4L16A 1G6OA 1TPZA 4IVPA 1XMIA 4U7DA 1VYVA 2XGJA 1DG3A 2H5EA 2ZI9A 1XFAA 1YZKA 3T1OA 4TTPA 4AKIA 2I1VB 1M7BA 1T0JB 2HCJB 4LBVA 5CM8B 3IDQA 1FTSA 2J1LA 3OIVA 3OE7A 2J0QA 1AN0A 2QNRA 2VLIA 3K70D 3NH9A 3OIYA 4QBHA 4LUCA 3U3RA 1P2UA 1LFDB 4O2RA 1CJTC 2CBZA 4FINA 4TL6A 2FPMA 1VPLA 5FUYA 3FHCB 1CKEA 1G7RA 2QMUA 5EXSA 4C7OA 3OHMA 3TSOA 1OFHA 5FR2A 1GTVA 2WPDD 4O3MA 3QNUA 3P27A 4GBMA 5FOUA 3TVTA 3WRYC 3AP1A 4Q9JA 5C18A 2XB4A 1FX0A 4YLGA 1Y3AA 2YINC 3NBXX 1Z28A 4PO1A 4DCTA 4DBLC 3I5YA 3FMIA 3M0EA 2IC5A 5CYPA 5CDFE 1E9FA 1ZNWA 4PPNA 4JMPA 1J8MF 1XD2B 3KKMA 1SVMA 1NVWQ 3H4MA 4AYXA 1NMXA 4HZIA 4UNRA 1XWIA 3EXAA 2WOOA 3HJNA 4QC2A 4A0RA 2CCGA 1PLLA 4PX9A 2ZVQX 2K5UA 2XTZA 2AWNA 2ZI4A 4TLEA 4C0KA 2E87A 1G4UR 2HUPA 1GG2A 1E1RA 3I73A 2ZR0A 5JHHB 3EPLA 1D9ZA 1JBKA 3CWQA 1SKYE 1COWA 2IYXA 2FZLA 2C9CA 3R8CA 1G1MA 2RHMA 3TNFA 1YR9A 5JZVA 3ADCA 2ANBA 3RC8A 3GLHB 4DWJA 1E79D 3ZH9B 5KOYA 2XB2A 1E0AA 5HCIA 4TTRA 3EAQA 2OBMA 1KMHB 2CHVA 1ZIPA 3BC1A 3NKVA 4PO9A 2VHUA 5EQTA 3UMFA 5TMPA 1KTVA 1KJWA 3I1FA 1KI6A 2FN4A 4G01B 1DS6A 2AD5A 1J90A 3T1VA 1IM2A 2BM1A 2GXUA 2PMKA 3ETLA 1RRGA 1N3BA 1G9XA 1ZC4A 4Q7KA 4S35A 4IRUB 4M4SA 4C2TA 2WJVA 3OEHD 4M9SA 1SHZA 4NE2A 4NYMQ 3RDPA 2VIIA 1KI7A 1FOEB 4LJAA 1GL7A 2ZSAA 3VHXA 2IYTA 1E9EA 1IBRA 2IEYA 3ZDQA 4D0GA 1Q0UA 3R9WA 5DI3A 4YMTA 3SJZA 3I5XA 1LV7A 1NLFA 2H7VA 4M9ZA 1UPTA 4ZO4A 4AG5A 2W83A 2NO9A 4M1KA 4KSBA 1NN0A 2CNWD 2IUTA 1MR3F 3HP1A 3ZVRA 1HH4A 4DXAA 3RRYA 2GCNA 4B43A 3GLGA 2QAGB 4RD2A 2NO6A 2ZRFA 4OHWA 5JSZB 4PAOA 2MSEB 2F1HA 1KI9A 1U9IC 3O47A 1VECA 1VCMA 1GKIA 2O8CB 4LJ5A 3OAAD 4RFVA 1ZM2A 1SVSA 4ON9A 4OK6A 3PR1A 3KTAB 2R6CA 2V7QD 3H86A 2OM2A 1YR6A 3CKLA 3F3YA 4KV9A 4BUJA 1TF5A 4AG6A 2OBLA 4QJ3A 3UATA 1T3SA 4B3FX 4DCNA 4EJSC 2X77A 4PAMA 4TT3A 5IRCD 5GJVC 1JR3D 4FCWA 4PC3A 4K46A 1SXJD 3CR7A 1G3RA 2LWIA 5JS8A 3C41J 1Z6GA 2XSZA 3AKEA 4A2QA 4POAA 3K8YA 4QOSA 3IPXA 2WJYA 3QKRA 3S1AB 1ZD9A 5A0FA 1VHLA 2UZIR 1XDBA 4TQUS 4BFXA 5IK2A 4JT2A 4M53A 1CS4C 1TUIA 2YHSA 4Q01A 1YRBA 1JALA 4NYMR 1G3QA 2J5XA 2XJ9A 2P67A 5FTLA 2O8EA 2G88A 4GP6A 1TMKA 1N25A 3DMNA 4A0FA 3D6TB 3W6OA 3GEHA 5CIWA 2FSGA 1QHSA 1GL9B 1WBDA 3LAWA 1P60A 4KITB 1I4LD 1YZLA 3AVQA 4WW0A 4FCTA 2WJIA 5JBQA 4C0LA 4Q48A 3BJIC 2V9PA 4HATA 4R9UC 2PL3A 1U94A 2G0NA 2VBCA 1OKKD 2RAPA 3B1YA 1KOFA 4JL8A 2BV3A 5AK0A 1HQCA 5FOTA 3NDPA 1EFRD 4PXAA 4ITRC 3UG7A 3U5ZB 1DPFA 4LHYA 4N3NA 3W5IA 5JWRA 2FWRA 2W6IA 3WMEA 3RNLA 5AUQA 1UM8A 1E2PA 2JLUA 3WHLA 2VP9A 4RD0A 3U44B 3GJ5A 1DO2A 2QPOA 4LWZA 4F92B 4CEHA 1EG7A 4ZDKA 1VG0B 1ZUNB 4I1SA 4RZXA 1OW3B 1KIMA 4M0LA 5C2JB 4MKHA 4DIDA 2NOAA 2AL7A 4BZXA 5JCZA 1KY3A 2XNDA 4BRWA 4C3ZA 3R20A 1N6OA 2WJGA 5KSYA 4BFWA 4HB3A 5H68A 1J70A 2O0KA 2QM8A 3VNVA 5HTKA 4OK5A 3T35A 1GNPA 2F43B 1NNEA 1G8YA 3TR0A 4OQFA 4YMVA 2D74A 1A7JA 3WP1B 4MQBA 2UZ3A 2FF7A 1LTQA 1HUQA 3B5JA 1M1YE 1XP8A 4DLUA 2V55B 2HT6A 3A8TA 4Z1MA 2BHRA 1NY5A 5FR1A 3SNHA 1Z47A 5H8WA 3GJ7A 2CHGA 4JLNA 4QNMA 5SZIA 4XJXA 2B8TA 4A8JB 1N5JA 5L3QB 4EFLA 4A4DA 2ZYTX 1TL7C 2X19A 2GCOA 3MG9A 2W00A 1E2NA 3EIEA 1E99A 4TQ9A 4TZ0A 1QBKC 4BGDA 2J46A 4Z54A 1EWRA 3QOFA 2ZYUX 5JRZA 3SN6A 2VTKA 4GPTA 1U98A 5EUMA 4OQXA 2JJ8A 4B32A 5JI2E 3MLEA 5FBRB 2EWWA 3HU1A 1IONA 5HZHA 2FG5A 4PHHA 4WOPA 4FWIB 4QFMA 3Q9LA 4ZI2A 2WKPA 4HAXA 4TL8A 2IUUA 1W2HA 2L0XA 5G53C 5K8IA 1BYIA 3IO3A 4DC9A 4D82A 2JIZA 1KK1A 3RSOA 1HYQA 3CRW1 5AR1A 5LB2A 1CBUA 1GKYA 1MV5A 5CM9C 3RS3A 3JZMA 4LDJA 4M2LA 1E3MA 2J7PD 4OYHA 1Z83A 4RY2A 2J41A 3B13B 3ZYCA 3TR5A 2ODWA 4RCZA 2V1UA 1HURA 3NHAA 3G82C 4BECA 3SFZA 1QVRA 3KXKA 3T12A 3QIAA 4B2IA 4NTZA 2A7QA 4EKDA 3PIRA 3RABA 4G5RA 3AF1A 1ZUHA 2ZR9A 5JRJA 3VU9A 2W6JD 3CRQA 4OQLA 3KFXA 3FKSA 2WAXA 3RAPR 121PA 1XEWY 1NP6A 2BMJA 3U3JA 1RC8A 2REXB 4TL7A 4B73A 1GM5A 1D2NA 4ARZB 5JEEA 4V03A 1TF2A 3MSXA 2O52A 3TW8B 4W5WA 4C0SA 4ZDJA 3AVWA 1YKSA 2CVHA 3P1JA 4LBWA 2ZIAA 1Q44A 4CZ2A 1W47A 2QRZA 2GJ9A 2ZR7A 4N0EA 2VPPA 4LYAA 1Z0FA 2VHJA 1YR7A 4JLDA 1NN3A 4LV8B 4NDZA 4NYJQ 2AWOA 2J59A 1AS3A 4TWZA 4FW9A 1ZNYA 4LBZA 2QBYA 2ERXA 4JBXA 5DN6D 1U9IA 1XTSA 2OHFA 3RLFA 4F38A 4KODA 4Q03A 4AK9A 2I3BA 4LC0A 4DDVA 3CPHA 1E1QA 3KJGA 3NC1C 4BFYA 4QHYA 1G19A 1U0JA 2OILA 2QG6A 1GDDA 2F9MA 1XU4A 2VSXA 5CIQA 2FDCA 3U4QA 2O8FA 2C99A 2DWPA 2XZOA 4XD7A 5KDDA 1HE1C 4LJ8A 4IVQA 2IS6A 2R9VA 4DDWA 3GP8A 1KZ7B 3DMDA 3BIFA 4EJSA 1ZJ6A 4AY2A 4D4KA 3UIEA 2ZTSA 1ZIOA 4FMDB 1Q57A 1QDEA 1E4VA 2ZRBA 3LBIA 3TSWA 1NBMA 4E07A 1KI2A 3EZFA 5DE3A 3T06B 1IN6A 4HZUB 3TRFA 1WRBA 3KUDA 1WBBA 2WM9B 2ZE8A 4FIDA 2D06A 3K0CC 3SJAA 2JJ2A 4RZ3A 3CM0A 4UNNA 3CB4A 3QKTA 3ZLJA 3VNUA 5AJVB 3TSZA 1LS1A 1BIFA 1DARA 4JBYA 4LPKA 5JECA 2OCYC 2YNMA 3FGNA 1XEWX 3PCRB 2WWFA 1NG1A 1TQ6A 3GJXC 4FCVA 4LV6A 4C9BA 1JEEA 4GL2A 1Q20A 4D81A 3U7EB 4OJKA 2QTVB 3SI7A 3X1ZA 4JSYA 1SQ5A 1UEJA 1G5RA 3D31A 3LVRE 3FHTA 2YV5A 3AUYA 1W36D 3UK6A 4DZZA 4LV5B 3L0OA 5TXGA 2OXRA 3TQFA 1CR0A 1XCMA 1E69A 5AJZA 1LS6A 4NYJR 4B6FA 4MDEA 4KLZA 1UBFA 2Q3HA 4JJKA 5EJEA 4MYTA 2H16A 1VYTA 4L4UA 3X1YA 2IW3A 5HE9A 3A4MA 2WBLC 4G5SA 1R0ZA 1R0YA 1CP2A 4KFTA 1N0WA 2G3YA 3KQNA 4JYCA 1XCGB 4ILEA 1XTQA 2WWYA 1S1MA 5BQ5A 3ZD6A 1P73A 1XJQA 3PUVA 3WBKA 5J47A 4AD8A 4F91B 1KK3A 4BFSA 1WP9A 2IYLD 2OFWA 4GP7A 5FUWA 3ZS8A 4KSCA 2KJQA 2XTNA 3BOSA 2PX3A 4MRSA 4QGGA 4AIIA 4DLXA 3ZVNA 2XITA 3LW7A 3MWJA 2QI9C 1HT2E 4Z8XA 2Q9BA 3TAHA 4XWKA 3DDCA 2NO1A 2GZAA 3BERA 3TBKA 3JZAA 1FX0B 1G20E 3AQ4A 4PC1A 4UJ5A 4XVRA 2QTFA 4MITA 2C77A 5IHPA 2JDID 5KPDA 4NCKA 5BN4A 4BEBA 3R9XA 4GOJA 4EPRA 2PJRA 1L2TA 3EA5A 2JASA 1E9DA 4Q4HB 4E22A 2NGRA 3OEEA 4EFMA 1TQ4A 4KO8A 5CK4A 4IVRA 4JLOA 1X1SA 2AHOA 1E2LA 2B92A 4KCGA 4MH0R 4QL3A 3TLXA 3K70C 3CRVA 2CVFA 3OZXA 2W0SA 4TN1A 1M34E 2BM0A 3KZ1E 3QPUA 1GAJA 4IJMA 5D3QA 3VQTA 2QGZA 1E0JA 4R2HA 2R65A 4DSUA 2ZM5A 3VTKA 3EC1A 1ZM4A 4Q4JA 4GZLA 4QGAA 3TKLA 3FE2A 2GJ8A 2XEXA 1KYIA 1G64A 1P61B 4HB4A 1XXHA 2C5LA 5LD2C 1JAHA 2CK3A 1N6IA 4TLDA 1XB2A 4TTQA 4XTCS 1H8EA 1U0LA 5KDOA 1XBTA 4M9XA 2JA1A 1Z29A 3SE0A 3DZ8A 2IWRA 1OPXA 3O8BA 1D5CA 1E2DA 1XMVA 2R6FA 1NSFA 2ZUCA 1ZM7A 2O0JA 2OFXA 4JJZA 1T91A 3BB1A 2F7SA 2QU8A 1UKYA 3KJIA 2IYUA 1KKMA 3QEJA 1VIAA 2OCBA 2GZHA 1QHIA 4WA7A 1DAGA 1XTJA 3SQWA 1P72A 4UXIA 5DNYB 4BZPA 2AFHE 2PX0A 3LQRA 5A5GA 4QNRA 1OYWA 3ND8A 3U3MA 1CJUC 4CEIA 5GVSA 4URVR 1GP2A 1TEVA 2GK6A 1XX6A 5DI3B 1OH8A 2MMGA 4K81B 1WQ1R 2UVQA 4PC2A 1QHXA 2QT1A 1AK2A 3LQQA 4PZYA 2ODEA 4LJ7A 3PFIA 4ZKEA 4BFVA 2O5VA 4GZMA 2J45A 4AI6A 3CF6R 4RD3A 4LRWA 4TMWA 5IF9A 2ATXA 3W6PA 3SZRA 5GADl 1N6KA 3GLGB 5GJCA 1PZNA 3SYKA 3AKDA 3ZIAA 1YZQA 2EU8A 3B1XA 3HPRA 4UKDA 1XZPA 2GILA 2IF0A 4V0OA 2EWVA 1UBCA 1QHYA 4IXNA 1OH5A 4B76A 1M2OB 4YC7A 1QF9A 3WMFA 1E9AA 2O8BB 2C8VA 2PBRA 5FH9A 2P2LA 2GXQA 4PHTA 4F4CA 3I62A 4DLYA 3KKOA 1EX7A 4BLRA 2FSHA 1W0KA 2DHRA 2WKRA 2REOA 1E9RA 1LNZA 3AP2A 1VYUA 5TB5A 1Q21A 1Z6XA 4P4SB 1Q3HA 3QKRB 4GMDA 5G3ZA 4KI0A 1ESMA 2OEPA 3UMSA 621PA 2QE7A 1IXZA 3B60A 3PG5A 2YYZA 1ZM9A 1AZTA 4DSTA 4TYNA 1DO0A 5EZ6B 4UNSA 3VR4A 1SXJB 4ZCLA 4Q9KA 4DLVA 4DEXA 3KQLA 1ANKA 3L0IB 2GJAA 4MYHA 3K0CA 4MRRA 2Y8EA 1VCIA 2ZUBA 2ATVA 2O8EB 2IT1A 3IIJA 5KDLA 4LHXA 2AK3A 3A4NA 1BMFA 1LB1B 1R7RA 2V1XA 3CPJB 3LDAA 4LC1A 4US1R 4M1OA 4YXWD 3CLVA 2PJZA 3AH8A 3K9LA 4JT4A 2ZJ2A 1F2TA 1VCNA 3LA6A 1ODFA 3R9IA 3IGFA 3QUSA 4RD4A 2D62A 4IDPA 4NCNA 3QKUA 1IN7A 4NONA 4UQOA 1N0VC 2Z4SA 3LVQE 3THYB 2AXNA 2IHYA 2CL7X 4RD6A 5LDDC 5G3YA 1SGWA 1XMJA 3MRSA 5EZ5A 3KL4A 4PHFA 3B1VA 4BLSA 4EAQA 5FOXA 4LCBA 1II0A 4UXJA 3TH5A 3GJ6A 4LJ9A 1AQUA 4NHOA 5BXQC 3HR8A 4LGMA 1TTTA 1D6JA 2SHKA 1TQ2A 2QRNA 4XIGS 1YQTA 1FP6A 1YRAA 3WXMA 1G4AE 4OHXA 2YOFA 1Z0AA 5LBIA 4QM7A 2X1VA 1E2HA 1ESNA 5DH9A 5BWMA 3IILA 1GFIA 1ZNZA 1N6HA 2C98A 4OHVA 2FPLA 3SBEA 3IBYA 2J0VA 2GAOA 2QP4A 2ZRPA 3RANA 1II8A 2A5GA 3OF5A 2X8AA 1KO7A 4HDOB 4IDOA 3MMPA 1LY1A 4PTLA 4G0NA 1A1VA 2F9LA 1KDPA 4DLTA 2YWEA 3ONWA 4PQRA 2V4ZA 1M7GA 1DOAA 4WZ6A 3NHBA 4QBGB 4X8MA 5L3SB 2R6DA 1ZNXA 1C4OA 4HB0A 2W2VA 4HUQA 2OT3B 2VO1A 4OI4A 3VKHA 5IT5A 2VP5A 4MDFA 2ZJ5A 3DPUA 3FB4A 1HTWA 3ADBA 5K8UA 3WBJA 1CJVC 1PUIA 1G5PA 2GCOB 2GHIA 3U6KA 1JQLB 2Q0HA 3PEYA 1F5NA 1FTNA 1S8FA 1RKBA 1OB5A 4OHYA 1E1RD 4LX0A 3R8FA 2A30A 3GLIE 1ZBDA 4TL9A 1COWD 1UDXA 1CTQA 3KQUA 1FFHA 4M22A 1U8YA 3KB1A 5AUOB 2FSFA 2GBLC 2Z5FA 2QQ0A 2DFTA 2DYKA 4DSOA 4Q1BA 4YONB 3AF3A 1ZD8A 4KFRA 1F2UA 3Q7PA 5KUTA 2GVDC 4R2IA 3MD0A 1NIPA 4HAYA 4PSVA 5CDFA 1BS1A 1WDTA 2EFDB 3SHWA 3VKGA 1NJGA 2JEOA 3ADDA 2CL6X 4OJQA 4US2R 4MA4A 5FPKA 2NG1A 4OHZA 2BMDA 3LRPA 2D4HA 4ESVA 4PPFA 2WIBA 1NIJA 4HDQB 4ZV4A 3P4YA 1W48A 4GDFA 5CLQA 1W1WA 3D8BA 4Q21A 3I3SR 3GLFE 3BGWA 1SVOA 2QM7A 1FQKA 2CE7A 4HAWA 1Z2AA 1JJVA 1DAFA 1RW4A 1VTKA 2LKDA 3CNNA 4L9WA 4TSFA 3BBPA 1OH6A 1EK0A 2AKAB 4KBFA 2FSIA 3E1SA 3CX7A 4DCVA 2IXGA 4FXPA 2R44A 1OT3A 4MGKR 4BFUA 1O87A 5P21A 5KSOA 4MKGA 3MUFA 1Z2CA 2QT0A 1M8PA 2IHBA 2FV8A 1YE8A 221PA 2QPAA 4RKFA 3LWNA 3O8RA 3QBTA 2HF9A 4A92A 4ZCMA 3BH7A 1JXMA 2ZETA 4Y0AA 3UWKA 4LJ4A 2ZRNA 1RRFA 3GLFA 2YC4C 1LF0A 3AF0A 4UNPA 4G5GA 3VAAA 3VR2A 3C15C 3HDTA 2J0SA 4URXR 4XTRA 1K6MA 5JS7A 1J2JA 3CIOA 4NCIA 4DLZA 1DE0A 4Q1AA 3KKNA 3FDIA 1SKQA 1EFCA 1KJYA 1XJ0A 1XEXA 3R7WA 5HKKA 4JLJA 4TT3D 1NN1A 5FBLB 3AGQA 2RKOA 3ZZTA 1FMLA 1PJRA 2DCUA 5DLQC 3WYGA 3P20A 2IS2A 2KI5A 2DR3A 4WXPA 3U4QB 3CO5A 1P4SA 2XAUA 1IJEA 2XSZD 3CZPA 2D2EA 3QY0A 2ZPTX 4AC9A 1N5LA 1Q1ZA 4M8NE 4O25A 1TADA 4AYTA 1E2QA 1D8TA 3LLUA 2BMFA 4M1YA 5D3MA 5IK2D 2A2ZA 2ZQ5A 1QHHA 1NF3A 1IXRC 2BCJQ 2BOVA 1U8AA 3AVPA 3WRXC 2PLRA 2YVUA 5EP3A 3SBDA 4WBSA 2P6RA 1JR3E 2WJHA 1P9NA 4C2UA 721PA 1SXJE 4BPBA 2NMVA 2P65A 3HYRA 4A2PA 2J7KA 3EZ7A 1RE0A 2H18A 1ZC3A 3A1UA 2OV2A 3OESA 5DHAA 4M1TA 2B8WA 3A4LA 1T3LA 4A6XA 2HJVA 3TUJC 2WVJA 2ZJBA 2ZI7A 2ZSBA 5L3RA 1A2BA 4IW3B 4BLOA 3SJCA 4IOLA 3IO5A 2JLSA 2QP3A 1XD8A 3OFNA 4Q00A 1Q1EA 4H1VA 3W8NA 2Q9CA 1XNJA 3U7GA 1C9KA 2ZRKA 3THXB 1E94E 3P4XA 2PCJA 4Q7JB 2IF2A 4CT4B 4Q66C 4JBWA 3L8YA 3ZZ0A 1KI1A 5FTJA 2ZU6A 1JR3A 2VRWA 3CF0A 3GCGA 2ZYWX 4HI0E 3P32A 2W6ID 4TLAA 1RVDA 2IYWA 3DVLA 1G21E 2QMOA 4Q4AA 2NPFA 3SS8A 1US8A 1KO8A 2QP9X 4JL5A 4OBEA 4TMZA 2YKGA 3WYAA 2ZS7A 2G9NA 1W36B 3SYLA 4TZ6A 3G5UA 2RCNA 1NSTA 3W8RA 4D2IA 3AVYA 1IN8A 3QPVA 5UKDA 1IY1A 1OHHD 4RZ2A 1Z5ZA 2QUZA 1WCV1 4GI7A 1X8KA 4PZLA 4DVGA 1UF9A 5A4JA 3K0SA 4CEJB 1L7VC 1FQJA 5EXTA 4ESHA 3NBYC 3PQCA 4B3GA 2J3EA 4NL4H 3CBQA 4B2PA 4CW7A 3ZQ6A 5LPNA 1I4DD 5FL3A 2LCFA 1RPZA 5EE3A 2Q6TA 2YJTD 3NEJA 4US0R 1AM4D 4JLPA 4U00A 1GIAA 4EFNA 2VA8A 2NQ2C 4Z1MD 4A9AA 1CRPA 3MWLA 2CJWB 2BDTA 2ONJA 4I1VA 1L4YA 2P5TB 1S2MA 2VYFA 4P4TA 5BYJA 3NC0C 2IWHA 3DKPA 1A5TA 2FZ4A 2RGDA 1Z63A 5LB4A 4P4UA 1XJCA 3FPAA 4EUNA 2RGEA 4TYYA 2XNSA 1E2MA 3RSLA 3H2YA 4RFSA 3AGPA 3DOEA 4B3XA 1S1CA 4KXFB 4ABYA 1BYUA 3BFVA 2QQEA 1EESA 4Q4JB 3FOZA 1MRSA 1MRNA 4MUBA 2F6RA 4L15A 2G1KA 3C16C 1NL3A 6Q21A 5KSZA 4TMVA 1ZCAA 2EQBA 4PQYA 5HCNA 4IOKA 4FN5A 1Z0DA 4Q19A 4I1UA 2F3TA 1C1YA 2ZREA 2JIZD 1MO4A 2ZRJA 4W9MC 4A8JC 4BQSA 5FL7A 2ZYVX 2OBNA 1DBSA 2OLKA 3LV8A 3GLHE 1I4TD 1HT1E 1N5KA 2C2HA 3L43A 1E96A 2KBEA 1JR6A 4GRAA 3HU2A 3LO5A 4DCSA 4Q1CA 4CT5A 1CXZA 5KO2A 5GJBA 2VP4A 4U5XA 2ZJ8A 2Q21A 3M1IA 2XOKD 3EASA 1VIYA 2QN6A 2W2TA 2IYQA 1VCOA 2JGNA 3CH5A 4LYHA 4C0QC 1UKVY 4DDUA 2RH5A 1L8QA 3IQXA 4II7A 3BH6A 4QJ4A 2VHTA 2ZRDA 2CLSA 4UJ3A 5FTKA 3WNCA 1XRJA 3NBZC 1K8RA 4CEIB 3HYTA 2Q9AA 1W2GA 2ZRCA 1RJ9A 4PZZA 2W0MA 4GT1A 1KMHA 2ODNA 4Q18A 4XVQA 1TEXA 4UNQA 5EP2A 1W4AA 4X8HA 4AKGA 1GL6A 1XD9A 2MSDB 3ZVLA 1FW6A 2B21A 2JCSA 1IY2A 4IOJA 4DB2A 1R5OA 2ZEJA 3NXSA 4DJTA 1E2FA 1G8HA 2B6HA 3QKSB 1GRRA 3ZVMA 1DAEA 2OLJA 1AGRA 3D7MA 2JATA 4N0DA 5B30A 3ICEA 4DUGD 1OFTA 3EX7C 3CR8A 1E1QD 1Z6AA 4A36A 3AVXA 2J7PA 3EIHA 3IIMA 1QRAA 3FVQA 3K0AB 4ACAA 4XD7D 2BWJA 2HLDA 2V3CC 4EPVA 3U61B 1G7CA 2G1JA 3N2IA 4MRNA 4V0ME 1OLOA 3UXMA 4LJ6A 3DOFA 1TU3A 2RGNC 3C14C 4TYQA 4D4LA 3K09C 3REGA 2BJVA 2DFKB 2FFQA 2RGAA 2IS1A 2GVZC 5FBWB 5F9HA 1KDTA 1TX4B 2GEUA 3PUWA 5JJIA 3RHFA 2YC2C 3TGPA 1ZD1A 4B35A 3ICQB 2JJ2D 3WY9A 5JSZA 4MRPA 4BLPA 1GVNB 2HDNB 821PA 1G7SA 2NTYC 4I81A 3DHWC 3W34A 1MABB 4QBFA 1XEFA 3BK7A 4MYUA 1EWQA 1AKEA 4KVGA 2FFBA 1KO1A 2QGNA 4QXAA 2WV9A 2YWHA 2OESA 3U3OA 3UPUA 4I4LA 5DN6A 4ZI3A 2QENA 2W58A 4E03A 3QXSA 2PT7A 2IA5A 1SULA 1KI3A 2VL7A 4B47A 4C4PA 4Q9IA 1RIFA 3MJHA 1F2TB 2V8OA 2GWHA 2OAQ1 2WHXA 1D2MA 2AK2A 3EA0A 5SZJA 1GZSA 5JI3E 5KPJA 1FUUA 3BH0A 4NYIQ 4A6PA 1GNQA 4NZYA 4GNKA 3S1AA 1EFUA 3T1TA 2GJSA 4QRHA 1KZGB 2ORIA 1VG1A 1AS0A 3CONA 3W6NA 2F55A 3IEUA 4PAQA 2IYSA 2KE5A 1FNNA 1DAHA 2C96A 3LLMA 4MGIR 1OB2A 5FUVA 2AN9A 4FI3C 4KAXA 3GJ4A 3CRMA 1J8YF 1NKTA 2PEYA 3UWOA 2ZRHA 1M74A 1PLKA 3D3QA 5DI9A 5KU1A 3ZJYA 1Q1QA 421PA 4D0NA 1DVRA 4ZIRA 1MO6A 4A0GA 3AF4A 1KNQA 3BFKA 2GZDA 3C8UA 2P0EA 5KYKA 1TUEA 2JLXA 2BBWA 4JSTA 3PJRA 1Z07A 3QBVA 2J9RA 1U81A 1CIPA 4C7OB 1ZW6A 3LXRA 2AR7A 1NN5A 1ZM3A 1UDWA 1G6HA 1G16A 2ANCA 4X8LA 2FGJA 8OHMA 3QQ5A 2VF8A 2HV8A 3KQKA 1Y63A 2A9KA 3OEED 1EGAA 2WOJA 3PUYA 3U44A 4ASUA 4Z8YA 2XTMA 4WZBE 4JVLA 4DIEA 3SEAA 2B7CA 3RS2A 1KJZA 2G0TA 2H1LA 3T61A 4TMTA 4LJYA 4LOAA 1E2IA 1NKSA 1CJKC 2KBFA 3B78A 1HEIA 4KYUA 4RZUA 3LFUA 1L4UA 1B23P 3FMFA 1DAIA 2ZU0C 2C04A 2DFLA 3DM5A 4AKEA 4NYIR 1P6XA 3TK1A 2CK3D 2ZI3A 4BE7B 3MFYA 2R2AA 4EPWA 1JI0A 1BKDR 3WNDA 1T5IA 1H8ED 3AF2A 1FMJA 3VR6A 1AS2A 1F2UB 1FUKA 4V0NA 1MOZA 4M1SA 3QEOA 1OIWA 2A5JA 2WMOB 4IXMA 5FOSA 1DAMA 4PSKA 1OV4A 3X2SA 2C9YA 3IBGA 3SDZA 4A8JA 2GNOA 4A82A 1WA5A 5JEDA 1IHUA 3LXXA 4RD1A 4HAZA 1W5SA 5JJKA 1E2GA 3DM9B 3ND9A 1MO3A 3BORA 3CPEA 2OE2A 2GF0A 3JVUA 2ZVPX 2YZ2A 1KI6B 4KLNA 5EXXA 3NDBB 2VF7A 2BEKA 1S3SA 4LZZA 2CMKA 3AVUA 3CUEF 4LYJA 2IUSA 3LBHA 1HA3A 1AQYA 2PT5A 2J0UA 2WZQA 3BS4A 3DO6A 5HZKA 1JECA 1O3YA 1OXXK 3X1XA 4URYR 1NLYA 3T34A 3AB3A 3CX8A 4TYPA 3E5HA 4MYCA 2BEJA 5FI1B 1XMSA 1CR2A 2HEIA 1KHTA 4TYWA 2DFNA 5KNDA 1I2MA 4IDHA 1XTIA 3MWYW 1KK0A 1N2CE 2QL6A 1OE0A 2ZS9A 4OI1A 3BE4A 2JLQA 3BWDD 4JVNA 4MGZR 3A6PC 2JLYA 3QXHA 3U7HB 4TMKA 4W7SA 5FI0B 2MMCA 1E4YA 2QSYA 4U02A 2XZLA 2AD1A 2GETA 1QG2A 3SR0A 1W4CA 1AGPA 3FKQA 1W49A 2GEVA 2VHQA 2QSZA 4FMCF 4CVNA 2ODBA 2WSSA 2PLFA 3GD7A 1R0WA 4PPGA 4JVMA 2ZJOA 1OSNA 1XEXB 3R7WB 5BN3A 3Q5DA 3TAUA 1UBEA 1W0JA 4YDSA 5AJWA 5EUQB 4IOMA 1AZSC 1G3MA 4D25A 4PSAA 2JLWA 1RFLA 4DCUA 4HAVA 2BJWA 3SFVA 4ARZA 2JJ1A 1DAKA 1D9XA 1SVLA 3PENA 1YZNA 4EPTA 4IEIA 3EW9A 1VG8A 2QE7D 3BRWD 3K09A 5D3MB 2HYDA 1QHHB 2J87A 5CJ2A 3EG5A 4H1UA 3V00A 2WSMA 4HLUC 3Q3JB 4BEJA 3F8TA 2NPIA 1X8LA 3Q7QA 4D26A 2HT1A 3J81k 1K5GA 3AVOA 4FD2A 2PMDA 5KNCA 2F1JA 2DWOA 1HE8B 2JLVA 5EP1A 3QF4A 1KI4A 1BMFD 2CCJA 2OAP1 3GMTA 1XPUA 5KTYA 2ZRMA 3BAFA 3LD9A 5K8LA 1OH7A 1CEEA 3MGCA 2QAJA 3ZD7A 4F93B 4V0KA 4CDGA 5TARA 2WWWA 1H8HA 1TAGA 2H92A 1LF5A 4JZKA 3PVSA 1G41A 1PVOA 4UXHA 1T3HA 3CW2A 3PUZA 4ACBA 1W7AA 3DZDA 4GOXA 4IHQA 1R2QA 1Q1BA 1SXJC 5GJWC 5TDHA 5DSZA 1II9A 1GITA 2OZEA 2ZAOA 1US8B 4MKFA 4NPHA 3GEEA 1KAOA 2OFOA 4LHVA 5DISB 3KX2A 3OE7D 1IN5A 1H65A 5DHFA 4LBYA 2ZSFA 4P3YA 1MT0A 5B64A 4D6PA 2VSFA 4QGFA 1SVIA 4CEHB 3MAAC 3A58B 4J0QA 3IUYA 4IKEA 4JYBA 3EARA 1DTSA 1Z0JA 1NVXQ 4YXWA 1XTKA 4D80A 3N5CA 4AKHA 4Q1EA 2DY1A 2A5YB 1DADA 3HU3A 3FFAA 4R7ZA 4XSHA 3Q8XB 3EPJA 2ZJZA 3GFTA 3Q72A 2Z6VA 3KB2A 4EQ6A 1NVVQ 1E6CA 4FMCB 1TU4A 2BKUA 2NO7A 4HLQB 4LPSA 2D7CA 3QENA 4FMBB 5FBQB 4A0HA 2F3RA 1Z06A 1X8JA 4NMMA 1Q3TA 2C95A 4EPYA 2WWXA 1S9DA 5TVKA 3W3AA 2X2EA 4NBSA 1CU1A 3GQBA 3SHFA 4V0LA 3GJ8A 1ONBA 3TE6A 2GEDA 4KU4A 1X6VA 1SVWA 3RRMA 3T1QA 1R10A 2XXAA 5FPSA 3EZ9A 4EPXA 4RFSB 1OIVA 2XX3A 4JKIA 1JAIA 2ZE6A 4TLBA 1XCPA 2V54A 1T8TA 2YOHA 2CHQA 5BN5A 1JPJA 1Z3IX 1RRPA 3RVBA 3K9GA 2EW1A 4DKXA 2NZ8A 2DPXA 3E2IA 5FUXA 5G41A 1VDZA 3KXIA 4NH0A 4F7WA 1FNMA 3AM1A 1NMZA 5M04A 2GA8A 1HY3A 4M21A 4BZQA 5CB8A 2ZI6A 5DIFA 2GF9A 2Z83A 3QXJA 2FMXA 2R62A 3PUXA 4DLSA 3RS4A 2A78A 4Z51A 1VMAA 1U8ZA 2FEMA 2WPDA 1ZRHA 3QG1A 5DO9A 3RWOA 2RB4A 3KJEA 4Q4HA 2WWGA 4BWYA 2O8DA 2ERYA 4L5BA 1EFHA 2OSBA 3L0SA 3F0TA 3VR5A 1QZXA 2UKDA 4IFEA 5J5CA 3O8DA 5EE0A 3THWA 4JLBA 4I1OA 2BKEA 2WKQA 1JJ7A 4TSFD 4ERNA 2NIPA 5CJPA 3O8CA 1CF4A 5CITA 4E09A 5B57C 2GESA 2N1BA 3GLIA 4XSGA 1Q22A 1N6NA 5ANRB 2JLZA 4AURA 5FOVA 2ZROA 4LHZA 5JFGA 3M6AA 2ZXUA 4QHSA 3REFA 5E7MA 1GWNA 1NVVR 2YWGA 3B8HA 3LY5A 2EVWX 1G3IA 1PUJA 1R5NA 5E7IA 1G3UA 2VP0A 1JPNA 3TW4A 2FFAA 2V6JA 2DWQA 3CH4B 2ZUDA 2DBYA 3B2EA 1RJ9B 3IHLA 3PV0A 2F1RA 4HAUA 4Q02A 5C1BA 3PEUA 4G5QA 3VU9B 4DRZA 2R6AA 3Q85A 3BB4A 3K9NA 3V9PA 1MH1A 4JLMA 2PEZA 1A82A 2ZITA 3H0KA 1ZVQA 1M6NA 4DLWA 1JEDA 3ASYA 3WP0A 1E79A 1V43A 1S9HA 521PA 1QG4A 3GLGE 3VFDA 3NIBA 2LKCA 3AEZA 1EXMA 3MCAA 5HKKD 1P9RA 4KHZA 2OG2A 2ORWA 4AWXA 1SHKA 3FFBA 3MJRA 1P9WA 3TUIC 3ADKA 1V5WA 2EFEB 2OCAA 1YZUA 1EFTA 5HPYB 3RWMB 3LBNA 2QBYB 2RGGA 4OQMA 5F2EA 4LHWA 1T6NA 1UKZA 3OEHA 2ECKA 1GRQA 4ZDWA 4XWOA 5JLJA 4KJZA 4G5OA 1WE2A 2IYVA 1U2RA 3VX4A 3C4JA 3X1DA 4G1UC 4B33A 4ZCIA 3AKCA 5ELXA 2QROA 3I4LA 2GRJA 2IS4A 2O8FB 4Q7MB 1D2EA 3B82A 3ZGXA 3IEVA 4URZR 2W2XA 1W4BA 1BH2A 2VSOA 4TLCA 5DGXA 4IDNA 4EJSB 2QAGC 1FZQA 3W3ZB 4HLUA 2ZRAA 3K1JA 4LY6A 3QG5A 3DKVA 4CRWB 3NBFA 1Z22A 2CNWA 4Q5IA 4DT1A 5C4MA 4PO8A 1NVUQ 3B9PA 3IPYA 3LH5A 3OFND 3X1WA 3T15A 3WMGA 2FEOA 2PH1A 1QHNA 3A36A 4BLTA 5AUPB 2O8BA 3A1TA 1NMYA 3OAAA 4H9GA 3PEVA 5E95A 1S96A 1YU9A 2I1QA 5CYOA 2V7QA 1P7CA 5IDVA 3G0HA 1KSFX 1N6RA 1P3JA 1GRNA 1P62B 1G8GA 1YHNA 5TV2A 4HUTA 1PLJA 4P4SA 1WB9A 2H8KA 3AVVA 4HLCA 4MGYR 3K0FA 3CNOA 1OFUX 3FTQA 4MKIA 4WAUA 4B3CA 1SXJA 2IX3A 5F3WB 4LYFA 1Z6TA 4QM6A 5J4VA 3P26A 3EPKA 1G5TA 2A3RA 5E4FA 4A1FA 1UJ2A 1T4GA 4BLQA 4JLKA 1J7KA 2GXSA 4C0BA 1ZUIA 1JNYA 4OI0A 2GK7A 4P33A 2XNDD 5J4KA 5JWOA 1JB1A 3RS7A 1IQPA 1E2EA 4OI2A 1CJMA 3IQWA 4KFSA 2WJJA 3TIFA 4B75A 4ZIRB 2ZRGA 5JHGB 3B1ZA 1IAQA 1AA9A 1YZGA 3OIWA 1R8SA 3QPWA 5BW8A 4KVAA 3THYA 1I2DA 1K5DA 1E9BA 1KO5A 4B44A 5L3VA 4B74A 3TVDA 4MUAA 1W36C 4URWR 2IXFA 1CR4A 1ZMXA 3GJ0A 3FYHA 4M9QA 2ZRIA 2G83A 3U6BA 3C5HA 1OKKA 1KAGA 4URUR 3RRNA 4Y0VA 1ZU5A 4HYYA 3EZ2A 3NWJA 1EFRA 4QG7A 5E3HA 3QE0A 1HV8A 1JQJC 3PXGA 3T5GA 4NKRA 3GFOA 1P75A 5H70A 1G8FA 5FPHA 2GDJA 1OHHA 4JL6A 1U0HC 5EP4A 2KB0A 1T8UA 4M1WA 2V6IA 1W46A 4Q47A 1KY2A 3SOPA 3NVAA 2BBTA 1WF3A 3QVUA 1ELOA 2EFGA 3H84A 2ZANA 4MRVA 1DG1G 1Z6YA 3GJ3A 3A1VA 4RJLA 2CLDX 5FL7D 2B7BA 1M7HA 3DEFA 4JVSB 4WXRA 2HXYA 5L3SA 2VP6A 4JLAA 1E2KA 1XXHB 5JMTA 2I4IA 4G3XA 2GBLA 1LVGA 4GFDA 3VX3A 2QORA 4WZAE 1SZPA 1XD2A 3B1WA 2F1IA 4XVUA 4FMDF 2D3WA 2NO0A 2VP2A 1ZCBA 1GOTA 1KDOA 1A2KC 4B48A 1XPRA 1XF9A 4P32A 4S2EA 4E5UA 3EWSA 4JIMA 4XWAA 4F4JA 1UBGA 2ZJYA 2OUKA 4JLVA 1UKEA 2EFCB 2WWIA 2J0UB 3ASZA 3ECCA 1W44A 3NG1A 2VH5R 3FKSD 3EWAA 1IN4A 2G6BA 4KYIB 2AFIE 1E0SA 2A5FA 3K53A 2E9SA 3GLHA 3JVVA 4V02A 2WTUA 3QXXA 1KI8A 4W5HA 2ZRLA 3EZ6A 3M4YA 2ZI5A 3WNBA 1GNRA 5EE5B 3CRRA 3WYFA 1TQDA 3UG6A 2N46A 4ZKDA 4JKYA 5B2ZA 2HLDD 1UAAA 4OL0A 1UEIA 1OYYA 4OK3A 2XOKA 5EXPA 2RGXA 4DB4A 3AUXA 5TY0A 1P2TA 5E7JA 2FPKA 2HYIC 3V4FA 1GKUB 2QZ4A 4WVFA 5HR5A 3QXCA 4L8GA 5SZHB 2AKYA 5CK5A 2RHDA 2VQSA 3FWYA 2BBSA 4NCJA 1IJFA 1UFQA 4A2WA 1OIXA 4YMSA 2RGCA 5FTNA 2IBMA 1NBMD 3LNCA 2W6JA 1NG9A 2GTPA 2QEQA 2QMEA 4JS0A 2HCBA 2ZAMA 5C4GB 1A4RA 3KKPA 1NBME 1P5ZB 2QAGA 5JWHA 2FA9A 2GAAA 5CB6A 1N5IA 1B0UA 2MSCB 2FGKA 1VKJA 1NLZA 1YZTA 1IOZA 2E1RA 3CF2A 4GSYA 4CGZA 4ZPXA 1F3OA 2QPTA 2O8CA 3QF4B 2C03A 2CE2X 2PZGA 4Q9LA 4DUGA 3EC2A 3KTAA 5H1YA 1GILA 1W5TA 4V0MA 4B71A 3RRZA 2P5SA 5J4YA 2N42A 3VHLB 4PC6A 3LW8A 4O2LA 4BFTA 4BRUA 2EYQA 3TJZA 2GCPA 4HDCA 1KKLA 5HE8A 4P0TA 4BFZA 3UMRA 2ZE5A 1W4RA 4Q1DA 4C0AC 2JAQA 2WMNB 5EE9A 4RSGA 4B34A 3A1WA 1T5LA 2C9OA 2ZSDA 2ORVA 1OXTA 2HXSA 5JCPA 1MO5A 4XH9B 2FU5C 2IEZA 3AVTA 3B6EA 2CLCX 1OXSC 1P2SA 3V4RA 3PITA 1T9HA 3IKJA 3LX8A 2ZSEA 3SYNA 3KFVA 2PCLA 2Z43A 2FJUA 3TUZC 4P31A 3DL0A 4DSNA 4ZDIA 3THXA 2XJ4A 4TMXA 2OCPA 1F60A 4PR0A 3BD9A 4R98A 4EDHA 2QY9A 2D7DA 1CR1A 3VR1A 5AUNB 2CCKA 1Q12A 1II8B 3QF7A 2FH5B 1ETUA 3VR3A 3OIUA 4ASUD 1N6PA 5AJYA 4EQ6B 1Z8FA 4RKEA 1AJEA 1S3GA 4YQFA 1G291 4F4IA 1G17A 2KWIA 3L2OB 3TMKA 1R8QA 5FTMA 2BBOA 3U3KA 5BYKA 1WXQA 1ZAKA 1NI3A 2BIFA 4K8OA 1KSGA 3ZZUA 2R8RA 4PPQA 1E32A 4DEYA 4HUQB 2BC9A 3H1TA 1QVAA 3Q5EA 3AP3A 4CEJA 2VHCA 3K9HA 4PFSA 3QSYA 5JJLA 2P6UA 1ZU4A 2XXAB 2GXAA 2P6NA 3A37A 4Q7LA 1YVDA 2IK8A 4KFUA 2FNAA 2Q3MA 3RS0A 4XOIA 1FPMA 3SC3A 1X1RA 1G8PA 2XZPA 3IIKA 4NP6A 5B58C 1E2JA 4YMWA 3FHOA 4NCHA 4D4JA 3IHWA 3K70B 5FPTA 5KHOC 2C78A 4YDHB 2CL0X 3F5FA 5AJXA 1DEKA 2GKSA 2ASEA 2CJWA 1OXUA 1KNXA 2DB3A 3UANA 2REBA 3GFPA 2F43A 3QJYA 4Q9HA 1XXHE 1NRJB 1U90A 4QJ5A 1KGDA 1N0UA 3BB3A 1XPOA 3KJHA 1R4AA 3CNLA 3VKWA 3U7FB 2H57A 2Q3FA 3HPQA 4PHGA 5LD2B 2O0HA 1BO6A 1LW7A 2O8DB 3KXLA 4DHEA 3B7GA 1WMSA 5L3QA 1ZYUA 4GOKA 3THWB 1RYFA 1Z08A 1KSHA 2JDIA 3NH6A 1E98A 5F9FA 1XZQA 4B3BA 4GMXA 5EE1A 3GLIB 2RGBA 2IXEA 1T0HB 4D0LB 4QBIA 3SJBA 4QHTA 3A1SA 3KUCA 4KBGA 4M1MA 3EIQA 1R0XA 3GEIA 5FOWA 3BFXA 1Z0KA 4HB2A 2FE4A 2BMEA 4NU0A 2CXXA 2A5DA 3AKYA 4QGHA 1NJFA 3CX6A 2Z0MA 1SKYB 1YR8A 3B9QA 1RZ3A 1AKYA 3I32A 1Z0IA 2WWHA 1MKYA 1TF7A 4LI0A 1E0KA 2JLRA 1ZINA 3I8SA 2HF8A 2BVNA 3ZQJA 3K0EA 4EIWA 2PZEA 1SVKA 2YWFA 4CYMA 3SQXA
chains in the Genus database with same CATH superfamily
2HF7A 1Z16A 1KVQA 1UADA 2E82A 2X5NA 3R0QA 3C70A 5J40A 4K9LA 3W5JA 2PWBA 5JT1A 2D2FA 3AIOA 4EGJA 1EIWA 1B8OA 3QH4A 1S4QA 1QVVA 1L5OA 3FOBA 4PRLA 4M7OA 4WIAA 2XUIA 4BKOA 3PGXA 5DTIA 4DXDA 2MSKA 1JAXA 3KOOA 2EG9A 4IDBA 1DXHA 2BFDA 4C0JA 3AV0B 4P8RA 1Z5PA 3RTDA 3N70A 1RBYA 2ZBEA 4QU8A 3DLPX 4LSGA 5CBPA 1G8JA 3TG8A 2A4MA 1A4XA 3G2LA 2WICA 2TMKA 3QXGA 2VK2A 2QJTA 1RRCA 4DDMA 3CZQA 2XVMA 4G09A 1YMQA 2FWPA 1DIHA 2FCRA 3PNMA 2XB8A 3UEOA 5AKXA 2V65A 1ZK3A 1P31A 2JI7A 5H5JA 2VJMA 4EB3A 3UAGA 4E31A 1M9NA 1U2EA 2MDTA 1U0NA 3JQBC 4DA0A 4I5IA 4Q4LA 1I2AA 1GNLA 1M75A 4RV5A 4UMEA 2ZS8A 5HWSA 2AX4A 4DT1B 2Y27A 4ROTA 3RFTA 4I5GA 1YRHA 2YOGA 1BCSB 1CY4A 3GFVA 1X14A 3AUSA 2D5CA 3Q3VA 3B12A 2LW7A 5AWFC 2IU4A 3CX4A 2ONKA 3ZU3A 3QKWA 3VO1A 1K0UA 1DELA 2HU8A 5EJFA 1QHGA 4R83A 2PU5A 1D7OA 5NLLA 1FDUA 3T5DA 3WGOA 3F6SA 4REMA 2WUDA 1QGDA 4DJJA 3WK5A 1MP0A 3R3WA 2C1ZA 1JDUA 4OKSA 5KNLA 3ZCSA 4UVDA 3LECA 1PS9A 3NOOA 4V3CA 1A4UA 4OV6B 1NY6A 3C5CA 5JTUA 4G1BA 1MJGM 3K0FB 4NSNA 1IPFA 1RCUA 2G9RA 2AG1A 2D4AA 3KE9A 3L82B 3RNOA 1OF1A 3EUWA 3NBMA 3GEDA 4H7HA 4DDTA 5L8VA 1ILEA 1Z0SA 1FXWF 1HRDA 3MGGA 2B4QA 4M8KA 4PQGA 1RPTA 3ED5A 4BRSA 4C4TA 4QKQA 2QMHA 4KW7A 2OCIA 4X1OA 4FGJA 2A9PA 2AXPA 2JI8A 3FMOB 4OHPA 3ZE1B 5GZ1A 1R9MA 2I6QA 4IFTA 3TIGA 2RMKA 2E5LB 3BT7A 1GUAA 3A6DA 3HRKA 3LUCA 1AZWA 4CJXA 3QMWA 1ECGA 2LRHA 2RGYA 3IVCA 2XCIA 4HR7A 4M7RA 2RHTA 1PWYE 1TUBA 3RS5A 4JDPA 4LXXA 3PZRA 3AI7A 4ZVRA 3I72A 4B3DA 4ID9A 3F2IA 3NHUA 5CEFA 4FT2A 4HEA1 4TUYA 3SU8A 3IP1A 1AIPA 2QU7A 1A5BB 2C2GA 4EZIA 5IZCA 1V5EA 1FP7A 1OZFA 2FK8A 1AB5A 2VNSA 3EVTA 4B6EA 3B3JA 1IUOA 4A15A 3HJAA 5JXWA 3G2IA 1PT7A 4JFAA 3L93A 1QYVA 4PQFA 4KHPB 2PYIA 4YMUA 4PW0A 4MUHA 4I9NA 1G21B 3DDWA 4D4MA 1ORDA 4I6GA 3W6ZA 4ZHQF 2PNJA 2PMBA 3GRZA 1U3FA 3QI2A 4O0MA 3RYTC 3WADA 4L16A 4NJMB 5IU6A 4U7DA 4QWMA 4MB0A 1AKQA 1PV1A 1FFYA 4L7VA 2AI2A 1XFAA 3T1OA 4TTPA 2G9QA 3GCXA 2HCJB 1UJ4A 1RP1A 5I4CA 1FTSA 3FPBA 1D1QA 5EJ8A 3KZMA 4Y2TA 2YASA 3H05A 2QNRA 2VLIA 3NLLA 4RK5A 1RCFA 2E5WA 3NH9A 3OIYA 3IP7A 3NBAA 3U3RA 3W2IA 1P2UA 5A4AA 3HCOA 4L27A 3U13A 2ZIGA 2YZGA 1KKUA 4KQCA 2P9TA 2H2DA 3FHCB 1CKEA 2FUCA 1ECJA 2FE1A 3D2CA 1QZZA 4FBGA 2H4FA 4J3NA 3ZHSA 2GLXA 3TSOA 1Z7BA 1DEHA 1GTVA 2WPDD 4O3MA 3NTVA 3HKDB 2H5JA 4ND8A 4O2BB 3BULA 3DL4A 5FLYA 5FOUA 3H13A 3TVTA 4S2UA 4Q9JA 5FIUA 2XB4A 2NSDA 2HWYA 5AVWA 2RG7A 1Y3AA 4ZMSA 4PO1A 2FX2A 1CUWA 2PMFA 3A0UA 1W87A 4Z3DA 3I5YA 2HHAA 1SNYA 5CDFE 1XZNA 1E9FA 2A0KA 4BVLA 2IBTA 3IOBA 4PPNA 3FI9A 4OFXA 1J8MF 3K5IA 5ES4B 2XVYA 1UL1X 3L7DA 5MHTA 3RCBA 1AMUA 4II2A 3AEUA 2AYZA 2QVBA 3OHPA 2AQIA 3BN3A 4IIUA 5FPQA 1MQAA 1IEVA 1QZTA 4HZIA 3UC9A 4UNRA 3VA7A 2OC9A 1M8GA 1IAVA 3EXAA 4QC2A 2A92A 3QUBA 4A0RA 5IP5A 2B4RO 2XMDA 2Q2OA 3PHIA 3WLKX 3ZOZA 1C2YA 1Z33A 2D1YA 2H31A 5ALLA 1I30A 4OA8A 1DC5A 2K5UA 2OV8A 3TQOA 1ACLA 2E87A 3I0ZA 4F3TA 1AKNA 5AHRA 1QIJA 1GG2A 1NXWA 4QDJA 2CZCA 1E1RA 5DRTA 3JQ7B 3TIIA 4RO0A 4WFIA 5MFZA 3ETHA 1D9ZA 3AETA 4XFDA 3BHJA 4UEOA 1COWA 5HJ7A 4DTIA 2JFGA 1G1MA 2X5XA 2ANBA 4RZQA 4EEZA 1I33A 1U0RA 2FPIB 2I3DA 3N58A 5KOYA 2XB2A 4AUMA 2FW8A 4TTRA 2JJYA 3BA6A 1C0PA 4RJIA 1ZIPA 1TA0A 1GRCA 3WKBA 2O2ZA 3NKVA 4PO9A 2VHUA 1N78A 2XCTB 5TMPA 2H1IA 3SAJA 4F7DA 5HIKA 3L05A 1YAJA 3M5DA 4H7PA 4BE9A 2Y92A 1W30A 2AD5A 5F2KA 3T1VA 3HJUA 1IM2A 3LP6A 2B9VA 2GHQA 2XVZA 3RLIA 3EGIA 4WFJA 4DV1B 2J3JA 1E6KA 4M9SA 3S68A 1YFZA 3GLUA 4Y9RA 3LC7O 1TTHA 4IQGA 4N3AA 3RDPA 4AQDA 5CB4B 3I0NA 3B9RA 2O3QA 4I4CA 2W11A 1YHZA 4O4HB 5E3IA 4QDOA 3ZGYA 5LMUB 2XR1A 3CVYA 1SCKA 2QRUA 4E08A 3LP5A 1E9EA 1IBRA 4FONA 4IZ6A 2WC1A 3QU4A 4XGNA 4ECEA 4C01A 2B78A 2J3KA 5DI3A 1FEZA 4FOPA 4NULA 4QRIA 4AJNA 2BN4A 5BVHB 4RMJA 1L1RA 5A2GA 1P74A 2D6FA 1ZIYA 3CNEA 1WHTA 4MUEA 3KD3A 3A70A 1ZGCA 3HP1A 2DT5A 3FR7A 5FQNA 2LD4A 4DXAA 5JALA 2CSUA 2AOUA 3RRYA 4B43A 1KS9A 4F4HA 2PLNA 3ANMA 3F96A 4QXPA 1J9EA 2A0XA 4OHWA 4RD2A 1T8SA 3P2IA 4LMRA 2BSXA 2F1HA 2YWBA 3EVEA 4M83A 5ESDA 1KI9A 1TMGE 5KTTA 1VIDA 1VCMA 1MW9X 3HFRA 2W43A 4LMBA 4QREA 1DJOA 1P1BA 1K7EB 1TE2A 2JFWA 2NVUA 4Z7OB 1T5BA 3BMQB 2ZKLA 3OD5A 4FX5A 4FU0A 4BP9A 3A28A 1F4PA 2OM2A 4TQGA 1FFBA 4E5PA 4EGCB 2AMYA 1TF5A 3KZKA 4MV5A 3TBHA 3C3PA 4EI2A 2AR9A 3G0CA 1USUA 2LDBA 3HCEA 4EY6A 1HLPA 1T3SA 4M1EA 1C3OA 1NJSA 1RYNA 2X77A 4YJKA 1ZH2A 1KBQA 1TM2A 1B6RA 2COKA 1TXGA 2QTAA 4ODIA 4CF5A 1PD1A 1MN6A 2C9BA 1SXJD 1Y8ZA 4O08A 1UQUA 1XROA 2LWIA 5IAGA 3C41J 1CIVA 2R00A 2XSZA 4A2QA 1EFDN 5IJ9B 3F73A 2YBDA 2F3SA 3CXRA 3IPXA 1J24A 4YMLA 3HXOA 5AVUA 4TQUS 3OECA 2OUIA 1OXKB 4M53A 2H1FA 4ZAZA 1CS4C 4MCAA 1Y4SA 2HU5A 1JALA 4RTRA 2H4XA 2WIKA 3QBDA 2J5XA 4N76A 1PU2A 1J2RA 1RI2A 2P67A 2HNAA 3GVPA 3VAZA 4EYKA 2KS6A 2O2GA 3JQQA 3WBBA 3UXEA 3RADC 4TV9F 1CUZA 2G88A 4FFMA 4O4JF 4DM3A 3Q9UA 5BMOA 5KQLA 2WSYB 3DMNA 4L08A 4A0FA 1UBMS 3W6OA 4KOEC 5C5CA 1XMOB 3CY6A 3ESAA 4EO4A 1GL9B 4MUXA 1V1JA 1P8AA 2BISA 1ILWA 3LAWA 4RCVA 2X0RA 4ENTA 2QL7A 1B8VA 4WKOA 4KIWA 3EEOA 4GEKA 3ZZ1A 1QGUB 1UXHA 1YZLA 2ZJ0A 4M88A 4EABA 4YO8A 3EPKA 1JHXA 4WW0A 1CWUA 2QIPA 2Y1KA 2VTBA 4EGSA 3W5SA 2V9PA 1RWOA 2ABWA 2PL3A 2XUHA 3PD1A 5D01A 1OKKD 5EZYB 4N5DA 4PG5A 3P71T 4A5SA 5AK0A 5FOTA 2O1WA 1BZYA 1K7FB 1EFRD 3C1UA 4KQWA 4OLFA 2M6RA 3PC8C 4IIXA 4ITRC 3NYWA 1UPUA 2NACA 4MJ7A 2DLNA 4RF4A 2XUZA 3S7ZA 1SURA 1RWNA 3QYAA 3AY7A 3H5IA 5AUQA 1SJ9A 1E2PA 4AZ0B 1IZ8A 2MYNA 2VP9A 3A14A 1RAHA 4MUIA 3EYWA 3GJ5A 4OHCA 4D9CA 5AIBA 4BLVA 2C42A 4JXXA 4Z5XA 4CEHA 3P94A 1UDRA 1VG0B 3NORA 3AL2A 2UUOA 5LIPA 4DCPA 4W63A 4MKHA 4DIDA 2YQZA 1H2EA 2O1EA 5AM5A 1O96B 3IAS6 2OGUA 5L7WA 2WJGA 3QRWA 1DUSA 1QGED 4BNWA 3BCUA 3IOCA 4R6XA 4AX4A 5BV2P 2H4ZA 3CEMA 1USKA 3A6KA 2IU3A 5C8YB 1RM0A 5EKXA 1B41A 2EL9A 2R6ZA 3RT7A 3VNVA 1NQOA 1GO2A 4OK5A 4PU0A 3T35A 3PNKA 5KNCH 2W22A 1SC3A 4OQFA 4I9HA 3EDQA 1A7JA 1VPTA 2HX1A 3WP1B 3GNQA 4BRZA 4LRSB 5B3AA 1I7LA 2JEZA 1N3YA 4AW9A 4FWBA 1LTQA 1HUQA 3B5JA 3ET4A 4OUDA 1YR3A 2I55A 2KHZA 1QBGA 2HT6A 4Z1MA 3TZQA 4WZBB 4O5OA 1T10A 4B45A 5FR1A 4B80A 3V1KA 1Z47A 3HEMA 4MDHA 2FZGA 4GBJA 5CXSA 1O95C 2CHGA 5SZIA 5CG1A 4AY3A 4A4DA 3EBOA 3MK31 4ZI7B 9ABPA 5AOAA 1MQ8B 2Q1UA 4Q4CA 4JWTA 1E2NA 4CTOA 2YIMA 1E99A 3IQEA 1XTTA 2CNNA 3DE1X 2J46A 1Q7RA 1U4OA 4BGDA 3EODA 2CF5A 1EWRA 3WOVA 2JD0A 2R8YA 3AZOA 5KC8A 1XUOA 3KCNA 4IH4A 1B93A 4XUGB 4LE0A 1KOGA 1U98A 4GU5A 4D0SA 4LZWA 1M1NA 1V4NA 4N18A 3NB0A 3MGBA 4ZMBA 2B8EA 1DC4A 3WFJA 3MLEA 5FBRB 2Z5LA 3DC2A 2PWYA 1IONA 3K5WA 5AVSA 1TW3A 5JAIA 3S3TA 2FRDC 4WOPA 4FWIB 4QFMA 1HDZA 1VJDA 1UKCA 4ZI2A 3OQIA 2WKPA 4HAXA 3O4GA 1E3LA 4V0RA 3SF0A 3VVLA 1QV7A 5BWOA 2J5RA 4IY1A 4EECA 2B0JA 2WF6A 5A4FS 4HOYA 4C4OA 4JN6B 3JARB 1KK1A 1TI7A 3OE1A 4MP3A 5REQA 1C5KA 3E84A 1UINA 1UMKA 2B4AA 4QUEA 1YWGO 4YRMA 1ORTA 2XVXA 3UJ8A 4RAQA 3A2MA 1LK0A 3F4KA 1T2AA 3K32A 4OYHA 3B6ZA 1B1CA 4RY2A 3ENQA 4BTVA 4J07A 3RRBA 2RKWA 3QLVA 1RC1A 1HQDA 2XCRB 4B6JA 4BECA 3SFZA 3I37X 1YCDA 3DAFA 2A5LA 1DIGA 1OOEA 2VQDA 2D0PB 2NUAA 2AOXA 1ZUHA 3BXGA 3HC7A 5H0IA 4DLNA 3ES9A 4G8DA 2HD4A 4ZZ2A 1Z7GA 5KB3A 3VU9A 2W6JD 1MVLA 1MGOA 2NYUA 4OQLA 3UKOA 4NVRA 2B8JA 3RAPR 1VE5A 3EY4A 2VDUE 5BNIA 1JJFA 5I01A 3DLHA 4UDXX 1D2NA 4GXTA 2I4LA 1CNMA 4KWEA 3MSXA 4V03A 3TW8B 1GQ2A 4W5WA 3ZX5A 3AIIA 2OFPA 2NUPA 5KZMB 5LLDA 3ZZNA 3SKXA 3GFRA 3GA7A 4KTVE 1CS0A 5A3QA 4N3BA 2QRZA 4L1KA 5IFKA 2WP0A 2AMFA 2PU7A 4NDZA 1WU8A 5LDGA 1NHWA 2HMUA 5ECWA 3Q5GA 4E3ZA 4XDYA 1AS3A 3NW9A 4TWZA 4CDNA 5C8VA 3MGKA 3FF4A 3W05A 1GGFA 4P53A 4EM6A 3R3UA 2OHFA 3RLFA 3UHPA 4NARA 5HKBA 2I3BA 2WZCA 3ETGA 4DDVA 2JARA 4FQ8A 1D1SA 1R6AA 3KJGA 3FCEA 3NC1C 2A9RA 1PYDA 2KQUA 3QBEA 4LIPD 3T7RA 1GDDA 4UUBA 1Y6QA 2I03A 2VSXA 3X44A 1S8OA 1WUYA 4KUHA 3LUGA 5K0GA 4KNWA 3OZIA 5GPBA 3TEMA 3G8DA 3R7FA 1K8ZB 1RBQA 1W1UA 4IVQA 4XFKA 1NPYA 1ULUA 2R9VA 3GP8A 4Y6RA 1CZHA 3DMDA 3EBPA 3OOHA 4W8GA 1SR8A 3FRIA 4AF7A 4D4KA 2ZTSA 5IAAA 1JFFB 4FMDB 3WNQA 4UTVA 1IDN1 1E4VA 3TSWA 3HSKA 3S28A 5LQCA 2DKFA 4BHTA 4MPTA 2VT7A 5DE3A 4HZUB 3P5SA 1WRBA 3KUDA 1WBBA 1MB0A 4P2BA 2WM9B 8ATCA 2ZE8A 3M9XA 3NT2A 2AOTA 2PQ2A 4S0ZA 3RVKA 5F7JA 2C94A 1P2BA 4RZ3A 1J1IA 3I9FA 3ETDA 5FB3A 1S8AA 3ZLJA 2PSJA 1MC5A 2BFFA 2PUWA 5JH7F 2P1RA 2XNHA 4LPKA 1JDPA 9ATCA 2YNMA 3ITNA 1NBIA 3O7WA 2B0CA 4OKIA 1Z39A 4RK7A 2OD7A 5FV7A 1NG1A 1TQ6A 3GJXC 5A5EA 1XKQA 4Q16A 1YK1A 4GL2A 1CB0A 1Q20A 2OP1A 1FU8A 1QFYA 3BG5A 3CUUA 4XYMA 1K0FA 4IIGA 2AF3C 3U7EB 4JSYA 4YAOA 1QYIA 4PG7A 5TF0A 5BURA 4ETNA 1CY6A 1G5RA 1PWXA 1XZLA 5EWJA 2YY7A 2YV5A 4JODA 3ROGA 3A9WA 4DPLA 4W5TA 3QMVA 3L0OA 1IULA 1PR5A 5TXGA 1WCIA 3LHIA 4BZWA 4EG7A 3N28A 2VI5A 2HOQA 4HH4A 2JW5A 5DM1A 3T5GA 1E69A 4B6FA 1LS6A 3D43A 4NE7A 2AHRA 1ATIA 1JMKC 4QASA 4KLZA 4X62B 4GIBA 4YUAA 4MDEA 5EJEA 5LBUA 4XGQA 4D3DA 4ZJUA 1V37A 3P96A 3X1YA 2OQRA 5HE9A 5KX5B 1JBQA 2WBLC 4K9QA 1R0ZA 1R0YA 2WM2A 1CP2A 4KFTA 3KQNA 3QU7A 3EHDA 3V8MA 5JAHA 5BQ5A 1XOIA 2BKLA 3O1IC 1P73A 3DBLA 1XJQA 5J47A 4I2VA 4AD8A 4TROA 5F2NA 3HM9A 2AMJA 2ECQA 3PBKA 4Q3EA 5GY7A 1XAJA 4BFSA 1I1HA 2HMAA 4BKMA 2OFWA 4GP7A 1E1NA 1SPXA 3I2JA 4KSCA 2Y0CA 4DUZB 3SVTA 5ICFA 1CZRA 4LOHA 2XTNA 3WLOA 4DLXA 1OZAA 1QFJA 3ABOB 3LNTA 2C54A 4XIYA 2QI9C 4Z8XA 4FGUA 4DCJA 3SZGA 3X1JA 3AR5A 4ALIA 3BERA 2GZAA 1ISFA 5I7SA 5JUWA 1JJBA 1G20E 3OQPA 1CW2B 3R5XA 4JJ4A 1L5QA 3ZTYA 4OXXA 1QOPB 2PKQO 5IHPA 2XYQA 4L4YA 4CMIB 5LOVF 5KPDA 5DYNA 4HNSA 4UMVA 4B3RB 2WJ6A 2CXRA 4RA9A 4BEBA 4CLOB 1E8NA 5BPHA 1IBSA 3T1YB 4E22A 2PJRA 4O2AB 2W2OA 1T5SA 1IWOA 1LLQA 1TQ4A 3RSZA 1K08A 2P5YA 3TX6A 3BXXA 3DGEC 2B92A 2B1IA 1B76A 2EX1A 1V11A 2G08A 4KCGA 4MH0R 3OZXA 4KH0A 2HWUA 4TN1A 1E2BA 1GAJA 3H42B 3EQ6A 4IG9A 2QGZA 3ZDEA 4OH1A 3M49A 1ZI9A 3VTKA 4Q4JA 4QGAA 1FA9A 3RR2A 3TKLA 4AROA 3I2KA 4RVFA 4QOFA 1G64A 3G6KA 4H3VA 3L0CA 3PD7A 3HABA 2QVZX 4PLPA 2DCMA 5BRJA 2WDZA 1JVSA 3E3AA 4IG4A 1Z4MA 1EK1A 4YRGA 2IYPA 4UCXA 5B3LA 1WDKA 2UUPA 1FDSA 4N5HX 1P7ZA 4OJYA 2I2WA 4JKOA 1M6EX 2Y1WA 2IHKA 4BEJA 2QVCA 1LRLA 1H8EA 2ACKA 3P9RA 2QHXA 1W2WB 3ZNPA 4AVYA 4GX2A 1OPXA 2QRQA 4R05A 3B70A 1D5CA 1UDAA 2A0UA 2O0JA 3N7TA 4D42A 1J0BA 1ISGA 2X42A 5JQGB 1KERA 1LVHA 4LKRA 1IK4A 1IBMB 2PMWB 1DRKA 2DLDA 5CXQA 2WG2A 3LCUA 4CKEA 3U19A 1EDZA 2GZHA 2MINB 1WV0A 5CA1A 1QORA 2X4GA 3ANLA 5B1IA 3SQWA 1RADA 5K7SA 1KVUA 2LNDA 4G25A 2BZ1A 3VVCA 3KAKA 2YN4A 1R37A 1OYWA 5JS1A 1XNRB 2D59A 1TEVA 3LC0A 4BN5A 1MAWA 2MMGA 5ARCA 1L7AA 1O4VA 3C6ZA 3JQCA 4PC2A 3LQQA 4PZYA 1AK2A 2J6IA 4GVXA 1IN1A 2B1JA 5BMVF 2PBLA 4FZ3A 3OLZA 2DM6A 4GZMA 3R23A 4YP9A 2Q7OE 3U9TA 1KDZA 3FOWA 1UZAA 1DAPA 3DKKA 4MHOA 2YWJA 4RD3A 3C3KA 4MJ3A 2ATXA 3FFXA 3LK6A 1HG0A 3PDIA 3MWDB 3D8RA 3JVDA 3EPRA 2JCXA 3GZNA 1N6KA 5F4BA 3GLGB 4PRKA 4PYLA 1H93A 2JNWA 3KKZA 4XQCA 3SYKA 3TIVA 2EU8A 5HX7A 4AF6A 1J2EA 2O2EA 5LNK6 3L1UA 1I6MA 2H3EA 3HCWA 1RPJA 3B1XA 3EZLA 1YDMA 2DFDA 3HPRA 4ZOAA 1HYBA 5DLYA 1HC7A 5AK4A 4CL8A 2IF0A 3IT0A 4IHJF 4XJSA 4V0OA 1JB9A 3G8YA 4OU5A 4BWGA 4L0QA 1QHYA 3RAGA 4IXNA 4YMHA 5FF9A 4B76A 4BL5A 1M2OB 2PZBA 3PF8A 4YC7A 2Y3IA 4XB1A 1A5ZA 4EUEA 3IFSA 4E6PA 2XRZA 4UOEA 4ME6A 3TZEA 5FH9A 1ISJA 3TOVA 4DLYA 3J7TA 3KKOA 1L1EA 4X94A 3MUOA 1S2LA 2N0SA 3LZ6A 3ZLVA 2DHRA 4E5SA 2ORYA 1E5LA 3RU2A 1E3JA 3AP2A 1VYUA 1Z4PX 4O02B 3UJDA 2IPLA 1TZMA 2QN2A 3AI2A 3C3AA 4HQ0A 3MJTA 2AJDA 4BP8A 1X7WB 2VUUA 4MVJD 3Q0TA 3NI2A 1JG1A 2RONA 2VT6A 3FMVA 2G0AA 2G67A 1LFAA 2PSSA 3BRWA 1IY8A 3NHPA 3KE8A 4UFNA 1PFYA 2MSLA 3KT0A 1TGVA 4RENA 1Z73A 4UQPA 4PYNA 5EZ6B 3CB2A 3D6MA 4DNOA 5IKMA 5JU6A 1DI0A 3INNA 1J1UA 4X41A 2PGOA 5F9MA 2PUAA 2H9AA 2Q1TA 2GJAA 3K0CA 1O0BA 2OV3A 2ZUBA 2O8EB 3Q3GE 1RJDA 2X58A 1JHQA 4QOEA 4UTZA 5ALTA 3U4CA 3FKJA 2PQ0A 1L8XA 4GKBA 2UZ1B 4MNTA 2FZCA 3IBCA 1LB1B 2LGJA 1U0SY 1Z3CA 4LC1A 4C5CA 5KVAA 3G17A 3K9LA 2XAAA 3KVRA 3AWIA 4JT4A 5DYTA 2HFKA 4ZZ1A 1KMMA 2HCTA 3IGFA 3QUSA 4RD4A 4ZVTA 3PLAE 3ROEA 1UFOA 6CHYA 5D7BA 4BEWA 4IDPA 3D0QA 4S3MA 2NADA 3QKUA 3LIPA 1PSWA 4DBZA 2QM3A 2FMIA 4YK7A 3V80A 4BYGA 2IHYA 3KYBA 2CL7X 3VZPA 3O83A 1I10A 2BEVB 5G3YA 2JVKA 4G4JA 4KLCA 1ZKMA 1GLGA 3EZNA 1KEPA 3UJ7A 4BLSA 1SWVA 3KTOA 5ITZA 4LCBA 2CEKA 5E1BA 3Q7SA 3PKJA 4LJ9A 1WL8A 1YJ8A 2G7ZA 3HADA 1CK4A 2BTQA 3K5PA 4IDGA 3DB2A 4RLQA 3ZXUB 2Q0QA 1D6JA 2SHKA 4XIGS 2QRNA 3AUUA 3EH1A 5ALGA 4AJPA 1CP3A 3WXMA 1CUEA 2X7JA 3I4FA 4FYHA 1ZN2A 1Z0AA 2NO4A 2HHCA 2VOEA 2Q5OA 1ESNA 1NUSA 2VHVA 4TVOA 3AFIA 3IILA 1ZNZA 4WESB 3FFTA 1N6HA 2EOAA 5JZSA 2FPLA 4D9GA 3WKAA 2GAOA 1KXJA 5KWSA 3H2BA 4C7JA 3OLCX 3OEYA 4IDOA 4QATA 4MCHA 4PTLA 2NP6A 4X7BA 1DBPA 3DBVO 3NJ4A 1TAUA 2F9LA 2XA9A 1YOBA 2A8YA 3DO5A 4Z6KA 3JD4A 3W5AA 3OI7A 1M7GA 1EBBA 2I6SA 1DOAA 3NHBA 2ZWIA 4QBGB 4X8MA 2R6DA 5D87A 5A5VA 3OY7A 5JAUA 1ZVVA 2YMLA 4ZGBA 5KJFA 2W2VA 1T5TA 3VYTB 1VFNA 3UK2A 3VV3A 4NMHA 5BV7A 1A7UA 2IYEA 4NJEA 3N2KB 4OI4A 3NGXA 2Q45A 5IT5A 2ZIUB 1T1JA 4ZPJA 3ADBA 2J67A 2IGBA 5DBOA 5K8UA 3WBJA 2A1UB 3NNSA 2GCOB 1FSPA 3MXTA 5EUCA 1EUDB 1Y7IA 3EGEA 3EYAA 4U2CA 3GZ4A 4EVSA 1FTNA 2VBGA 3ROKA 3N8KA 1CRLA 4B6OA 1EWYA 1OB5A 2OC4A 1E1RD 1ZJ4A 3UGTA 4CLDA 4RVSA 3O3CA 1XDUA 3ESDA 4HCJA 1COWD 1UDXA 3KQUA 3OZRA 1FFHA 2GT1A 3JAKA 5LZ8A 3KB1A 1EM8A 4HDAA 2XRYA 1H6DA 2F48A 3FLBA 1PL7A 3T7TA 1PNOA 2GBLC 2OCDA 2PA3A 3K92A 3SXPA 4L8VA 3NVKI 3D8UA 3L4BC 1ZD8A 4FGWA 3PKIA 3ZNQA 3JCZA 3JALB 4LJSA 2I6UA 4R2IA 3ULKA 2FKNA 3BTUA 4LVOA 1Y98A 5JE8A 4PSVA 1XCLA 1BS1A 1WDTA 3HZOA 4IJUA 3SHWA 4GMHA 3CKKA 3ADDA 1PEKE 2EFYA 3M1YA 4RA6B 1C7IA 4MA4A 4WOJA 3AOGA 1EVYA 1PZEA 2DJIA 3OBIA 5HF9A 3P9XA 4C22A 3HLYA 5E2IA 3H5RA 1DWUA 3DBHB 5JMWA 4HVLA 3K0BA 4BNIA 3LT1A 4HDQB 4M60A 2JZCA 1W48A 5I9IA 4C4AA 2Q1XA 3IX7A 3F6YA 1HYGA 1W1WA 5DNVA 3T4PA 2QTNA 1RJFA 2X15A 3BGWA 2EBWA 2QM7A 3S99A 1F14A 4I19A 3R7NA 3Q87B 1EWKA 3OKFA 3VM6A 1RW4A 4WBNF 3HQ4O 3BBPA 4OJTA 4CN9A 4EO9A 4KN5A 1N7IA 1U3WA 5K0TA 2FSIA 4IL5A 3CX7A 3JRXA 1UWLA 1NQXA 2R44A 1U7ZA 3L7LA 3DW3X 4PHCA 4H6XA 3NQ41 2CYAA 3T3GA 3ZE8A 1P4RA 4TTAA 1OGYA 4GLLA 2GSWA 5DHPA 2W71A 1VKRA 3RYHB 4DREA 2V0GA 1PP4A 2ID7A 2QT0A 1M8PA 3LC2O 2B4TO 2IHBA 2JIOA 3UWPA 5JSQA 3O8RA 3DDSA 3LWNA 3SDSA 2XKJE 3SS9X 5AM1A 5J43A 4A92A 1NUAA 3R5HA 4BJ5A 5JY1A 1VRVA 1P7WA 1QUEA 2KX7A 5ERXA 5K03A 1V1MB 4QEDA 3ECAA 3KQMA 2PWAA 2VJLA 5B6JA 3HUDA 3N0WA 3AF0A 1GKLA 1NFRA 4UNPA 1ZS9A 2F00A 2J0SA 4DYHA 5JCJA 4BKQA 1GY8A 1JIJA 1Q2XA 2ORED 3CIOA 3OX2A 1M5TA 3NEPX 1YOVB 4Q1AA 3FDIA 1KJYA 3BL8A 3IAEA 3P9IA 1UC4B 1W59A 5A7GA 4B7AA 4ARIA 1NN1A 3K72B 1ARZA 3OM9A 3UT5A 3PDWA 4EJFA 4ZRMA 5FI5A 3FBWA 5DLQC 1HZZC 2ESRA 2F62A 4WXPA 3CO5A 2XAUA 1C0LA 2JPDA 2XSZD 4FNAA 5ISMA 5DX1A 1AUXA 1JSZA 2ZPTX 4AC9A 1FYDA 4FW8A 1IFXA 4O0LA 4O59O 1EPUA 1TADA 1E2QA 4JNKA 4Q3DA 3RT9A 3SOZA 4AJIA 1DKMA 2A2ZA 2ZQ5A 1QHHA 4JV5B 1NF3A 1IXRC 1JBEA 2JG3A 1FLAA 2JIPA 2YVUA 4F12A 1PK9A 2RHHA 1YO6A 1MX1A 2WJHA 1P9NA 3IQGX 3PJGA 4OJMX 1SXPA 4LN1A 721PA 4C2UA 3IDAA 2QTLA 2YIVX 5C3UA 3W2FA 4CQLA 4OTZA 2G80A 4BPBA 4ZEMA 2P65A 3ER6A 3HYRA 3EDCA 4FYMA 1QH9A 3ZD9A 2X9QA 2OWDA 4MS3A 4TSKA 3S2FA 2B98A 3VVBA 3OESA 2OV2A 2O2HA 3HWRA 4M1TA 2B8WA 3V5NA 3C8HA 4LF7B 3HS3A 2XEDA 4INOA 3HFGA 1A2BA 1G8KA 3CRZA 3L79A 3P0FA 4IW3B 3V8BA 3X3HA 1XD8A 1YUNA 2ZXEA 3K35A 3OFNA 4Q00A 4R9NA 3CEHA 3VRHA 5CLFA 1XZBA 2J4CA 4FNMA 3E15A 3IMKA 3FPSA 3KLMX 1HT0A 4CMHA 8AT1A 3P4XA 2WIGA 3BJEA 4CT4B 5DBHX 4Q66C 5I9BA 1KE1A 4JUAA 5FTJA 1QAQA 1RYYA 2ZU6A 4N7MA 1XHFA 4M7WA 1JR3A 3CF0A 3OWOA 3EHEA 3TO5A 4DAEA 4I55F 7GPBA 2BYTA 1V26A 4TLAA 3ONDA 2HL6A 1J21A 1DFGA 1IBCA 2IYWA 3CUYA 3DVLA 3RVPA 1WMFA 2CNBA 1WVIA 2NPFA 3L02A 5IJ0A 5ED0A 1Z74A 2QP9X 3BJZA 4JL5A 2ISSD 1SFRA 2WP8J 3GB9A 4GD3Q 4XKJA 4KV7A 1RI1A 5DIZA 4RK0A 4ZA2A 3BYZA 3SYLA 1EAMA 2QUHA 1DTEA 3MCZA 4YVFA 3VDRA 1F20A 5CR9A 4D2IA 4GGOA 1IN8A 4CKCB 5ENDA 3C43A 4KRYA 3RYIB 1UF9A 2YMQA 3FCSB 5A4JA 1L7VC 3N7AA 2G4CA 1FQJA 2BUCA 2EJTA 3BF8A 3MJ4A 5DOZA 3DR5A 4NL4H 2GAJA 4CTJA 1XKXA 3K2BA 1H4SA 4KPUB 1AKTA 1E66A 2OBBA 2JHGA 5EE3A 1E7QA 2Y05A 2YJTD 3KDAA 4DM4A 4JLPA 5BV0A 4ZOCA 1JA9A 4EFNA 5FTWA 4EKGA 4Z1MD 4LRQA 4E88A 2CJWB 2UUAB 4ZQHA 1SY7A 4ENSA 1L4YA 2C4UA 2P5TB 2IH2A 1S2MA 1NMSA 1WSDA 2G7MC 3NC0C 1QSGA 1K7XB 3VH1A 2IUEA 2FZ4A 4YAJA 3VPXA 5LB4A 1BHJA 4P4UA 2BGLA 3FPAA 4EUNA 3QITA 1ORVA 5KOJB 4W4TA 3H16A 3MFQA 4AP9A 1EX1A 3U09A 5TJHA 2XV1A 3OO0A 1GNSA 2XBLA 3U62A 4G0VA 2FRVA 1S1CA 4CLRA 3IP3A 4KXFB 2ZP1A 4E14A 2FPWA 3H99A 4X1KA 2QMYA 1KWGA 1TYAE 1Q1AA 2WB2A 1U8CB 2V6MA 1UBTS 3HBLA 1QCZA 1MRNA 2HJWA 1DRJA 1QK5A 2FN9A 2IV2X 1L7MA 4NAUA 4BGUA 1VE6A 3VH3A 3L6BA 1N2HA 1ZCAA 2ZG6A 1XZ8A 3C6YA 3N6VA 4HFJA 4IO1A 4TMVA 4DAOA 1UBLS 3IXQA 2X0JA 3T9CA 2O19A 5L53A 4I1UA 2ZRJA 4HNAB 1MO4A 4GF5A 1Z4JA 1E89A 5AVKA 4NU8X 4RTLA 2OBNA 4B6QA 3DTVA 5IDWA 3LV8A 3DJYA 3GLHE 4NATA 2E7ZA 4LQCA 2C2HA 2RK4A 2VDRB 3UM9A 2C4KA 1DT5A 1YXMA 2BGRA 2OHOA 3D4OA 4BNGA 4KXLA 2KBEA 3FAKA 1IUPA 3WDLA 4EMUA 1RYEA 2PKXA 3D8NA 2PBZA 1TRHA 3KCQA 1NYTA 3LO5A 5DRYA 3FWZA 1B7GO 2W2KB 4H3SA 3FIUA 5TSDA 3V4OA 4DCSA 2FEXA 4U5XA 2GM4A 2PUCA 1DBIA 4WN3A 3TRDA 2FFJA 3ZJUA 2RE8A 3B2NA 1VIYA 4TV8B 2ZIFA 1SH7A 3KSAC 2RHCA 2IY7A 3CH5A 3AL3A 2J9XB 3NYIA 1J09A 1R4NA 2EIHA 3KB8A 3OJXA 2HNBA 5EQDA 3IQXA 3ID6C 3LZDA 1S3IA 1DCFA 2WIFA 3GDOA 5C0OE 5L7YA 2CLSA 3IESA 3LCMA 1QCCA 3NP9A 2CKDA 4RHTA 4JOQA 2YXPX 5FP0A 3OUUA 4XVCA 2Q6KA 4EKNB 1AHNA 4JXKA 4MV3A 5I9TA 2X0EA 1BA2A 2ZT5A 1CF2O 4HV4A 2RHJA 1OZHA 2A14A 2D5LA 2QXYA 2C5GA 3UPDA 1RQNA 1ACJA 1GL6A 1XD9A 1ID1A 1N2CB 2B21A 4OX9Y 1JEYB 1LDBA 3J81A 2X4DA 3LKDA 1E1KA 1M1ZA 4MOWA 4CN8A 2ZEJA 4W1PA 4DJTA 1ABFA 1SBIA 2C20A 1E2FA 2P68A 3PRYA 1GRRA 1QXSA 1DAEA 4YRDA 1AGRA 3D7MA 3T7CA 3PC2A 3TZKA 4AO8A 1E7WA 4H16A 4RANA 4D8VA 1H23A 2I2BA 4P54A 1OFTA 3JS5A 4DDKA 4DUGD 3EX7C 2C2ZA 1BDIA 1C1HA 1IC6A 1ZH6A 4OQYA 4QAQA 4YAIA 4YT4A 2DBQA 2H52A 1J49A 4MDYA 3LRTA 5HG0A 4AJ1A 2PLWA 1QH1A 2ZWMA 4FEYA 4ZVNA 4CHTA 2ONZA 5KNBH 3N05A 4M89A 4RETA 5BQ3A 1G7CA 4Y3UA 1KZ9A 4AG3A 5IFLA 4V0ME 2FUG6 1IM5A 5L45A 3UXMA 3HVHA 4LJ6A 2ATCA 2VZ8A 4R41A 2GA9A 4U2BA 4QUGA 1VA4A 2RGNC 2V0NA 2WTMA 5BV8A 4H7FA 2BJVA 3P2YA 1U5BB 2HSEA 2IS1A