5AUQA

Crystal structure of atpase-type hypb in the nucleotide free state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
245
structure length
232
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLRKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb
source organism Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Hydrolase
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
total genus 71
structure length 232
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5auqA01
4JKIA 5G40A 1G3RA 3L2OB 4LV8B 1AQUA 1EFCA 4Q18A 4WAUA 3WMEA 5EE0A 2E9SA 1NN5A 5K8TA 4YXWA 3RYTC 4DHEA 2F43A 3ZZ0A 1IN8A 1N2CE 2VA8A 1TQDA 2YNMA 2ZI6A 4PQFA 3THOA 3WBKA 4EKDA 2K5UA 3ND8A 4MRVA 1XXHA 3REFA 1XX6A 2YV5A 1T4GA 8OHMA 3WY9A 4Q4HB 4DCUA 2WWXA 1EFTA 3A1TA 4DLRA 1E0KA 4AKIA 2R8RA 5AJXA 5FOWA 1IHUA 3TR0A 3PEVA 2ZXUA 2KBEA 1EFUA 1Q44A 3BRWD 2DWQA 3V00A 3VU9B 4NCJA 3OAAD 3K9GA 4BFSA 4FMDB 3DDCA 2HV8A 1NRJB 5KDOA 5HCNA 1EXMA 4HAXA 4LBYA 1D9ZA 1XTSA 1DAMA 3T06B 2ZAMA 1KOFA 3U44A 3SYLA 3X1YA 1AM4D 4Q9KA 4Y0VA 3A36A 1NJFA 3B1XA 2PJRA 1D6JA 1UFQA 3X1DA 4PC1A 1KNXA 1G8FA 2ZYUX 1HYQA 4Q01A 1HEIA 4TQAA 3GJ0A 2VHJA 3P27A 2C9OA 4OHWA 2RHMA 1N6IA 2ZR7A 4F7WA 2O8FA 3A4NA 4CEHA 1KK3A 3NTUA 2QP3A 1A2KC 2R44A 4IVQA 2VHCA 2VQSA 3FB4A 3C14C 2QRZA 2ZSFA 1C9KA 5HZHA 2N46A 5JCPA 2OXCA 2YKGA 4QXAA 1KO1A 3CRRA 1GITA 3K09A 3KB2A 4XIGS 2CHVA 4DBLC 2Z0MA 1OXUA 2HJGA 2ZAOA 4L5BA 2WV9A 2Z43A 3B9PA 4M21A 1II8B 3WYAA 4Q48A 1BH2A 2R6FA 3KFVA 5TXGA 1A1VA 3AKEA 3NIBA 4EJSB 1ESNA 3HU3A 1OSNA 5EE3A 3FOZA 3HR8A 2ZRIA 4B43A 1NBMA 1YZUA 3CRW1 5AUOB 2WJVA 2BBSA 1VKJA 2WJGA 3AP3A 2Q21A 4BPBA 3ZZTA 4LWZA 1XF9A 3H4MA 4LSGA 4URUR 4B6EA 4OI1A 1C4OA 4Q4LA 1EX7A 2ZTSA 4O25A 3IQWA 1YZQA 1G8YA 4PHFA 3CZPA 4RFVA 3T1QA 2CE2X 4G0NA 3VKGA 5CLQA 2BBOA 2DWOA 4RCYA 4S2EA 3QXSA 4DDTA 2UKDA 3GLFA 2DY1A 4MYHA 2D2FA 1E2HA 3RNLA 5J4YA 3B82A 1ZJ6A 4O2RA 1T8TA 2JIZA 2ZUBA 4TMTA 2P2LA 1VMAA 1E2GA 1W44A 1KMQA 2QT0A 3C5CA 1OHHD 2CL6X 3SDZA 2IYUA 1NL3A 1Q3TA 1GKYA 4YQFA 4C30A 1OYWA 1P9NA 3L0PA 3U3OA 3TR5A 3LH5A 3CX7A 1Z06A 4JYBA 5A5GA 3QF4B 3NBYC 1OT3A 5D3QA 2VSOA 4JL5A 5FI1B 2AD1A 1AN0A 4FWIB 1SKQA 4ZCIA 4ZKDA 2B6HA 5DSZA 2YWEA 1M34E 2GJAA 4TL8A 1KYIA 4U00A 4MGZR 1X86B 2OCAA 3QF4A 3KQHA 2C99A 5LPNA 1HURA 4M9XA 3BD9A 2B8TA 1GSIA 1OH8A 1J70A 2ERXA 2V1XA 1R5NA 3J81k 4QG7A 3MLEA 3UMRA 3THYA 5J40A 3W8NA 2NGRA 1VHTA 3FVQA 3RWMB 4HZUB 4QL3A 1MO3A 3OE7D 4A8JB 4PC3A 1JR3A 5F9HA 1FTNA 4BZXA 3HWSA 3W3AA 2VYFA 1GL6A 2BMJA 2IYRA 1OH5A 3KKPA 4UXHA 2IYTA 2BBWA 5EJEA 3UKDA 2IXGA 1SXJA 3SE0A 4MUAA 5K8UA 4YMWA 3LW8A 5L3SB 5CJPA 4BUJA 4TZ6A 1G17A 2D3WA 1AS3A 3PEUA 4B2PA 4Q66C 3FFAA 3EPLA 4C2TA 3E70C 3BWDD 2VP4A 1MV5A 4GP7A 1SKYE 1RJ9A 5FOSA 2QAJA 3B1WA 4WA7A 1K5GA 4AURA 2C9YA 2ZJYA 3L0SA 4QNRA 5JSZB 1QBKC 1ZINA 3RRNA 2OCYC 3GQBA 3NBXX 5F2EA 4M1YA 5G3ZA 4DEYA 2XXAB 3IEVA 1OIWA 3QEJA 4URYR 4Q9IA 4QJ3A 2HT6A 3VR5A 4S35A 3KL4A 1CULC 1GZSA 2C95A 2KI5A 1G5TA 5CITA 4Q9HA 2P6UA 4GI7A 2J5XA 4G01B 1SVOA 3ZS8A 1AZSC 4KYIB 2RAPA 3HPQA 2PH1A 3VR3A 1F5NA 3N2IA 1K5DA 1XPRA 5JJKA 5FPSA 1II0A 4TQUS 2W2TA 2J0UB 4MKFA 4ERNA 3WNCA 1E0JA 1KI6B 1KMHA 4IEIA 2OHFA 4DSNA 1ZCAA 5HR5A 1G4AE 1OHHA 2OO7A 5EXSA 1DEKA 1XEWY 2MMGA 1Z5ZA 1ZIPA 3T5GA 3TUIC 3ZIAD 1I4TD 1P72A 3EC1A 3P4XA 4NDZA 1KMHB 1US8B 4WW0A 2EFDB 2DFTA 2ZETA 4N3NA 4A82A 2RGXA 3CR7A 1P73A 2DR3A 4KU4A 3MCAA 3MMPA 4TSFA 3FTQA 4V02A 1XTJA 3CUEF 3RWOA 1RW4A 2EW1A 4MYUA 1PLLA 4URZR 1SQ5A 3B1YA 1NI3A 2QM7A 4F38A 4RD2A 3GEHA 4TMVA 4NH0A 4QC2A 4JT4A 4L9WA 2QMHA 4I1SA 1HQYE 3C41J 2J1LA 2CLCX 2CHQA 2WKRA 1OW3B 1DO2A 2ZRJA 4IDHA 3I73A 5C4GB 2WWIA 4YMSA 2GKSA 1KSFX 4HEJA 2HLDA 1OFUX 2JJ8A 2QMUA 4GPTA 5EE5B 2ODNA 1KO8A 1P4SA 2I3BA 3CLVA 2JJ1D 4WVFA 3B9QA 4C9BA 1ONBA 5SZKB 2EU8A 4KBFA 3BH0A 1BMFA 4PANA 2GDJA 4RZ3A 4PTLA 4LBWA 4HB4A 2VPPA 1FUUA 1HE1C 1OJLA 1VDZA 1KI6A 3MSXA 4N1AA 3REGA 1R10A 2BOVA 3QPUA 1WF3A 2IX3A 1JPJA 3NBZC 3L43A 1G21E 3K0FA 1YQTA 4V0NA 3R7WB 4JSYA 5CYOA 1WDTA 2F3TA 1GWNA 2ZI4A 3I92A 3EPHA 1SVKA 4I4LA 1Z0AA 4GBMA 5CDFA 1Z83A 1NVXQ 3K0FB 3CF0A 4BFUA 3V4RA 5FUWA 2BMFA 5H1YA 5KTYA 4DEXA 4B3BA 1VHLA 4EQ6B 4A15A 3NHAA 1OKKD 1YZKA 3EZ9A 3IQXA 3TQCA 1WRBA 1FW6A 1GVNB 2VHQA 3UATA 4LZZA 1NP6A 4LPKA 4K46A 1OYYA 3K70B 3MJHA 5BN3A 4KVGA 4M1TA 3WRYC 4DLZA 2WVJA 5DN6D 2C04A 4X8MA 4AYXA 4Q9LA 4DSTA 1T0HB 5FPTA 2NQ2C 4DCTA 1TADA 4JBWA 4YC7A 3GFPA 4A0FA 2F1IA 1KO7A 2FFHA 2ECKA 3BIFA 1SKYB 1W0JD 1KI1A 3FHCB 2BV3A 3LDAA 4RCZA 4UJ5A 3T15A 1W4AA 4PO1A 2WSMA 5DI3A 1XB2A 2I1QA 3BK7A 3PEYA 2AD5A 2JLXA 4KLZA 4Q19A 2OG2A 5B2ZA 2KBFA 4ILEA 1NMXA 1WE2A 4L8GA 5JWOA 3QF7A 3SOPA 1S3GA 4I81A 5TDHA 4RY2A 5LD2B 2C98A 3TAHA 3PUXA 4OQMA 4YONB 3UXMA 1TTTA 2HYDA 3ADKA 4URWR 1TF2A 1ZU4A 1G16A 1NIPA 4Z8XA 3L8ZA 3VMFA 5JJIA 1W47A 2ZQ5A 1PVOA 3N70A 3OF5A 4PPNA 5J5CA 2CE7A 2OILA 2ZI7A 2ZVPX 2CLSA 1Q57A 2WWHA 1T3LA 1G7SA 3KDSE 4NZYA 3KJEA 3LD9A 3IHWA 3RAPR 3AF3A 4IDQA 1X1RA 4BGDA 3VTKA 3RHFA 4YMTA 4P33A 2FV8A 2J9RA 3IO5A 2QGNA 2FJUA 2PBRA 2V7QD 3CWQA 3D3QA 3KJIA 3RS7A 5KPDA 2BM0A 2ZSDA 2GVDC 1GG2A 1S96A 3W3ZB 3E1SA 2PLRA 5DNYB 1NY5A 4Q4JA 1NVWQ 4DXAA 1N25A 1YR7A 2XB2A 2IYQA 3KB1A 3VR1A 4WZ6A 1XJCA 3JZMA 5CIQA 3EAQA 1Q21A 1ZD1A 1IJEA 2PEYA 4E22A 3R9WA 4W5JA 1XTRA 1XMJA 3AP1A 4KLNA 4QGAA 4OK5A 4XVQA 5FOVA 2J59A 1E1QD 4I1OA 3EG5A 4KJZA 1Q12A 3GJ3A 1X8LA 5BQ5A 2KB0A 2LKCA 2IYLD 2LWIA 1OIVA 1CU1A 1P2SA 2PZEA 1Z6XA 4FWTA 1Q20A 2A78A 5FUYA 5JWHA 3W8RA 5J4LA 1G5PA 1LF5A 5C2JB 1KO5A 1N6OA 1II9A 5JMTA 2J7PA 3OEEA 4OHYA 1RPZA 1ZC3A 1ZMXA 3LBIA 4LJ8A 2YJTD 3U44B 1IXZA 1FQJA 2ZITA 4TLBA 4BFWA 1QHNA 4ZI2A 3G5UA 5IK2D 1U9IC 5F98A 1XD8A 2UVQA 4EPTA 1H8HD 2ZI9A 1JBKA 4KFRA 2JASA 2QM8A 2QPOA 4LHXA 2FGKA 1DAHA 5EP2A 1EWRA 5JHGB 1G6OA 1B23P 3M1IA 4IEEA 2CCKA 2O8FB 3C5HA 1U90A 1G3UA 1H65A 4HLCA 1CJTC 1K8RA 2HCJB 3VKWA 1Q1BA 1WCV1 4HZIA 1V43A 1XD2A 1MKYA 3EIQA 4BZQA 1RVDA 5DLQC 4R7ZA 2JDIA 2QE7D 3MWKA 2OCPA 1SXJD 3UG7A 4DIEA 4QNMA 2NTYC 1YZNA 5TARA 1UPTA 2JJ1A 4DSUA 4PPGA 1KY2A 4LOAA 2FSIA 3WBJA 5FBWB 4BFYA 2QE7A 5HCIA 1A7JA 1JAHA 2R2AA 1R0XA 4Q02A 2ZRKA 4ITRC 3EWSA 4US0R 2WJHA 5ELXA 2OFWA 1NLFA 1IXRC 1NG1A 4J0QA 1OLOA 1TQ2A 5B57C 4O0MA 2FEMA 2BIFA 5F3WB 3CZQA 4E03A 3PIRA 2ZRGA 3FYHA 721PA 3JVUA 2GRJA 2WSSA 3VNUA 3IILA 2QAGA 4FMCF 4HDQB 2WJYA 1VCIA 4HAYA 2QT1A 1VYUA 2I4IA 2IYYA 3L0IB 1N0WA 3LXXA 4JL6A 3Q8XB 5FBRB 2CHGA 3O47A 3EIHA 1OF1A 5TVKA 3SYKA 1HTWA 3U3KA 1VPLA 1CBUA 1L4UA 4FW9A 1J7KA 2EFGA 5B58C 4M9ZA 3A1VA 4QJ5A 4KBGA 2HEIA 4AG5A 1IY1A 4BQSA 4LUCA 1P62B 2A5DA 4Z8YA 4A9AA 1E9CA 3QKSA 1U8ZA 5G41A 3SHWA 4E5UA 4JLAA 1G7CA 1KK0A 2IBMA 2J87A 4PHHA 3PENA 3H0KA 5A0FA 3RRZA 4BLQA 3LRPA 3FFBA 5FI0B 3ADBA 4MYTA 4JLNA 4TTRA 4IFEA 2BKEA 1MABA 4JMPA 3X1XA 4HAVA 3K53A 5JI2E 1XJ0A 3RS2A 4QHSA 2B7CA 4P4TA 4MKGA 1LV7A 4HLDA 2JLVA 1W36C 1TUEA 4A8JC 2VP5A 3SQXA 3ND9A 4AIIA 1IN4A 2VHTA 1T3HA 4OK6A 1PJRA 2C2HA 1VYTA 1W5TA 2Z5FA 4JL8A 1A4RA 1G9XA 2H8KA 4PPFA 5FH9A 1UBEA 2XXAA 1OB5A 1NBME 4O2LA 2HJVA 1AIPA 4V0KA 2ZRMA 3AVWA 2J45A 4YMUA 4UQOA 4UXJA 2ZR9A 4JZKA 1G18A 1O87A 4CVNA 3ZVNA 1P2UA 1FP7A 2NZJA 4HZUA 3LX8A 1XEXB 1DARA 3TW4A 4MDEA 2JLZA 1KKMA 5FOTA 1X3SA 3QVVA 4GL2A 2YC2C 2GCPA 4NPHA 2P0EA 3NEYA 1E4VA 1XMIA 1VCNA 1WMSA 1F2TA 2F9LA 4JS0A 2F9MA 2H16A 4HAZA 5KDDA 4LBZA 5AUQA 4CEJA 5JZVA 2ZE5A 5FL3A 2CL7X 1D2NA 3NXSA 1N6RA 4A8JA 2E87A 5CYPA 4IFBA 4NONA 4QHYA 1JPNA 3AGPA 4NU0A 3RC3A 5JI3E 3BERA 1S4QA 1SHKA 3RSOA 3A1WA 2PLFA 3Q9LA 3A1UA 1RRGA 4FXPA 3RLFA 4BLPA 1DADA 1VG8A 1BIFA 4KSCA 5CB6A 4XWOA 2GTPA 1M8PA 1UBCA 4FCWA 1VCOA 1XZPA 2ATVA 4N0EA 4NE2A 3ZIAA 4ZV4A 2O8DB 3SN6A 2H17A 3HU2A 4G5GA 1B0UA 3HR7A 4ASUD 4X8LA 3VKHA 1ZC4A 3VHXA 2CL0X 1G291 2NOAA 4TL9A 1QHGA 3EZ2A 4UNNA 1E94E 4Q1BA 5EUQB 1KI9A 3QQ5A 4MA4A 3IIJA 4LX0A 2XJ9A 4RZ2A 3TKLA 4E07A 3V9PA 3SU8A 2QPAA 2ZPTX 5CK4A 1PUIA 1QHHA 5E4FA 2BKUA 2OFXA 4H1VA 1SGWA 2IK8A 3MWJA 2DFNA 1U8AA 5FUXA 1R2QA 4NYJR 3NC1C 3AVVA 2OBNA 2XZPA 3C16C 1CJUC 1W4CA 2CLDX 3LA6A 1S1CA 1UDXA 2IEZA 4LHWA 5LB2A 5L3QB 1G19A 3SJCA 4C2UA 3P4YA 4Q7LA 1P6XA 1XWIA 3BH6A 4C0KA 3CNLA 3EPJA 1UADA 5HKKA 5AJYA 2ZU0C 2WIBA 3B1ZA 3QVUA 1A2BA 2JIZD 4POAA 2QPTA 1UKEA 3ZD7A 4P4SA 3HYRA 1CR2A 3AUXA 2WSSD 4LHVA 2GF9A 3SBEA 4DZZA 5DH9A 4QBGB 1NN0A 4L9SA 3FHOA 3DZ8A 3K0SA 5L8VA 1QHXA 3T61A 2FE4A 1FUKA 1E9EA 1S3SA 1XFAA 5FR1A 1M7BA 1Z07A 2QSYA 1W5SA 3OIWA 2JJ2D 2WM9B 5J4VA 2JGNA 4KFSA 1E79A 4ZO4A 3CONA 1AS0A 2ODWA 3NG1A 4LC0A 4R9UC 2RH5A 1K6MA 2ZIAA 3LVRE 3ZQ6A 3SI7A 4H1UA 2ONJA 2QG6A 1HH4A 1TEXA 1XZQA 2Q3HA 3IEUA 2GBLC 3GLHB 4LDJA 4W5HA 2G88A 2V54A 4B3DA 2G77B 4ZCMA 2FFBA 4P4UA 1Z63A 3GEIA 4GOJA 3IPYA 5DI3B 4OL0A 4OI4A 2IF0A 1U0JA 3TMKA 3DHWC 3MRSA 4JLBA 1ZAKA 3U3RA 4ZDJA 4XD7D 1TQ4A 4V03A 5FBLB 2ZJ5A 1SXJC 5KUTA 1NG9A 1GRNA 1E2MA 4DCNA 3TRFA 5ANRB 3R9XA 3AVTA 1IAQA 3GJ4A 1FPMA 4XD7A 3B6EA 4A2PA 2Q9AA 1R5OA 1FTSA 5JJLA 3QKSB 2C8VA 3RC8A 1M7GA 1GNQA 3OHMA 3WP0A 4DT1B 3NBFA 2XB4A 4K8OA 2QROA 5KNBA 1GL9B 2WWYA 3AH8A 4XWKA 4RJLA 1ZYUA 2HYIC 2VSFA 5BYJA 4NBSA 1EGAA 3LFUA 3FKQA 1SVMA 5EP4A 1W0KD 2GVZC 4P0TA 4HI0E 1KI4A 5HZKA 2JLSA 3QI2A 1W4BA 2FGJA 4TYQA 1PUJA 1P9WA 1E4YA 2R62A 1ETUA 2QEQA 4B2IA 1W49A 4RZUA 3QUSA 2RGEA 3KUDA 3GP8A 4DLUA 2XJ4A 2Z4RA 3H84A 1RC8A 1TEVA 3KKQA 4AC9A 1E69A 3MUFA 1WXQA 1GKIA 3TUZC 1RRPA 2W58A 3TJZA 4Q1CA 5CM8B 1YE8A 4QRHA 2O52A 1O3YA 3I72A 4ABYA 1OV4A 5DE3A 3KTAB 4LJYA 4EPWA 4IHQA 3QJYA 2KSQA 4C0QC 1XEXA 3CNNA 3U6BA 1UM8A 1GOTA 5H8WA 4BWYA 4V0ME 1XCGB 4LJ7A 2V4ZA 1UKZA 2YWGA 4PR0A 4LJ6A 2FEOA 4ESVA 1UAAA 4TMWA 5LD2C 2D62A 2OESA 4HLUA 1YR8A 4QGFA 1M2OB 4NCKA 3QKUA 3EZ6A 5LB4A 5BXQC 1RFLA 6Q21A 3LX5A 3GJXC 1KDRA 1XTIA 2W83A 5IK2A 5JS8A 3LWNA 2PL3A 2WMOB 2XTMA 3PUVA 4TQ9A 5JCZA 1RKBA 4BLOA 1IY2A 3VHLB 2WMNB 3DEFA 4M1MA 3KQUA 1W4RA 4I1UA 5EXTA 4B34A 4IXNA 2FNAA 4F92B 3A4LA 4KODA 3H2YA 521PA 1SVIA 1A5TA 1W0JA 2WPDD 3BJIC 1Q22A 1YR9A 2ZREA 3NKVA 3W34A 4CF7A 3D6TB 4JVMA 4W7SA 2JLRA 3W90A 1SVLA 1JR3D 4QFMA 1FZQA 2CNWA 1XRJA 1JR3E 4EUNA 1G3IA 5BYKA 2MSEB 1RRFA 1KSHA 1FX0B 1NKTA 3GFOA 3GPLA 1XDBA 1OB2A 3K0AA 2X1VA 2GXUA 4OHVA 4NKRA 4QGHA 3THXA 4AI6A 1X8KA 3AVQA 1M6NA 4PQYA 1OXSC 2XZOA 1YVDA 1TMKA 4AG6A 1KAOA 1Z2AA 2QZ4A 3U5ZB 3E2IA 1Y3AA 1IM2A 4DB4A 1CP2A 1N0UA 1OXTA 3THXB 1E2PA 1NKSA 4M22A 621PA 3UG6A 2ZANA 3QG5A 4EFLA 2HUPA 3R8CA 2DBYA 1KI2A 2FWRA 2OEPA 3K1JA 3VX4A 4KITB 2O8BA 3LBNA 3FMFA 2EWVA 1II8A 3R7WA 5AJWA 2ZS8A 1OKKA 1QZXA 3SJZA 1MT0A 2JLWA 3CRQA 3TUJC 5KSPA 2NMVA 1WQ1R 2NIPA 3I1FA 4KFUA 2BCJQ 2QU8A 4HDOB 4ACAA 2BMEA 3SS8A 2R6CA 4Q7KA 4NMMA 5FPHA 1IOZA 4JJZA 4Q21A 3WHKA 3AVPA 4A4DA 3BAFA 4AYTA 3PUZA 4Z1MD 2GNOA 3LW7A 1E9RA 2YWFA 2GXSA 1SXJE 4RD1A 3OZXA 5EP1A 1KI7A 1RE0A 1E2IA 1RYFA 2BWJA 4GOXA 4DUGD 4IVRA 2PCLA 5FTKA 2ZE7A 3QBVA 2P5TB 2W6JD 3PITA 4M9SA 4NYJQ 4RVCA 5C18A 4DLSA 1CLUA 1E9DA 2XEXA 1G8PA 3NHBA 4LBVA 4MH0R 2CNWD 4LK2A 1DO0A 4OJKA 3O8RA 2FN4A 3I5XA 4JJKA 4MGIR 2CVHA 1Z6AA 2JLQA 3P1JA 1ZM2A 1E32A 4GMXA 2AWOA 3I61A 5IHPA 2FU5C 3OE7A 3K0CC 1Z2CA 3QXCA 1DS6A 4C4PA 1AA9A 2VH5R 2QNRA 3FMPB 5AUNB 4GP6A 1IN7A 3BFKA 1FNNA 3GMTA 5EQTA 3GCGA 2VIIA 3LQRA 4DKXA 2F3RA 4DLTA 2ORIA 1E0SA 1NBMD 4ZCLA 2GJSA 2VF8A 1UDWA 4Q4HA 3THYB 4MGKR 5FFMA 4LHZA 2C96A 5EP3A 3SQWA 4M1WA 1JEEA 3QXJA 1IBRA 3I32A 2UZ3A 1YHNA 1X1SA 3VFDA 1J99A 4KXFB 5J4KA 3SFZA 2FMXA 2OLJA 1QG2A 3Q3JB 2N1BA 1VG0B 4QGGA 5SZHB 1T5LA 2DHRA 5SZJA 5L3SA 1H8EA 4B48A 2IS6A 4Q4AB 4OJQA 2X2FA 5FOUA 1XTQA 2O0HA 1FMLA 2IS4A 4WBSA 5FTMA 4AY2A 5BWMA 3EIEA 5BN4A 2QGZA 4B73A 3G0HA 4OKSA 2NO0A 1HUQA 1P9RA 1UKYA 2R6AA 1U0HC 1XMSA 3ZS9A 1N6KA 3K0EA 3OIUA 3MJRA 4LHYA 3KJGA 4NCNA 3DM9B 1FFHA 4KFTA 1NIJA 3EARA 1G7TA 1R8SA 2D74A 4MUBA 1Q3HA 1W36B 4NYMQ 4WXRA 2CCJA 1F48A 4B32A 2IYVA 4NTZA 3PCRB 4CEIB 1Z0IA 4BEBA 1W1WA 2WICA 3VR4A 3SZRA 4BLRA 1L8QA 2WHXA 4G1UC 2C03A 4TZ0A 1E2LA 4Z1MA 3B5JA 1LW7A 5GJVC 4IKEA 1X6VA 3WP1B 5B30A 5DGXA 1OFHA 3IIKA 4FCTA 2X19A 5DO9A 2FPMA 3UWKA 4TTQA 1J90A 5J47A 1G8HA 1AGRA 3WNDA 1ANKA 1FNMA 1M1YE 4M8NE 3I3SR 5EZ5A 3AVOA 4D81A 2PT7A 1IJFA 4BFZA 4BASA 3LAWA 3SC3A 5HKKD 3QXHA 2QY9A 4B75A 4B2LA 2F1HA 1U9IA 2RGNA 2ORWA 1NJGA 2O8BB 2BHRA 1QHIA 4P4SB 3M6AA 1R0YA 4OQXA 4JYCA 1N6HA 2W2VA 1KHTA 4X8HA 4RKFA 1TL7C 1ZU5A 4ZI3A 4KO8A 4NCHA 5G3YA 1P3JA 1HE8B 4D25A 1G5RA 3SNHA 4LV5B 4Q5IA 5KSZA 1XD2B 1KKLA 3LO5A 4LYFA 5EUMA 1KO4A 2WJIA 2F43B 1Z0JA 4BFTA 5FOXA 2Z83A 3CB4A 3HU1A 3Q5EA 2V3CC 5DISB 2AN9A 2GXAA 2DFLA 2QAGB 3MWLA 4IJMA 1JB1A 3BB4A 3CPEA 1QHYA 3GLGB 2EYUA 1JI0A 4Q7JB 1D5CA 2G1JA 2P65A 2QBYB 3AUYA 3CWZA 5EXXA 2OCBA 1CJVC 3TQFA 2GK7A 1GIAA 4LYAA 4TLCA 2TMKA 1ZW6A 3NVAA 3UMSA 2BEKA 5JHHB 1KZ7B 2ZRNA 1KZGB 2GZAA 3D8BA 3QEOA 1UF9A 1P60A 3F3YA 1XCPA 1Q0UA 3OIVA 4NCIA 4UXIA 1G7RA 2W6JA 3NWJA 2VL7A 4Q47A 2OBLA 2ZUDA 3IGFA 2LKDA 4CZ2A 1Z0FA 2ZJAA 4YLGA 5E7JA 3ECCA 3RRYA 4HLUC 3C4JA 3U3MA 2JAQA 5UKDA 2OFOA 1GRRA 3VAAA 4PAOA 4IVPA 4X8OA 2V8OA 3LY5A 1YR6A 2SHKA 2FSFA 3AP2A 1T6NA 3CPHA 3QKRA 1KDOA 2XZLA 4JIMA 4CT4B 3BS4A 2D7DA 3KFXA 1F60A 2AFIE 2RGNC 1E0AA 3FDIA 4JLPA 2BVNA 3IBGA 3V4FA 1T3SA 5E7MA 4BECA 5C46F 1CIPA 4FMDF 2FDCA 1UBFA 4D4KA 4AKHA 3I8SA 4WIAA 4ACBA 3O8BA 1IONA 2AXNA 5D3MA 2C77A 4LJ5A 4CW7A 421PA 2ZU6A 1NSTA 1OXVA 1XPOA 5CIWA 3ZJYA 4W9MC 2ODBA 3C8UA 1ELOA 1GUAA 1G64A 1QHSA 1BMFD 3NH9A 3S1AB 5IF9A 1ZNXA 3H86A 5AK0A 5DYIA 5K8IA 3ZVRA 4PSAA 4A6PA 2O8CA 1AQYA 2OBMA 2OXRA 4LYHA 2CVFA 4DDVA 2REXB 2Y8EA 1VG9B 3FE2A 3A1SA 1SULA 2CMKA 4Q1AA 1F2UB 4YMVA 4RFSA 2IL1A 1JEDA 2ZROA 3C7KA 2GXQA 2QUZA 1DPFA 1QG4A 1OIXA 2OM2A 4ZIRB 2O8CB 2ZRBA 2ANCA 2YOFA 4LJ4A 3GJ8A 4OI0A 1T91A 2PZGA 2LCFA 2OAQ1 1R6BX 1NSFA 2IF2A 3GLHE 1XTKA 3QOFA 1U2RA 3GLFE 4KCGA 3Q72A 1KNQA 121PA 3AF0A 3DO6A 2EWWA 4U5XA 2BMDA 1KJYA 1EESA 4B71A 5KPJA 2BCGY 3WMFA 5KDLA 2R6GA 3LLMA 3IUYA 2FFQA 3TGPA 4ARZB 3OEHD 2NO6A 5GJWC 2PMDA 3RDPA 1Z6TA 3U7EB 1SXJB 4OI2A 5KOYA 1HT2E 4KHZA 4PZYA 4RSGA 5GVRA 5EZ6B 4A2WA 1OH6A 4LJ9A 2HLDD 3O8DA 1IN5A 1AKYA 1L4YA 4Z51A 2XSZA 1FOEB 3MD0A 3RVBA 3A58B 2IYZA 3BC1A 4XSGA 1LY1A 2C9CA 3E5HA 5IRCD 2IT1A 2ANBA 1HY3A 4CEIA 5AR1A 5JSZA 4DSOA 4C7OA 3BORA 3AGQA 4M1KA 3W6OA 1XP8A 3ICEA 4TT3D 2CBZA 2ODEA 2XTZA 2WPDA 1GDDA 4CEHB 2F1JA 4C0LA 2CK3A 4LJAA 3KTAA 4P32A 4XVRA 4G5OA 1E1RD 2IUUA 1G8GA 4NP6A 1R8QA 3K9HA 3ONWA 2IWHA 2Q9CA 4UNQA 1LB1B 1ZUHA 2FZ4A 5DHAA 4EPYA 1E99A 4JBXA 4CYMA 4HUTA 1W46A 4CIDA 2IS2A 4TYWA 1D9XA 3B7GA 4RD0A 3NDPA 3L8YA 5CDFE 1Z3IX 4V0LA 5A4JA 3DMNA 2HF8A 5KNDA 2FA9A 1SVSA 3ADDA 2ORVA 2FZLA 4IOLA 1MH1A 2VP0A 3QXXA 1XPUA 1IY0A 4LY6A 3QY0A 5C4MA 1YRAA 1JALA 4B47A 2GEUA 4GZLA 4WOPA 3ZH9B 3KKMA 1CF4A 3CM0A 3KXLA 1Z6YA 1C1YA 3P32A 2PX0A 4XOIA 1CEEA 1E3MA 1KSGA 1DE0A 1L2TA 2GJ9A 221PA 3A6PC 4C0AC 2VF7A 2J41A 1KY3A 5AJVB 3KZ1E 2ZUCA 3TSZA 2NG1A 3PR1A 4H9GA 4I1VA 4QHTA 4BLSA 4D4LA 1ZP6A 4ZDWA 1GKUB 4D82A 4C7OB 3T35A 3QE0A 1L7VC 2OT3B 3GLHA 4LI0A 2W00A 4M4SA 4KSBA 1JJVA 5DI9A 5KU1A 1U81A 4EFNA 4OQFA 3AEZA 2V6IA 4EPVA 3BH7A 1CJMA 5H68A 4Q7MB 5FR2A 3THWB 2AL7A 1FQKA 2G1KA 4PX9A 2QENA 4JKYA 2GJ8A 1KGDA 3C15C 2J0UA 3F0TA 1OFTA 4PPQA 2GCOA 1W48A 2ZS9A 1ZM9A 3QPWA 3B1VA 3B60A 1DG3A 4YDHB 4EJSA 4GFDA 4IDPA 3OEHA 2ZJOA 2D7CA 2NO1A 3QPVA 3OIYA 1WA5A 3MG9A 5L3VA 2X8AA 1XU4A 1SVWA 3CNOA 2YINC 2OUKA 1G3MA 4F93B 2QP4A 2H1LA 2FPKA 4PSKA 1PZNA 1R7RA 1R0ZA 4MQBA 3QSYA 4OK3A 1TF5A 4OHZA 1TPZA 1JAIA 3HJNA 2VP9A 4C0JA 3N2EA 1YZTA 4DIDA 3NH6A 3X2SA 2ZI5A 2GILA 3UIEA 5BW8A 4G5SA 1E9FA 2A2ZA 2GEDA 4US2R 1Z0KA 3MGCA 2NPFA 2ONKA 3LLUA 4UNRA 2GA8A 2D4HA 1OXXK 3R9IA 2P3SA 4DDUA 1E98A 2WIAA 4TT3A 3SFVA 1ZNZA 2ZEJA 3BE4A 2YHSA 1JXOA 3EXAA 4Y0AA 1E9AA 4LGMA 2REBA 4DCVA 1JNYA 2RGDA 2IWRA 2EFCB 1MABB 3TSOA 1RZ3A 1I2MA 2IA5A 3PVSA 1DOAA 3WXMA 4A0RA 1P75A 4KAXA 4DVGA 4A6XA 3Q85A 4LRWA 2ASEA 5D3MB 5G53C 4PC7A 1GM5A 2JA1A 5CK5A 4ZDIA 4MKIA 4C0SA 1YZLA 3FPAA 1TF7A 1EFHA 3QKTA 2XGJA 3HYTA 3SJAA 821PA 1I2DA 2CJWB 4TL6A 1EFRD 1Z6GA 4Q00A 1UBGA 2MMCA 2R6DA 5F9FA 3AF2A 3K8YA 2H5EA 2RGGA 2FF7A 1J8YF 1Z8FA 1BS1A 5FPYA 2GHIA 4HSEA 1XXHB 3EWAA 1EFRA 2RKOA 4NYIQ 5C1BA 4IOJA 1DAIA 3Q5DA 1GFIA 3CKLA 4IXMA 2G0TA 4Q1DA 1YRBA 1Q1EA 2HXSA 4PHTA 3TVTA 4UNPA 4JLKA 5SZIA 1GTVA 2ZI3A 2G9NA 2J7PD 4KVAA 2YOHA 2DFKB 4V0MA 3EX7C 2W6ID 4ARZA 2CK3D 3RS3A 1Z08A 5CM9C 2JDID 1BYUA 2WKPA 3UWOA 2VO1A 2QTVB 1AGPA 1PV4A 2PCJA 2QMOA 3PUWA 3LV8A 3ASZA 2JCSA 3KQLA 4HAWA 2CCGA 2A30A 1M7HA 1G1MA 3CW2A 3K09C 4GRAA 4BE7B 3PEWA 4DCSA 4XH9B 4BZPA 1N3BA 5E7IA 3UANA 4DLXA 2P6NA 2RGCA 2V9PA 3NEJA 5GVSA 3EA0A 3GJ6A 4AD8A 2CJWA 3FMOB 3VR6A 2G0NA 2NO9A 3KQKA 4A2QA 3AKCA 4GNKA 4OYHA 1MR3F 3I5YA 1CKEA 2X2EA 3BXZA 1DAGA 1CR0A 1E2JA 1VYVA 1ZD9A 2BC9A 2P67A 1S2MA 1DTSA 1BOFA 4RD3A 4Q1EA 4C0HA 3GLGA 2QORA 4RZXA 3VX3A 1UJ2A 2XTNA 4PZLA 1LS6A 2V6JA 3RANA 1FMJA 2KE5A 3ZDQA 2IUSA 3GEEA 4B3FX 2C78A 2GBLA 1E2KA 5JEEA 3EA5A 1CR4A 1Z0DA 3A8TA 4JT2A 2ZRDA 3TLXA 3HDTA 2QTFA 3RSLA 4YDSA 2RGAA 4II7A 1G6HA 2OAP1 1P2VA 2A3RA 2EYQA 2AK3A 2JJ2A 4AKEA 1Q1QA 1T8UA 4TLEA 3MFYA 1E79D 4DDWA 3DKPA 2J0VA 3EW9A 1E2EA 2GESA 4PC2A 2ZS7A 1LVGA 1AKEA 1XCMA 3SYNA 3H1TA 1P2TA 1ZNWA 5LBIA 2DCUA 4DB2A 4WZAE 5JRJA 3T12A 1QHHB 1FX0A 3KXKA 1I4DD 4UNSA 2D2EA 4G5QA 3RS0A 4BRUA 2RCNA 3TIFA 1BYIA 3BFXA 3DMDA 1NLYA 3D31A 4IOKA 1V5WA 1E2DA 3B78A 3VNVA 2AFHE 4F4CA 3DZDA 2J46A 5FL7A 3ZD6A 2XSZD 4HYYA 5FPKA 5CJ2A 1TAGA 2IS1A 3R8FA 3TK1A 4MYCA 1DBSA 1QDEA 3AVXA 2O5VA 4EPRA 1NMYA 1GRQA 1QVAA 3W5JA 4N0DA 3M4YA 2WWGA 4HB3A 4R98A 3K9LA 4GOKA 1MRNA 2OZEA 4QM6A 4QJ4A 3ZVMA 5JS7A 2ZRAA 1MO4A 5CLLA 4U02A 4HDCA 4TLAA 2GETA 2J7KA 4PO9A 1KI3A 2AK2A 1LS1A 5M04A 4B33A 1R5BA 1TX4B 1P5ZB 3U7HB 3T5DA 1TU4A 2PEZA 3JZAA 2O0JA 2ZVQX 1BKDR 4U7DA 1U98A 3L82B 1NVVR 3U7FB 3W9YA 1XJQA 1ZUNB 5FTJA 5JWRA 4EQ6A 2EVWX 2JLYA 3I62A 4JLVA 2F55A 1U8YA 4TMXA 1IQPA 1KK1A 1LNZA 4RD6A 1AZTA 3FHTA 3DM5A 1S9DA 4XVUA 4TYYA 2IYSA 3U7GA 1GAJA 3CBQA 4TMZA 5KHOC 3AM1A 3BB3A 3U4QA 3ZQJA 2UZIR 3TVDA 1CR1A 4TWZA 1N0VC 1KAGA 3WNBA 2GK6A 2VTKA 1S1MA 1E1QA 4C0BA 3LXRA 3IPXA 1T0JB 3CH5A 4MRPA 4URXR 1CXZA 3IDQA 3LBHA 1D2MA 1WB9A 2FFAA 3PUYA 1ZM4A 5JLJA 4W5WA 4M2LA 1AJEA 4TLDA 4EFMA 2BM1A 3QNUA 4Q9JA 4NYMR 3OFNA 4M9QA 1AK2A 3QIAA 2CDNA 1F2TB 3PJRA 3TE6A 2HT1A 5DIFA 3LQQA 5HE8A 2QQEA 1EG7A 3TH5A 3VU9A 1DELA 3K9NA 2Q3FA 2JATA 2P5SA 2Q0HA 4QOSA 1E1RA 1KI8A 4GMDA 3VQTA 5GADl 2AHOA 2F7SA 3T1OA 1A82A 2XITA 2XAUA 1G3QA 3GJ7A 1ODFA 4PQRA 2G3YA 1BO6A 3T34A 4EDHA 5JRZA 2O8EB 2OSBA 4XJXA 4F4JA 4D4JA 2HDNB 4URVR 1ZVQA 1EWQA 4A0GA 4A36A 4L16A 3B13B 2B7BA 1US8A 4UKDA 5TV2A 4Q4JB 4CEJB 4Z54A 3GD7A 3NC0C 3K70C 1UEIA 3AKDA 3U60B 1TUIA 2IC5A 4LC1A 1GNPA 2HXYA 3BOSA 4D26A 3AVYA 1CRPA 1W0KA 4D2IA 1LFDB 5IT5A 2YZ2A 2FX3A 3DOFA 4IDOA 1D8TA 1HV8A 4LPSA 3Q7PA 1SHZA 1T9HA 4AWXA 2ZM5A 3MWYW 1G41A 4B35A 1XXHE 2W0MA 4M1OA 5JECA 5GJBA 4JVLA 4PHGA 1RJ9B 4LV6A 3KJHA 3U2QA 2QMEA 1W7AA 1E96A 2YC4C 2VSXA 2ZJBA 4A1FA 4NHOA 2V55B 4R2HA 3GLIE 3UMFA 2QI9C 2WZQA 3JVVA 2H92A 1N5LA 1UEJA 5EXPA 1OFIA 3W6PA 2RMKA 4PSVA 2Z6VA 4DLWA 1EX6A 2IW3A 4C3ZA 3THWA 5L3QA 2IXEA 4O3MA 3AV0B 2QAGC 3QENA 3T1TA 1P61B 2W2XA 1E9BA 2GEVA 4AK9A 4L4UA 4PAMA 1ESMA 3CRMA 3DKVA 4GSYA 2EFEB 2WOOA 5DYGA 2H57A 3CR8A 2JLUA 1Y63A 3KXIA 4B3XA 1AS2A 3DPUA 1WBDA 1JQLB 2EFHB 4DLVA 2QBYA 2X77A 2GCNA 5DN6A 2AR7A 3NDBB 1HT1E 1PLKA 4KV9A 2DWPA 4MITA 2IEYA 2WBLC 2F1RA 4MRNA 1DAFA 2YYZA 2NO7A 3RRMA 3QKRB 4Q1FA 4B6FA 4D80A 2RHDA 3KX2A 5FBQB 4QM7A 1YZGA 5K8LA 5IDVA 3QBTA 2FPLA 1H8HA 4LCBA 3KKNA 4HLQB 3KKOA 1ZCBA 2A9KA 2VP6A 4DT1A 1NNEA 3QG1A 2ZE6A 5L3RA 4M0LA 1JXMA 2ERYA 2DPXA 5AUPB 2W6IA 4DRZA 1GL7A 3P26A 4IDNA 1GP2A 4JLJA 4D4MA 1NLZA 4MRRA 4GT1A 4OQNA 3TNFA 1G4UR 5KSOA 1UKVY 1J2JA 4JLOA 3TSWA 4D0GA 3GLFB 3FWYA 4WXPA 1NMZA 2YWHA 2PX3A 3MAAC 1CJKC 3UPUA 2NPIA 2OV2A 2BJVA 4GDFA 3PFIA 3FKSA 2C5LA 2GAOA 3F5FA 3AF4A 1DG1G 1M74A 5FBVB 1TQ6A 4TYNA 2MSDB 5FUVA 3F8TA 4BLTA 4FN5A 3T1VA 2WJJA 3M0EA 3FKSD 2HF9A 4EPXA 3OAAA 3ZGXA 4B3GA 3PG5A 3IO3A 1COWA 4IOMA 1KDTA 3ADCA 2V1UA 2GZHA 1MO5A 5AWFC 2ATXA 1Z29A 5TY0A 4CRWB 5CB8A 1Z47A 2DB3A 2ZSEA 1JECA 2AWNA 3U61B 1VCMA 1R4AA 1HA3A 2W0SA 4ESHA 1JR6A 1N5IA 1U99A 3U6KA 3CPJB 4BEJA 4KI0A 1XMVA 1NVUQ 2F6RA 2G6BA 1KDPA 3OFND 3HPRA 1E2FA 5B64A 1N6LA 3CRVA 2VP2A 2VRWA 4E09A 4FMCB 4DWJA 1VG1A 3U3JA 3R20A 4MKHA 1W2HA 5E3HA 2WAYA 1D2EA 4DJTA 1ZNYA 3EZ7A 3WHLA 2QQ0A 3ZVLA 4B44A 3OEED 1PLJA 1GILA 2AX4A 2GAAA 1CRQA 4D0LB 3ZYCA 3GFTA 1LF0A 2E1RA 4Q03A 2KWIA 2EQBA 4TTPA 1NN3A 1T5IA 3W5IA 2B92A 2NZ8A 1QVRA 5J4HA 3FGNA 1ZRHA 2QSZA 1KJWA 4ZKEA 3AB3A 1KIMA 2AXPA 3K0AB 1LTQA 3SR0A 3A37A 2WWFA 2QL6A 2N42A 2A5JA 2BJWA 2IUTA 1VIYA 1RIFA 2XX3A 3BFVA 5KSYA 4HATA 4RKEA 4XTRA 1DVRA 2FSHA 2A5YB 3ZLJA 3AKYA 2J3EA 4L15A 4PZZA 1NVVQ 3RS5A 3TBKA 1YU9A 4PC6A 3ASYA 1WP9A 1DAKA 3P20A 2HCBA 4KYUA 3IBYA 4CT5A 2JEOA 2VLIA 2WKQA 3ETLA 2ZRLA 3EC2A 3DL0A 4R2IA 1COWD 4CGZA 5KYKA 2ZYWX 1QF9A 4JVSB 2Q3MA 1KTVA 5P21A 4IRUB 3X1WA 5HPYB 2B21A 4XWAA 1XEWX 2Q6TA 3UK6A 2WWWA 3ICQB 1FL9A 5JEDA 2PZFA 1KSJA 3I8XA 3IKJA 1NY6A 4EIWA 1IXSB 4FMBB 4FI3C 4YXWD 1R0WA 4F91B 4ZDKA 3GLIA 2J0QA 4HAUA 2H18A 4JLDA 3BB1A 4OHXA 5DHFA 3AVUA 3WRXC 1E9SA 2ZRFA 4FD2A 1ZM3A 4GZMA 5FTNA 1E6CA 4TMKA 2FG5A 2GWHA 2ZYVX 5H70A 4D6PA 1Z22A 2V7QA 4XTCS 4QBIA 1HQCA 3DOEA 3X1ZA 3EZFA 1E2NA 3CF2A 2CXXA 4BFXA 2P6RA 1W36D 3SHFA 1RRCA 4BRWA 2ZSBA 2FOLA 1J8MF 2QTHA 4XSHA 5HE9A 1TU3A 1ZD8A 3WMGA 1ZIOA 3Q7QA 1XBTA 5TB5A 3W6NA 2XNDA 1ZM7A 2VEDA 2I1VB 3CH4B 2BDTA 3CX6A 4EJSC 4JSTA 3K70D 1N5KA 1W2GA 1F3OA 4QBFA 1KK2A 2B8WA 1N6PA 2YOGA 3SJBA 2Q9BA 3IHLA 1ZUIA 4DUGA 1IN6A 2G83A 5HTKA 2ZE8A 5BN5A 2XOKA 3FMIA 1X8JA 3N5CA 2OLKA 2QRNA 4B3CA 2A5FA 3RS4A 3RABA 3CIOA 1RYHA 1F6BA 1XD9A 1ZBDA 5GJCA 1OH7A 1YKSA 2D06A 3A4MA 4JBYA 4QBHA 1XNJA 2QP9X 3LVQE 2XOKD 3TAUA 2PT5A 3IIMA 2ZJ2A 1Z28A 5E95A 1SZPA 3KQNA 4US1R 1GNRA 3BBPA 2L0XA 4NL4H 4PAQA 1JJ7A 1TNDA 2WOJA 2IYXA 2DYKA 3GLIB 2ZRHA 4UJ3A 4B74A 4FCVA 1N5JA 2A5GA 1MRSA 4TN1A 2R65A 1OPXA 4V0OA 4ASUA 1WBBA 5TMPA 4A0HA 2FH5B 2AKAB 4HB0A 4IW3B 3HP1A 2BBTA 2ZYTX 3PQCA 5FTLA 3SEAA 3AQ4A 3GJ5A 3OESA 4A92A 4R71A 4WZBE 4G3XA 2RGBA 2ZRCA 4AYWA 4QKQA 3LNCA 1CS4C 1NN1A 4LYJA 4OQLA 2PJZA 5AJZA 4Q4AA 1MO6A 4DC9A 3BGWA 2YVUA 2IXFA 2QN6A 3GLGE 2IHBA 1KJZA 4MGYR 2R9VA 1I4LD 1OE0A 2KJQA 4P3YA 2WTUA 5LDDC 4JLMA 1EK0A 4OBEA 4RD4A 4HB2A 4K81B 1H8ED 1Q1ZA 4ZPXA 1S8FA 1NF3A 3CO5A 2RB4A 2CEAA 2GCOB 4BFVA 4PFSA 2REOA 4HUQA 3WYFA 2J0SA 4EAQA 3B8HA 4G5RA 2GZDA 3SBDA 1U94A 2ZJ8A 2VBCA 1U0LA 3O8CA 3B2EA 3B85A 4FIDA 1P7CA 2MSCB 4RFSB 1FP6A 4PO8A 3WYGA 4DLYA 4HUQB 3EASA 4ZIRA 2GJKA 4PXAA 2GF0A 4M1SA 1CTQA 3AF1A 4P31A 3CX8A 1G20E 4TSFD 4JVNA 1JQJC 4NYIR 1VIAA 4F4IA 5JFGA 1MOZA 4D0NA 1S0UA 2O0KA 4MRSA 3VR2A 2O8EA 4B76A 5JBQA 1N6NA 5EE1A 1QRAA 5KO2A 1VTKA 2ZR0A 4TYPA 1XEFA 1VECA 2XNDD 4ON9A 4AKGA 4CDGA 2BEJA 2ZJZA 3CF6R 3G82C 2ZSAA 3L0OA 1E2QA 1YJ5A 1S9HA 2H7VA 2WAXA 2Z4SA 3K0CA 3TW8B 5KNCA 3PV0A 3I4LA 4TL7A 3PXGA 3ZZUA 3S1AA 2VHUA 5FL7D 3D7MA 4M53A 4FINA 2A7QA 2OE2A 2IYWA 2PMKA 4I99A 4MDFA 2QA5A 3KUCA 3DVLA 1DAEA 5EE9A 3U4QB 2O8DA 2AKYA 2XNSA 2FSGA 2IHYA 2ZRPA 1F2UA 3EPKA
chains in the Genus database with same CATH superfamily
1J07A 1H5UA 4PRYA 5E3IA 3NO4A 5C80A 1AQUA 4Q18A 3GHHA 2H6EA 3WMEA 5A4AA 4P93A 4JT9A 5DGCA 1YA4A 4G09A 5EE0A 1FSPA 3QITA 2WJ4A 1SOVA 3JYPA 4O4IA 1G2PA 1N2CE 1F3LA 3WBKA 4F45A 3THOA 4TSRA 1CPYA 3L8FA 4HEA1 1XX6A 2NU9A 4D3YA 3NAMA 5LLDA 2YV5A 1Y4AE 1UJ6A 2NT3A 3W0LB 4XWYA 4LRQA 2V0GA 4DLRA 5A4FS 4AKIA 2R8RA 1X7WB 4OKIA 3K1TA 3PEVA 1FRZA 5A06A 2PGDA 3VU9B 1N3LA 2ZBUA 1XTTA 2D7JA 1HRDA 1EUQA 3OAAD 4B3HA 3EVTA 2ESRA 4W8GA 4JJEA 2QD4A 3K9GA 5CDSA 1Y80A 4FYXA 3DDCA 4J0IA 4RTQA 3DEYX 5FI3A 3Q10A 3CUTA 1XZJA 4L73A 5HCNA 1EXMA 1UP6A 4DBZA 4GMKA 3T4EA 1XWFA 2MDTA 3AG5A 3AHIA 3ROZA 4DPLA 1V0JA 2DGDA 2FPPA 2HNAA 5EMLA 5G1NA 1I94B 5TRTA 4QEDA 1ZH8A 4H1TA 2AOXA 1V7PC 2D1FA 2Q4DA 3T4PA 3SXPA 1UFQA 2WSIA 3DOJA 1MPXA 2X9LA 4PC1A 1A5ZA 1KNXA 3ZPXA 4A2CA 1O9BA 3LPNA 4OHWA 8ADHA 3S5UA 1N6IA 1UK7A 1UBLS 3HYCA 1GPDG 4UBOA 1LPBB 3UJ7A 2QI9F 3ORRA 4F7WA 4PN3A 5L53A 3QJGA 1ULHA 4CEHA 1PO7A 4EG4A 2BH2A 3IJEB 2WYWA 3G2OA 4D9JA 3X2FA 3CKYA 1GTJ1 3HXPA 4J03A 2QP3A 3HVKA 1JTEA 2R44A 2X4GA 5CNMA 5EPOA 2VQSA 5BMVF 4ZEOA 2FMFA 1QPZA 1ZVMA 1ZW1A 1GNVA 4IZ6A 3SMQA 2QRZA 2X86A 2AI2A 5LYJB 4UHHA 4BP9A 1GY8A 3GFBA 3A1DA 3C3BA 4QX6A 2ZUFA 1HNZB 2N46A 2H1FA 2ZWVA 4EX6A 1QYXA 2F59A 1V96A 2A1TR 4HY3A 3GFVA 1ABFA 4ZVUA 2PKCA 4L5YA 3PWTA 5FV7A 1QYRA 3K09A 1QG0A 3KB2A 3SF8B 2HAEA 3FWHA 3HJCA 3COSA 4DBLC 2HJGA 3T7RA 2I66A 4L5BA 5KTTA 2Z43A 3E3MA 4JP3A 1JN0A 3PLAE 2A9OA 2WQZA 3U9LA 3MWDA 1XR3A 3L1JA 5P8WA 2HJHA 3AKEA 4GU5A 2ZUEA 2Z30A 1E3DA 1ESNA 3V8NA 2CXUA 3VO1A 5KU7A 1OSNA 4LTMA 1YHZA 4BMZA 1EBFA 1F9AA 4JKOA 4H7EA 4FEEA 4BNXA 3CRW1 2C5AA 3RU7A 1W4LA 3WZLA 3C7AA 2C29D 3ETHA 3VZBA 3W9SA 2C4NA 4V2IA 1M5RA 1ZDMA 4LWZA 2BFDB 4URUR 1V1MA 4YJFB 1L7QA 1Q1GA 2VAXA 4RTPA 4ROTA 3SZ3A 3AY7A 1EFAA 1CYDA 4O25A 3QBDA 3IQWA 3NCTA 1WDWB 1WJGA 3CZPA 4OJMX 4RFVA 5FWAA 1BSVA 3FZYA 1IBCA 1X1CA 5ALXA 2FQXA 3JVDA 4NF2A 2WIJA 4QXPA 1O94D 4RH3A 4C7BA 2W2NA 4YCJA 1MGOA 2MSNA 4IINA 3ZCXA 3PT9A 4I1IA 2VTEA 4GHWA 1KQGA 1R6UA 2HC9A 2VJMB 3SJUA 1NFFA 2DY1A 4MWOA 1ILWA 2ZYGA 3VOSA 3THSA 3Q7EA 3I01A 2ZT6A 2JIZA 2JCVA 7REQB 1OHHD 2PKYX 5KQLA 1Q3TA 9MHTA 1QGAA 1X1EA 4LTDA 4C30A 4L4YA 1UFRA 4FJ2A 3RI3A 1GPYA 3CV3A 4HZGA 5TGZA 4B6OA 4G4IA 1I6LA 2WHYA 3LKBA 1Z06A 4JYBA 4NAUA 4WXHA 5REQB 3AEKB 5D3QA 3SGLA 2FQYA 1KEEA 2CJYA 3DOOA 3CURA 2PKRA 3SHTA 1OFUA 4OM8A 1SAYA 3TMAA 4MDHA 4FWIB 1SG6A 1QPGA 2J07A 3D1VA 4H6XA 4ZCIA 1C8VB 2B6HA 4RPIA 1CP3A 2X22A 2WUVA 3OKPA 1KYIA 2F1KA 4MGZR 1X86B 2D1YA 2OCAA 3QF4A 2PFGA 4MV0A 4WCVA 2C99A 1KS9A 1TC1A 2BTQA 3JR3A 4UM9B 2B8TA 1RE1A 1ZO8A 1GSIA 3O5AA 2HA5A 4MB0A 2Y1GA 3UOGA 3THYA 4H7FA 4ATNA 1XUOA 2NGRA 2AXQA 4LZJA 3W2GA 1ZCZA 1T1GA 1X3LA 4BNHA 1C3JA 2FSUA 2OXFA 4B8ZA 3HWSA 1CUAA 2BMJA 5DMXA 2IYRA 3KKPA 4ZICA 2IYTA 1K7XB 1ZJJA 1YNSA 4PLHA 1TI7A 2JPDA 3I9MA 5BP7A 2R8XA 1YULA 1E1KA 1CS0A 4MP3A 3UKDA 1JQKA 5K8UA 4YMWA 3LW8A 2NUPB 3UA3A 3CUSA 4HS4A 4E5PA 1QH8B 2BCEA 2D3WA 3LX4A 1AS3A 5AW0A 4NS4A 4Q66C 4ZMRA 1JDUA 3KAJA 4C2TA 3AR6A 1D03A 1F4LA 2WJWA 1BVRA 3E70C 4GP7A 1UBOS 1N7JA 4MO9A 4YAOA 1TQ8A 1JG4A 4WA7A 3AW9A 3HV2A 4QNRA 3WZ2A 2QY6A 2O2GA 4AJ2A 2VJLA 2OCYC 1K68A 4WLVA 2YN2A 5BUSA 2LIPA 4DEYA 3U16A 2OKCA 1YH3A 3IB6A 2Z3ZA 4U1RA 1OIWA 4GI3A 2XXAB 4QJ3A 1O0CA 5DBGA 2WD9A 4RVNA 4ZZ1A 5I7HA 1HX7A 3CS3A 3RRXA 4D02A 4LCJA 4DA8A 2X5NA 5EEGA 5KC9A 2WWTA 1OU4A 3WSVA 3PQ2A 2PX2A 1FLNA 1UFKA 5JNVA 1AZSC 2PWPA 1P9LA 1F5NA 3CNQS 2VXOA 4YO8A 4ZREA 1K5DA 1QS0A 3G3EA 3PWZA 3C7DB 3FZGA 3ROQA 1SU8A 2HEGA 1WBJB 2HHCA 2W2TA 2J0UB 1EUCB 3V7YA 5CYGA 3E8SA 3DVAA 3IOEA 3FVTA 4RABA 3AHHA 2AN1A 1KMHA 4LYEA 1W1UA 2QMYA 4IFTA 2OHFA 4U8HA 4NK4A 3H2JA 1OHHA 2D1SA 2OO7A 5LU9A 3EDOA 4HRVA 1XEWY 4OAOA 5HA5A 1Z5ZA 1ZIPA 1GDHA 4MSUA 4DZTA 1A9ZA 1I4TD 3D3JA 4DA9A 4NU5A 4GM4A 1NHGA 4NDZA 1Z4NA 2WT4A 1M5TA 2HPAA 5TEVA 2EFDB 2RIRA 4D7AA 4RETA 1H2EA 1IE3A 3CR7A 4RXUA 5A03A 4DW8A 1P73A 1XKXA 3DXZA 2C4KA 2CJXA 4TSFA 3ZE7A 4B3IA 2D4AA 5LQAA 2WLTA 2EW1A 4J0JA 1PLLA 4URZR 1ENPA 3INGA 1Z4LA 2H06A 3GEHA 1V9SA 4XGIA 1AMUA 2HRQA 4BBAA 1FYXA 5KBYA 1I7LA 3G17A 4UCQA 4N6OA 1CQJB 4L9WA 4QICA 3VSEA 4TT8A 3EGWA 4FNAA 2JS7A 3KC2A 4AO6A 3V4PB 5KINB 3LQ2A 2J1LA 4MCHA 4NECA 4GMFA 2R4QA 1ML4A 2CHQA 3TPCA 4JC0A 4ZAYA 1DO2A 2NU7B 4MW9A 3ZK8A 4CKBA 5C4GB 4DR1B 3F6CA 2VK1A 5L51A 3CUUA 1OFUX 1SCIA 2QMUA 2X23A 3UJ3X 4FYKA 4B6QA 4ZI7A 2QN9A 4UTXA 4O0LA 4W1PA 3U7JA 2I3BA 5K01A 3AL0C 2Z58A 2O48X 3CLVA 5J2UB 3TOZA 3B9QA 1ONBA 2QL5A 4CODB 1D6SA 3N74A 4PANA 2DPHA 2REQA 4PTLA 3IUSA 2QX9A 2FWMX 4HB4A 1HE1C 4RAQA 1MEOA 3Q3CA 4UFNA 1LXCA 3WV5A 1VDZA 2KHZA 2Y1CA 4OBXA 4X85A 1KI6A 1LTHR 5J43A 5TE9A 1I5RA 3FZEA 1K7CA 3TRDA 1VGVA 4GR5A 3U4MA 2P4UA 2TMDA 4ISCA 4FFRA 5BW5A 1XRMA 1EQ2A 2VDNB 1MGPA 1MDFA 1WF3A 2CUKA 3NBZC 4EW2A 1PN3A 3L43A 1G21E 2EJCA 2INGX 4D9MA 2H2FA 5EJAA 3NGLA 3QFTA 3UT5A 4AJ4A 2Z57A 1FRNA 1H2YA 3M6LA 1A9QA 3G9ZA 1VPVA 3LFTA 2Y1OA 4LXYA 4TMFA 3UJPA 1MQ8B 1FS5A 1E1DA 3M83A 1MD9A 3I2FA 5LWQA 3JQAB 2Y9PB 4QYIA 5AKKA 2I7VA 4HNAA 1M10A 2ZI4A 3I92A 3LVBA 1VJ1A 2NACA 1ORRA 3HUUA 4RJKA 4CLOA 1Z83A 4M0EA 3LDHA 5BMVB 3FOEC 5CEEA 2BMFA 5H1YA 4CTJA 3TZLA 4B3BA 4HMQA 2C4VA 4EQ6B 3DL4A 3NHAA 1YZKA 1PWEA 2JGKA 3EZ9A 3HS3A 3IQXA 4OQPA 3DBLA 3TQCA 1B8NA 4B1FA 1U1IA 4NEQA 1Y33E 1W0CA 1ZEMA 4I50A 4NFHA 1XZMA 1NP6A 1AKUA 4ML3A 5HRCA 3K70B 1M2FA 1U04A 1U9JA 3MZ0A 1Z6PA 1Y7TA 7REQA 1C1DB 1YDWA 3WRYC 2YWXA 4CTNA 5DN6D 3LCMA 2C04A 1UM9B 2AJDA 5ALGA 4MRAA 4GBED 1ZK2A 4HGRA 4B2YA 1NVDA 3CUYA 4EW1A 3WJ1A 4DCTA 1X74A 4MW0A 3WK7A 1Z73A 1PCXA 2F1IA 5EKSA 2J6BA 3GWGA 1ZI6A 4IIJF 3FHCB 1SKYB 3LDAA 4MLZA 4UJ5A 4KPFC 5I7RA 1ZONA 4R1TA 2B5WA 1YRWA 3HJBA 2Y1DA 3BK7A 1YC5A 3WLEA 2AD5A 3HQ4O 3PBKA 4KLZA 4WTOA 2OG2A 1FYDA 3V80A 3GH1A 5I5GA 5FLXA 1MW8X 1NMXA 4LVUA 5DYWA 2NYRA 2C2YA 5E8RA 2PLAA 3U39A 1WW2A 4BTLA 1U2EA 3KOOA 3KZXA 4N9WA 2SKEA 5D8DA 1DC3A 3GZJA 4R8VA 3HVRA 3PUXA 1G5QA 4OQMA 4YONB 3UAZA 1TF2A 3QFCA 4ALLA 4FDLA 4HWRA 2CDRA 5JJIA 4PVDA 3L8ZA 2B2XA 1ZUNA 2R8YA 1W47A 3OD5A 1PVOA 3MBKA 4C0WA 5AVUA 5F7JA 1F0YA 3C87A 3MPUA 1QCZA 4H3HB 5J5CA 3KEQA 3UCFA 1IWOA 2KW5A 3CJTA 4CMAA 1XYYA 1G7SA 5KX5F 1QFZA 4PGGA 3KJEA 3DMRA 3BMOA 1GFZA 3RTEA 4BGDA 5EKXA 1G4HA 4RHXA 1JKJA 2E21A 1KVUA 5K3FA 1LRKA 4I5FA 2VEOA 3CWQA 4G0YA 5J5VA 3UK2A 2I6QA 5KPDA 3F97A 2E4WA 1PR1A 2YQ4A 1TCAA 1GG2A 4LRTB 1U11A 1U65A 3RSSA 5AW1A 1VJTA 1WEKA 5JCOC 4Q4JA 1N25A 1NP3A 1YR7A 1GKKA 3DULA 1BGWA 1U4SA 4WZ6A 2FE1A 4RS3A 2Q7OE 1Z5NA 5BWLA 5JJCA 4NOKA 4DLBA 3R41A 3C98A 1L1EA 4ZCQA 2PEYA 1W34A 3LIPA 3WLJA 3WMWA 1NI4B 1YVRA 1LI7A 1L7OA 4IKOA 4KLNA 3ZXIA 1O9GA 2P2YA 1KA9H 2Q9UA 3KR9A 3R3HA 2FMUA 4I1OA 1X8LA 3MUNA 1H6DA 2QE6A 3EFEA 1VP3A 2ZIUB 3LYHA 4AZ3A 4HQOA 1OAAA 1KOJA 5BVGB 4GLLA 1NBAA 3F5SA 1GTMA 1L5RA 1ISFA 2Q2OA 5FUYA 5KQSA 2WE8A 1NKVA 1Y37A 2ZB4A 1LF5A 3M33A 4PLPA 1KO5A 2EEPA 4Q05A 4RK5A 4BX3A 2C8KA 1U0RA 3NVKI 1QE3A 5KHAA 1T2AA 2A88A 3OEEA 4D5EA 4OHYA 4UHBA 1TM5E 2ECFA 3DZCA 2R5NA 5TMDA 3LBIA 2DERA 1G60A 3U44B 2JGJA 3VV3A 1Q50A 1WKBA 1FQJA 2ZITA 5CHYA 1F2VA 3C45A 4EG8A 3I4CA 5D86A 1SUEA 1TZ2A 1U9IC 1YS2X 4TTTS 3T5TA 3W8FA 2TS1A 2ZI9A 1JBKA 3JD0A 1SQGA 2HK9A 4AJEA 1TJ3A 4QFBA 1N4DA 1JQ3A 1SG9A 2FW1A 2BD0A 3EF3A 4LHXA 4WACA 2WU4A 1X7GA 5DSXA 4BFLA 5GV8A 4DV1B 1QR2A 3M1IA 2OAEA 2WSYB 1J0CA 4N40A 4RELA 5B58T 2CCKA 2O8FB 1OGIA 1G3UA 1XNHA 2QTMA 1H2FA 3W7AA 4O3FA 5GY7A 1SFRA 4N54A 4X5OA 1HGXA 3BWEA 3SX2A 3RYCA 2QE7D 1JQDA 1LZLA 2OCPA 2RBGA 3PJEA 3UG7A 4FOOA 2M2IA 3OD1A 4U8GA 3RE1A 3PNVA 2C97A 3H5TA 5TARA 1KY4A 2FRVA 2G36A 4NJEA 4PPGA 2FSIA 4MKRA 3DEHA 5EIBC 2O4CA 3ER9A 4HO1X 5AVKA 2IZ1A 3WL7A 1KEPA 3N28A 3VR5H 1DCFA 2P68A 1H9CA 1F12A 4US0R 4V1CI 4M0FA 1GT6A 1P29A 1IXRC 5LL6P 2NNLD 2OORC 4K87A 4MAMA 2VT3A 1OLOA 3CSSA 3K30A 4J0QA 5B57C 3IT0A 3J80A 1HNXB 5KTKA 1NDQA 2OD7A 3B5IA 4OBBA 1QR6A 5F9MA 4E03A 3E5NA 3R6GA 1TTTA 2QM3A 3FYHA 3H3FA 4P6VF 4BAGA 2BGJA 3HHEA 3JVUA 2E18A 4EG5A 1GG9A 3OCYA 3VNUA 3P0HA 3N1UA 2H7XA 4DAOA 1ZPDA 1O58A 3HB7A 3IILA 3RBAA 3WIBA 2DBZA 3L0IB 3KLMX 4PLYA 4LY9A 4LHEA 1N0WA 3KJNA 1BVHA 2GPJA 1Q5PA 2I8AA 2CNOA 3EIHA 1OF1A 2ZT5A 5TVKA 3WGIA 2YHIB 2EZTA 1NUUA 3N07A 4R1QA 1VPLA 3FTCA 1N2BA 3SQNA 4BO5A 1N1DA 3V6LA 1NHWA 1Z36A 2Q5OA 3SSMA 3WNQA 4WEOA 4CKEB 3A1VA 4AG5A 4OXXA 3VI3B 1NNSA 4LUCA 3H11B 1ZLYA 4A9AA 1IAVA 1RWNA 3A1NA 5TMEA 1GGJA 1ZIYA 2FPRA 4GD3Q 1T8YA 1WSWA 1NQUA 2WYOA 4G0PA 4KZPA 3FSGA 3O2QB 4OJTA 3SVZA 1EXNA 1YA6A 1L5GB 3RRZA 4BLQA 3LRPA 2HD4A 1K27A 3FFBA 2BJHA 3HLTA 4HKTA 3ADBA 2A1UB 3CNBA 5CJJA 4IFEA 3W6UA 1MABA 2XVXA 3OFSA 3PL1A 2BLNA 4KK4A 5JI2E 1XJ0A 6ABPA 2B7CA 1PNTA 5JG7A 2FZEA 3K9BA 1KZ6A 4CL8A 1I3MA 1XI2A 2FPIB 3LCRA 4HLDA 1TUEA 4A8JC 2VP5A 3G13A 3HFSA 3KPYA 4AIIA 1XZBA 1H6CA 2QTNA 2G6TA 5HFNA 3TLGA 1PJRA 2VZ0A 2ZWOA 1VYTA 4JL8A 4LI3X 4MQEB 1A4RA 3PFCA 4R31A 4OLBA 1Y98A 2H8KA 2BGMA 4G2NA 4PCUA 5HF6A 4BVAA 2E3JA 2FWBA 4O4IF 4Q16A 1FYWA 3L7DA 4XOUA 2A1IA 4FYJA 1AIPA 5H7XA 4YIHA 5C5DA 1Z18A 3H5WA 5JOQA 1Q0TA 2GMWA 2J45A 4UQOA 3QJ5A 1YL6A 3N6RA 4WWHA 3D59A 1RQPA 1FP7A 1X9GA 3D6VA 3DDUA 3LX8A 1DARA 2EGUA 4Q37A 1RVV1 2BGUA 2X13A 3TW4A 3URMA 1JVBA 4H3KB 5KKNB 1KKMA 1XMOB 1A8SA 1C14A 2PNJA 5ALKA 2I2BA 2WMDA 2HHAA 3NEYA 4Z6KA 3L0YA 2VJAA 1XMIA 5JPCA 1EWVA 2BISA 4FJ1A 4CCSA 4JS0A 2R47A 5AI6A 1ZRMA 2H16A 4M6WA 4M1QA 1EB9A 3I76A 1SBCA 2XDYA 1N9KA 1AXRA 4OYLA 1Q7BA 1BNCA 1JIIA 4IMIB 2PS0A 4M9CA 1QFJA 1WB6A 3HP4A 2CL7X 1RQLA 4K28A 2G9RA 5CYPA 4IFBA 4KO2S 4DG5A 2CLMB 3AY3A 1HLFA 1VJCA 1TZKA 4EI2A 1UXJA 4NU0A 5JNTA 3L8GA 2IUYA 5JCJD 5KEIA 3PQ3A 2I6UA 4GOMD 4LX8A 1G63A 2ON6A 3GHYA 4QYTA 3BERA 3V33A 5JZ9A 2EHDA 1U2GA 4O2BF 3NBAA 2PLFA 4KACA 2QTVA 4M8SA 5DU2A 2X3YA 5JD3A 5LXTA 2ISSD 3GWZA 3HL0A 1IRXA 4BLPA 3VVBA 1VG8A 3E5MA 3QFSA 3HFRA 1Y4DE 3TM4A 5CA1F 1P0MA 1P2BA 3JW8A 1M8PA 1UBCA 4FCWA 1VCOA 2ATVA 4ZV4A 1U0GA 1P19A 2X8LA 1ZA1A 3JRXA 4G5GA 3R8XA 4Z0PA 3HR7A 5DWQA 2P9ZA 1ZC4A 1IBSA 2AVNA 2NOAA 1PV1A 1NXTA 1QTNA 1ODIA 1WXHA 1ZNQO 3LF2A 4NZ9A 5CHEA 3VR4D 3LECA 5JTUA 1QHGA 3BA6A 3EZ2A 4UNNA 1BX1A 5EUQB 1NVKA 1Z2EA 3QQ5A 4MA4A 3IIJA 4XA8A 3TKLA 3CE9A 2I4NA 4O2AF 4JXJA 1GPJA 2QGFA 1YCHA 2PRSA 2QPAA 2ZPTX 2RC5A 1GGEA 3HY4A 1MJHA 4QODA 2XQIA 3HMQA 4H1VA 2IK8A 4IL5A 5FUXA 2DFNA 1U8AA 4E4RA 1R2QA 3H2IA 3LSTA 2IXBA 4MHOA 4I5EA 1QMGA 2JA2A 1W4CA 2J3IA 1YQEA 2XMSA 5BN1A 4BNLA 4LHWA 4UUBA 2HGZA 5LB2A 4EBBA 5BSVA 4RQBA 4MS4A 4X7BA 3OIDA 4L76A 1BXRA 2FN3A 4JAVC 3D4NA 5A5EA 1FDOA 3BH6A 2GYYA 2HU8A 3CNLA 3EPJA 1UADA 2FJPA 5EJ2A 5EHQA 3OEYA 2ZU0C 5ULLA 3B1ZA 1PAUA 3JQBC 5BVHB 5KQPA 2JIZD 2QPTA 4JUAA 4KE6A 5JNSA 3U37A 1JS1X 3ABRB 6GPBA 1T3ZA 2BELA 3C6QA 3AUXA 3C3EA 1EP3B 4O2AA 4X1YA 4M9UA 3UUGA 3UUEA 1F8XA 4EG1A 1M6YA 1Y8RB 5E6UB 4F56A 4X6XA 4QBGB 4A26A 1YE5A 3U09A 3DZ8A 3K5WA 5L8VA 5GM2A 2O20A 2QV7A 3G5MA 2HA3A 1FUKA 1E9EA 1E5VA 2YXEA 3RHTA 3OE4A 1C81A 1M7BA 1DX6A 1Z07A 2X2OA 3K0HA 4F96A 2JJ2D 5AKYA 2BDEA 2WQ7A 4IIYA 2B4RO 2JGNA 4F3NA 3B1KA 1E79A 1GAQA 3CONA 2YJ6A 2P5YA 4ZO4A 2H31A 2OAGA 2ODWA 4ZQGA 2CDBA 4AUEA 5BN5B 1DIRA 2H4YA 2VUSA 3IVGA 4N18A 3LVRE 3ZQ6A 4H1UA 5DHQA 5LA6F 2BT4A 4B3DA 4E6PA 4EB6A 4L4XA 3ZHBA 4N5HX 2G77B 2FFBA 5A1JA 1Z63A 4DUYB 1GQRA 3MCZA 4EHNA 2XMGA 4GOJA 1NX9A 2PGJA 3IPYA 4OL0A 4DVJA 1PJQA 2IF0A 4MCIA 4ZOLA 1IOVA 1K2VN 2V65A 1C50A 3DP7A 3MRSA 3QM1A 3ZU6A 4JLBA 3ZWMA 1P6UA 1C5KA 3AERB 3OPYA 3UK1A 1NJ1A 2O57A 3ZXXA 2I03A 1SC6A 4TUYB 5FBLB 3GELA 1KP3A 2KLBA 3R9XA 1RD4A 3E22A 3GJ4A 1FPMA 2C5EA 3BA1A 1KPIA 3B6EA 4CM5A 1RC0A 2Y9MB 4BGUA 4J07A 2NM0A 2AOWA 1I3NA 4J16A 1VRWA 2NSDA 2GHTA 3BWVA 4K88A 3JTEA 4I50B 4XEHA 4Y0NA 3VOBA 1TYCA 4MVCA 3RIXA 1Y81A 5FT9A 3EVFA 5I9LA 1PJ2A 4HHEA 1JB9A 1J56A 1VL1A 4N8SA 3TLCA 3UMBA 1E63A 3OHMA 2PM8A 3DTNA 2BYTA 3GLVA 1Z4OA 3AH8A 4OVKA 1QP4A 4GWLA 4MVJG 3LUJA 1D0SA 2Q41A 5GONF 4KIJA 4DV2B 3FKQA 4DA7A 1Q2XA 1BA2A 1YDHA 2GVZC 1SCUB 1M6EX 5KYTA 1EDEA 3FMGA 4EHIA 1DL5A 4RMNA 1PUJA 4TYQA 1P9WA 4BXOA 5K9ZA 4X92A 4RJTA 4PG5A 2XECA 2EJBA 1GGKA 3H1AA 1NQTA 4XUCA 4CETA 4KW7A 4RZUA 1BVYF 4H35A 3GP8A 2JFGA 1JHQA 4DLUA 4YRMA 2ZDQA 4MTLA 4ZZ2A 3CUVA 3DD5A 2XUPA 1JJFA 1KJ8A 2HBRA 3SK0A 3WBBA 1E7MA 3KZCA 2W58A 4Q1CA 4B3JA 1RYZA 5CM8B 1YE8A 4MINA 2O52A 1XRPA 3I72A 5LXTB 4EDFA 4ND1A 3U17A 3DOUA 3MTAA 1XMPA 5DE3A 3OKAA 3ZJVA 4IHQA 1NURA 3DWFA 3QJYA 3EG9B 3KLPX 1J21A 3IR5A 1HSZA 1PT8A 4LZOA 3IMCA 3CNNA 1PG0A 2ZSKA 2MU1A 3NJ8A 4KR9A 2DHCA 4LQ4A 2IEIA 2HMYB 3HWWA 2UYYA 1NM5A 4FGKA 2Q3EA 4LJ7A 4XPIB 4NOMA 4UCFA 1UKZA 2YWGA 3VO9A 1F06A 1R5JA 2FEOA 2AFHB 4X3OA 4EYOA 5KJFA 2D62A 2OESA 4II3A 3ACCA 1XYGA 4QGFA 4NCKA 5B1DA 1RFLA 3ELWA 3PNYA 2HDHA 1BEUB 1B00A 3FW1A 1GNLA 3CJQA 3LRTA 4YRAA 1ZHFA 1WXXA 3B36A 1DKMA 3FYTA 1RKBA 4N3BA 1UINA 2YW2A 4BLOA 2R8EA 1IY2A 4N03A 3DEFA 3VHLB 3I3OA 2YJZA 5KAPA 5IYZB 4M1MA 1R0SA 1S7CA 4CLEA 2JZOA 3OY7A 1MC1A 2WUWE 4F92B 3OOYA 4KODA 3H2YA 2Q2VA 4ZO8A 3L9XA 2IQ5A 1ZRNA 3W34A 3NKVA 1YR9A 2ZREA 5B4UA 4CF7A 1LW6E 2OMEA 3DBRB 3R3WA 3EZYA 4JVMA 4XWGA 4YCNA 4AN1A 1RPNA 4NESA 3JY6A 2GGSA 4QFMA 2GVNA 3GJQA 1JMKC 3RIYA 5DGIA 3JPWA 1JR3E 4EUNA 1G3IA 1VI6A 3MOSA 2QYTA 4QUAA 4BC0A 3A2LA 1NKTA 1DSSG 5EMMA 3GPLA 4HPWA 4DSAA 2KQUA 4PYMA 4NKRA 4BNDB 1X8KA 1PQPA 4GXTA 4XWWA 4PQYA 1J0DA 1YVDA 2AMFA 1TMKA 3H9UA 4MKZA 4UEOA 3EY9A 2BKAA 4XX0B 2JIRA 3UJBA 5F4BA 4FYYA 2QZ4A 3NYRA 3E2IA 1Y3AA 1VPTA 1YRQA 2I80A 3OJFA 4OP2A 5ESDA 1CP2A 4LMAA 1H1LA 1P74A 1E2PA 1JDPA 1JQEA 2DPMA 2H5IA 2C3OA 1ZRSA 2R00C 3G6WA 3NFYA 4IS3A 4KO3S 3TIXB 4WADA 3I9KA 2ZAIA 4NVRA 3SBXA 1E4EA 1YDEA 4QVIA 2HUPA 3D3EA 4CM4B 1CZOA 5EOVA 3K1JA 3N6XA 1GCIA 2O8BA 1OI7A 3LBNA 4X24A 5HJEA 1CUVA 2QJFA 4GPD1 3FBGA 1G8SA 4IGIA 4R8KA 3R7WA 3TLKA 5AVWA 4RTMA 4FQ7A 3VXKA 1A7UA 1YVUA 3I1IA 2MJLA 1QYIA 3RW9A 2JLWA 3CRQA 3TUJC 4BC1A 1ZSNA 3RIHA 3RJ9A 2NMVA 1ZS9A 4CKZA 1Z34A 1A9YA 3I1FA 3LHIA 2A5LA 2HBZA 3NIWA 4ZCTA 2RE8A 1PK7A 2HWUA 2BCJQ 4E7OA 1YQUA 1Q0LA 1YACA 2C54A 3KAPA 3SS8A 5AQ1A 5HKOA 3MJEA 2IHZA 5DTRA 5ITWA 2R6CA 2W8BA 4DQXA 1IOZA 4JJZA 4A4DA 3AVPA 1E3JA 2FQWA 2XYVA 4AYTA 3MNFA 1FFDA 4DBVO 1MQAA 3WKAA 2GNOA 3IHKA 3V4SA 4Z1MD 5B2EA 1F8YA 2NUTB 5HQ3A 5LR6A 1H05A 5LUAA 1TYDE 2FX5A 4DSZA 3RKSA 2GXSA 1H9AA 1SXJE 3GNQA 2B37A 3OPYI 4TWIA 5DEIA 3FGZA 2B4QA 1UDAA 2ATIA 4OIMA 2JAOA 2GEJA 1KTIA 2BWJA 4DUGD 4QATA 3M6IA 1F4VA 3DHVA 2BFCA 2ZE7A 2W6JD 3CZCA 4JC4A 4M9SA 4EKYA 5C18A 1EP2B 3HJUA 4YFVA 4ALJA 4DLSA 1CLUA 4MH0R 5L7WA 2PUBA 5FA6A 1Z3CA 3C97A 2CNWD 4C2AA 1QIEA 5KJ1A 4MQFB 1T24A 1PK8A 1Z7GA 2H5LA 4KXVA 3GCZA 1UWVA 4K1LA 3U7QB 1JHAA 3WAKA 1XROA 1U6KA 2YS7A 4JJKA 4MGIR 4EP1A 4BVHA 2JLQA 3L1HA 4JLUA 1AXEA 3AM4A 3JQFA 2G76A 1JU3A 1XQYA 5IHPA 3I61A 5AXBA 2FU5C 3OE7A 3IS3A 1AUXA 1O97D 2GTIA 3E03A 3TD6A 5I7OA 2BE7A 4H6WA 1GPMA 4C4PA 3PC2A 2VYND 2PZKA 3FMPB 5L7YA 2G63A 1M2WA 1DOZA 1FNNA 1JSCA 1PHPA 3L8DA 1SELA 2Z1DA 3QVTA 3LQRA 3EB9A 1I4EB 1W5BA 4ZVSA 3JCZA 3NOXA 2AOUA 4LQDA 3RS8A 3UQYS 4AM8A 4CE6A 2GJSA 4Q4HA 2PUTA 2YDXA 3NHSA 5EAIA 4EOGA 3Q3IA 5EP3A 1PW5A 1NYQA 4M1WA 4YRPA 3UTCA 3B6ZA 5JBIA 4CNQA 1X1SA 3IV9A 3WIEA 1GG5A 2AZDA 1T5DX 3IB3A 3VFDA 1UJCA 2P9YA 1I01A 2W2LD 2PSJA 3U48A 1OTXA 2OLJA 1PZXA 1QG2A 1U2TA 4GXRA 1VG0B 4KRYA 3W5AA 3UXYA 5IBRA 2E89A 5BPHA 4KHPB 3NBUA 5SZJA 4B48A 1CRWG 4B4VA 5JAPA 1QAMA 4OJQA 1ZFNA 2VHEA 4Q3KA 5DF1A 5IVIA 3FOFC 3LRXA 2DXIA 2O0HA 4LTNA 1EA5A 1RSZA 4FILA 1C4WA 4NJMA 4B7CA 2Z2XA 5FTMA 2VRCD 5BWMA 7AT1A 5I6DA 3K0KA 3U81A 1CVIA 4MUKA 1SPXA 2VF4X 1P9RA 4HX2A 3IAHA 1EU1A 4CCWA 1UKCA 3K0EA 1L7NA 4GOLD 1Z13A 1KVRA 1LDMA 1Z74A 2I67A 4RJJA 3KJGA 4YASA 1QAOA 1C41A 3DE3X 1NJ6A 3DM9B 4MUBA 3EARA 1LLQA 2D74A 4N7BA 1DINA 1Q3HA 4RA9B 4NYMQ 5GOTA 1PSWA 4ZYWA 5ITSA 4MS1A 3RG8A 4ZYYA 5BXYA 3RVOA 3PCRB 3VA7A 4EI9A 3H8WA 3VR4A 3WK4A 2XUQA 4KMRA 4BLRA 4QQRA 4MUGA 3P2MA 3TIIA 2JGEA 2C2OA 3Q1KA 1HT0A 1HDRA 4YDRA 1ZCFA 4G1EB 2GLXA 1XZDA 2C03A 4HJXA 4Z1MA 5AVJA 1FUEA 1AMNA 1N7HA 3PC4A 2BFEB 2I6SA 3WP1B 3RYHB 8ATCA 4FCTA 2J0SA 1NYTA 2WP8J 4XUGB 4BEWA 3MJ4A 1PDOA 4LWQA 4NARA 4RHCA 3WGLA 1M2OA 4DR5B 3K16A 1DWPA 4TTQA 1J90A 1JLHA 1Z5PA 4ZA2A 2A84A 2RG1A 3GJYA 5FBKA 4BQIA 1M1YE 1APBA 3EN0A 4PINA 1RADA 1GKLA 2R6ZA 4D81A 5BV2P 1RAAA 4YNBA 2CHUA 5E6SA 4M7PA 4NE7A 3LAWA 1E5XA 3DBHB 5ALFA 4B75A 1QIKA 1U9IA 3QVWA 1YQWA 2O8BB 4J6EA 3UC5A 4YX9A 2C5FA 3OHSX 1R0YA 3DMTA 1I2ZA 4OQXA 1M1ZA 4RKFA 4DS3A 1E6KA 1TL7C 4DQDA 4ZI7F 5IC4A 4ZHQB 1PJSA 1GDTA 4ND4A 4NLLA 4PX2A 4OB7A 4D25A 2PSHA 1G5RA 2G1AA 3SNHA 5B7NA 2PAAA 1CDOA 1SIWA 4N6NA 5EC8A 5JPDA 5KSZA 4EARA 4ER5A 3TTYA 1Q0RA 5EUMA 1KO4A 3MB8A 3PJFA 5FWXA 4YR7A 1UH5A 1XCBA 4N01A 2EATA 4WFQA 3CB4A 2W8ZA 3P2YA 4IICA 4DZRA 3HN7A 3K20A 3FBWA 4IJMA 4A8HA 2UYOA 4HGZA 3GCXA 1GN8A 1QHYA 2OYSA 4RHYA 2ZUUA 1D5CA 2G1JA 2WNHA 2IGBA 3KZKA 1GIAA 1QOQB 1WU7A 2TMKA 1ZW6A 2IHTA 5HF9A 5JHHB 1GZ3A 4XLLA 1P60A 2VWQA 2YUTA 1Q0UA 4CRWB 3LGAA 4NCIA 2WAAA 3W2TA 1FB5A 1L7MA 2YFKA 3W78A 1QQBA 3MHTA 1GYQA 1YL7A 5FB3A 4YLGA 3RRYA 3COJA 2FK8A 5HFJA 4FGSA 3EQ9A 1I6MA 1IMJA 2QN3A 3T7EA 4ZYVA 2BTEA 1PX0A 1ZUWA 2X5JO 2WT9A 1T0IA 4HC4A 1KEVA 2OFOA 3DTVD 3ECAA 4LEIA 2MIIA 5EJ7A 4PAOA 4IVPA 3PTZA 1QMPA 1YR6A 2H48A 3HR4A 4JR1A 2UYCA 2JIPA 2YQZA 4KUHA 2IU3A 3QKRA 2X8BA 3ET5A 1NQAO 2A9FA 3K05A 4YWHA 1QE0A 1QO0D 5IARA 4CT4B 2UZ1B 2XGSA 3DLCA 3KFXA 4CNBA 1NNUA 2Q3CA 1VZ2A 5I8PA 4D0RA 2JZCA 3B52X 3FDIA 2ZW9A 4WI1A 3IL2A 1Y7IA 2VVTA 5CXUA 1LI4A 5FWDA 4BECA 2FDCA 3MS2A 3V9AA 4FMDF 1OBHA 2BZ1A 2FI1A 4TUYF 4XYEA 3DYVA 4WL0A 3VJLA 3I8SA 3D5TA 1HE4A 1QIJA 3O8BA 1IONA 1H23A 5BQXA 2RHJA 4URFA 4C5AA 3TDKA 2AMLA 4AF7A 1XZAA 3BIWA 4K6HA 1GAXA 3ET4A 1VPDA 2CMHA 4INZA 4W82A 421PA 1XPOA 3ZJYA 1GUAA 1EH5A 4YN3A 1QHSA 3NH9A 4RL4A 3PDHA 1UKAA 3LHSA 2FN9A 3I9NA 2A9PA 2VDRB 3H86A 3H6KA 4HFJA 5U1PA 3ZVRA 4BO6A 3LXMA 4LDZA 3DMPA 4PSAA 4WKOA 4TV9F 5B1HA 4UASA 3H13A 1AQYA 4LYHA 4NAVA 4J1TA 1LTKA 4DDVA 2O1XA 1PW7A 1C7RA 1RJDA 1EUDB 2REXB 2Y1LA 2FHSA 2JIDA 3FE2A 5JIBA 3JATB 1GPNA 2YHUA 2IL1A 1JEDA 1V39A 3C7KA 2GXQA 3CA8A 1JFVA 3D4LA 2QUZA 1RWKA 1LI5A 2EP5A