5AUQA

Crystal structure of atpase-type hypb in the nucleotide free state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
245
structure length
232
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLRKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb
source organism Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Hydrolase
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
total genus 71
structure length 232
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5auqA01
2ZETA 1GKYA 4A2QA 4YQFA 2JDID 4DEYA 1WE2A 2OCBA 3H1TA 4R71A 3O8CA 5BYKA 4B3BA 1NN1A 1XMSA 3OZXA 3H4MA 4PC2A 3VX3A 5AUOB 2W6ID 1G5RA 4NONA 2V1UA 2C2HA 2BOVA 4DLTA 4BWYA 2W2VA 3TH5A 3LH5A 4DVGA 1E2JA 1YZQA 3R9XA 5FOWA 1P6XA 4Q9KA 2BBWA 1G16A 5SZIA 2ZRGA 5H1YA 4WVFA 3X1ZA 2W83A 5FOTA 2OESA 3PUWA 1B23P 2YJTD 2NG1A 3LFUA 1FP7A 1LFDB 1OFTA 1XNJA 1KHTA 1CKEA 1KI6B 2IUTA 1J8YF 3GMTA 4Q4AB 1K5GA 1E9AA 1ZBDA 4Q4HA 5JSZA 4RZ2A 3GLHB 3F5FA 2PMDA 4KLNA 1E79D 1JXMA 4S2EA 1XCMA 4OI2A 1RRCA 2ZRNA 2FFAA 2ZI7A 2ZJAA 4HAYA 5K8IA 1KK0A 1W46A 1N0UA 1AQYA 5IDVA 2DWQA 1AS2A 3R20A 4Q5IA 5JWRA 1VG8A 2GJSA 3TIFA 4NL4H 4H1UA 2O0KA 3U60B 1SVIA 3CWZA 3DM9B 3FKQA 2CE7A 1E0AA 5SZJA 2F1RA 2PT7A 3TVDA 4A0HA 4B33A 4UNRA 4A1FA 1OXUA 4OK5A 2G83A 2HF9A 3K0FA 1Q3TA 5TARA 1FUKA 2IYTA 3QUSA 5HKKA 3L82B 4MKIA 2CLSA 5TV2A 1G1MA 1HYQA 3L0SA 2G1JA 5JS8A 1BS1A 3CPHA 2WM9B 5M04A 1P4SA 5B58C 3OAAA 4PQFA 1YZKA 3VAAA 2RGBA 3AVYA 3ASZA 1TF7A 4TL8A 2BVNA 2QENA 4NYIQ 3HYRA 4KVAA 1W4AA 2IYRA 1DADA 3W6OA 4C7OA 2ZSAA 1EG7A 1U94A 1E2LA 2ANCA 3BB4A 2QPOA 3WMEA 2YC2C 3CRVA 1X3SA 1KK1A 2ERYA 2J46A 2C9YA 2WMNB 3A37A 1OXTA 1XB2A 3OE7A 1TNDA 1X8LA 1DEKA 1IN8A 2QNRA 3KFVA 4WXRA 4WXPA 5KU1A 4JLJA 2QU8A 1BIFA 1GKIA 3QXXA 3QEJA 4X8LA 1P61B 4UXIA 3TMKA 2IYXA 1G3RA 1ZNYA 1I2MA 2QM8A 1AN0A 1GRQA 1ZD9A 4JS0A 2IXEA 4EJSA 1P2UA 4NCIA 1XJ0A 1KI4A 4YMSA 2P65A 3I3SR 3HU1A 3BRWD 1W36C 1M8PA 3CRMA 2CVHA 5TY0A 4LSGA 1GG2A 1O87A 1E9RA 1NBMD 1FX0B 3I61A 1W36B 2ECKA 3QBVA 2Q3HA 3ZZ0A 3ONWA 3RDPA 2XGJA 4HDQB 1YHNA 4PFSA 3GQBA 4DB2A 4Q18A 3CIOA 5D3QA 2G0TA 2OAP1 4RZ3A 1MOZA 3SDZA 2BKUA 2W2XA 3B9PA 1KDTA 4LHVA 1UKYA 1A5TA 2PCLA 3E5HA 3L8ZA 1GUAA 3CR8A 1FNNA 4Q9IA 2XZLA 2QMEA 2H1LA 5FI1B 1S96A 2QP4A 2ZAOA 4RSGA 2EFGA 2N42A 1IXRC 3BGWA 1T4GA 3TK1A 2CHVA 3KZ1E 1CEEA 3KJGA 3TBKA 4W9MC 4LX0A 3BB1A 2Q21A 3RS4A 5DSZA 4CRWB 1Q12A 2ZRDA 4EUNA 3K70C 4TMTA 3WMFA 3ZIAD 4QFMA 4MGYR 1T8TA 1YRAA 3X1XA 4DIEA 4LI0A 3LQRA 3EPHA 5BXQC 2I4IA 3AF1A 1T3LA 4QNMA 1MRNA 3DMNA 3UANA 3AVPA 1E2KA 2Z0MA 3EZ9A 3N5CA 4EPVA 1U8YA 2Q6TA 2DFLA 5HR5A 2F3RA 2OE2A 2GEUA 2OCYC 1PLKA 2IS2A 5C1BA 1II8B 5DI3B 3AP2A 4JL5A 2NO1A 2BKEA 1M2OB 3AGQA 1IHUA 4E03A 5JEDA 1UBEA 4EJSB 1IAQA 3GEEA 3FVQA 3RS5A 3W8RA 1VG1A 1WDTA 1KI1A 3G0HA 1YR7A 2R44A 1G8FA 2A5YB 3QY0A 1NLZA 3MWKA 4TL6A 3VHLB 5EE0A 3M1IA 4I4LA 1X1SA 3GJ0A 1E2DA 4ITRC 3MWLA 2CCGA 1W4CA 1P9RA 5AJXA 3O8RA 2HUPA 1WBBA 4DLXA 3HDTA 2BBSA 1VTKA 1KDRA 1HT1E 2FJUA 4US2R 4DUGA 5HZKA 2Q3FA 2N1BA 3NBYC 4NYJR 4V0NA 1E2QA 1ZIOA 5K8UA 3VNVA 3PEWA 2J0UB 4HZUB 1SXJD 3MRSA 2EFDB 5DH9A 4V0LA 4TL9A 4W5WA 1II9A 4LHZA 2OLKA 4O0MA 2C9CA 3T61A 5K8LA 1YZGA 3I92A 2CEAA 4RY2A 1RW4A 3MLEA 2IBMA 4XJXA 5L3SA 5KO2A 4B2PA 5H70A 221PA 1BO6A 3NVAA 3Q9LA 3SE0A 4D80A 1TX4B 2ZRPA 2CNWD 3AV0B 1TUEA 4HATA 3VQTA 3RRNA 3I1FA 1QVAA 1Z6YA 4W5JA 4B44A 2PJRA 4IDHA 5DI9A 1U99A 2BM1A 1Z0FA 3B6EA 1XDBA 1LTQA 1JAHA 2CMKA 3P26A 3F8TA 5GJWC 5HPYB 1XTKA 4NZYA 4PAQA 4V03A 1EX7A 1M7BA 1OPXA 3LA6A 4PANA 2IS6A 4DC9A 3OFNA 1NBMA 4B43A 1A2KC 4JZKA 4Y0VA 2ZRMA 4TL7A 2OUKA 2QL6A 2QTFA 3NBFA 1OXVA 2BEJA 4FINA 4Q4HB 5EE9A 1S2MA 1KSJA 5AK0A 2HT6A 3I5YA 1OSNA 3HU3A 1M74A 3QENA 3QIAA 1G8GA 2PL3A 2AL7A 2OEPA 4HB4A 4II7A 4MH0R 4OQNA 5JJLA 3BE4A 1NVXQ 3THYA 1E1QA 5FFMA 1PV4A 4ESHA 1SKYB 1Q1QA 3IUYA 5JHHB 3B8HA 3KUDA 2FFBA 1VCMA 3GFTA 3VKWA 4XWKA 1WXQA 3REGA 3BXZA 3K9LA 1NNEA 4P4SB 2GEDA 1IBRA 4PSKA 2JLYA 3JVUA 1E2FA 2AX4A 2CCJA 3EW9A 2V55B 3X1DA 4AY2A 1JPJA 4AD8A 1CTQA 2ODWA 2REOA 4R9UC 2OHFA 1U2RA 3QPVA 1CR0A 1JJ7A 4KLZA 5FUYA 4B2IA 2ORIA 1SZPA 2V7QA 4N0EA 1WQ1R 1W0JD 3GLHA 3BOSA 2YWHA 4AK9A 3GCGA 5JZVA 2IF0A 2JGNA 2OFOA 1KKLA 3F0TA 2X2EA 3KXLA 4L8GA 1XMVA 1TF2A 1CJKC 2QROA 3DMDA 4ZKEA 3ZZTA 2GWHA 1FQJA 1AQUA 4QOSA 2VA8A 4DIDA 4LYJA 5J4KA 1QBKC 3ZZUA 3HJNA 4D82A 3BD9A 3DZDA 4M1OA 1X1RA 4MITA 1IN7A 1OH6A 4LC1A 2W6IA 5AJZA 2C78A 1JEEA 5DO9A 2ATVA 2WTUA 1ZRHA 5AUNB 5FI0B 2ZI5A 1MO6A 2IYQA 4IXMA 3QJYA 4XVRA 1Z0DA 2O8DA 3H2YA 5J47A 4C0KA 5HCIA 4RZUA 2GXSA 2QMUA 3QE0A 3DOFA 4MGZR 1ZM4A 1MABA 3AP1A 5EE5B 5L8VA 1K5DA 4KJZA 5C4GB 1R5NA 4MGIR 1OF1A 1R0YA 5IRCD 1PUJA 4B2LA 2W0SA 3NTUA 4QXAA 4OK3A 1V5WA 1T8UA 3VMFA 3G82C 3ZVRA 3U2QA 3LY5A 4TZ6A 4A0FA 4PSAA 4FXPA 1GILA 2PLFA 1IQPA 1E2HA 1CF4A 3IHLA 4F4JA 1LY1A 2W6JA 3ADDA 3CONA 2IXGA 5JJKA 2LWIA 3CH4B 1WB9A 1ZU4A 3GP8A 3UATA 1E9EA 3KDSE 4JJKA 2AK2A 1A1VA 3QG1A 2WWIA 1XJQA 2V1XA 5EZ5A 5FR1A 1GFIA 4IRUB 4EPTA 1P3JA 1J99A 2CK3A 1OHHA 2D7CA 2GXAA 2FMXA 2IWRA 3PR1A 3ZVMA 1E2MA 4GNKA 2VP6A 4DUGD 5LB4A 3DOEA 1WA5A 2YV5A 3L0OA 4DXAA 5EXPA 3GLIB 2QQEA 4M1MA 4KFRA 3PITA 2HDNB 2GK6A 4IVPA 4RKFA 3TGPA 4BEBA 4LJ5A 3LVRE 4MDEA 3DDCA 4RCYA 2WWYA 3KB1A 4ILEA 1G7CA 1G3MA 1S3SA 4GOJA 4KI0A 2VP2A 1RRPA 4D26A 1Z29A 2P6NA 1XPRA 2BMFA 2VP0A 1Q1BA 3K0CC 3KTAB 1W2HA 4B34A 1GM5A 1FZQA 2B7CA 4JJZA 3CO5A 3V4RA 1Z28A 2RHDA 4JBWA 4Z51A 5AJVB 2RGGA 2WIAA 4BZPA 4KBGA 4CEIB 2XNSA 1GDDA 3SJZA 1SXJE 4A8JB 3U3OA 2QY9A 2A30A 3AP3A 3H86A 2ZPTX 5JFGA 5F2EA 4NMMA 4AYTA 4WZ6A 1TPZA 4FCTA 3PQCA 3EXAA 1CR2A 2G3YA 4FN5A 4GP7A 4OBEA 4CT4B 2I1VB 2MSDB 3BH6A 3DKVA 1GRNA 5KSOA 5DISB 2HLDA 3K8YA 1CJTC 4D4MA 3CUEF 3SU8A 3CH5A 5KDLA 3B82A 3NC1C 1UDXA 4GL2A 5F9FA 2DHRA 1Q1EA 3PEYA 3EX7C 1A4RA 4FW9A 2WMOB 2R6GA 4G5GA 4JSYA 2VHTA 4A0RA 4PPGA 4KFUA 2QPTA 4HAZA 1KOFA 1W47A 2A9KA 2WAYA 2OFWA 2FNAA 1SXJA 2DWOA 3GJ4A 1EFRD 1HQCA 2NO0A 3A1SA 3L8YA 1NI3A 5JECA 3SHWA 1XJCA 5JCZA 5LPNA 3GLGB 1NMXA 4KO8A 3RRMA 1R5OA 4L4UA 1UFQA 3U3JA 1OB5A 4M1TA 4YLGA 3QXSA 4W7SA 1RRFA 1TMKA 3LV8A 4JLNA 2R9VA 5E3HA 2PZFA 1K8RA 3A4MA 2GRJA 4PO1A 2XSZD 1QHHB 3IPYA 1W7AA 2CNWA 3LBNA 3K09C 3D7MA 1YZNA 3K0CA 1D8TA 2OZEA 4M1YA 2K5UA 2VHUA 5SZHB 2NMVA 2JLSA 2XXAB 3ICEA 2OLJA 2J1LA 1R8QA 4Q19A 3MUFA 4URZR 1GRRA 4IVRA 3UMSA 4PQYA 3VKHA 3A36A 1VIAA 2AD1A 1BYUA 3I73A 4PAMA 1XMJA 4V0KA 3T35A 3U7FB 4B3CA 1XF9A 4URVR 4MYHA 1Z2CA 2J7PA 3QPWA 4V0ME 2ONKA 4LV8B 4AYWA 3PCRB 5J4LA 3KL4A 3QVUA 5E7IA 1KI9A 2ZE8A 4JVSB 1KDOA 2O8EB 3RNLA 1R6BX 1FX0A 1IN6A 1AS0A 2X1VA 5FOUA 5CITA 2YOHA 3K9HA 4AI6A 1X86B 2NPFA 1YE8A 1E9BA 4BFUA 4DSOA 2RGNC 1W5TA 2F7SA 2BMDA 2DPXA 4P4UA 2XJ4A 4Q4JA 5L3QB 2WPDA 5DGXA 5FBWB 3K9NA 3L2OB 2GCOA 4HAVA 3C41J 2QAGA 4L5BA 4BFYA 4PPNA 3ZS9A 4B32A 4L9WA 1C1YA 4OK6A 4JMPA 2CL7X 2CLCX 1C9KA 4BFSA 2ZRAA 3AVTA 2O8BB 1T3SA 4IW3B 4MA4A 4NPHA 1YR9A 3ZVLA 5JRZA 3THYB 1GWNA 2C99A 2QT1A 2GBLC 1DOAA 1XD8A 2X19A 4AYXA 2BCJQ 1JPNA 3K53A 1NN5A 4RZXA 3ZGXA 1SXJC 4QGHA 5LB2A 2GDJA 5C2JB 3GLHE 1RKBA 4MRSA 1E9SA 1OT3A 2GF0A 4BRUA 1P2SA 1G291 5GJVC 1TQDA 1DE0A 4MYCA 3MSXA 4CYMA 4B6FA 2FGKA 3SS8A 3SFZA 2NO7A 5KNDA 2KBEA 1UJ2A 3HP1A 3ND9A 3W6PA 2ZJ5A 3K0FB 1OXXK 4FWIB 1FNMA 1G18A 4YC7A 3U3MA 2IYSA 1E2PA 3N70A 2OM2A 2WJVA 1F2TB 1Z0JA 3OAAD 2ZUCA 4K8OA 5EP1A 3W8NA 2E1RA 2NZ8A 2YOGA 5DYGA 5BN3A 1ESMA 1ZNWA 2XNDA 2KJQA 4LJYA 1JXOA 1M7HA 4KODA 2UKDA 3KUCA 4OQMA 3BH7A 3JVVA 4IOMA 3S1AA 4IJMA 4ZPXA 1Y3AA 4DCSA 4XWOA 4DLUA 1US8A 5HCNA 2IA5A 1YKSA 3PUZA 2ZROA 1LW7A 1J7KA 4D4LA 5JS7A 2FPLA 1UDWA 2OBLA 2NZJA 1DVRA 1KI8A 2P6UA 2ZIAA 3RWMB 2J45A 4HZUA 2O8EA 4OHVA 3SYNA 1VHLA 4B47A 3SJBA 1Z07A 4IDPA 4UQOA 1SVMA 4P4TA 4ZV4A 1T9HA 3PUVA 4NYJQ 4IOJA 1E79A 2ZEJA 2QAGC 3MWYW 3RC3A 1EWRA 3UWKA 5IF9A 1IY0A 3OF5A 4XWAA 1Q57A 1G7RA 1JI0A 1ZM3A 4TQ9A 4DHEA 1G8YA 1KAGA 3FDIA 2OO7A 3TQCA 3B13B 5AUQA 3FHTA 2HF8A 3U7EB 1CU1A 1N5LA 4TTPA 1ZCAA 5DE3A 3SI7A 3KXIA 1CR4A 2VQSA 4DSTA 3LO5A 2FWRA 1HV8A 1G7SA 2X77A 1GOTA 3EA5A 1AA9A 4NP6A 4GMDA 3CNOA 4IEEA 2FFHA 2XSZA 4HLUA 2ZVPX 1TEVA 1I4TD 4URWR 1FPMA 4DLVA 2QM7A 1F2UA 3MJRA 1XEFA 1SXJB 2WWHA 4CDGA 1Z6TA 2OCAA 2XOKA 4B35A 2FSFA 2JJ2A 2ZUBA 1KSFX 3GPLA 4E5UA 3TVTA 2A5FA 1E9FA 3ZIAA 5DN6D 4ZI3A 2Q9AA 3CX7A 2WKRA 2CLDX 1UKZA 2IF2A 5DYIA 1CR1A 1OIWA 3CPEA 4O2LA 2XTMA 4Q7JB 2DR3A 4D0GA 1TQ2A 1NLFA 3BB3A 4DSUA 2O5VA 4KITB 4PPFA 1R10A 4V0MA 3SQXA 3U3KA 1G6HA 4NYMQ 1Q1ZA 4HYYA 5G3YA 2QUZA 1DPFA 3ZH9B 4BLRA 3EC1A 5FUWA 2ZYTX 4WZBE 1P60A 1LS1A 3W5JA 4D4KA 4X8OA 2ZXUA 2P2LA 1XD9A 4NE2A 1X8KA 3CZPA 2PEZA 4YDSA 1ZIPA 5FBLB 4LJ6A 3P4XA 3OIWA 1ODFA 3KQLA 4CEIA 4QG7A 4C0AC 1QG4A 1E4VA 4KU4A 3RSLA 2XJ9A 2WJYA 5FBQB 1E96A 1H8HA 4M9XA 4LY6A 4EFMA 1OH7A 2ANBA 2QMHA 3GJ8A 3K9GA 2QP3A 1RVDA 2SHKA 3EG5A 4TMXA 4ZDWA 3TRFA 3LBHA 5GVRA 4EPRA 3FHOA 3R8FA 2EVWX 4US0R 2F1HA 5EP2A 4Q1DA 3TAHA 2Z4SA 3FKSA 5KOYA 1LF5A 2ZJZA 5LBIA 2V4ZA 2WJJA 2P5SA 2B21A 2B92A 2GAAA 1DTSA 4G5QA 4MGKR 1IONA 1E1RD 3TQFA 1R0WA 4Y0AA 2B6HA 1ELOA 2D06A 1SKYE 2FZLA 2HCJB 3AVWA 1FTSA 3WP0A 4C7OB 3FWYA 3UK6A 2QN6A 3RWOA 1RIFA 2NO9A 4FD2A 1KO5A 1AKYA 4JYBA 1VECA 1EFUA 4Q7KA 4WIAA 5EP3A 4MDFA 1KO8A 2GJAA 1E6CA 3A1UA 1Z6AA 4G5SA 2WKQA 3K0AA 5TB5A 3NDBB 1XXHE 2J0QA 1SULA 1U8ZA 2IYZA 2VIIA 1ZVQA 4WOPA 4RFSA 1FMJA 2REXB 1W0KD 4C0HA 4NCHA 2RKOA 3IEUA 3PXGA 3DPUA 3RS0A 4TYWA 3THXA 1NVVQ 2ZQ5A 3B85A 4Q1EA 3HPRA 4Q7LA 1T0HB 4IDNA 5HE8A 2TMKA 4KYUA 5LD2B 2WWWA 2FX3A 4QM6A 4DSNA 1AKEA 5B57C 3SYLA 2WPDD 2XITA 4LK2A 4LJAA 1WCV1 3EARA 4M53A 3GJ3A 2IYLD 3AEZA 4MUAA 1KNQA 1EFTA 1XRJA 3BAFA 2ZAMA 3KKQA 4CVNA 4W5HA 1KZGB 1EFCA 1G4UR 3U4QB 4QHYA 3NG1A 4MRRA 3FMFA 4XTCS 4PXAA 2HXYA 3WHKA 2VP9A 3ZVNA 3M4YA 5FBVB 1TF5A 3PVSA 5G3ZA 4DCTA 4ZCLA 3ZDQA 3P20A 1DG3A 2ZR7A 4QGGA 5DLQC 1XTSA 4FCVA 3FE2A 1NSFA 1H65A 1NY5A 2IUSA 4OYHA 1ZM9A 3EAQA 4QJ5A 2VL7A 4B3FX 3TE6A 2YYZA 3IGFA 2E9SA 4FIDA 3AM1A 2JAQA 3I5XA 3GLGE 1QHSA 2OBNA 4GMXA 2F1IA 2NIPA 1JALA 2D4HA 2HV8A 2YC4C 4M1SA 1D9XA 4BFXA 1OYWA 3W3AA 4PZYA 1UF9A 3BC1A 3UKDA 2QG6A 5KSZA 4M1KA 1LB1B 3PENA 1KSGA 1U98A 1SGWA 4LYHA 3WYGA 1XWIA 3KX2A 4LZZA 3WNCA 1XEWX 2GEVA 4DLYA 1ZW6A 3FTQA 1IY1A 2ZRKA 4BPBA 4P4SA 4JT2A 1XTJA 1A2BA 2J87A 2BC9A 5KHOC 3U5ZB 1S1CA 3SZRA 3QF4A 3SC3A 3OFND 4PAOA 1RZ3A 3PG5A 3U7GA 1Z0AA 1D9ZA 2RCNA 1J70A 3BFVA 3AVUA 1OFUX 1Q20A 1XEWY 3A58B 3AF4A 3AUYA 4G1UC 4KCGA 4LCBA 4M9QA 4DJTA 1Q0UA 1YU9A 2QZ4A 1T5IA 2P0EA 5HTKA 4CGZA 1EFHA 2F6RA 1W4RA 2OXRA 3BFXA 1SHKA 2F43B 3TR5A 2ZRBA 4KVGA 4M21A 1KI2A 1F60A 3TLXA 3TSZA 5DNYB 1OYYA 5GJCA 2GILA 3EPLA 2EWWA 4XTRA 1MR3F 2MMGA 4Z8YA 2ZE7A 2QBYB 2BMJA 1L2TA 4K46A 4NHOA 5IK2A 4GZLA 2FSIA 1CRQA 5FUXA 4QRHA 4PHHA 2KE5A 1CLUA 1W49A 1W5SA 4TLBA 1Q3HA 2CXXA 1OLOA 3PIRA 1EESA 1COWA 3L43A 1L7VC 1Y63A 2BM0A 1KI3A 2VHJA 3IILA 4HDOB 4Z54A 2PMKA 4US1R 3QOFA 1NG1A 4XD7A 1ZMXA 1MRSA 1NVVR 2YVUA 4PC7A 3SBEA 2ZE6A 3WYAA 4LJ8A 4LBYA 2VF7A 2P67A 1NJFA 2PEYA 4WA7A 4PTLA 1RE0A 3JZMA 3O8DA 3LX8A 2R6DA 1E1QD 3NDPA 2J0UA 1P9WA 1HH4A 1GL7A 4LPSA 3RS7A 2OSBA 2C03A 3T1TA 1UKEA 2VPPA 3C15C 421PA 4XOIA 4KFTA 4PO9A 1G8PA 2WKPA 2ODBA 3M0EA 4TYPA 1PZNA 2C9OA 4C2UA 2ZI4A 4IOKA 2CBZA 2ZJOA 1T6NA 1UBGA 4GZMA 2WSSD 1P62B 1TAGA 4GFDA 1NKSA 4QKQA 2F55A 1KKMA 5A4JA 1XXHA 2DFNA 3T5DA 2ODEA 2WOOA 4JBYA 4NYIR 2AK3A 3SJAA 2D2EA 2FDCA 3T12A 5CYOA 2V9PA 4IXNA 1F5NA 1KO7A 2ZITA 1ZAKA 3TUZC 3UPUA 2FZ4A 4QGFA 4CEHA 2JDIA 2GZHA 4F92B 1F6BA 2GJKA 4CT5A 1CRPA 4PX9A 3TNFA 1N0VC 3LW7A 4DBLC 1BOFA 3GD7A 1DBSA 4NDZA 1G64A 4N3NA 4G0NA 1P75A 3WY9A 1LNZA 4OL0A 4O25A 2G6BA 3IO3A 2BJVA 2QTVB 4NYMR 1FW6A 5FBRB 4RFVA 2HJVA 1GIAA 4AKGA 3RYTC 2XTNA 4ARZB 4IFBA 4ZIRB 5CM8B 2ONJA 3SN6A 2WIBA 3CZQA 4TQUS 2ASEA 2ODNA 3RVBA 3VR3A 3V00A 4UJ3A 3BIFA 2GJ8A 4LV6A 5EXTA 3ETLA 4POAA 4KSCA 2ZVQX 1FTNA 1QHNA 3IBYA 2ZI9A 4IFEA 1P5ZB 2A5DA 2CK3D 1G3IA 2FA9A 2B8TA 3NHAA 1BKDR 1TU3A 4M2LA 2HXSA 3R7WB 1AJEA 1VMAA 4MRPA 1ZU5A 3GLGA 4M8NE 2UZIR 3CLVA 1JEDA 3FB4A 2BJWA 3QBTA 3THWB 3GLFA 2WJHA 4QBFA 1GKUB 2NPIA 2PT5A 2J5XA 3ICQB 4RFSB 3CF6R 4BEJA 1KJYA 1G5TA 3CF0A 3IHWA 5IT5A 1HEIA 1GNRA 4HLQB 1QHXA 1G8HA 2QP9X 1WF3A 1S0UA 1JNYA 4WAUA 4MUBA 1XXHB 4MQBA 1N6NA 2FH5B 2ZUDA 3VR5A 2BWJA 4TLCA 2BV3A 3T06B 2WJIA 4HB0A 4ACAA 2IUUA 1JB1A 4HAXA 4HSEA 3CX8A 3C16C 1Z2AA 2R2AA 4PO8A 5J5CA 3EWSA 3SQWA 3RABA 1HE1C 4EKDA 1A7JA 3KKNA 4C3ZA 5CIQA 2IX3A 2HCBA 1VKJA 2JIZA 3WBJA 2IWHA 3SBDA 2J0VA 3Q3JB 2G9NA 3KQUA 3I72A 2G88A 1RRGA 2A5GA 1I2DA 3B9QA 5B30A 2P5TB 4JBXA 3R8CA 3PUXA 4LBVA 1VIYA 4XVQA 4FMCB 4CW7A 4AKIA 3FYHA 4M1WA 4BECA 1W1WA 3CKLA 3FOZA 3QNUA 2VP5A 1H8EA 1VG9B 3KTAA 1T3HA 4LYFA 3V9PA 4DCUA 1FFHA 1VG0B 3ADCA 3IIKA 4UXHA 1E2GA 4LHYA 4M9SA 2V6IA 2WSMA 1IJEA 3GLIA 3ZLJA 2ZYUX 1DAHA 3K09A 5CJPA 1B0UA 4GI7A 2RH5A 3M6AA 3SJCA 2QBYA 4V02A 1BMFD 1HTWA 2R6FA 1II0A 2QRNA 1T0JB 3LRPA 3WNBA 1AZTA 4PC1A 4F91B 1DG1G 1S3GA 2QI9C 2CJWB 2F3TA 3E70C 3AKDA 5CB6A 1OE0A 3F3YA 3P1JA 3RSOA 2FEOA 3KFXA 2ZU6A 5CYPA 1OKKD 1N6IA 1KI6A 2Z5FA 3N2EA 1NN0A 4WBSA 2RHMA 3JZAA 3SNHA 3LNCA 5CK5A 2ZS8A 3B1ZA 2ZRIA 3W6NA 1J2JA 1PJRA 4BZQA 1KMHB 1KMQA 1EX6A 4AIIA 1UADA 3ZQ6A 3V4FA 2ZSFA 1FP6A 2C95A 1RJ9B 4QJ3A 2ZS7A 2JATA 3B78A 1E2EA 5IK2D 1GAJA 4BFVA 1XD2A 4C30A 2GF9A 3OEHD 3Q85A 1MO5A 1N5KA 2FSHA 2IYVA 3D6TB 1G19A 1LV7A 1FUUA 4ZCIA 4M9ZA 4B74A 5SZKB 4A36A 1OH5A 1COWD 5HE9A 2OFXA 4KYIB 1QHYA 4BQSA 3T5GA 4A0GA 2VEDA 4M22A 1E3MA 2XAUA 1NMZA 4A6PA 2FOLA 4K81B 1AS3A 3P32A 5DIFA 2O8CA 2AXPA 3VU9B 3EZ2A 1CULC 3TJZA 1XPUA 3LAWA 1NP6A 4JVNA 4TN1A 3VR6A 4EPXA 2BDTA 4I1OA 1AIPA 1RPZA 3VHXA 5KPDA 2GCNA 3FGNA 5JI2E 4JKIA 4B3XA 4Q9HA 3KQNA 2YWEA 3ZYCA 2HT1A 2VSXA 3VU9A 2O8CB 1N6OA 4OHXA 4TZ0A 4D0LB 5J4YA 3QPUA 5LD2C 1Q44A 1VHTA 2ZI6A 5CM9C 5KSPA 2J7KA 2OILA 4ACBA 821PA 2O8FB 4E07A 2JIZD 1DAIA 1GNQA 1NF3A 1QDEA 2ZREA 2RGXA 1MO3A 4OHWA 4Q9JA 3U4QA 1N6KA 2H16A 3VR1A 2XZOA 3LLMA 1QRAA 3K0SA 4TT3A 3K0EA 4EPYA 1FQKA 3N2IA 2AWNA 4Q1AA 4UJ5A 1UBFA 5BN4A 1E98A 2GXQA 5EXXA 2Q9CA 1XD2B 3Q7PA 3LDAA 4KV9A 1XP8A 2VSOA 5FL7A 5C18A 2WWXA 2FE4A 3AKCA 4KAXA 4B76A 1XFAA 3W34A 4BZXA 3X2SA 4GSYA 2CL6X 1NLYA 4Z8XA 2ZSBA 5FPSA 3FFAA 1OB2A 2C77A 2Z6VA 1NKTA 2L0XA 3AH8A 3OEED 5B64A 1YVDA 4X8MA 1AK2A 2JJ2D 4AKEA 4TTQA 4TYQA 2D74A 1Z47A 5GVSA 4Z1MD 2RGNA 2NTYC 1L4YA 1MT0A 5EUQB 4LDJA 1DARA 1KNXA 4BLPA 4FWTA 2J7PD 1L8QA 3U3RA 4E22A 4OI4A 3TUIC 3J81k 3AF3A 3MG9A 3NH9A 4KXFB 3WRYC 2QSYA 1N5IA 4CEJB 1NMYA 3IQXA 2B7BA 2WV9A 2IHBA 4GP6A 4LJ9A 4Q47A 3FMIA 5TDHA 1BMFA 1KK2A 3U6KA 2IEYA 3CB4A 4B3GA 4F38A 3LX5A 2FF7A 4XD7D 2VTKA 3EC2A 4JYCA 5L3RA 1OV4A 2PLRA 2O8BA 3A1TA 3E1SA 4LUCA 1GNPA 1NIJA 5EZ6B 1KY2A 1DAKA 4FMDB 4A9AA 4DDTA 4C2TA 2JJ8A 2C98A 4RD2A 2QRZA 5TMPA 3LW8A 2C96A 4TMKA 2GCOB 3KKPA 4LYAA 4BLSA 3IIJA 2HJGA 3AF0A 4BFWA 3L0PA 5L3VA 1KJZA 3IDQA 2H57A 1KJWA 3KJIA 4PQRA 2ZE5A 4AG6A 2R65A 4MKGA 4A92A 5FL3A 3KB2A 3MFYA 3BORA 5BWMA 3EPJA 3MCAA 1JR3E 3FKSD 1E4YA 1Z83A 3TKLA 1U9IC 4C0BA 3U6BA 2IC5A 4A2PA 4N0DA 1XZQA 1U0LA 2C5LA 1ONBA 2WWFA 4DEXA 6Q21A 4AC9A 1L4UA 5FH9A 4QBIA 1H8ED 3HWSA 4EIWA 4RJLA 3O47A 5B2ZA 3NH6A 4I99A 3R7WA 3WMGA 2X2FA 4D2IA 4JLBA 1OIVA 1R4AA 5G41A 5KDOA 4BASA 4FMBB 4C4PA 3IO5A 3C4JA 1OH8A 1JQLB 2V54A 5UKDA 3ZQJA 3IPXA 1N2CE 5CJ2A 3ZJYA 2DBYA 4DT1A 3VR2A 2EYUA 1ZJ6A 3TR0A 3AKEA 5EUMA 721PA 2AXNA 1Z3IX 1TUIA 1S1MA 5ANRB 2ORVA 1JR3A 1TU4A 2XB4A 4ZIRA 1NIPA 4YXWD 4E09A 4V0OA 5FOSA 5GADl 3C14C 1G3QA 4AURA 1GVNB 2WAXA 3BK7A 3QKSB 2DY1A 3GLFB 3TW8B 4QC2A 3QF7A 3THWA 2BEKA 5BYJA 3OIVA 4TT3D 4DKXA 3TSOA 2QA5A 3PEUA 4Q02A 4MYTA 4IDOA 1G6OA 2PZGA 1MKYA 2PX3A 4EAQA 1KI7A 4XSGA 4F7WA 3QKSA 2NOAA 5KNCA 4ESVA 2P6RA 4HDCA 2P3SA 3DZ8A 4QL3A 4QGAA 1IXZA 3OEEA 2X8AA 4P31A 4EFLA 2ZS9A 4URUR 3GEIA 4YMUA 4UXJA 4C0JA 4XIGS 3WBKA 2ZTSA 3PFIA 1SKQA 1A82A 2FU5C 4F93B 3WXMA 5AUPB 2FN4A 4GOXA 1JQJC 2D3WA 5EQTA 1E94E 2FPKA 3IIMA 4G3XA 4Q48A 4ASUD 4B6EA 2OG2A 2Q3MA 4LPKA 4H9GA 2QEQA 2QE7D 2R62A 4JLPA 1YZLA 4BLOA 3HPQA 4NH0A 3OIUA 1R8SA 4D25A 1GSIA 2JLQA 3GLIE 2IYWA 5KNBA 4PC6A 4C0QC 2O0HA 4OI1A 2QQ0A 2WZQA 4HLDA 1ZUNB 4ZDKA 1NVUQ 1E0KA 1OKKA 1YQTA 4TMVA 4JLOA 1P9NA 2ZRLA 1UBCA 4C0LA 3D3QA 2JJ1A 4BRWA 3CRQA 4LGMA 1DAFA 2FEMA 2B8WA 3UG6A 1VDZA 1J8MF 2H18A 4M4SA 3RAPR 1KYIA 3EA0A 4LRWA 3S1AB 4D6PA 1KAOA 2XTZA 3D8BA 1ZNZA 2AWOA 3ND8A 3C5HA 2Z43A 4Z1MA 4U00A 3GJ6A 2A5JA 5BN5A 2W6JD 2JLZA 2LCFA 4YDHB 1VPLA 4XSHA 3QKTA 3UG7A 3DKPA 1S9DA 2AN9A 3AVXA 1ZNXA 3CF2A 2GVDC 4U02A 1LS6A 2RGEA 3NC0C 4TSFA 3GJXC 5FPTA 4JLVA 3QKUA 3BERA 5EE1A 1I4DD 1VCIA 2ZR0A 3LVQE 4RKEA 2RMKA 4JVMA 1HE8B 5K8TA 1IXSB 2YWFA 1Z0KA 3BFKA 4BGDA 3W3ZB 2GCPA 1XTQA 2XX3A 1JBKA 3IKJA 4JLMA 2IL1A 1DO2A 3GEHA 2ZU0C 4I1UA 4Q03A 5HKKD 3LQQA 4EQ6B 1XU4A 4BUJA 4NCKA 3E2IA 1OXSC 2Q0HA 4DZZA 1TQ4A 4OI0A 1G21E 3UIEA 3C8UA 4U7DA 2GA8A 4NCNA 1E99A 3A4NA 1HY3A 2D7DA 1IY2A 1JR3D 1X8JA 2MSCB 3EASA 3K70D 4G5OA 3LWNA 2JCSA 3GFPA 4TLDA 2WICA 4GDFA 3B1YA 1IN5A 3P27A 1EFRA 5FPHA 3ZD7A 2IW3A 1Z6XA 1YZUA 1NSTA 4KFSA 1KO1A 4FMDF 4PZLA 1M6NA 4JLKA 4AWXA 1D6JA 5KTYA 2F9LA 2H17A 4EPWA 1Z6GA 3AUXA 2JASA 3NXSA 2OT3B 2QTHA 1MABB 1T5LA 1Z5ZA 4AG5A 4D81A 5JEEA 2O52A 4TMZA 3B7GA 2PJZA 3UWOA 3PV0A 4QHTA 2QMOA 3H0KA 4OJKA 2KB0A 2WVJA 2O8DB 3AQ4A 1GL9B 2O8FA 4C0SA 2A78A 5JSZB 4Q4AA 3TUJC 2QGZA 4PPQA 4IHQA 4PR0A 2JLUA 1R7RA 3ADKA 3EIHA 1KIMA 1N25A 3I4LA 5DHAA 5FTMA 1D5CA 3L0IB 5CDFE 5J4HA 1EK0A 4DLZA 2H7VA 1O3YA 1UEJA 1GITA 4NTZA 4DDUA 4OKSA 1N6HA 5A5GA 1Z8FA 4DLSA 4AKHA 1CS4C 1OW3B 1Z0IA 3EZ6A 4TYNA 4DLRA 4NU0A 4TYYA 4DWJA 1M34E 2ZRFA 1QZXA 1HA3A 3R9IA 3T1OA 5KSYA 5LDDC 2VHQA 2WJGA 2GAOA 2OXCA 3THOA 4XH9B 3Q7QA 3HR7A 4L15A 2AKYA 1FOEB 2RAPA 2HYIC 4O3MA 4RD3A 2VO1A 1QF9A 4ABYA 4R7ZA 1RJ9A 3NHBA 1XPOA 1U0JA 2VH5R 621PA 4C9BA 1M7GA 3UMRA 2AD5A 2QT0A 3GLFE 2EQBA 1SVKA 3RANA 2VBCA 3G5UA 1F3OA 1ZM7A 2GK7A 1UPTA 5H8WA 5F98A 1E9DA 3QXJA 1TADA 5C4MA 4PHFA 3UMFA 5FL7D 1QHGA 2JA1A 4R2HA 5G40A 1YZTA 2GHIA 8OHMA 3AF2A 1XEXB 1W4BA 5FUVA 3T1VA 2EFHB 4HLCA 3TSWA 2YINC 1QHIA 2WOJA 1G20E 4B75A 5E7JA 1P73A 3CBQA 1AM4D 2HLDD 3VX4A 1P2VA 1RYHA 3NBXX 4DT1B 3FPAA 2WHXA 4L9SA 2GNOA 2LKDA 3VFDA 2FG5A 3Q5EA 1JJVA 1AZSC 2CDNA 4H1VA 2ZANA 4UNNA 1UAAA 2EFEB 2J59A 2YNMA 4QHSA 4EDHA 3DL0A 3KQHA 1SVSA 2ORWA 4ASUA 5KDDA 3PEVA 5CB8A 2OV2A 1VYUA 4Q00A 4DLWA 3TAUA 4R98A 2W2TA 3MAAC 4JSTA 2RGDA 1TTTA 4OQFA 1MH1A 5L3SB 2A7QA 5BQ5A 1S4QA 4OJQA 2EYQA 4A6XA 3K0AB 4I81A 1E32A 4NKRA 2JLXA 3ECCA 1Z63A 2RGCA 4IDQA 5JLJA 2LKCA 3EIEA 1YRBA 1WMSA 2W58A 5TVKA 4Q01A 3U7HB 3IQWA 5FOXA 4TMWA 3LD9A 3PUYA 2JLWA 2FSGA 2ZSEA 5FTNA 3CR7A 4Q7MB 2IYUA 1ZYUA 2J41A 3BBPA 4ZO4A 3H84A 1XMIA 1JECA 5AJYA 1TL7C 1ZC4A 1R0ZA 5JBQA 4MKFA 2AR7A 2DYKA 5E95A 4Q1CA 1KO4A 3D31A 3SFVA 2NQ2C 1KZ7B 1E0JA 1W0JA 5EE3A 4ZCMA 4HB3A 2V6JA 4G5RA 4Q1FA 3ADBA 2CHGA 2QE7A 3K1JA 4I1SA 2Q9BA 1II8A 5DI3A 3RC8A 3IBGA 3C7KA 1ZD1A 4GT1A 2D62A 1NG9A 5FPKA 4JT4A 1DELA 2ZRHA 4HEJA 3CX6A 1W36D 3QVVA 1KSHA 1NRJB 4HI0E 3A6PC 2JLVA 4UKDA 4CZ2A 5AR1A 1XTRA 1ANKA 2IEZA 4HZIA 2BIFA 1MO4A 3W5IA 3O8BA 1CIPA 2I1QA 3P4YA 2PCJA 4GBMA 3NIBA 3I32A 4F4IA 1H8HD 2ZJ2A 4G01B 4B3DA 1E0SA 4RCZA 4A2WA 4A15A 4JVLA 1N0WA 2KI5A 2PBRA 1ZC3A 2CVFA 2IT1A 2RGAA 3CRRA 4BFZA 2FGJA 4JIMA 2A3RA 1NY6A 4PSVA 2KWIA 5CIWA 5D3MA 4KSBA 4PZZA 3OESA 3REFA 1HUQA 1BH2A 1E1RA 5IHPA 2DFTA 4DDWA 1OJLA 2YOFA 5DHFA 2GESA 2CL0X 4GRAA 2OCPA 5J4VA 1PVOA 1EXMA 1FL9A 1GP2A 3OIYA 3DEFA 1F2UB 1F48A 2VLIA 2CHQA 2D2FA 3EZ7A 4MRVA 1WRBA 1XTIA 4MYUA 3LBIA 2O0JA 4TTRA 1AGRA 1UKVY 3NBZC 5FOVA 3B1VA 5DN6A 4O2RA 1ESNA 4TQAA 3QXHA 1CJMA 3FFBA 1G17A 4PHGA 4CIDA 4PHTA 5C46F 1IN4A 3RLFA 1ZM2A 3LXXA 1DAEA 2V3CC 4HLUC 5JJIA 1KTVA 3WYFA 3FMOB 1M1YE 2AKAB 2KBFA 4PC3A 1OHHD 2DWPA 2F1JA 3PJRA 4ZDJA 1XX6A 1IOZA 5FPYA 3ZS8A 1U0HC 2QPAA 3A1VA 5JMTA 4RD6A 4J0QA 2EU8A 1ZD8A 3CW2A 3QEOA 3QQ5A 4EJSC 1N6LA 2GKSA 2BBOA 4QBHA 2Z83A 4KHZA 2XNDD 2I3BA 5KYKA 1YR8A 2DB3A 1VCOA 3Q8XB 2ATXA 3RRZA 1F2TA 1FMLA 2VP4A 1RC8A 1D2EA 2AFHE 4QJ4A 3SHFA 4ZKDA 3C5CA 1WP9A 5JWOA 3MJHA 2QSZA 1KMHA 2MSEB 3SR0A 2IYYA 2BHRA 2ERXA 2J3EA 1CP2A 2VHCA 3A8TA 2ZRJA 4D4JA 3SYKA 1S9HA 4IVQA 3NWJA 3W90A 3KXKA 1IM2A 4TSFD 2BBTA 1KGDA 2CJWA 4LJ7A 1TEXA 1US8B 4S35A 4EQ6A 2IXFA 4Q9LA 4B73A 3B2EA 1LF0A 4IEIA 2VF8A 5CDFA 1GL6A 3VKGA 4BLTA 5A0FA 3OHMA 2G1KA 1U81A 1DS6A 3DVLA 2GZDA 5EXSA 2IS4A 1JAIA 4GOKA 1NJGA 2C04A 4BFTA 1EGAA 5EP4A 2PZEA 1ZCBA 1KDPA 4NBSA 1Q21A 1D2MA 1YJ5A 4FI3C 4B48A 5L3QA 1NBME 3VTKA 1XCGB 3DM5A 2MMCA 1JR6A 2ZJBA 1AGPA 4MRNA 2J9RA 3FHCB 4URYR 3IEVA 1OFHA 2PH1A 3I8XA 4GPTA 4UNQA 2YHSA 3OEHA 4UNSA 3DHWC 3EWAA 2UVQA 3CNLA 3U61B 1G4AE 2GVZC 3LXRA 2VRWA 5JWHA 4RD4A 4JLAA 3KKOA 2W00A 4UNPA 3WRXC 2V7QD 2ZJYA 3AB3A 4A8JC 5H68A 1E2IA 1N5JA 2REBA 3B5JA 5J40A 4URXR 2QAGB 3GJ5A 1RYFA 3CM0A 3EPKA 4JLDA 5G53C 5EJEA 3CRW1 1VYTA 2W0MA 4RD0A 1G3UA 3AVQA 4ZDIA 1W0KA 4Q4JB 4TWZA 4QBGB 4OHZA 5KUTA 1RFLA 4HB2A 1EWQA 4OQLA 3QI2A 3BWDD 1KY3A 5E4FA 4N1AA 1QHHA 4ERNA 2YKGA 3I8SA 3HYTA 4Q21A 3GFOA 5FTKA 4LHWA 2ZI3A 521PA 4DRZA 1Z08A 2UZ3A 4HUQB 3FMPB 3RS2A 1CXZA 5F9HA 1N6PA 4Q4LA 3HU2A 1CBUA 2CCKA 5JCPA 2RB4A 4P33A 1SQ5A 1ZUIA 3LLUA 3X1WA 3ZD6A 3GJ7A 3HR8A 4WZAE 4A82A 1IJFA 1XCPA 1DAMA 2IS1A 2GXUA 2QAJA 1P7CA 3QKRA 1S8FA 2FPMA 1DO0A 1V43A 1W2GA 5TXGA 1VCNA 2G0NA 2V8OA 4JKYA 1NL3A 2XXAA 3KJHA 1NN3A 1XBTA 4Q1BA 5E7MA 4CF7A 2EW1A 5FTLA 1MV5A 3R9WA 2F9MA 4QNRA 3MMPA 3OE7D 3KQKA 2AFIE 2GZAA 3NKVA 2HEIA 2KSQA 3BJIC 3B60A 4OHYA 1SVWA 4R2IA 2XEXA 4ARZA 2NGRA 5D3MB 2EFCB 1ETUA 1LVGA 4ON9A 3RS3A 2WSSA 3WHLA 3BH0A 2YZ2A 4Q66C 2BMEA 3RRYA 3MWJA 4MKHA 1SVOA 3NEJA 3VNUA 1R0XA 2FV8A 121PA 1BYIA 1GTVA 4DDVA 2QORA 2R6AA 3Q5DA 2DFKB 4JL6A 1I4LD 3THXB 1G5PA 4CEHB 3B1XA 3UXMA 5AWFC 4A8JA 1E9CA 1WBDA 4FMCF 2XZPA 5F3WB 2DCUA 1CJUC 4DCNA 4U5XA 2H92A 1HT2E 1UEIA 4TLEA 1OIXA 3SEAA 5P21A 2ZYWX 4P32A 2VYFA 5CLLA 3TW4A 1QVRA 3WNDA 1G7TA 4XVUA 3CNNA 2GBLA 4IOLA 3WP1B 3T1QA 2AHOA 3ASYA 1G41A 2YWGA 2JEOA 1KK3A 4NCJA 3T34A 3U44A 5BW8A 2JLRA 1HQYE 3MD0A 4LBZA 4LHXA 2NO6A 1QG2A 3CPJB 4EFNA 2JJ1D 5FR2A 2WBLC 1K6MA 2OAQ1 2Z4RA 3RHFA 4RVCA 3CWQA 5CLQA 2Y8EA 3I62A 3W9YA 2BCGY 3U44B 4A4DA 1R5BA 1VYVA 2H5EA 3Q72A 4IKEA 1DAGA 4LBWA 2VSFA 1GZSA 2E87A 1YR6A 1PLJA 5JHGB 3VR4A 2ZRCA 1CJVC 3NEYA 3KKMA 4ZI2A 2J0SA 1SHZA 2IHYA 1E2NA 4OQXA 4CEJA 1W48A 1OFIA 2G77B 4LWZA 4BE7B 4HUTA 3AVOA 2WWGA 4LOAA 1W44A 1U90A 3AGPA 4HAWA 1P2TA 4HAUA 2C8VA 1NVWQ 5KPJA 3QXCA 1E69A 5ELXA 3BS4A 4YONB 3K70B 2H8KA 4X8HA 2IK8A 4YMTA 2ZJ8A 5JRJA 2ZYVX 1ZUHA 2ZR9A 5FTJA 4LC0A 4YXWA 4D0NA 1PLLA 1R2QA 1T91A 1SVLA 1N3BA 5JI3E 2ZM5A 2A2ZA 1P72A 4LJ4A 4I1VA 4QM7A 3AKYA 4B71A 5GJBA 2QGNA 1U9IA 1D2NA 4KBFA 4YMWA 2ZSDA 2N46A 2R8RA 1PUIA 3QSYA 2EWVA 3B1WA 4M0LA 1G9XA 4P0TA 2OBMA 4RD1A 4FCWA 1HURA 3EIQA 1XEXA 2F43A 1Q22A 3KJEA 5AJWA 1ZP6A 4L16A 4LV5B 3T15A 4JL8A 4YMVA 3A4LA 2GTPA 2HYDA 3X1YA 1N6RA 3QKRB 3MGCA 3SOPA 1C4OA 1Z22A 3AVVA 2CE2X 3QG5A 3DO6A 2GJ9A 1J90A 2GETA 3A1WA 4DCVA 3QF4B 1TQ6A 1UM8A 1Z06A 3EZFA 4WW0A 4P3YA 2XOKD 1U8AA 5CK4A 5HZHA 4DB4A 4BLQA 4F4CA 4HUQA 1XZPA 4TLAA 2XB2A 1ZINA 1X6VA 2FFQA 2PX0A 2R6CA
chains in the Genus database with same CATH superfamily
2UYGA 1HETA 4YQFA 4ZTZB 3OP1A 4DEYA 1WE2A 1C3XA 4D5GA 2DPGA 3L4EA 5E9QA 2HW8A 5HMLA 1X38A 2E21A 2Y1XA 2WA2A 3OZXA 4QWMA 3H4MA 3R5JA 5JPDA 3BE6A 2ZM6B 1P4JA 5LZ8A 2VYND 2X5NA 5AUOB 4ODIA 1ZKDA 1KP3A 2NU6B 2VT7A 4GEKA 1U63A 3TH5A 1QQ5A 4XRRA 1E5LA 3LH5A 5B6IA 2D8AA 3QSGA 3VVBA 4DVGA 1E2JA 1YZQA 3FIUA 2XLCA 4JROA 2XT6A 3FF4A 3QNMA 1TZJA 5LYYA 4WVFA 3OVMA 3S4YA 2W83A 3CX4A 2OESA 3PUWA 4UE6A 4ARCA 4XEHA 5I3CA 5ALSA 4EB8A 2C07A 5AM2A 4O2BA 3R6GA 1FJGB 1FP7A 1HFWA 3S40A 1MPXA 1T2CA 2DERA 3AFHA 3C45A 1K5GA 1E9AA 4AICA 5JSZA 4HF7A 1QB8A 1BFUA 1EVZA 1WTCA 1L9KA 1FCJA 2A0FA 2Q5IA 3DBOB 3GLHB 3PSHA 4C7VA 5CVTA 4DR7B 1GCGA 2WPNA 5COBA 3TL3A 3C3XA 3JVIA 3FOBA 1XCMA 1FC0A 3EC7A 3IBSA 4FFOA 4QGSA 2Y2VA 4A3SA 2FFAA 2WG0A 4NNJA 2VUTA 3D6MA 5CLGA 1LSSA 4K1XA 1FQWA 4Q34A 4LF6B 2PUTA 1AS2A 4LOHA 3R20A 6REQB 4CM7A 2GO1A 3RS8A 2Z1MA 4WFIA 4H1UA 1JSZA 5JDCA 3D2AA 2O0KA 4R9VA 3CWZA 1SOAA 2XXJA 3DM9B 1KWGA 3IVGA 4RAOA 1ZCZA 2YW9A 1E0AA 5E6RA 5SZJA 3IMGA 4PQGA 3TVDA 4GPBA 4EA6A 1OXUA 1QFSA 3JYNA 3GAAA 1YZFA 3OMXA 4XE5A 1L7OA 5JO9A 1L4GA 4UDXX 4C3UA 1B26A 2FMUA 1BHQ1 1HYQA 3I6BA 2P1RA 3L0SA 4UMFA 4GBJA 5EQFA 1Z37A 4BWFB 3L7IA 4JLUA 5M04A 3EOAI 1P4SA 4PYQA 3PJEA 4RDIA 1SH7A 1YZKA 2ZWPA 4L5AA 1MB2A 3I58A 5JNLA 4HN4B 1TF7A 4TL8A 1R8JA 2QENA 4FDMA 4NYIQ 5EMHA 3WYNA 5EJ6A 4CFYA 5L40A 3L8MA 2XRYA 3IMCA 3N8GA 4YO7A 3P9SA 1E1MA 2D0PB 1DOHA 4RQBA 3RW9A 5K6TA 3P7MA 1IXYA 1N2JA 4C76A 2ANCA 3BB4A 3N6VA 3DEAA 4UMVA 4O1IA 1X3SA 3KZCA 3ZV3A 2C2OA 1YBHA 2ERYA 2WMNB 3TBHA 1OXTA 4FUQA 1EVEA 1TNDA 4L5JA 4KLAA 4KO1S 2OV6A 2XMDA 5FAXA 1NPYA 1FYVA 5KU1A 4WASA 1U5BB 1ITZA 2QAIA 2IU4A 4IDAA 2NM0A 1D2HA 3F6YA 4CCAA 2P6OA 3LUHA 3QEJA 3QKWA 4D9EA 4LW8A 5LP6B 2UUOA 5BVHB 3TMKA 4E5VA 1ZNYA 2QM8A 1A9OA 1GRQA 2IHTA 1KMIY 3DAHA 3MWEB 4PFJA 4EJSA 5L6LB 1E1LA 2ZKLA 3PE3A 2AFVA 1RDFA 2CVHA 1YR3A 3C39A 3URMA 1GG2A 1Y80A 4PCLA 1JFSA 4CU2A 1W36B 1TK3A 2ECKA 3ELWA 1EVJA 3ZZ0A 1BW9A 3GVCA 1J1IA 5LIPA 1GAXA 4PFSA 2GO7A 4Q18A 1IY8A 4I2VA 1W9MA 1YOVA 2NV6A 5D3QA 4KR3A 3O8OB 4TZTA 3SDZA 3GZNB 1QNLA 3IOEA 5K6RA 1KDTA 1IWOA 3W3AD 3C6MA 2QW8A 2XUPA 4YV0A 3N75A 3DT9A 1A5TA 3HXLA 4AJ4A 1RAEA 1SZCA 3LY7A 4WKGA 1GUAA 3HBLA 4ZU3A 4JMLA 4EEKA 1ORVA 3B3GA 5ITSA 1Q92A 2XZLA 1KE2A 1MENA 2QMEA 3TSCA 4I55F 2X4IA 4K1LA 1P5HA 4RQUA 2HIGA 2ZAOA 1QCCA 4XGQA 1T9CA 3BIJA 3WBFA 2N42A 3BGDA 1QO7A 1GLGA 5I7OA 5JJBA 1K7CA 4RVNA 1T34A 3IESA 1KBZA 2J0EA 1L1RA 2P2SA 2RK4A 3GLTA 4WOCA 1WUIS 4DQLA 4WINA 5JCXA 4ZAZA 5JZBA 4KR6A 1F0NA 1PHPA 1SVUA 4DREA 4MGYR 3TZQA 2FZVA 1YRAA 1SBHA 3HA5A 4U6NA 3TQRA 4YMHA 4FGUA 2R86A 2GSDA 3LQRA 1Y5RA 4AMUA 3EPHA 3AF1A 4QNMA 1GPDG 1E3WA 2YQ5A 3DMNA 2Y1LA 3UANA 2JLCA 1E2KA 3SZUA 5DGCA 1PJBA 1QFMA 1NP3A 4AL4A 2HLHA 4EPVA 1U8YA 1AKVA 4RIEA 1K68A 2L69A 2DFLA 3RC2A 2ZBFA 1Y5IA 1T4DA 2PFKA 1U2ZA 3COWA 3LBYA 3M81A 3V9AA 1V6AA 2GEUA 4RF2A 4LRQA 2OCYC 5ALZA 4BVBA 3TE7A 2IS2A 1II8B 4MQ6A 1HG0A 4OXKA 4JL5A 5IUNC 4IX9A 1M2OB 2FRXA 1IHUA 1A3CA 4P9NA 2EJCA 3QOYA 5E3IA 3RYCA 2EGGA 1EA5A 3D8HA 5JVDF 5A0TA 3EXEB 1YONA 2FRDA 3IE2A 1VG1A 1THGA 1Z5VA 4J03A 1IY9A 4ZYWA 2W9XA 4EABA 1AK9A 3L8GA 1YR7A 2R44A 1M2EA 5T67A 1G8FA 2Q28A 3AF6A 3FI9A 3MINA 4TQGA 5D1HA 1NLZA 3H9JA 4D9FA 4I4LA 2FW0A 4MR8B 3LT1A 3E9MA 3RUHA 2X7XA 3GJ0A 1PDVA 1E2DA 1F9AA 4ITRC 4JA2A 1UINA 4JGIA 1WKCA 3GRFA 4ND2A 3WJAA 1L5NA 2BH9A 4DLXA 3UJ3X 2J67A 3HDTA 4LVUA 4TTJA 2IW1A 2FJUA 2ZSUA 4XGNA 3VSDA 1EM8B 1AZWA 2N1BA 3NBYC 3PLRA 1E2QA 4DMKA 4M3NA 2IP4A 3PEWA 2XGSA 4CG3A 1Q0LA 3P8ZA 3QLTA 5BYAA 2WIDA 3KSAC 4PAGA 4W5WA 2PGXA 1A04A 3LK7A 4BHTA 1KRWA 4DXHA 4WBXC 3P45A 2C9BA 1UQTA 4EJFA 3CT4A 3ZNOA 4C7KA 2CEAA 3GJRA 4FDAA 3MLEA 4D8XA 1JLLB 4XJXA 3EQ7A 3T6KA 2XMZA 1USGA 3TSAA 1ZGZA 4IIJA 5F2KA 3ZBTA 4CR8A 4IEFB 1E1NA 2JJYA 5IJXA 3HEBA 4DHWA 3A27A 1MTZA 4MGHA 4D80A 1JKXA 2O50A 4BY9E 3AV0B 1Z33A 1EP2B 3I1FA 1NWCA 4EFKA 2NP6A 3EPRA 1TI7A 3A3NA 3A9RA 3DDZX 3E4CA 2PJRA 1YA4A 2O59A 3R3VA 2BM1A 2I6FA 1M2KA 3LC2O 3B6EA 4FNGA 2OHJA 1QQTA 2JGDA 1WMAA 1P1BA 1UBMS 4RHEA 4WKCA 2DHCA 3F8TA 5THXA 1FDSA 1XTKA 1ZQ9A 2OQ2A 3I6ZA 1EX7A 1GZ6A 2QN2A 2RIPA 3ME5A 4G8JA 4PANA 2IS6A 3E3AA 1JE1A 1M75A 3CURA 3OFNA 4JZKA 3ZWXA 4Y0VA 1QPZA 4ATNA 2JW5A 5BRNA 3V4LA 2BEJA 4Q4HB 5C1IA 1S2MA 1KAMA 3PPIA 2HT6A 4AN1A 3L01A 2O1EA 3E61A 3ZK8A 3WFZA 1TJ5A 3QIAA 4NBNA 2PL3A 4IRXA 2AL7A 3Q6MA 4D6XA 1HR0B 4MP6A 2BGJA 4PO3X 1PV4A 4P5PA 1AU9A 2GUGA 3H2SA 3OZEA 4EG8A 4ESHA 1LPPA 3E03A 4OP3A 1Q1QA 3IUYA 2AR9A 2C2KA 2O3JA 3SC4A 3B8HA 3WV4A 3ZKWB 5JHHB 4XPZA 3TNDA 4DV2B 3N9IA 1EP1B 1VCMA 3DC2A 4HQ6A 3VKWA 4XWKA 3K9LA 4ETWA 2H5IA 4ZZ3A 2Y1CA 3SY8A 2G9RA 4PSKA 3PUJA 4OA8A 3NRJA 5CNKA 5NULA 2AX4A 2CCJA 3RHZA 2V55B 3TL6A 1JLHA 4JH0A 3X1DA 3X44A 2ODWA 2WF5A 1C14A 3DT6A 4RTJA 1NXVA 4AROA 2OHFA 1C0PA 1V2HE 1V4BA 3TLKA 4KLZA 1Q83A 3TDMA 4E6PA 2ORIA 1ZAYA 4C4YA 5HQTA 2BFDA 3AMVA 1W0JD 4D3XA 2CMHA 4AK9A 3GCGA 2JGNA 1R37A 3PGJA 1FFAA 2DHEA 4D99A 1CJKC 5H59A 2ASVA 4YRRA 1M3SA 3L7OA 3TLAA 2ZK7A 2GZ1A 2G67A 3BAZA 4QOSA 4XCQA 5AH0A 2JAPA 1ISJA 4PG7A 5J4KA 4UAUA 1WEHA 5P8WA 4F6LA 1TUBA 1RXYA 3DDWA 3WLTA 2X5KO 4ZGWA 3W5AA 4LDPA 4IJQA 1PQYA 4M1OA 4QOFA 4FLMA 2ZB4A 1IN7A 2JGJA 1QRSA 4RK1A 1ZESA 1ZRHA 1EK2A 4IKOA 2JFNA 1S3FA 1MO6A 2IYQA 3ABSB 1Z0DA 4ZT5A 3EYAA 3FFWA 2ZIWB 5J5AA 2R47A 2EBWA 4HH3C 1MPTA 1C9MA 4GGMX 4N47A 1J0CA 2QMUA 3QE0A 4LQ4A 2XDYA 5AI4A 2J9FB 1XVTA 5HFAA 1JZTA 1ZM4A 2AHRA 5EE5B 5L8VA 2DZDA 3FWZA 3D4NA 3PEEA 4UTRA 1RWWA 2NUPB 2OD9A 3O1LA 4RACA 2A7XA 2XMRA 4B2LA 5C31A 3IOCA 4IR7A 3RJ5A 1X92A 3AERB 1H69A 4OK3A 3WB1A 3INNA 3VMFA 4CDNA 4MCIA 1ID8A 5LOVA 3ZVKA 1C1XA 1T5SA 5AVTA 1OI7A 3DP9A 4TZ6A 5BOSA 1Y3IA 3AFMA 3DMFA 4JD5A 1XVLA 3PIDA 1E2HA 4NEHB 4D42A 3IHLA 1YTUA 2W6JA 3UMJA 3A6FA 1DQSA 1EFLA 1FDRA 1ZK1A 2IZ0A 4MS3A 1YDFA 4RF5A 4RENA 4EUHA 1E6WA 1E9EA 3UATA 1VLJA 1ZVKA 4H7DA 3A0RB 1UOQA 1X1TA 1XJQA 2V1XA 4L85A 4RIGA 5FR1A 4AKSA 3REQA 4DLAA 4QPJC 1RI4A 3KWMA 3WKBA 1BD4A 3FFXA 2N0SA 1J99A 5JZSA 3RUEA 4OBWA 2VDPB 4KXVA 1OHHA 4L78A 4DVJA 2GXAA 2FMXA 2IWRA 4MV9A 4WCFA 2E48A 5C1DA 3NPMA 5LB4A 3DOEA 1WA5A 2OB2A 4QIHA 3CT6A 3C3WA 1QVVA 5EXPA 3UC5A 5BWOA 1ENPA 1W75A 4DIOA 3PHHA 3R0ZA 2AT1A 3VHRA 2HDNB 3RGWS 4E08A 1XMXA 1PL8A 4ZHQB 1G8AA 1RRVA 3ZWWA 2BCEA 4R6XA 3W2HA 5IKEA 4ZI7F 3CR3C 3OUZA 5ETJA 1Z29A 2P6NA 3MWDA 3SM9A 1ZXXA 1AQIA 2L18A 2BMFA 3E3NA 2ZJ6A 3F7NA 4I50F 3B36A 1Q1BA 3K0CC 3RVLA 1Z0ZA 1JKFA 3SSMA 1SB8A 1SM4A 2GPWA 4RMNA 1KJ9A 1V4NA 1FZQA 3CISA 3KZOA 3S6JA 3CO5A 1LK7A 1TM7E 3LZ6A 4JB0A 1KJ8A 1SOMA 2AUTA 4AU1A 4INOA 1Q19A 5IPFA 1Y37A 3N8HA 3KWJA 4GYYA 3QWAA 3I45A 4CEIB 1YI1A 4AXXA 2G1AA 5F2NA 2YIDA 4A8JB 5HUHA 3OPVA 1IZ8A 2YW2A 3O7MA 4NAUA 1YU6A 4D4IA 4JVOA 4R1UA 6AT1A 5JFGA 3H2KA 1YFZA 4NMMA 5DRTA 2XZTA 2A0XA 4DM7A 4IIBA 4FCTA 3PQCA 4CIYA 3M7IA 4OBEA 4F5YA 5BNIA 3D6HA 5LQDA 2I1VB 3A4TA 4R0NA 3TCNA 2VDLB 1GRNA 1WL8A 3DOUA 4J7UA 1ARZA 1UWCA 2HLDA 2I5PO 3SU8A 3I01A 2Q45A 3E1GA 5HYVA 3RR2A 3HWX1 3IMFA 3BD8A 1UDXA 5F9FA 1VKRA 1Q1EA 2H4WA 2RG7A 3T4PA 2I2DA 2PA3A 2VHTA 4Q15A 3RTGA 3AKZA 1HDYA 4PPGA 3CNQS 4EFDA 1NQOA 3REQB 4HAZA 1TAUA 1AKTA 1W47A 5C8YA 2A9KA 2XOXA 2WAYA 4KRGA 1ISMA 3W5UA 3U5TA 3V2GA 3S27A 3DDHA 3I9OA 3L8DA 1VLZA 2ZAGA 1SD1A 2BELA 4LNUB 1SXJA 4RLFA 2MIIA 3A1SA 1DIOB 2NO0A 3VH2A 2XZDA 1QGED 3OOSA 4GRIA 4DSZA 5F9MA 2XDQA 2WD9A 2HDHA 1HSZA 1O4VA 5BOSB 5LPNA 4YJGA 1JV2B 1KZHA 5M2QA 1C1XB 2ZVDA 4LZLA 3ZXUB 1R5OA 4RULA 1IN1A 3ETJA 2LPMA 4YRAA 4L7QA 4NPAA 3FNGA 4M1TA 4RSMA 4XA8A 1PZXA 5CCBA 4YPOA 1TMKA 2VUIB 1E5QA 1XDZA 2RHJA 1KR2A 2DUJA 4L76A 4DR2B 4FLEA 4LOIA 2HU5A 3WGZA 3A4MA 2J9FA 2WUDA 3OG9A 2PZJA 1P29A 3IPYA 2CNWA 2B37A 3LBNA 2SCUA 3K0CA 4KYTA 4G5XA 4CDRA 1D8TA 2OZEA 2R8XA 3SX0A 1FLVA 3OHPA 4M1YA 4N8DA 3TTXA 5BMVB 1YSCA 5AXBA 2NMVA 1U4OA 4RORA 4RZQA 2C2BA 2OLJA 3G6KA 4G0OA 4HX2A 4PRYA 2CLKB 4PZAA 2HRZA 3UMSA 4L9RA 3O26A 3BCSA 1CUHA 1E4OA 1P7WA 3DB2A 3I73A 3EGVA 3SD7A 3T35A 1VOTA 4GECA 4MYHA 4XKJA 2P6PA 4CF5A 2FMIA 3EXHA 2CKMA 5J2TA 1DC4A 3O74A 3PR2B 3QPWA 4BYGA 3M4NA 4AYWA 1ULTA 1OBOA 1XAJA 2B7LA 2GAIA 4KUHA 1KI9A 2IZ6A 2VJMB 2ZE8A 3PRHA 4JVSB 3RNLA 1FX0A 3BGVA 4ISBA 1IN6A 4KAFA 5K1ZA 2YOHA 3ZW8A 1ZEMA 3IAS6 4JWKA 3G2NA 4TWBA 3EHDA 2OCGA 5K51A 2I78A 2BFFB 2VNHA 1KORA 4N54A 1VIDA 2WLTA 4AZ3B 4D56A 1W5TA 4EZEA 2F7SA 4XUEA 2DPXA 3QX8A 3VPHA 3DR3A 4OX9Y 4P4UA 1E1KA 2XA9A 4IG9A 1BE1A 2VYVA 4FZ5A 5DGIA 2NZXA 1U0BB 3L2OB 1GNVA 2MHCA 10MHA 2QAGA 4L5BA 4BFYA 4JJ8A 1F4VA 4L73A 1OZHA 4L9WA 1QCZA 1N2OA 4JMPA 4F4DA 1KMMA 1C9KA 5CPFA 5J47A 2BONA 2NSLA 1N2HA 2ZRAA 3V7FA 3DZHA 1A5BB 3GG9A 3LQKA 3N2KA 1FS6A 4ZQEA 3WLEA 4RMGA 3G0DA 3K53A 3FAZA 1WO8A 4RZXA 4RTSA 3E82A 4HQLA 2GDJA 3GUVA 4G07A 4EGCB 2AQKA 2DGDA 1RKBA 1PT8A 1XQWA 1YVRA 1E9SA 1WVIA 4QU9A 2CF6A 5GJVC 4QWWA 3OE4A 1KYZA 1DE0A 3BIWA 2M1XA 2PXHA 3BD7A 4MYCA 4O5AA 4UATA 3UAVA 3SS8A 2O1XA 4HTFA 3SVTA 2KBEA 3W4IA 4OQZA 1UJ2A 3HP1A 4I6JA 3P71T 3Q2KA 2V5VA 3W6PA 1FUYB 1CX9B 3C4VA 5LLDA 4K6MA 3T7JA 1TGYA 3QA3E 5AVKA 4CQNA 1AQNA 3DDSA 2HSWA 3H9GA 4OB8A 1F2TB 3OAAD 2HEGA 1PQPA 1YL7A 2Y9PB 5EP1A 2HIAA 3TUJC 5TQ0B 4EYQA 1JLKA 5BSFA 1BC5A 5LR6A 4EX6A 1WSBA 5BN3A 1TPYA 3JS5A 1H6BA 1JW9B 1KA9H 3G23A 1XZCA 3K0KA 1XHEA 2KJQA 5KX5A 1QP7A 1UBHS 1JXOA 2EIHA 2Y2UA 4Q7QA 1LJLA 4OQMA 2XCSB 3BH7A 3JVVA 1JLLA 1NW9B 2QUKA 3JWEA 1Z18A 3U40A 5ISMA 3E9YA 4G63A 3JYOA 1AKRA 5DV9A 2UZAA 3SSOA 1NT4A 2IA5A 3AUJB 4YCMA 1LW7A 1DBVO 4PLVA 1V37A 4CKBA 4RPHA 5JS7A 5FHQA 2ZIAA 2NZJA 2P9BA 1KI8A 1YL5A 3ZXIA 2J45A 4GZ6A 4OHVA 2MWMA 1N1EA 3CC8A 3S44A 1Z07A 4DNOA 5JLAA 4IDPA 4OM8A 3AEXA 4G0PA 1SVMA 4F96A 3MOGA 3UPTA 3QVKA 4OJMX 5IDYA 4N3CA 4UHFA 5HGJA 1BKSB 3ABRB 3NDRA 3WJ7A 1XLTC 2ONYA 2QLTA 5J2UB 3IV7A 3DD5A 2QV7A 4MR8A 4YALA 5F33A 2XE8A 3U4DA 3V4PB 1SMKA 1ZOOA 3AU9A 3UCXA 4CETA 1EWRA 5CRIA 3MINB 5C32A 2JI6A 1O97D 4NY1A 4DJEC 2CFIA 1IY0A 1J2YA 1SR8A 4ZAXA 3MBOA 3H5WA 5JASA 4XWAA 5LLSA 1JJBA 2Q5QA 4E7OA 5IXSA 3M6MD 1IQ0A 3C1OA 4HYQA 4Q4CA 4DHEA 4UCFA 4P7GA 5C37A 3DFKA 4BP9A 4PZ0A 4KO4S 1RHMA 1QU2A 1EDEA 4FW8A 5AI6A 1M2OA 2A0YA 2IEGA 3U7EB 1CU1A 3PHCA 3ORFA 1PQ4A 5KYXB 2JFUA 4LJKA 3GO4A 3PFKA 3KXIA 3PKZA 4K9DA 3BX1A 1FW8A 3FGOA 3M4ZA 2JGRA 2X3YA 4U39A 2P35A 4R7TA 4DSTA 3KZXA 4KWTA 4AXBA 1K7YA 1MB9A 1GOTA 3EA5A 2H2FA 4NP6A 3AHGA 3CNOA 4IEEA 1NURA 3BA6A 3SGLA 5EPUA 1QIMA 5KB3A 3ZTTA 1TEVA 1HZJA 3QVGB 4Q24A 5KVCA 3DOJA 1FPMA 1M34A 2QM7A 4MPDA 1LLUA 5BSKA 5FP0A 4C5CA 1GT6A 1IRIA 1Z6TA 2G6TA 1TJPB 2ZJ3A 4P7JA 4HNSA 4B35A 1V7ZA 2FSFA 2WWVD 1J23A 2QVCA 2JJ2A 2ZUBA 5EGSA 1HYEA 3TVTA 4YUVA 1I01A 2Q1XA 5FLYA 2QVBA 4C22A 3WWZA 2FMTA 3OU7A 4IZHA 3D7SA 4RZHA 1VHDA 1XVUA 5C5CA 4AY4A 1OJ7A 2VP3A 1OQAA 2PH7A 2E7ZA 2XTMA 3L6RA 2OHGA 2AZTA 5DMXA 4DSUA 3G5TA 3E3MA 3RTAA 1GPMA 1QR2A 2GF2A 3I9LA 3OPYA 1R10A 4V0MA 2PG3A 3T52A 1MG5A 5A9TA 4G6ZA 1G6HA 1I3KA 4QXQA 5LU9A 2LR0A 4CLRA 2GD0A 2IPNA 1WPRA 4YS6A 3PC8C 3ZH9B 5FUWA 5JATA 3JQDA 1BW9B 1SXHA 1YQUA 2BZSA 3AK4A 5EHZA 4D8YA 1F0KA 4LJ6A 1D04A 4ICIA 5A03A 3KQLA 1W93A 3GZ4A 3S1LA 4UUMA 2OM6A 4C0AC 2BISA 2Q7OE 2HQ1A 4EKEA 1UC4B 5F7ZA 3G88A 3LWZA 5BSHA 2WJYA 1H8HA 2O7SA 2PDAA 1VGVA 4J4BA 2XBMA 2OR3A 5E7QA 1MC5A 5KJ1A 3JQ7B 4ZDWA 1RVDA 3W6UA 1M0TA 2FP4B 3LBHA 3R8FA 3FHOA 4K0RA 5IUKC 4QNNA 4J0EA 5EP2A 1A2QA 1XRLA 3TAHA 3FRJA 2Z4SA 3WL8A 4G4IA 4KQXA 1LF5A 1W6UA 3BWXA 2EGHA 1SCBA 2M9MA 2P5SA 1JHDA 2B21A 4REQA 4E3ZA 1ESZA 4BFCA 1DTSA 3E9ZA 3HKCB 3KSRA 4MGKR 1R0WA 3DZBA 4ZVMA 3TPZA 2DF8A 3LVBA 1BCSB 4O4IB 1SKYE 2FZLA 2VQEB 3WKDA 1JWAB 3DHYA 1P0FA 1Q0RA 1GO2A 1L7QA 3PHLA 2BGUA 3FWYA 3F2VA 4N5LA 2QN6A 2NO9A 1CS0A 2BF7A 3R3SA 4FD2A 4EHLA 4R8MA 4FILA 1AKYA 5ITZA 1EHIA 1WJGA 3PNVA 1KO8A 2GJAA 4MDFA 3VI4B 1K4MA 1A96A 3EMBA 2WKQA 3F1LA 5K3EA 4OX9B 5AKXA 3EMDA 5FYQA 3PGMA 2WAMA 3ESAA 4KQHA 1FVXA 4WOPA 4ZRNA 3P9IA 1W0KD 1YJAA 4BNZA 4DE5A 4PAWA 4NCHA 4CQMA 1JWBB 4PINA 2RKOA 4KIGA 5EWJB 2UXDB 4MW5A 4KQMA 1RQLA 4AY6A 3RKSA 1NVVQ 2GBGA 3E9NA 2BGKA 4L27A 4D9JA 3B85A 5CGQB 6ABPA 4U7PB 1GLVA 4FT2A 1XZAA 3WQSB 4JNCA 3MCWA 2GD6A 3O31A 3HCOA 4ZAGA 4ZT6A 5REQB 3ESBA 1OWPA 4K7JA 4KMRA 5ARCA 6REQA 4G1VA 4GPAA 3GBPA 5FUMA 2NQ8A 4MYSA 4MUAA 4B6OA 1XRJA 4ENUA 3BAFA 1NZJA 4CVNA 1K63A 5AM0A 5F52A 2RBKA 1CSEE 2D5BA 2ZAYA 3FMFA 2C0CA 1JUDA 4PXAA 4QPDA 3GPBA 2HXYA 1MZVA 1VA5A 3RVRA 1TF5A 4Z4GA 4U7JA 5BNTA 1RT9A 1GTL1 4BRZA 1N3LA 2X6TA 3ZDQA 4EJMA 2XW6A 3PXXA 2GEKA 2ZR7A 3ZV6A 1AV6A 1YMVA 1HKHA 2IGBA 2QK4A 3IERA 3FE2A 4FCVA 4PBSA 3ZHSA 2IUSA 4OYHA 5ALYA 1FTYA 3TQQA 3DVQX 1SAYA 2EW2A 3MT8A 2D54A 3KE9A 4QJ5A 3TTUA 1E3JA 4EOGA 5TGTA 3IGFA 3IAEA 3CZCA 4FS8A 4YTEA 3WWPA 5AHWA 1A8HA 1GA4A 3EIXA 1QHSA 1P17A 2QM3A 3FVWA 1GCIA 4U9IS 2F1IA 1JALA 2D4HA 4D9KA 1D9XA 1BEUB 1JYSA 1V9CA 3BL6A 1FSPA 1RLJA 4JJAA 3L7AA 1JTFA 3BC1A 1V48A 1R1DA 4F3TA 5JZ9A 1WY7A 2XD4A 1JIKA 2JAOA 1SGWA 1ORRA 1TYDE 1XWIA 1Y89A 1ZJJA 2QDXA 2WT8A 2WTMA 3OOWA 4NBVA 4NESA 4MO2A 3OSUA 1T0BA 4DLYA 3N8KA 1YJCA 2MSLA 2Q3DA 3PQ2A 2JA2A 3PS9A 3A9WA 4Q3OA 1YHZA 2H8GA 2XEDA 4HO1X 3KHSA 1I5OA 1MAWA 1XTJA 2J87A 3INGA 1L4FA 1YJ8A 2A1UB 2BC9A 3FW1A 1UKCA 4D3FA 2ZKIA 1X13A 1NLUA 3LLCA 2G28A 4IIHA 4Q3BA 5IT0A 3SZRA 3QF4A 1PK8A 1PJLA 1BNCA 1CB7A 3PG5A 1TLFA 4UHJA 3W1WA 4EI8A 1YVEI 5LCXA 1J39A 9MHTA 4CLOA 1ZOIA 1FIUA 3ZCQA 3BFVA 2PZAA 3WRXA 4GKKB 1KGSA 1XEWY 4J1QA 4LCBA 4C4TA 4CLHA 2ETXA 5LSAA 2NZVG 1Q0UA 3MTBA 4TVKA 2ZDQA 1T5IA 3VDNB 5CA1A 3H9EO 4UD2A 4CGZA 1EFHA 5ECGC 2E4WA 2OXRA 2C92A 1H1DA 3BFXA 3LUJA 4E5SA 1BDJA 3FJYA 1GARA 2DQZA 1BX1A 3ZI4A 1YDHA 1GCAA 4RXTA 1VGRA 3TSZA 3M6FA 3MSCA 3QEKA 2EWWA 1UBRS 1X1AA 2C5BA 3HUDA 2W6QA 1MR3F 3G2MA 1ZW1A 2BMJA 1L2TA 3AX6A 4K46A 2V6GA 5CIYA 2C2YA 4EA7A 1XNRB 2FSIA 2P9HA 4BO9A 4LXQA 1YACA 2IGTA 2CKDA 2PUVA 4FB4A 1JLMA 1RAHA 4FYPA 2GHTA 3OCYA 5TR9A 3ESXA 5AICA 3QA9A 1E1CA 3CLTC 1C4WA 3EGWA 1Q3HA 1ZMOA 5K05A 2XGGA 3OQNA 3PIRA 1J1UA 1COWA 2G1PA 2WTAA 4HHEA 2NAPA 3ES9A 1JJFA 4M9CA 2V7PA 2BM0A 3VBEA 2VHJA 4DILA 3BMXA 4Z54A 2PMKA 1V3QE 1W35A 3GWGA 2XPCA 1QFJA 2RJNA 4C78A 3EZNA 1V4VA 2QGFA 3HA7A 4KNWA 3ZQUA 1NVVR 9LDTA 1Z3CA 2A9PA 4PC7A 2H1HA 1DI0A 3IT0A 1IM5A 3KJXA 3LRTA 2A94A 1ZMTA 3ZX5A 2BE9A 4L8FA 4BBPA 4YY3B 1DQNA 1NJFA 3IAAA 4WA7A 1BJKA 1GAQA 4QOGA 3JZMA 1NV9A 3LX8A 2R6DA 4QSHA 3ZIUA 5AVZA 4OXQA 5BSEA 1VKNA 3CJTA 2AMFA 4FHCA 1JVNA 1HH4A 4WXHA 5F1OA 3KEFA 3OJFA 1H9BA 3WL3A 4LPSA 5LQUA 3INTA 1DNPA 1BKYA 5B3LA 2JEYA 4OHFA 1XKLA 3KSMA 4RWZA 5LQAA 4UTOA 2VPPA 1L4KA 2AUMA 5BPHA 1H05A 2QHXA 3VYVA 2WKPA 1MDBA 1H93A 1PJSA 1TYBE 3FFTA 3GROA 4KQEA 1EUYA 3ZHUA 4MNTA 4IOKA 3MF4A 4HMOA 3THRA 3I1YA 1U7WA 1U7DA 4GZMA 2BTQA 4TTVA 2WSSD 3AEKA 3JZFA 1KZ4A 4GFDA 2C3UA 4CPDA 5A4JA 5JXIA 2O5RA 2WOOA 3E2MA 2JFHA 2AK3A 1HDZA 2I2AA 2VT6A 3OLQA 2IH5A 1JMKC 1J1ZA 2FPRA 2X5JO 1ZXBA 3NAZA 2WILA 5F5NA 4D45A 1B8PA 1T8YA 1H5NA 2ZITA 4HH1A 2XUFA 3HGQA 5D3KA 3M9WA 2PMCA 1MEJA 4QGFA 3MBIA 4CN9A 2JDIA 3JRNA 4CT5A 1A50B 3VMMA 4TMFA 3BIOA 1I36A 3GD7A 3STTA 1IBCA 4HSGA 5LUBA 2QD2A 4DBLC 1G64A 5CDGA 4R8RA 5K6AA 3II6X 4BO5A 3O8LA 1MX1A 3WY9A 3RYIA 4CKCB 2IYEA 2YFYA 4OL0A 1WKVA 1XJWA 3PUKA 5K8VA 2G6BA 5DBGA 3U5ZB 4MP3A 2BJVA 2QTVB 2YBDA 2UXCB 4N4AA 2HJVA 2DUWA 1NVBA 4R8VA 2YXBA 3RYTC 2XECA 4ZIRB 1N4DA 4FNMA 1VLVA 2O06A 2JH9A 3K4QA 3IHKA 3KSZO 2G9VA 4HJXA 5BR1A 1K9SA 1RXEA 3CZQA 3DE6X 4TQUS 1A8QA 5C52B 4CLXA 4AQ7A 1O54A 1CQIB 1Z6PA 4JEIA 4UJ3A 3V00A 3CLSD 3VA7A 5JQGA 2PUGA 3EOZA 3WDLA 3S70A 1QOZA 2FWIA 1DRKA 3ETLA 3K96A 1W4ZA 2ZVQX 4R16A 4MS4A 3RV4A 4CKYA 4UHDA 1ST2A 2ZI9A 3IBYA 2NXWA 4JC8A 3RYIB 3TKAA 3EWIA 5ABPA 3JTEA 1G3IA 3G0OA 2B8TA 1TVCA 3C8DA 4OCZA 4M2LA 1SIOA 2HXSA 2P4SA 4HDSA 3R7WB 3HDGA 1AJEA 4MRPA 4FSDA 1EE1A 3ID6C 2I7CA 2L17A 1GU1A 5BW5A 2CLIB 2VUSA 4QBFA 4HVTA 1U1EA 1Z45A 1WB4A 3D6VA 3PL1A 1GA1A 3G9ZA 4ZYVA 2MR5A 3PFGA 4EENA 4RKYA 2B3TA 4GC5A 4EY3A 1G6Q1 1RQNA 4HLQB 1OPRA 1WF3A 5T64A 2PLAA 4GLLA 4WBNB 1I2ZA 2X4GA 3CVVA 2OQRA 1UXGA 3CE6A 1FB5A 2JZCA 2FH5B 3NS7A 3URKA 3IQDB 1JB9A 1NZFA 3EXG1 4TLCA 3VR5A 3GCZA 4HB0A 1V1MB 3GP5A 4M37A 1SUEA 4PSCA 2IUUA 1B43A 4HVLA 5DCWA 4BNDA 3L3BA 2W70A 1DWPA 4KXLA 2X7JA 5C5DA 2IZOA 1Z2AA 2R2AA 3HBNA 3A10A 4H0NA 4PO8A 1JG3A 1K0FA 3S7ZA 2QRHA 1R15A 3UEOA 4A0QA 3SQWA 1UAGA 1HE1C 3DDNA 3KKNA 3RABA 1TT5B 3U0BA 1QYDA 2A4KA 4XZ3A 3GYGA 5CIQA 5DF1A 5M3BA 1VKJA 1XCLA 3NQ41 1CY6A 1OA1A 4HRAA 2IWHA 3SBDA 3KQNA 4XARA 3T4EA 4UAJA 2GH1A 1AKQA 4BWGA 3KQUA 4F5DA 3I72A 2G88A 2PYZA 2ZUEA 4B4DA 1USWA 3R8CA 1LLQA 3PUXA 4EO7A 1PVVA 1IZZA 3OJEA 3ZHBA 2NVWA 3T54A 2YVAA 2ECQA 3C7AA 1SY7A 5A5VA 2VP5A 2VOJA 5IS2A 4KQ9A 5LA6F 1VG9B 2J9YB 3KTAA 3Q15C 3QGMA 3ADCA 2JH3A 1KBOA 4M8IA 2B8JA 4X6YA 3K9BA 3IIKA 3WL4A 4XB6B 5AI0A 2WDPA 4IQ8A 1N5DA 1E2GA 5EMNA 5G1NA 3ACCA 3H87A 3AETB 3G59A 3W3AH 4HEHA 3CCBA 3T94A 3H3JA 2NSHA 2VYCA 1PI3A 1SIUA 3F3SA 3HKEA 2V6IA 2WSMA 1D09A 1DKRA 1J8VA 3K09A 4FOSA 3GT0A 4GXQA 1RU3A 3M6AA 1K7SN 2R2GA 2X9QA 3E9RA 4P5EA 1GU0A 4QOJA 4DG5A 1HYBA 2PRZA 1WM1A 2AZXA 2R6FA 1UXHA 3OM0A 4FFRA 2Q4EA 3SS7X 1UOPA 1Z34A 3WNBA 5KHLB 4RPJA 3MQ2A 2A3NA 2AG8A 4RK6A 1V7PC 4RK7A 3F3YA 3CXUA 4MV5A 4OIFA 4QEZA 2HJRA 3FXAA 2IEDA 4K9SA 1OKKD 1QG6A 1N6IA 2Z5FA 3A4IA 3N2EA 5DGDA 3JZAA 3U9LA 2R8EA 2I2FA 5D7NA 4ZQCB 1TCUA 1RWNA 2ZRIA 3ORSA 4MR9B 1E4EA 1VMDA 1E8DA 1C9DB 1KMHB 2B34A 2YJ4A 3PIIA 4BZQA 2RIRA 4DIBA 1EX6A 2WFLB 1YH3A 1UADA 1YCHA 2QW1A 3RVDA 5L53A 2HU2A 4K6FA 1QS0A 1QF7A 3DUFA 4FCCA 4PEVA 3LHSA 2E89A 2I2XB 3MFQA 1GAJA 1S89A 1ESCA 1BHJA 1XD2A 5EIFA 3VU8A 5BXYA 1N5KA 3IRUA 2W2KA 3BCRA 3G5AA 2H5LA 2E4AA 4B3MB 3DCNA 4DV7B 1NR5A 1BQ4A 1FUUA 1TD9A 4M9ZA 2HHAA 5SZKB 4B74A 3V55A 4GMGA 4ZCIA 5AIBA 2O54A 1HPLA 2NTNA 4MZXA 1RCTE 5HTOA 1VBKA 4JJ6A 1SCUA 3ICCA 3NBKA 4A0GA 3S8EA 4AJNA 5HXAA 1VDMA 2XAUA 4A6PA 1BE6A 4GPIB 3P32A 2WNHA 3VU9B 1CULC 2P3QA 3G2QA 4WESA 1GDTA 5BWNA 1EK1A 1KVSA 4GX1A 2W42A 1J00A 4RY0A 4TN1A 3VR6A 2C8LA 4Z0PA 2BDTA 3LBFA 1J2TA 2V98A 2I9PA 1JF8A 4DMRA 3F67A 2PTGA 4U2KA 4WESB 1EE2A 2GM3A 2VSXA 3VU9A 1N6OA 2J3DA 4OHXA 4D0LB 4AMGA 1UPCA