5AUQA

Crystal structure of atpase-type hypb in the nucleotide free state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
245
structure length
232
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLRKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb
source organism Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Hydrolase
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
total genus 71
structure length 232
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5auqA01
3ZDQA 2BIFA 3P4XA 5AK0A 1J8MF 1DTSA 1KDTA 3H4MA 4TTRA 4A6PA 4ZI2A 4W9MC 4QHTA 4PHFA 2G83A 3A1VA 4DCSA 2FEMA 4BFUA 4K46A 4PC3A 5LD2B 3FMPB 1SHKA 2P3SA 2B8WA 3GLHB 4RY2A 3K0AA 2IYLD 1P2SA 1CR4A 2OBLA 3K9GA 1IBRA 3TIFA 4EPVA 1PV4A 1YRBA 2BBOA 3VNVA 5AJYA 4F92B 4AIIA 4DVGA 2QNRA 4WAUA 3I8XA 2N1BA 4NZYA 5EZ6B 1DAMA 1NJFA 4AG6A 4JT4A 1AIPA 1TF2A 4Q1AA 4PSKA 3QNUA 1VCIA 2BMJA 4Q1EA 1YHNA 5AR1A 1W0KD 2QMOA 1BOFA 1NF3A 3LY5A 2HV8A 4Q4AB 1VPLA 2XZOA 3KZ1E 2NQ2C 3WHLA 5GVSA 1MT0A 3GEHA 1CXZA 4A9AA 1ZUHA 1WE2A 1FZQA 1VECA 2N46A 3MGCA 4NU0A 3X1DA 2CLSA 4WBSA 1ZU5A 1NLZA 4Z1MD 4BEBA 2Q9CA 2OAQ1 3UPUA 1ZCAA 2O8EA 4WZAE 4TYNA 1JBKA 1FTNA 2WZQA 1F48A 2WAYA 1G8FA 1LS1A 2CBZA 1E2PA 4FWIB 4QOSA 4YDHB 5J4HA 2DCUA 5DI3B 3SBEA 2CCGA 3GLFA 2NO6A 4HEJA 2ORIA 4M1YA 4TWZA 5FPYA 3NHBA 3QPWA 1Z6AA 1MO6A 2BKEA 1R6BX 1ZM7A 4Q4AA 1E2IA 1EG7A 4PAOA 2BM0A 4H9GA 1XPRA 3FGNA 2QPAA 3VNUA 2GCOB 3RRNA 2ZRKA 2O8CA 1BH2A 3TR5A 2GZHA 1Z6XA 2UKDA 2C95A 2REBA 3LXRA 3OAAA 3EASA 3PEYA 3FMIA 4LHWA 1NVXQ 1Z0IA 5AUNB 1II8B 3DM5A 4XWAA 2FZ4A 2FNAA 5F9HA 1DAIA 1QVRA 3RVBA 4YMUA 2R6GA 5HTKA 1PUJA 1G16A 3SJBA 4G3XA 2LKCA 1E1RA 3THYA 2JDIA 2ZE6A 3T5GA 1YE8A 2GKSA 4MGKR 4RSGA 1A1VA 2FV8A 3TLXA 1Z29A 3RLFA 4HAWA 1RJ9B 5JLJA 3CZQA 1HY3A 3O8DA 5L3SB 1HE8B 1NN3A 2C77A 4OJQA 1HYQA 2QAGA 1NL3A 4DEYA 1JR3A 1P5ZB 3RWMB 4Q4JA 1U98A 1W4CA 3X1ZA 3IHLA 2FSIA 2WWYA 4R2HA 1IHUA 1Y3AA 3R20A 1T3LA 2FG5A 3IO5A 3P1JA 4HAZA 4DDWA 5KPDA 1FP7A 3D6TB 3KJIA 4URVR 3BRWD 2Q9BA 4MKIA 5FOSA 1B0UA 5GJWC 3MWLA 1L8QA 5JJKA 2ZYTX 2GRJA 3DKPA 4C3ZA 4A36A 2V4ZA 1FQJA 1CTQA 5HR5A 1CLUA 3KFXA 2FPLA 1U90A 4DLYA 4HAUA 2NTYC 2P6NA 1EX7A 1XCGB 4AKEA 4D25A 4DCTA 3TSWA 2J87A 1NLFA 2RGDA 3VMFA 4FCTA 1JPNA 2DWQA 3NBXX 4OHXA 4XVUA 1P9RA 1AS2A 1T8TA 3A37A 4M1OA 1JR3D 1WF3A 4R98A 2ZYWX 1DG1G 2XEXA 4CDGA 3RRZA 2O8DA 2PEZA 2I3BA 3QVUA 4NKRA 2VPPA 1Q57A 2ZU6A 4D0LB 3FVQA 4NHOA 3AP1A 3GCGA 1D5CA 1ESMA 4N0DA 4H1VA 3V4RA 3U44B 3NDBB 5HKKD 1G20E 2QP3A 3WBKA 4ZIRB 3B1XA 1QHSA 4FMCB 4BFVA 2RB4A 2F1JA 1MABB 1MR3F 2ODNA 3QVVA 4YONB 2RKOA 2VP9A 4B43A 2PL3A 5C1BA 1CRPA 1S1CA 5J4YA 2GF0A 5KDDA 1W0KA 2J1LA 4WVFA 5KSOA 4PO9A 4PHTA 2IEZA 4YXWD 3L0PA 3RRYA 4US1R 1NLYA 1TUEA 3S1AB 3VKWA 3TVDA 1XWIA 2QBYA 4UNNA 3ZD7A 4G5RA 4IVPA 4ZIRA 4C2UA 1UAAA 4GP7A 3MWJA 1XDBA 4ZDIA 1JALA 2WV9A 4QL3A 3U44A 1IM2A 2BJWA 2C5LA 1TU3A 5LB4A 4FN5A 3OIYA 2BV3A 5FTLA 4HUTA 4V0LA 1RYFA 1U0JA 3AF1A 4B71A 1HH4A 1F6BA 2HYDA 2IXEA 3LX5A 1FOEB 3RS0A 4TL9A 1PLJA 5DE3A 4MRRA 1XTIA 1UKZA 4OYHA 2RGEA 4TLAA 1LFDB 1OFIA 3M1IA 4IOLA 2F3TA 5TVKA 4KO8A 5EXPA 3TJZA 3GLFB 2ZREA 4HSEA 4LYFA 1YZTA 2Z5FA 4ESVA 1G21E 3B5JA 4HLDA 3SJAA 2E1RA 2F7SA 2IX3A 1AS3A 1F2TB 1A4RA 1CJTC 1R0XA 3CR8A 1U8YA 1XXHA 1XEFA 4TMZA 1KJWA 5BYKA 4XTCS 3KJGA 4S2EA 5DO9A 5L3RA 1U9IC 4A8JB 2JLYA 1WBBA 3U3OA 3TQFA 2W2XA 2VIIA 3K70B 5JI3E 4JSYA 4MYTA 4H1UA 2JGNA 2KBEA 2KB0A 2QTHA 3PUYA 1U8AA 2C2HA 1DBSA 2QT0A 4FCVA 1AK2A 1Q1QA 3EG5A 4C9BA 3DZDA 3RNLA 2OM2A 4MGZR 2DYKA 4TLDA 4PC1A 4AURA 1W48A 2ZANA 4CIDA 3KB1A 4HYYA 1SVIA 2QSZA 521PA 1JNYA 4GNKA 3THXA 3QI2A 2HXSA 5E95A 1P2UA 3CIOA 4QGGA 1VYVA 1ZU4A 3A4MA 5SZKB 5H8WA 1XZPA 2IWHA 1OSNA 3AVXA 3IGFA 1OFUX 1EGAA 4NYMR 3NEYA 3HU3A 2O0HA 3X1YA 3OIVA 2Y8EA 3PFIA 2ZS7A 3EPHA 4AYWA 4F4IA 5EP3A 3OE7D 4YQFA 4A92A 5DLQC 3I32A 3KXLA 3JVVA 1E1QD 5C46F 5J47A 1LS6A 3THWB 3BB4A 4DLTA 1J70A 3TUJC 2CVHA 3TSOA 3ADCA 4Q9KA 5B58C 1N0VC 3A1UA 1V5WA 2QMEA 3T1VA 2BDTA 2D06A 3PUZA 3SNHA 4EPYA 2ZR7A 5G40A 1FUKA 3QBVA 1XPOA 4W7SA 2D7DA 2ZRIA 4A82A 1P72A 4DIDA 3CH4B 3ONWA 4CT4B 3DMNA 3M0EA 1XPUA 3IILA 5DIFA 3CONA 1OIWA 5FBWB 4US2R 1ODFA 2QAGC 3QG5A 4E03A 2O8EB 1CR0A 3AKDA 1DOAA 4B34A 1Q3TA 2WWFA 4KBGA 4DCVA 2ZE7A 2GHIA 3GJ7A 5CLQA 1XEXB 2W0SA 1GDDA 2ZI4A 4F4CA 1KI6B 3GLIE 4Q18A 2OG2A 4JLDA 4MYHA 1H8HD 1N6IA 1OYYA 1KNQA 4PR0A 2OAP1 1E96A 2J0SA 2OSBA 3DM9B 2PLFA 1PZNA 1T8UA 2JIZD 3AVPA 3V4FA 2BWJA 3DMDA 3H1TA 2Z43A 3LW8A 2XXAB 1G3QA 4HAYA 1Z2AA 2VP5A 2CLDX 3EA5A 121PA 1N6RA 5LBIA 2DHRA 1N6NA 5FH9A 3TR0A 2J45A 3AVOA 5J4LA 2ONJA 1Z28A 2IYUA 4IJMA 4Q4LA 4WXRA 3LO5A 4JLOA 1US8A 4A2QA 1QHHA 5A4JA 4LGMA 2AFHE 5GADl 3ZLJA 3UMRA 1LVGA 4LOAA 3NWJA 3L82B 4I99A 3PUVA 2RGNA 2ZRMA 1E99A 2V1XA 2W6JA 4JT2A 4TMKA 1P60A 3VR4A 4OKSA 2ZETA 3EPKA 1T5LA 3SEAA 4LSGA 1N5LA 1E1RD 3IIJA 4HDCA 2B92A 2MSDB 1MO4A 4WZBE 1QHHB 4B3BA 4DHEA 2QA5A 3K0FB 3GQBA 4V0ME 4JIMA 1ZINA 1AQYA 3A58B 1Z0KA 1TX4B 1NJGA 2Q21A 1NKTA 1P7CA 1VHTA 4TYQA 4A8JC 1LNZA 1D2NA 1F2UA 1CF4A 2ECKA 1W47A 4EPXA 4JL6A 1GRNA 4QNMA 1X3SA 1GKUB 3GEIA 2TMKA 2WAXA 4US0R 2J7KA 2QGZA 4UNQA 2WSSA 3KB2A 4OQFA 1KI6A 5H1YA 2D74A 4RFSA 1S0UA 4ERNA 3WYAA 1MH1A 3FB4A 4A4DA 1TU4A 3PEUA 4URWR 3LH5A 4DZZA 1DAHA 3GFOA 1CRQA 2EYUA 2VF7A 4IXMA 5FUVA 2QROA 4I81A 2JLVA 5CJ2A 1S2MA 3CF2A 3OEED 1S8FA 5J4KA 4KODA 4ESHA 2QE7D 2V7QA 3BORA 2ERXA 1L4UA 2CNWA 3NBYC 3GP8A 4ASUA 4QG7A 3LAWA 1TTTA 4DT1B 2JLWA 2IHYA 4QGHA 2EVWX 2JJ2D 3IPYA 3LXXA 4A0FA 3MLEA 4C0AC 1Z6GA 3B82A 1JECA 1ETUA 1NRJB 4C0HA 3T1QA 4B73A 2AD5A 2G88A 3Q9LA 4L5BA 4OK6A 1E2EA 2FSGA 4NE2A 4NYJR 3AB3A 3OEHD 1FX0B 4B32A 1N5JA 4C7OA 2J41A 4UKDA 2ZJ2A 4Q03A 3CX7A 1FMJA 421PA 2GESA 1R4AA 3RS7A 1HT2E 3C16C 1VCNA 1D8TA 3BH6A 4Q9JA 4FWTA 3MWKA 4JJZA 3K09A 2FFBA 1XMSA 3X1XA 1NSFA 2GJKA 2ZSAA 1TEXA 1GITA 1FP6A 3WRXC 1ESNA 4LHYA 4Q7LA 3HU2A 1E9CA 5GJBA 3AVQA 1C1YA 4TLBA 4YMWA 3BIFA 1TPZA 4PPQA 4DBLC 2QP9X 1OV4A 1X1SA 3L8YA 2ZI9A 1NI3A 2VBCA 3AEZA 2CL7X 1YR8A 4FIDA 4MUAA 3OF5A 3SDZA 3KKQA 5FOVA 2XNDD 1WCV1 1G19A 4M2LA 4BPBA 2HCBA 3WMEA 1SKYE 2QMHA 4BLOA 1IXRC 2ZRLA 1G5RA 3T34A 5EUMA 1BMFA 1R8QA 5CDFE 1D2EA 2BHRA 3HDTA 4TTQA 3TH5A 2QG6A 4N0EA 2FA9A 4Z8XA 2YJTD 2XSZD 3AGQA 4PO1A 5AUOB 3AF4A 3GFPA 3WNBA 1YR9A 1XX6A 1VIAA 3TAHA 3NDPA 1Z0FA 3BC1A 4JVNA 621PA 3FOZA 1R5OA 3CX6A 3GPLA 2D3WA 3L8ZA 4M8NE 3CM0A 4DJTA 1HTWA 1UDXA 1G4UR 2ZS8A 5DGXA 4U5XA 4A0RA 4Q01A 5FPSA 2YKGA 4UQOA 1G8GA 4YLGA 5BYJA 4NCNA 2ORVA 3EX7C 3KJHA 3EZFA 4DC9A 3FHCB 2QRNA 3K53A 2OCAA 4PSAA 3RS4A 2NPIA 3FKQA 5JRZA 1OPXA 3CWZA 5GJCA 3K0SA 2BMEA 2X1VA 4RKEA 5L3QB 2JLXA 1G9XA 1T9HA 2FSFA 2ZVQX 1MRSA 2DB3A 3B7GA 3AUXA 721PA 5M04A 4Q4HB 1YZQA 1W36D 1S9DA 3TRFA 2ZUBA 3IBYA 1Q1ZA 3GLGB 4AKGA 1WDTA 2ZU0C 1NBME 3EWSA 4XSHA 4Q5IA 1K5GA 2BEJA 3U4QB 1DAEA 2EFGA 2JEOA 2V55B 3IQXA 2J0VA 2CLCX 2PZFA 4LY6A 4IEIA 1KAOA 4W5WA 4B6EA 1VIYA 2MSCB 3T35A 4QKQA 1W2GA 2Z4SA 5P21A 4DUGA 2QM8A 3SQXA 1DVRA 4PZLA 2WKPA 2GILA 4FCWA 3N5CA 4EPRA 2RGCA 2YVUA 1JQJC 3NIBA 4BFXA 1EFTA 3CKLA 3TW4A 1SZPA 4IDOA 3LLUA 2ZJBA 4CT5A 1XJ0A 2ZRGA 2RGBA 4BE7B 1EWRA 1OFHA 3E2IA 1W5TA 3TSZA 3QXSA 2IS1A 1GL6A 2W2TA 4G5GA 2YV5A 2VRWA 3ZVNA 1TQDA 1US8B 1SXJC 3KL4A 3W6NA 1C9KA 5KO2A 2GTPA 1FPMA 4AKHA 3VTKA 1WP9A 2JCSA 4EKDA 3MFYA 1G4AE 3ZVRA 5EXXA 4EJSB 2WWWA 4LHXA 2P5SA 4OI1A 4TQUS 4JJKA 3F0TA 3EW9A 4B3CA 1P9WA 2QU8A 4NONA 2WHXA 1KO7A 1GTVA 1OT3A 1N25A 2YC2C 1KO5A 3P32A 2VP2A 3QKSA 1G6HA 3T61A 4P31A 3OZXA 4OL0A 3SU8A 3I61A 1SVMA 3LLMA 1U9IA 3L0IB 4C2TA 3EXAA 1M6NA 5JCPA 1MO3A 4AD8A 4DB4A 4PC6A 3AGPA 3O47A 2ASEA 1W36C 2Q3MA 1W4RA 3I1FA 3X2SA 4BWYA 1QHYA 1M2OB 1IN4A 1DO2A 1QHGA 2CMKA 2OILA 3JZMA 4KSBA 1AZTA 3RHFA 3ZQ6A 1GVNB 2H16A 5G3YA 3SFZA 3P26A 1KJYA 4QBFA 2IUUA 2C99A 2H18A 2R8RA 1ZM4A 2OCYC 1RZ3A 3B1WA 2KI5A 3MD0A 4M1WA 3U3MA 2ANCA 4OK5A 1AM4D 5SZJA 1SQ5A 1TQ6A 1UBEA 1VG0B 3IHWA 4EPWA 1UBGA 2RHDA 3WNDA 2H8KA 1UM8A 3WP1B 1E0AA 2ODBA 4DLVA 1I4LD 4O2RA 4EPTA 4URYR 3Q3JB 2GXUA 5LD2C 2LCFA 1KNXA 1YQTA 5UKDA 2GBLC 5LDDC 1RVDA 1KHTA 1ZIPA 1UDWA 1N3BA 5CDFA 4Y0AA 4JLVA 3U3KA 2K5UA 4LJ5A 2GAAA 1UKEA 2VH5R 1E9DA 3R8FA 5FOXA 3V9PA 3A1TA 2RGGA 1G3RA 4WOPA 4DDUA 4HB4A 2ONKA 4JYBA 4HAXA 3TE6A 3MAAC 3CRQA 2GCPA 3WBJA 1E9AA 3U61B 1RYHA 1OW3B 3SOPA 1P9NA 4MRVA 1MOZA 1YVDA 2IYVA 3KKOA 1OE0A 4LUCA 2ZJ8A 1XTKA 1NN0A 2OCBA 1JJ7A 1DARA 1HT1E 4NTZA 1KMQA 4M22A 4B3XA 1B23P 1QDEA 2D2FA 5FBVB 2G77B 2C98A 3AH8A 3W6OA 1X8KA 2G1KA 3BK7A 4QGAA 1OIXA 3KQNA 4ARZB 1XB2A 2XTNA 1KKMA 5K8LA 2Q9AA 2A7QA 2IBMA 2UZ3A 4JBWA 1DO0A 2A78A 1S3SA 1CS4C 1E2JA 3OESA 1G64A 5BW8A 1J99A 1F2TA 1RFLA 2VA8A 3OFND 1JR6A 3HJNA 3GLGE 2RHMA 2F6RA 3CR7A 4XD7D 1ZVQA 3QJYA 2XZLA 2JLQA 2JJ1A 4URZR 5FOUA 1L7VC 4OHVA 4Z1MA 1EESA 1TEVA 2IYSA 3U6KA 2O8FA 1GIAA 1PJRA 1P3JA 5CIQA 4DLWA 3LDAA 4Z8YA 4PQYA 2Z4RA 3CRVA 1T0JB 4CYMA 1G7RA 3NHAA 1DPFA 2WJVA 3ASZA 4B6FA 2OBNA 3P4YA 3AKCA 2GK7A 4EJSA 3N2IA 4GMXA 5CM9C 3C4JA 1G7CA 5KSYA 3U2QA 3L0OA 1JXOA 3UG7A 4IRUB 3UK6A 2O52A 1FL9A 1G8YA 2X19A 1GILA 3W8RA 3NH9A 4PANA 2AX4A 4EQ6B 1CU1A 1AN0A 1C4OA 3G5UA 4JL8A 5DH9A 1H8EA 3K0FA 1TUIA 5C4MA 2D4HA 2NMVA 2IEYA 3PITA 3GLIA 1RRCA 1XD8A 4XSGA 1DG3A 2ZI6A 5JCZA 1GRRA 1AGRA 5IRCD 5KHOC 1DAGA 3TNFA 4OHYA 1Q44A 2H92A 4EIWA 5FR1A 3CNLA 3GFTA 3EZ9A 3EA0A 3EC1A 4X8MA 2HF8A 3EC2A 4MQBA 4DB2A 1A5TA 1MABA 2BJVA 2L0XA 4F4JA 3NBZC 4ZKDA 1E9FA 2IXGA 2BEKA 2O8DB 2JJ2A 5B2ZA 4I1VA 3GLGA 2A30A 4YMTA 5F9FA 1A7JA 4TSFD 3RS3A 1KI2A 4GOJA 2IYXA 1TQ4A 4P32A 4A2PA 4KU4A 2UVQA 3KXKA 2RAPA 4MUBA 1E2QA 4KBFA 4TZ0A 4PX9A 1G5PA 1WMSA 3V00A 2RCNA 1E2HA 3B60A 1UF9A 2C04A 4M1SA 5JWHA 3A6PC 2ZYVX 3QXHA 2GWHA 4Z51A 2OO7A 3BOSA 2FX3A 4CEJA 3R8CA 5L3QA 2AFIE 1MV5A 4B33A 1OH7A 3I92A 2WMNB 4HB3A 5G3ZA 1Z47A 3THOA 3CRRA 2ZTSA 4IOMA 4AYXA 4LPSA 3QIAA 2XAUA 1YU9A 3DOFA 3TW8B 5CK5A 3B1ZA 1MKYA 1OB2A 4HLUC 1E9SA 2A9KA 2WOOA 2VSXA 2X2EA 3QKRB 4IDNA 4LV5B 4R71A 4TTPA 2R6DA 4ARZA 1KMHA 2N42A 1ZM9A 2E9SA 2IF2A 3ADBA 3HPQA 2NG1A 1DE0A 2QAGB 4DSUA 1W5SA 2I4IA 4MRPA 3ZS9A 1PLLA 1X86B 2JJ8A 4Q7JB 2CNWD 5FUWA 4ZCMA 4DLUA 3TQCA 2GCNA 2CDNA 4PAQA 3NG1A 4RD0A 4XWKA 2ERYA 2R6AA 4E07A 1K6MA 2YWGA 2ZS9A 3R7WA 1MRNA 2AN9A 2OFWA 1XJQA 4CEIA 1L4YA 1XEWY 4LJAA 3U5ZB 1S3GA 1UEIA 2A3RA 1R10A 1E0SA 4KVGA 1MO5A 5EE9A 2JDID 1KI3A 3AUYA 1SKQA 4KCGA 4LHZA 2ORWA 4BFSA 3PEWA 2I1VB 1LF0A 4HLCA 4NCIA 4GL2A 1E2GA 3LQQA 4Q9HA 2ZJAA 2IWRA 3SBDA 1I2DA 5C2JB 1IN5A 2O0JA 1W44A 2C78A 1XTRA 2NZ8A 5IHPA 4B44A 4QHSA 5HPYB 2FWRA 1G41A 2V9PA 3DOEA 2C9YA 1G1MA 3MUFA 2GK6A 2F9MA 2OCPA 2RGNC 4X8HA 5AJVB 4GSYA 4B3DA 3GEEA 3GLHE 4QJ4A 5DHAA 2XJ9A 4MGYR 4FINA 2G1JA 4D81A 1E9EA 5DI3A 4ZKEA 3QSYA 5L8VA 2ZUCA 2PCJA 5JECA 3PIRA 1COWA 1VMAA 1G291 1HV8A 3LBHA 2BMFA 2WWGA 4J0QA 4OHWA 3CRW1 3DEFA 3GJ4A 1ZD8A 1EX6A 3QKRA 4TN1A 4IVQA 3R9IA 1H8ED 3AKYA 5EE3A 4RKFA 1Z0JA 4UNPA 4DWJA 3LW7A 1IQPA 2G0TA 2V54A 4DDVA 2VYFA 3JZAA 4OQLA 2OEPA 4FMCF 4RD1A 2MMCA 4NDZA 3ZVMA 2QTFA 5KYKA 1U99A 3I5XA 2HEIA 3KDSE 2CL0X 3VFDA 3ZIAA 1XEWX 1YKSA 3CWQA 3K8YA 3E5HA 3GJXC 3NXSA 3C8UA 2BC9A 1OXVA 3FFBA 4GI7A 3U7HB 1FNMA 2ZI3A 1QF9A 3HU1A 1G17A 2OESA 1KGDA 2QRZA 3LVRE 5HE8A 1XTQA 1ZIOA 5CM8B 2BCJQ 3Q7QA 3ETLA 4IFBA 4Q48A 5JFGA 2FGJA 4TZ6A 3OE7A 1AJEA 4Q66C 4OQXA 2JA1A 2V8OA 2NO7A 4JLBA 4BQSA 1M7BA 1SXJD 4EFNA 4QBIA 2BVNA 5EXTA 2YINC 3C14C 2FPMA 2XOKA 5FL7D 1PVOA 4NBSA 5EE0A 2CHQA 3DKVA 4GFDA 4KFRA 4GOKA 5CYOA 1KK0A 3GLHA 2IUSA 4G5OA 1OLOA 4TSFA 2A5JA 1SHZA 1Z6YA 1E2LA 2FN4A 2ZI7A 4O2LA 1W0JA 1VTKA 2J5XA 1JEEA 1XMVA 3RANA 3BH7A 4DKXA 2ZM5A 1GL7A 1LTQA 3DVLA 4TMTA 2E87A 3GMTA 3LQRA 4MKHA 1XCMA 4LYJA 4POAA 4IOJA 4C30A 4DUGD 1JI0A 4GT1A 1S96A 1KI8A 4AC9A 4OI0A 1VG8A 4Q1FA 4JVMA 2V7QD 4XTRA 1ONBA 2VHCA 1HQYE 2YC4C 4TQAA 4A0HA 2D7CA 1Q21A 2WJGA 2XOKD 4QJ3A 1BIFA 4EQ6A 1R7RA 2P67A 2FEOA 2I1QA 2GEDA 5FUYA 4OBEA 4X8OA 3U4QA 1LB1B 3O8RA 3WRYC 2GEVA 4PPFA 3PENA 2F3RA 3FHOA 1TMKA 3ZJYA 2QTVB 1CR2A 3EZ7A 5TARA 5DNYB 1UJ2A 3I72A 1L2TA 2XX3A 3D3QA 3LV8A 4A2WA 1KSGA 4QJ5A 1XU4A 5AJXA 3TGPA 1G3IA 1GWNA 4Z54A 3GJ6A 2H5EA 5CIWA 2DWOA 2F9LA 4UNSA 1W46A 1D9ZA 1JAHA 4OI2A 4AI6A 2QQEA 1T5IA 3PV0A 3U6BA 1KYIA 2WKQA 2J7PA 1ZD9A 3L2OB 3SHFA 2EFEB 2GZAA 3C15C 1YJ5A 4KSCA 3UWKA 1XRJA 4M1KA 5CK4A 1RRGA 1VKJA 3LVQE 4URXR 3QXXA 4G0NA 5FOWA 2HT1A 3B9PA 3F8TA 3L43A 1BO6A 3T06B 1P2TA 4KV9A 1UFQA 3M4YA 3AQ4A 4KFTA 5KU1A 4JBYA 2VL7A 4A6XA 4MITA 5ANRB 5G53C 5AUPB 4JLAA 3UMSA 2WWIA 3D8BA 1XMIA 2WPDD 2ZVPX 1HQCA 4G5QA 3THWA 3R9XA 4DEXA 3ZZTA 1T6NA 2CVFA 2HT6A 4BUJA 4M9SA 2AHOA 4BRWA 4ZCIA 2VHQA 4MA4A 4FMDF 1OH6A 2ZPTX 1KDRA 2ZRBA 4D80A 1VCMA 2JIZA 5DYIA 3K9NA 4XD7A 5FR2A 1Z06A 4NCHA 4LBWA 4XIGS 1OYWA 2KBFA 4QRHA 3B85A 1KDPA 1ZJ6A 3NBFA 4ON9A 4A1FA 3THYB 4Q21A 2H7VA 4Q19A 1OKKA 1ZYUA 2JASA 3AVVA 1JB1A 4HI0E 4HZUB 2ZRDA 4B2IA 1IXSB 1FX0A 2P6UA 2QPTA 3GJ3A 4IVRA 1TQ2A 3BFVA 4E22A 3FYHA 4E5UA 5KNCA 2WJYA 3QBTA 4ASUD 5DISB 4RFVA 1G8HA 3HPRA 5E4FA 1LY1A 3ZS8A 4LC0A 2BM1A 4JL5A 4UJ5A 5FTNA 2OLKA 2NOAA 3LFUA 1WRBA 3KQKA 1J7KA 4B3FX 4I1OA 5HZKA 2GXSA 3IIMA 5H70A 3EPLA 4RD4A 4JLPA 1GAJA 2J0UB 4QC2A 4G5SA 3T15A 2ATVA 3TK1A 3NTUA 4PPNA 3KKPA 3TAUA 4UXJA 4YC7A 1QG4A 4KHZA 1UPTA 3TBKA 1P2VA 2W00A 2WJHA 2SHKA 2WSSD 3K0CC 3M6AA 3SJCA 4JMPA 4II7A 4B75A 2WTUA 3RC3A 1NKSA 3SR0A 2ZR9A 4EAQA 2D62A 4AYTA 2CHGA 4IEEA 3BERA 3MMPA 1YZGA 2PMKA 2BCGY 2WVJA 2HJVA 1EK0A 5KOYA 1XFAA 3I8SA 3WYGA 4TYYA 3RABA 2OE2A 1K8RA 3U3JA 2AXNA 5KSPA 1A82A 4BGDA 5KPJA 2ZROA 1KI7A 1KZ7B 4LJ8A 3SI7A 3VR1A 4B48A 2YNMA 5AUQA 1VYUA 2Q3HA 4N3NA 2W0MA 2J0QA 2ZRHA 1ZM3A 3RWOA 1ZAKA 4EUNA 1U2RA 4M21A 2BBSA 1ZC3A 3HYTA 4V03A 2ZRJA 5KTYA 4QM7A 3BFKA 3Q5DA 4V0MA 4LJ6A 4JKIA 2P5TB 2NGRA 2EYQA 5FI0B 1CBUA 2HLDD 1GFIA 3VX3A 1FUUA 4UXIA 2F1RA 1KO1A 2J3EA 3ZH9B 3W8NA 3RAPR 5TY0A 2DPXA 2QSYA 3QXJA 4GZLA 4BZXA 4B3GA 3I5YA 3BWDD 3EIHA 4QM6A 3AVTA 2GVZC 4X8LA 2IS4A 1RC8A 2GXQA 2VSFA 4EJSC 4B2PA 3EWAA 3QE0A 1G8PA 1T3SA 4BEJA 5LB2A 5JJLA 2IC5A 4O25A 1E6CA 4Q4HA 1X8JA 3W6PA 3O8BA 1CJUC 3CNNA 5BWMA 2A2ZA 2PH1A 1YRAA 2RGAA 4S35A 1ZD1A 2O8FB 1M7HA 2FF7A 1N6LA 4C0LA 4LX0A 4KI0A 4ZV4A 3C7KA 3AKEA 3JVUA 1E2MA 2HUPA 1E0JA 4KAXA 4PSVA 4PZYA 5JRJA 3B2EA 3QQ5A 2H57A 3PVSA 4LRWA 2B7BA 4EDHA 5LPNA 1UKVY 3LBNA 4DDTA 4KFUA 1AKYA 2QZ4A 2QL6A 3A36A 5JWRA 4DCNA 3GJ0A 1P4SA 5FL7A 4JKYA 4HB0A 2R65A 1GNQA 4N1AA 3CLVA 1G6OA 3AP2A 1E4VA 2J9RA 3VU9A 4C0BA 3IKJA 4M9QA 3W5IA 5BN4A 4OK3A 4GZMA 4XVRA 5CYPA 1T0HB 4GRAA 4D0GA 5L3SA 3W34A 2W6IA 3LBIA 3ZZUA 4CF7A 2ZE5A 1S9HA 1N6KA 1TADA 1YZKA 3K9LA 3SHWA 1EFUA 2OBMA 1E94E 1GM5A 1SXJB 3ZIAD 4A15A 5F3WB 1OF1A 4M4SA 1RRFA 1VCOA 5J40A 3WHKA 3A1WA 4OQNA 1BYIA 3THXB 4DLZA 1OHHA 4LJ4A 2NO0A 2FSHA 3H0KA 4GPTA 1ZC4A 1NG9A 4C0JA 4YMVA 3DPUA 2QE7A 2GBLA 1BYUA 3VKHA 4LBVA 3QUSA 2ANBA 3P27A 3PJRA 2QM7A 3IIKA 2ZRCA 4RZ3A 2ODEA 4O3MA 2JLSA 1AQUA 1BMFD 3K0CA 4TMWA 2VHTA 3K1JA 5F2EA 4L9WA 1Z63A 3DHWC 4GMDA 4PC2A 3J81k 3OEHA 1IY2A 3I3SR 3GD7A 2Q0HA 3FFAA 4IDQA 4D4KA 1IXZA 2IYZA 1XJCA 1NG1A 4HUQA 5KNBA 4BLTA 3SQWA 3BJIC 3E70C 1W0JD 5JS7A 3ADKA 4C0SA 2Q6TA 4TQ9A 1UEJA 5FBRB 1JEDA 2AWOA 2FGKA 3A4NA 1KSJA 4R2IA 1JPJA 1GNRA 1D2MA 3CB4A 4MYCA 2IK8A 2FDCA 1FFHA 1NSTA 1ZRHA 4HUQB 2QN6A 3FPAA 1CULC 1IOZA 1FQKA 1JQLB 4NYIQ 3U7GA 2UZIR 2IA5A 4MKFA 3CF0A 2WIBA 3WP0A 2BBTA 2PJZA 4QBGB 1YZNA 4RFSB 1IAQA 3QKSB 5E7JA 3ND8A 4DXAA 2AL7A 1NBMA 3CPHA 3CNOA 3Q7PA 5TV2A 2ZJYA 3IPXA 2O0KA 4PHHA 5K8UA 5JWOA 5GJVC 1KIMA 4TT3A 1R0YA 3QG1A 4U00A 4LV8B 3EARA 3BGWA 3QENA 2W2VA 1W4BA 3KKMA 4Q02A 4RD2A 4NP6A 3FHTA 3FWYA 1WB9A 3GJ8A 3OHMA 4NPHA 1E79A 3S1AA 2W6JD 1XP8A 1ZNXA 3OAAD 5IF9A 2QY9A 3WY9A 1SVLA 2Q3FA 2XNSA 4CRWB 1CEEA 1KO8A 1N2CE 3BH0A 4NH0A 3QPUA 2CEAA 2OV2A 1HURA 2V3CC 3WXMA 5IK2A 2EU8A 3RS2A 3BXZA 2QAJA 1IONA 4ACAA 2Z6VA 1Q12A 2YZ2A 1Z07A 2DFKB 3U7FB 1ZCBA 4I1UA 4KLZA 2IYTA 4MDEA 4BLRA 4IOKA 3B1YA 1EWQA 3KQUA 2WJJA 3FE2A 3ZD6A 3AF2A 1KK3A 3B1VA 4PQFA 3UATA 1W36B 2Z83A 2IYWA 5JSZA 2YWFA 3UG6A 2WIAA 2QEQA 4LCBA 3EIQA 3KKNA 5DI9A 3Q85A 3VHXA 1H65A 3CX8A 2QMUA 1NNEA 4BFWA 4QHYA 3F5FA 1XD2B 1U8ZA 5EJEA 1OJLA 1UBCA 5FPKA 4D4JA 2A5GA 4JVLA 5FTJA 4ZDJA 4PAMA 1WQ1R 2G3YA 4BASA 4L9SA 3T12A 3MWYW 1DS6A 2R6FA 3C5CA 2KSQA 3B8HA 3K70D 2CL6X 4EFMA 4D6PA 3QEOA 2OUKA 3SFVA 2GF9A 1WBDA 2O8BB 2EFDB 2ZI5A 1SGWA 2P6RA 2B8TA 2GJAA 3NKVA 4NMMA 3AM1A 4Q1BA 1Z6TA 1OFTA 2HCJB 4CVNA 2XSZA 3H86A 2P2LA 3QY0A 4BZPA 5HZHA 2OHFA 1XD2A 5TDHA 3QXCA 1HEIA 2DY1A 1AKEA 2REOA 3OIUA 2CHVA 2W58A 1KSHA 2WOJA 5J4VA 1GG2A 4I1SA 2A5DA 1KY2A 2BKUA 2ZIAA 3FTQA 4F93B 2VP6A 5AJWA 1U94A 3MRSA 2G9NA 4E09A 2R9VA 2LKDA 2AD1A 2QENA 4CW7A 1Q1BA 3IUYA 4Y0VA 3UIEA 1II0A 4YDSA 3IO3A 1RJ9A 2F1HA 3PCRB 4KXFB 3UKDA 3ZQJA 3LNCA 4LYAA 1NY5A 2CXXA 1ZW6A 1LV7A 1JAIA 1IY1A 1RRPA 4AWXA 1E1QA 2ZRNA 4AKIA 2OZEA 2JATA 3MJRA 4D4MA 3HYRA 4F38A 3RS5A 5JEDA 3SJZA 3TKLA 5JHGB 4IDHA 3KTAA 3RYTC 4B47A 3BS4A 2GJSA 5CITA 4P3YA 3GLFE 1TF5A 3PXGA 4NYJQ 4HDOB 3VHLB 4KITB 4TL7A 1N5KA 5SZHB 2ZQ5A 5KNDA 4UXHA 3VR5A 1II8A 2D2EA 4JZKA 1CP2A 2AWNA 2C9OA 1G7TA 2XB4A 4MGIR 1OH8A 5A0FA 3CUEF 1V43A 5KDOA 3ND9A 4AY2A 1Z83A 1R8SA 5FBQB 1X8LA 3QOFA 1OXUA 1O3YA 8OHMA 4TYWA 3SYKA 1OKKD 1GP2A 3SZRA 4LJ9A 1QVAA 1W7AA 2IYYA 2EFHB 1Q0UA 2ATXA 2QI9C 3FMFA 3SS8A 2J0UA 4QBHA 3OIWA 3PG5A 2X77A 5IDVA 1E98A 1DADA 1HA3A 1Y63A 5HKKA 4DT1A 3RC8A 2DR3A 4A8JA 2PLRA 4Q9LA 4JBXA 4DLSA 3K70C 1XXHB 1BS1A 2IF0A 1BKDR 4RCYA 1E3MA 2HLDA 5CJPA 4JYCA 5FBLB 2XGJA 4GOXA 1PLKA 2A5YB 3B78A 4V0OA 3AP3A 2WPDA 3WMGA 4ZO4A 2IXFA 2B6HA 1ZM2A 5EQTA 1P75A 1N6OA 1Q1EA 2XTMA 4HZUA 1IJFA 3NH6A 2VHUA 5FTMA 2WICA 3EAQA 3K0AB 1UBFA 3FKSA 4UNRA 5JJIA 2CK3A 5EUQB 4IDPA 4DLRA 4MRNA 1Z22A 2IW3A 3ZYCA 1DELA 3CPJB 1G5TA 4KJZA 2FFHA 1CR1A 1NMXA 2QT1A 3TUZC 1YZLA 1CJKC 4ABYA 4M1TA 2HXYA 1F2UB 1SXJA 3HP1A 1T4GA 4JLNA 1J8YF 5DYGA 2VF8A 3K9HA 3MSXA 1SVWA 2P0EA 1I2MA 1GUAA 1E32A 5H68A 1KJZA 3A1SA 1TAGA 3BFXA 2KJQA 4HAVA 1VDZA 4MYUA 1R0WA 4NYIR 4DSNA 4XJXA 1IN7A 1KI9A 5K8IA 3AV0B 4CEIB 2DBYA 2CCKA 3VU9B 3HR8A 3SYLA 2ZSEA 2B21A 3QF4A 3GLIB 4HB2A 1EFRD 2HJGA 1AS0A 3REGA 4PZZA 1SVKA 2XZPA 4IW3B 1ZNZA 3RSOA 5JMTA 4LDJA 3VKGA 3Q5EA 4D82A 2PZEA 4TLEA 4A0GA 1ELOA 3AVWA 2GZDA 4HDQB 2VLIA 2QQ0A 3TVTA 3UXMA 1Z3IX 2Z0MA 4WXPA 4BFYA 2F1IA 1XMJA 2H1LA 5BQ5A 3UMFA 1M34E 2WM9B 4GBMA 2C03A 1LF5A 5JHHB 2ZSFA 5FI1B 3B13B 3BAFA 2ZRPA 4BFTA 1E4YA 4P4SB 5B30A 3MCAA 4U7DA 4CEJB 4WW0A 3CO5A 4AK9A 3VR2A 2CE2X 2ZSBA 3IEVA 2OT3B 4TL6A 4BECA 3DZ8A 4LJ7A 5JSZB 4JSTA 4TT3D 3NC1C 4LWZA 2VEDA 2QP4A 2RH5A 3IBGA 1KKLA 1E9RA 3CW2A 1J90A 1F60A 2GNOA 1XBTA 5FPHA 2G6BA 4LI0A 4LK2A 4QNRA 4C0QC 4Q4JB 3BD9A 2X2FA 2KE5A 1A2BA 1X6VA 4KYIB 4WIAA 5KSZA 4KLNA 2PJRA 2IHBA 3EZ2A 1AA9A 1GNPA 1Z08A 4Q7MB 2VP0A 4TLCA 2W83A 5JS8A 3MJHA 2YOGA 2IS2A 1GKIA 2ZAMA 4R7ZA 3QF4B 1QBKC 4OI4A 4PO8A 4IFEA 1Z2CA 1VHLA 4HZIA 3AVUA 5F98A 2PZGA 1GKYA 4JS0A 5JZVA 1Z8FA 2PT5A 3W3AA 3LX8A 1XNJA 2YYZA 2ZR0A 4JLKA 1P62B 3PUWA 3CPEA 2IYRA 1H8HA 1KO4A 1KZGB 4Q9IA 4BLSA 1UADA 1WA5A 3DL0A 2O8CB 2CCJA 3HWSA 5C4GB 3IQWA 3WNCA 3X1WA 4NL4H 1P6XA 4KVAA 3R9WA 4M0LA 4C7OB 3FKSD 1CIPA 1KK2A 2QUZA 1LW7A 3B9QA 3F3YA 1UKYA 2ZRFA 5EE5B 5GVRA 5B57C 2R6CA 1SVSA 4LZZA 2DFNA 1I4TD 1DAFA 2GCOA 3CH5A 2YOHA 1SKYB 3ADDA 2ZAOA 1NN1A 4LBZA 3AVYA 1G18A 3K0EA 1RW4A 1OIVA 4RZXA 1QZXA 4LYHA 2ZSDA 2JAQA 3KJEA 1G7SA 5FOTA 1QHXA 1E69A 3O8CA 5EE1A 2QGNA 5FPTA 1WXQA 5AJZA 2FFAA 4G1UC 1IJEA 4RD3A 2DWPA 2YOFA 3Q8XB 1A2KC 3KUCA 5E3HA 3A8TA 3KQLA 2ZRAA 5JBQA 5JI2E 3ZZ0A 5EZ5A 4B35A 1NVVQ 4ACBA 2FE4A 3FDIA 4FXPA 3G82C 1D6JA 5D3QA 4F7WA 3ASYA 3I73A 2F43B 3U60B 5DN6D 2P65A 4P4UA 3U3RA 4U02A 1KDOA 3B6EA 3KQHA 2FJUA 1JR3E 221PA 5FFMA 1NMZA 1R0ZA 2ODWA 3FMOB 3REFA 1N6PA 2B7CA 3CF6R 2C96A 2QPOA 1W4AA 1N0UA 2FOLA 2KWIA 1GL9B 4V0KA 4JLJA 3KTAB 2F55A 5CB8A 3T1TA 1R5NA 3C5HA 1Q20A 3E1SA 4XOIA 4R9UC 2QBYB 2YHSA 1U0HC 1EFHA 3AF0A 4MKGA 2R2AA 2IT1A 2XITA 3BE4A 3ZGXA 1PUIA 3EPJA 1Q3HA 3QPVA 5K8TA 1OHHD 2PT7A 2IYQA 3I4LA 5E7MA 4QXAA 4XWOA 2FPKA 3OFNA 2OLJA 4DSOA 3SC3A 2OFXA 2DFLA 1DEKA 1JXMA 3W9YA 1II9A 3HR7A 1KSFX 2ZITA 1XTJA 5IT5A 1NVUQ 1KMHB 4KYUA 2IL1A 4NCKA 1JJVA 4FMDB 6Q21A 1FTSA 2VHJA 5E7IA 4OHZA 4P33A 4PQRA 1ZNYA 2QORA 4YXWA 4BLQA 3RDPA 2VTKA 1CJMA 4B76A 4L4UA 1S4QA 1KAGA 1HE1C 1ZMXA 4IHQA 3BB1A 5FTKA 2GAOA 4ZPXA 3SE0A 5CB6A 2NO9A 4QFMA 2NIPA 2AK3A 1GSIA 4TYPA 3KUDA 4P4TA 1COWD 2OXRA 5ELXA 1YZUA 2IS6A 1I4DD 2GJ8A 2YWHA 4BRUA 2WJIA 1W49A 2J7PD 4IXNA 2CK3D 2V6IA 2O5VA 4DRZA 3LRPA 2O8BA 3AF3A 4D0NA 4FMBB 1HUQA 1SVOA 5BXQC 5JEEA 1NP6A 1NIPA 1EFCA 4OJKA 3T1OA 2PBRA 4Q00A 3RSLA 1OXTA 1KK1A 1XCPA 5DN6A 2WMOB 4G01B 2GEUA 2HDNB 2WKRA 2PX0A 2XB2A 2FMXA 3DDCA 1M7GA 1FNNA 1VG1A 3OEEA 4O0MA 1Z5ZA 2VQSA 2ZE8A 1NN5A 1ZNWA 3KFVA 5A5GA 1OB5A 4DSTA 1P73A 2JJ1D 5KDLA 3W90A 2FU5C 4TL8A 1QRAA 3QEJA 3CZPA 3P20A 2XJ4A 2JLZA 3I62A 3LD9A 1U81A 2PMDA 1ZUNB 1RE0A 3VQTA 1ANKA 2AXPA 4HLQB 2AKYA 1AGPA 2IUTA 3CRMA 2RGXA 3TUIC 4MDFA 4C4PA 2VO1A 4Q1CA 1S1MA 5BN5A 4PHGA 3EIEA 2R44A 2EW1A 2ZJOA 2NZJA 1RKBA 2DFTA 2ZYUX 4GDFA 3EZ6A 4JVSB 3WMFA 4RZUA 2F43A 1KI4A 3IDQA 4UJ3A 2WWXA 3D31A 2AKAB 1YR7A 1F3OA 4DIEA 1E0KA 1K5DA 4BFZA 1E79D 1DAKA 2JLRA 3VX4A 5TB5A 4W5JA 1XF9A 4V02A 4M9XA 1M8PA 4DLXA 4F91B 3PEVA 4L16A 3CBQA 1D9XA 1VG9B 2FH5B 1R2QA 4B2LA 2GDJA 1GOTA 3NVAA 1ZP6A 4PFSA 2GJ9A 3TMKA 1XZQA 2HYIC 2WSMA 2CJWB 4PPGA 3L0SA 2ZJZA 5C18A 2HF9A 4CEHB 1Z0DA 4ZI3A 3G0HA 1P61B 3VR6A 2NPFA 5HE9A 5IK2D 5TXGA 1KI1A 1NY6A 1ZBDA 5CLLA 2R62A 2X8AA 4RD6A 3GJ5A 1OXXK 2G0NA 1Q22A 4LV6A 1IN6A 3DO6A 1KY3A 2MMGA 2A5FA 3SYNA 3A4LA 1GZSA 3UWOA 4CEHA 1E2FA 2WWHA 3N2EA 2PCLA 3WYFA 1RPZA 1OXSC 2CJWA 1E2NA 1NMYA 1SULA 1XTSA 4ZDKA 3LA6A 4HATA 4I4LA 2EQBA 4FI3C 2OXCA 5B64A 2BMDA 1QHIA 3ECCA 4WZ6A 1SXJE 3QKTA 4MRSA 2REXB 2LWIA 1QG2A 3VR3A 1T91A 2CE7A 1KTVA 4LJYA 2AR7A 2YWEA 4M9ZA 1CKEA 3KX2A 4OQMA 4ZDWA 4CZ2A 4FW9A 4RVCA 1OH5A 3BBPA 4IKEA 2FZLA 2EFCB 4DCUA 3Q72A 2EWVA 3QKUA 4XH9B 3NEJA 4NCJA 3ICEA 3T5DA 4YMSA 5L3VA 2ZUDA 2J46A 3K09C 5KUTA 3VAAA 1O87A 4BLPA 4D4LA 4MH0R 4CGZA 2GVDC 1RIFA 2VP4A 3UANA 4BZQA 2H17A 1NVWQ 5AWFC 3R7WB 1G3MA 2J59A 3IEUA 2GA8A 4ITRC 4D2IA 2BOVA 4Q1DA 1XD9A 4P0TA 4URUR 1NBMD 4Q47A 4RJLA 4TMXA 3U7EB 5TMPA 5EP4A 1VYTA 1NVVR 821PA 2NO1A 3RRMA 1XXHE 5D3MA 1G3UA 1N6HA 3KXIA 2C9CA 4Q7KA 3W3ZB 1J2JA 5HCNA 3BB3A 4TMVA 5FL3A 4PTLA 1KOFA 4HLUA 4KFSA 4JLMA 4W5HA 5EP2A 5BN3A 3ZVLA 4L8GA 4PC7A 3PR1A 4LPKA 2ZEJA 4LBYA 5DSZA 3SN6A 1T3HA 2PEYA 1QHNA 2ZJ5A 2XXAA 4GP6A 1IN8A 4P4SA 1CJVC 5HCIA 1N0WA 3ICQB 3H2YA 1M1YE 2AK2A 1YR6A 5G41A 4K81B 4ZCLA 4L15A 2PX3A 4PXAA 2V1UA 1W1WA 1XEXA 1TF7A 4M53A 3NC0C 3W5JA 1U0LA 3H84A 4LC1A 4B74A 3PUXA 3MG9A 3LWNA 4K8OA 4XVQA 1E2DA 2OFOA 4M1MA 4EFLA 1R5BA 3C41J 2BBWA 1GRQA 1ZUIA 2FFQA 4ILEA 4RCZA 4LHVA 1AZSC 5EXSA 1NIJA 5FUXA 1TL7C 2XTZA 2JLUA 1FW6A 5DHFA 4WA7A 1F5NA 4FD2A 4D26A 4V0NA 4C0KA 2ZXUA 2MSEB 1Z0AA 1FMLA 1TNDA 1M74A 2EWWA 3N70A 4RZ2A 5J5CA 2XNDA 2GXAA 4AG5A 1EFRA 5SZIA 1E2KA 2GETA 2WBLC 4QGFA 1IY0A 3D7MA 1E9BA 3PQCA 3QF7A 1X1RA 5D3MB 1N5IA 2C8VA 4NYMQ 5EP1A 1EXMA 1W2HA 2VSOA 2RMKA 2W6ID 2V6JA
chains in the Genus database with same CATH superfamily
3ZDQA 1T8RA 1XYGA 2BIFA 5AK0A 5JPDA 1TMOA 2GPWA 3E0XA 2WYVA 4XB2A 3LPDA 4A6PA 1SUEA 4QHTA 2QW8A 4S0XA 2H1RA 4N6NA 3CWCA 4BFUA 4TZTA 1IN1A 4PC3A 5LD2B 3FMPB 1A9XB 2P3SA 1USWA 5JCOC 1HE3A 3K9GA 5LN1A 5K3SA 5C3UA 2CXTA 2G7ZA 3VPCA 4ND2A 1PV4A 2ZYHA 5AI9A 2BBOA 2E5FA 4PG6A 4XUGB 4AIIA 4I9NA 3RYFB 5EPOA 5EXEA 4D7AA 3FVVA 3I8XA 4NZYA 3EDYA 1DAMA 4MLDA 3D6MA 2V7WA 1AIPA 5FWXA 4M7OA 2VWHA 1VCIA 2BMJA 3QNUA 4K9OA 2G9QA 5LJLA 4JNCA 4HWPA 1ZMBA 1BOFA 5LA6A 3CJTA 3D5QA 1DEAA 1Y82A 2Q3EA 2XZOA 1BWQA 1RP1A 1Z8DA 3WHLA 3HV0A 1MT0A 4GLLA 3TAXA 1XVAA 2N46A 3LX6A 3VGPA 1CC1S 1JQ5A 3P0RA 2FLVA 3QE4A 3SR3A 2IHKA 3UJCA 2EBUA 2CLSA 3VVLA 3X1DA 4CFSA 2I2DA 3OCJA 4GHWA 1BD4A 2COUA 1ZCAA 2PO7A 2O8EA 1JBKA 3UMMA 4ZMRA 1Q7CA 3JWIA 2WAYA 3ZXYA 4TKVB 3RARA 3AI3A 4QPCA 2CBZA 4ZVVA 5J4HA 5TR9A 2C4NA 3MJTA 4FFWA 1Y3CE 2DCUA 4OGGA 2CCGA 3LZCA 3FPKA 4HEJA 2H4YA 2BJHA 2R00C 4FBGA 3GRUA 4AAYA 1E2IA 2B34A 1EG7A 1DI0A 4G07A 9LDTA 4AW9A 4KRYA 1IUPA 1IHDA 1XPRA 3TCNA 2H5JA 3AFHA 3C85A 3DTNA 2E48A 3FGNA 2QPAA 4BQNA 2GCOB 3RRNA 2UUBB 3I1JA 3QEMA 3OAAA 4IUBS 2C95A 2REBA 5DXJA 3VO2A 3PEYA 1P1KA 3FMIA 4IS3A 1NVXQ 2C4TA 2HCFA 3O2JA 1GR0A 2BFAA 3R23A 4LXUA 3D7KA 3NWEA 5E6SB 4WLNA 3NIDB 3P5BA 3SBXA 3JAMA 1QVRA 5BQOA 4KC0A 5HGXA 5I5EA 5HTKA 3V9AA 4EF6A 1G16A 1SRRA 3P0JA 3NASA 4MPPA 4U3JA 3VM6A 2WA2A 4O4HB 3LL4A 4GUDA 4MQFB 2LKCA 1ARZA 3H18A 4PLFA 5I7UA 1UANA 3ZTYA 3THYA 1V4NA 1P9LA 4MGKR 1A1VA 3TTYA 1IEXA 3DAGA 3TLXA 2AZMA 1DRVA 2VKQA 5FA8A 3RLFA 3L18A 1RJ9B 4LW8A 5EHNA 5JLJA 2O54A 1YI1A 3CZQA 1Z8HA 3DLTA 1HY3A 1U1CA 3ONFA 1UQTA 1K98A 3Q87B 4PG8A 5L3SB 1N3LA 2TYSB 4QASA 2I80A 5IZCA 4KQEA 3FTCA 2DERA 1HE8B 1LRLA 1NN3A 1KP9A 5HCUA 1BEEA 1HYQA 1FLAA 1EI9A 1FP4A 2WFZA 2IIBA 4QOFA 4XB6B 4P5PA 2JGRA 3DOCA 2OVBA 1IHPA 3TG8A 3IHLA 1EM8B 1BHSA 4OATA 4RVSA 2FG5A 4YWHA 2FP3A 5KPDA 3Q8LA 1FP7A 1P33A 3D6TB 3TR6A 4BFCA 2DUWA 3BRWD 3OPYB 4WFJA 3S2SA 3D5TA 5AK4A 4U5QA 1VXOA 3OHPA 1B0UA 2JGMA 3E6AA 3G2HA 1IUOA 1CIVA 1AV7A 1L8QA 2AE1A 4FTWA 4NX2A 1M1NA 3OJCA 2HF7A 3V1KA 5JC1A 2JIOA 1F4LA 3M70A 3W5CA 2H4XA 4XB1A 1FQJA 1KYYA 5IT5A 1U3GA 1USUA 4EY6A 3VR5H 3TZKA 4H7FA 2NTYC 2P6NA 2E4XA 3TEJA 3OF2A 3P2JA 3Q0IA 3WBBA 1JS1X 1CT9A 3CW8X 2AJBA 4B31A 2HMYB 3RIGA 4RKRA 2X6TA 5IAEA 4HXFB 2BW0A 2Q8QA 3VHQA 1K7SN 1QFYA 3NBXX 4OHXA 2HMSA 1ZHOA 1V8ZA 4I55B 3A37A 1N5DA 4M1OA 2ZAGA 4QTTB 3K9WA 4R98A 2ZYWX 1XE3A 2XEXA 1JPUA 1S89A 1C3JA 2GBIA 3U4CA 2QV7A 1DP4A 4JQCA 2VPPA 4AN1A 2I03A 3PPIA 1RM3A 1T36A 5BSMA 4HKTA 1QTIA 2NZYA 1XTZA 3CUSA 4RE5A 4H1VA 3RUAA 1RAIA 3DF7A 3U44B 1I7LA 3PRKE 5E9JA 1N2EA 1JKMA 1G20E 2IOYA 3BL8A 1NF8A 4G4JA 4GOOD 4ZIRB 4CXMA 1WBJB 4FMCB 3PX7A 1VDMA 1XZEA 2J5QA 3NJ8A 3ZGYA 3WGKA 1MABB 4F1WA 5JNSA 7ADHA 2Q1XA 3QVVA 5CG1A 3EPPA 3O4JA 4YCBA 4RX1A 1V8DA 4GH5A 4QOGA 3FPBA 4UUQA 5CEEA 3FFWA 4POOA 1S1CA 3ZWVA 3DTVA 4ENTA 4EAAA 1W0KA 4WVFA 1K92A 4G8BA 3NIGB 4KMRA 3X1MA 1MOPA 1Y9JA 3DQPA 1ZJJA 4AJNA 2FSSA 3P71T 4NNPA 1QZ3A 2A4KA 3EGDA 4G5RA 4ZIRA 1M0TA 2NU8B 2C9BA 1AK1A 3MWJA 3ELDA 5KNDD 1OZFA 1WXFA 5ALGA 2BJWA 4NJMA 3A1EA 4BO2A 5KNDH 2XV1A 1TU3A 2NN3C 4FN5A 4GUAA 4UE6A 2BGRA 3UH1A 4HUTA 4V0LA 1RKQA 1U0JA 3AF1A 3ER8A 1F6BA 2IXEA 3R5FA 4MARA 4XX1A 4BO8A 4ZGGA 1IIBA 3QVGB 4NVRA 5GY7A 1VHJA 3AR3A 3PQ4A 4TL9A 1PLJA 1GLNA 4MIKA 4YIKA 3V7UA 2D6FA 4EX6A 1XTIA 3DEHA 2VN8A 1PT8A 3H1GA 4OYHA 2GM5A 2J3QA 4ZCTA 4MINA 1DKOA 2QRVA 3JARA 4RYLA 1WVGA 1BN6A 1OFIA 1DZIA 2ODPA 2VEOA 3IAUA 2HMVA 4IOLA 2GZ2A 1STOA 1I51A 5EXPA 5JMWA 2O2DA 3ZVKA 4X7MA 4MEAA 3A0UA 4RGBA 4HMOA 4QOEA 3HXOA 3NKLA 2Z5FA 3N7AA 2E21A 1NJ8A 1G21E 3KQPA 3H9UA 3T7CA 1A9XA 1JLSA 4HLDA 5BR8B 1HOTA 3KJFA 3CLSC 3GXOA 1A4RA 2PRJA 3L6EA 3ZKWB 1K9VF 3CR8A 2GB4A 3HNPA 1CYEA 2HSEA 3UJ7A 3W4JA 3LS2A 1F8XA 2D59A 5L45A 1TM2A 3KJGA 3QUQA 4MEJA 5GONB 4GVLA 4Z5XA 2NUTB 3SF8A 4GYYA 3PUYA 4UC0A 2C2HA 3PVCA 3CISA 1FYFA 3NCTA 5FA6A 4CKWB 1AK2A 1FFXA 1OT5A 1ADFA 3IXLA 4G0YA 4O08A 3IDZA 4ARSA 4RA6A 4LIPD 1WP4A 3DFFA 2HA3A 3IKVA 1PEDA 2PR2A 3IOMA 3K4PA 2I2XB 4AURA 1W48A 2IEIA 4HYYA 2FCAA 2I6FA 4BQQA 4JCOA 5A3VA 5DIZA 1F8FA 3GC6A 2D00A 1IXKA 4GNKA 3HDGA 1N7GA 2HXSA 3WGZA 1ZSYA 4AM8A 5EMJA 4CLXA 3FYTA 4MV4A 2X42A 1VYVA 4QGGA 2VDJA 3KQWA 3KZCA 3WAJA 1W29A 2HFJA 4XJTA 5SZKB 1XZPA 3M5PA 5DLEA 3TOVA 4ABTA 3EQ7A 4RPLA 3AVXA 4Y6SA 1L4FA 4H60A 1XDGA 2AOTA 5JVDA 5JS6A 2O23A 1TLFA 5ITWA 2IDJA 3PQ6A 1KZ9A 2O1SA 1VP9A 1JQKA 1FSGA 1JSLA 4YP6A 3AHGA 4IP0A 4Y8VA 1S7CA 4P0QB 3JVVA 4HDMA 2ZATA 5J47A 4M36A 3SF0A 3DAOA 3PDWA 1P6UA 3URMA 2JH3A 3NBUA 3KYCA 4FUQA 3E3NA 3HA5A 4JUAA 3ZY5A 1L4GA 4IQ4A 2EGHA 1VZ2A 3SM9A 1W4ZA 8MHTA 1Z6QA 3T1VA 1B1CA 4EPYA 5LNK1 2ZR7A 1X77A 2BSQA 1FUKA 1GUBA 2ETXA 1QIMA 2PM8A 2YJZA 3QBVA 5HDQA 3O8NA 2H1HA 3ZHXA 5T4EA 4YV1A 3ISJA 3CH4B 5IULC 4IWYA 5JNLA 1J24A 3HCAA 3M0EA 4B7UA 4H17A 1XPUA 3T0IA 3CONA 3X3HA 3DULA 1OIWA 4PLVA 5FBWB 1ODFA 4N8SA 1XQ1A 3QG5A 1ZD2P 3AKDA 1R00A 2FMHA 3PVZA 2X86A 5KOJB 4M8LA 1DFGA 2YY7A 1Q3TA 4L3WA 6LDHA 4RWEA 1XEXB 4ZC8A 3A3NA 4BVEA 2AZDA 5I7SA 2H0AA 2ZAIA 4GDMA 4HBGA 2WSLA 5DBFA 5TJHA 4IH9A 4LZOA 3TI7A 1IM8A 1R6VA 1DHTA 1H8HD 1OYYA 4PR0A 2OAP1 3O1JC 3C97A 4MLCA 3AEQA 4A5OA 4XD2A 2PLFA 4X65B 2P2GA 2BWJA 4QU9A 4M8KA 3DMDA 2C3PA 2Z43A 2XXAB 1JQDA 4Y1GA 1Z2AA 2UZAA 3FAKA 2CLDX 1ZGZA 3GLTA 3WQRA 3EA5A 121PA 1N6RA 2GZMA 4HN9A 5K8VA 3OZFA 1M6WA 4X63A 4D25A 3TEMA 3AVOA 5LYJB 3MTQA 2ZZNA 1C9NA 3R6WA 4B80A 1Z28A 1DKMA 1Y80A 5JALA 2CWWA 3PDIB 5F1OA 3C3XA 4JLOA 2NX2A 1QHHA 3CLTC 1QFMA 1X1DA 1QYCA 2Y6UA 3L4KA 5GADl 3WLHA 1E77A 2C5HA 3UMRA 1LVGA 1QYRA 4LOAA 1ST3A 5GV8A 3CYFA 1POWA 3Q7EA 1E99A 5ECGC 4B1FA 2WQZA 2CNLA 2V1XA 1I3LA 3BYZA 4IYJA 4PFQA 1P60A 4MQ4A 4W1QA 3Q6NA 1RP7A 2CNDA 1XQ6A 1JSRA 1R8JA 2PPVA 2XVMA 1QCCA 4KWHA 3S1SA 2MSDB 4J0FA 3NNDA 3F6CA 4A0SA 3NHZA 2ZB7A 3EDCA 1KETA 1QFJA 3F49S 4AUKA 4DHEA 2W22A 3K0FB 1N2CA 5JXWA 3M2TA 4YO7A 4TUYA 3D2AA 3LQ4A 2Q21A 1MAWA 3PR2B 5AI6A 5DK6A 2NWQA 1P7CA 3K6KA 1VHTA 2HK6A 3E35A 3LP5A 2OZLB 4M0DA 4TYQA 1LNZA 2QRGA 5FJJA 3OQ6A 4MI1A 2ECKA 3TLAA 2J9YB 1M2NA 5DGHA 2K7FA 2RK6A 3EW7A 3H83A 4CV2A 3VC1A 1X3SA 1GKUB 1UDRA 2TMKA 2WAXA 4US0R 1QO7A 8AT1A 2QGZA 2WSSA 2I55A 2D74A 1NVDA 2B5WA 3W3AH 5KCMA 3WYAA 4CNQA 5MN5A 4G1FA 3FRJA 3E1KA 2AUMA 1MH1A 3JZIA 5ILGA 2RHHA 3FB4A 1DUSA 4NE7A 4M83A 3PEUA 4J4BA 4DYHA 1W52X 3GV0A 3AETA 1CRQA 2VF7A 4QE3A 2Q2QA 1NJ6A 1YULA 1USGA 2X58A 4ZHQA 2JLVA 1XRSB 5CJ2A 1S2MA 1Y4AE 3CZCA 2H7YA 3M9LA 4BDTA 4PRYA 4BMOB 1SAYA 2C5FA 3CPSA 4ESHA 2VT2A 2XOXA 2FKAA 3BCHA 3BORA 2IHUA 3R3JA 4ZT5A 3WK5A 4QUKA 5AK3A 1PE0A 1FYWA 2GK4A 3DQZA 1RQ2A 2EKQA 2Z8YM 1N2OA 1EBBA 5AJTA 4A0FA 3MLEA 4I1IA 1X14A 4C0AC 3B82A 3EWNA 1XU9A 2AJDA 3GFFA 1JECA 2J30A 1RWBA 1X7WA 3AG5A 4JXKA 3O7MA 4OK6A 4R2MA 4XA8A 4B73A 2FSGA 4G2NA 4NE2A 3SX0A 3AB3A 1GUFA 1YOVA 1ZITA 5F33A 1N5JA 1A8QA 1Y1RA 3PDCA 2QIOA 1ECGA 3DKKA 4AJ2A 2PWBA 4BS9A 4Y2SA 3T3OA 1Q6YA 3KBBA 4P53A 3CX7A 1DIBA 1RTTA 3EXHB 5JVDB 4M88A 4TX1A 3JZFA 3ZIDA 4DWVA 3HWRA 5AVTA 5L7TA 1WJGA 3BH6A 4W99A 2MDTA 3EBLA 3GY0A 4ENWA 5M7EA 3R1IA 1NQTA 3K09A 4U7JA 5CNIA 1CRWG 2JLBA 5JBNA 5KTSA 3X1XA 2GJKA 4L5YA 4YRKA 3CH6A 3FIJA 2ZSAA 1TEXA 4WD3A 5KAPA 3C3AA 3WRXC 1BKYA 3TMAA 1UBLS 3K30A 5GJBA 3Q2OA 3LUCA 1TPZA 3S8MA 3QX9A 4TRNA 5IEJA 4LDRA 2QYSA 2OCXA 2ZI9A 3H87A 4D8YA 4N47A 3GIWA 1J0CA 1GU7A 2CL7X 1YR8A 3E48A 3JQ7B 4HGRA 4FIDA 4GVPA 4CKWA 2YBEA 2RI0A 3OF5A 4GLFA 2BD0A 3KKQA 2XNDD 4ZCRA 4M1QA 2P0YA 4X0EA 3HN6A 4K28A 1LSUA 1E1NA 1UT8A 3P4UA 3OH8A 4ZVMA 2WAMA 3LK7A 4U2EA 2HCBA 2V8BA 3T9DA 1SKYE 3QVTA 4BLOA 3F47A 4F06A 1IXRC 4F60A 3ZK9A 1G5RA 3ER6A 5ERYA 2WIJA 1DIHA 3DSRA 3RYHA 1F17A 2OK7A 1D2EA 3DCIA 4WASA 1WXDA 2QG6A 1THGA 3HVUA 4GR9A 3RE1A 3TZEA 1Q7TA 1AHPA 4Z8XA 5E7QA 1E8NA 4M0CA 3AF4A 4FONA 1YR9A 1XX6A 2LNDA 3HSKA 3NDPA 3DT6A 4YP5A 5F4ZA 3MINA 621PA 5KCZA 4KNYA 1R5OA 3H05A 4IHJB 2AXEA 3NZEA 3HXTA 3MQFA 4BVGA 1EVQA 3RVJA 1H5UA 1NVBA 6GPBA 5CUQA 3ZWKA 2MINA 2YKGA 3KZXA 4J0KA 1G8GA 4YLGA 2XWPA 4PIPA 1JIIA 2D5BA 4D9MA 1W581 3EX7C 1B14A 3OOJA 3EZFA 3K53A 3EGVA 3RS4A 4AF8A 1GKLA 1LEHA 1Z7WA 2NPIA 3FKQA 5CVEA 4ZZIA 1OPXA 1PX0A 3VU1A 3CWZA 3IUQA 1UBOS 3U4AA 1YVPA 5C0OE 3AR2A 2JLXA 1IBKB 3GXBA 1G9XA 4ZOBA 3UYLA 2DB3A 1BAPA 1K8XB 2TECE 1WV0A 2AQIA 4HEHA 2JFZA 1X94A 4WDRA 4DV2B 5M04A 1YZQA 4AQ7A 1P4AA 2ZUBA 4K6KA 5ICCA 2JGJA 1MT3A 1VE7A 1WDTA 1XLTA 2ZU0C 4JKOA 5DM1A 5G2OA 5TQJA 4B4VA 4YV7A 1DBPA 1KERA 1QTNA 5E4TA 4ALJA 4DNQA 1DAEA 1NYLA 3IQXA 1K06A 1VLQA 1R0LA 2ZWIA 1UXJA 1L7AA 2B1QA 4HD8A 4MPTA 4ZTZB 1BNCA 1Z38A 2WZBA 1XL0A 4LY6A 5BRJA 5DDIP 1CZOA 1W2GA 5BRAA 5FKJA 3L1UA 3WAKA 4EHFA 4YRMA 4ZEMA 1PZXA 5EUCA 3C6MA 3H8JA 2PUGA 3VVCA 1LQUA 1D2AA 2WKPA 4A8HA 2GILA 3N5CA 3ULKA 3ESQA 1Z7EA 2PT6A 3ZY6A 4BFXA 3F71A 1EFTA 1Z26A 3OZBA 1DQSA 5GGXA 3AL2A 3ETHA 4XPIB 2FWMX 3FCXA 4RY8A 2D5IA 2CHEA 3KOXA 5F35A 2XCUA 4CT5A 2RGBA 3A32A 3GRVA 5EQDA 4E6EA 3I12A 3U62A 2AVDA 4BVFA 3WO1A 1RHRA 1YVEI 3R40A 4Q6WA 3TSZA 4ZCPA 1MV8A 3FYUA 3IPCA 3QXSA 4EMBA 2JIDA 3ZBUA 3WYEA 3L84A 1J00A 1GL6A 1R5JA 3WAGA 2DG2A 3VI3B 1PNQA 2YV5A 3U39A 3K4QA 4DMHA 1HGXA 2PU5A 5K3OA 1P0QA 1EH5A 4UASA 1YL6A 3GLRA 4MPDA 3CFYA 1M2EA 3EY9A 3QMPA 2JCSA 3IBSA 1IOVA 1EGQA 5AJUA 1SEVA 3MFYA 1JFLA 2ZTUA 5EXXA 2WWWA 2EX0A 6ADHA 1G2IA 2EXXA 3AFGA 4JJKA 4V39A 3I8OA 2QTAA 3ZD8A 4AICA 1FRNA 1YBMA 1A4IA 2AQ8A 4G0XA 2XHZA 1PTJC 4Y6RA 1TXGA 2QU8A 4C7KA 1UK9A 1GTVA 1OT3A 2YC2C 5BSRA 1KO5A 1U0NA 4EATA 1Z9BA 2EQ5A 3ZWOA 1FMFA 1DBVO 3T0GA 3NYRA 4P31A 3OZXA 3SU8A 1XLVA 2QN3A 3CGGA 1UBNA 5AOAA 4R4JA 4N65A 4HRAA 2Q62A 4MV9A 2D1TA 4KYTA 2IVFA 3R7LA 3R2JA 2DR2A 4QVIA 4RIIA 2QUBA 4ARVA 2PX4A 5IN5A 4DG9A 1DDGA 4DB4A 4PC6A 3AGPA 4FOLA 5DRTA 2V45A 1GDHA 1WSAA 3TNDA 3DEJA 4BWYA 4WKGA 2IHNA 2H4HA 4R83A 1Z2PX 2OILA 1QNFA 1BVRA 1WCIA 3RHFA 3GW8A 3BGVA 2ASVA 1AF7A 5IKPA 4KN9S 4QDTA 3G79A 4B3HA 1AXEA 3SFZA 1KJYA 4QBFA 2IUUA 2C99A 2H18A 2ENUA 3DF9A 2KI5A 2RC5A 2ANCA 4B79A 1AM4D 3T5AA 5KTRA 1SQ5A 3E7FA 1N3YA 3NHFA 4MWBA 2AEMA 4DNOA 4L6CA 4EPWA 2VJBA 2Z2XA 4NZMA 4DCCA 1XTVA 4OSPA 1PL0A 3FCOA 4LRYA 4MRMA 3WP1B 3EXHC 4LN1A 5BSGA 1E0AA 1TQHA 1AURA 5DGCA 2C4VA 5CH5A 5B37A 4LYYA 5EJMA 3ROPA 1CHNA 2LCFA 5HIIA 5UKDA 3OCUA 1C4KA 3Q3IA 5DASA 1KHTA 1RM0A 1C30B 1ZIPA 4M9RA 1MIHA 5E9QA 5CDFA 2ROQA 2K5UA 2Z09A 1J5PA 4LJ5A 1AX9A 2JAHA 2VHEA 1H85A 4UUBA 1JYSA 2AMJA 4ARAA 4ETMA 3R8FA 4R41A 2RGGA 1G3RA 1UZNA 1OI3A 3OMXA 1W30A 3FWKA 2C5AA 1NBWB 3CG4A 3COZA 1QIJA 4HAXA 3TE6A 3OQMA 1ZI6A 2JFQA 4J1NA 4ZN6A 4XWWA 1GGEA 3SXPA 5AD1A 5JFOA 4NOLA 1E5TA 3SOPA 1QVWA 3GEPA 2CWDA 2H5LA 1ZPDA 2C2ZA 4H3KB 2IYVA 4MRVA 4U0JA 5CD9A 5LL6P 3ORQA 2ZJ8A 3TSCA 3V5NA 3G2NA 1ULHA 2OCBA 1DARA 1EYZA 3HZRA 2B2CA 4M89A 4WJKB 3HJGA 3VU8A 1L7MA 4JB0A 2K4MA 1P1CA 2X0EA 1QDEA 2D2FA 3TPCA 4IJ5A 1Z6ZA 3RHSA 5HZGA 3CVVA 3TL2A 4ZARA 1Y4DE 2C98A 1LDMA 1D4AA 1EK6A 1UM9A 1IK6A 5NULA 2NT4A 4HZGA 5TE9A 3K6SA 2ONZA 4RIEA 4MW1A 4X64B 1OIXA 3KQNA 4ARZB 1XB2A 2XTNA 4M99A 4E7OA 5K8LA 2HEGA 1K6IA 5GOTA 1DPGA 4KR9A 2F62A 1CS4C 1USKA 3VSCA 1E2JA 4MMXB 4CIWA 3HY3A 1E20A 3B1FA 3I1YA 3BICA 3MMZA 2G08A 4E2FA 2F6RA 2NYAA 3C8ZA 4MAMA 3CR7A 2SKEA 4YRLA 1ZVKA 3C45A 1G59A 4ZJUA 3OEWA 4P84A 1EP9A 1P0PA 2JLQA 2A3NA 4K2AA 4OHVA 4HQ0A 2JK1A 1TEVA 2P2DA 4FKBA 3U6KA 1GIAA 3QVOA 1PHRA 5T41A 1XZMA 3KALA 3QFRA 4DLWA 1BCSA 4OHFA 4PQYA 1P2BA 1XSEA 3D4BA 3F6PA 3P7MA 4RGVA 1E7YA 1VE5A 3NHAA 2NU9A 3LQYA 2WJVA 3MT9A 3OZDA 4LNHA 2OBNA 1W59A 1XHFA 2BI4A 1T5DX 3N2IA 4GMXA 2Y3IA 2VYCA 4H16A 2KLBA 4P3XA 1ZVJA 3SM3A 5JO0A 3V8BA 3FUUA 5TJ9A 3PD7A 3RBZA 4IRUB 5JS2A 2O52A 3UK6A 2E89A 3ZE6A 4DQLA 1GILA 1NQWA 3N0RA 3LLCA 2LP4Y 3IURA 1C4OA 1CU1A 2M9MA 3A4YA 1BTOA 3CRNA 3QOXA 4JL8A 4L8FA 4Q24A 1DRWA 1H8EA 5AKYA 1TE2A 1GL3A 2D4HA 3DPSA 3AL0C 3PITA 2DQZA 1RRCA 1XD8A 4MUMA 4YK7A 1DTWB 2XUDA 2QAIA 4RORA 3U37A 2HRDA 5IUNC 3PI7A 5HF6A 2AFHB 3ZEIA 3GROA 1EFPA 3O9VA 3F1LA 2WYWA 1UZMA 3KEMA 3E81A 2H92A 8LDHA 4YUAA 2P4SA 2GN0A 3CNLA 4HO1X 4FGZA 3EA0A 4JA0A 3EC1A 2QYTA 4HPJB 4QPNA 1MABA 3DEIA 4F4JA 3NBZC 4DJDC 4ZYVA 1EEXB 2ODAA 4Z2YA 3QHPA 4Y1EA 2WWVD 5COBA 3J80A 1GTMA 1YOBA 1NZFA 1WL8A 5L53A 2QN8A 3BILA 1FDRA 3AR6A 3D6UA 2OMEA 3KOYA 4YMTA 3WLNA 5JUWA 1E3TA 1C14A 2G8LA 1SK8A 4YALA 1BQEA 3ANMA 1B6GA 4HQRA 3RS3A 4WBNB 1LSJA 1NXOA 2QWXA 3K2BA 1ND5A 4BQIA 4DCGA 3HB0A 3DP9A 4PX9A 3HNOA 2RCNA 3GX1A 5DHRA 4AQDA 3B60A 4Q3EA 3A6PC 4M1SA 4BVLA 1EHYA 1U4SA 4UAVA 1QGYA 3OKCA 3IJ5A 3AU9A 4MDHA 4G86A 1D2GA 1WZCA 5JCJA 1WZ2A 1M0EA 2WHQA 2DFDA 2AFIE 2W43A 3GJSA 3R9KA 3QVLA 1JH8A 1Y8RA 3A9CA 4WHMA 5JASA 4DABA 1USIA 5HJEA 5DYNA 5G3ZA 1I7DA 5CDSA 4BVJA 4EF5A 1VPVA 4U9UA 2PKQP 2FWNA 4MS3B 1I5EA 2BTOA 1RWXA 5I9BA 4EVQA 1YU9A 2SICE 2WYIA 3SVLA 2VQ3A 3TW8B 3B1ZA 3A25A 1MQ9A 1UWCA 1XDZA 2X2EA 4IDNA 4IIEA 4PG5A 1KMHA 1GFZA 1R4MA 1ZM9A 4LDPA 2IF2A 1RYMA 2EJBA 1VRVA 4UAUA 3WICA 1E7SA 3V33A 1GNSA 2WAOA 4CTNA 1L8OA 1V8PA 1UFRA 2FUG6 4PZ0A 3OX1A 5G1OA 3RJZA 3ZS9A 1NA5A 3CCCA 4LOLA 5EY5B 4E1VA 2GCNA 2G40A 2CDNA 4PAQA 4FVTA 4UUNA 4RD0A 2GN1A 2ERYA 1ULBA 1K6MA 2PGLA 3R7WA 5TGZA 3U4DA 5FYQA 1J9GA 2JFWA 2ZM5A 3WGQA 1E6UA 3QLVA 5BO5A 3LHIA 2JFNA 2J9FB 3NAMA 4LJAA 3DTTA 1S3GA 3ZXIA 4KVGA 2PH5A 1E0SA 5JCJD 3EMKA 4AF6A 3DVSX 1MO5A 3QTTA 5EE9A 3T99A 5EIBC 3AUYA 1SKQA 1WKVA 3D3JA 3QLJA 1PT9A 1IHOA 3FNFA 2WIDA 2IIPA 5HF8A 3WQSB 3PEWA 1CUSA 3U31A 4E30A 3UAYA 3ZNPA 4RTLA 1OWOA 4BQRA 1SUDA 4JB2A 3EQ6A 4NMXB 5LMUB 2OY0A 3GQVA 4HFNA 3TM5A 4BWFB 2JAWA 2IU6A 4L5IA 1XTRA 3GT4A 4B44A 5HPYB 3DOEA 2GPNA 3NM5A 3WDMA 4QFDA 3DW3X 3Q7TA 1CLEA 2AJ8A 1FSPA 2OM6A 2G9VA 4NAVA 5AJVB 2G4LA 2JH9A 3QEKA 2R6JA 3QZUA 4HDSA 4JX8A 4MW7A 4UUPA 3WDKA 1PKEA 4OKIA 4FEAA 4CF3A 5C52B 1PKXA 2M6RA 4D81A 4CQNA 5H80A 3SSAA 1M2VA 3CNQS 3QUTA 1JQEA 4ZKEA 1CQJB 2NU6B 3UUFA 4HNVA 5L8VA 2EDAA 2PCJA 3PIRA 3BMQB 2HPHA 3PL5A 5CFPA 4LVCA 5DM0A 4LJKA 5KJ6A 3UAVA 5J2TB 4OHWA 3CRW1 3DEFA 1KFCB 2ZXEA 4FHCA 4DLLA 3AOEA 1EX6A 2G67A 2P35A 4UDOA 5AVKA 1H8ED 3AKYA 5EE3A 1KZHA 4EVRA 4RKFA 3TW8A 3K92A 5EWMA 1IQPA 4N5HX 2G0TA 3L49A 5D1HA 1Q6ZA 3JZAA 4OQLA 2OEPA 4RD1A 2I9KA 2MMCA 1IEVA 3QELA 2QTFA 5EHZA 4RYDA 5F5NA 1RXUA 1YJCA 4OB7A 3TTUA 4LZJA 1KWKA 2HEIA 3M5DA 3QW2A 5ERXA 3ZIAA 5BP7A 2C20A 1GZDA 1PRYA 3CWQA 3H2KA 4PLCA 4V0QA 2LBPA 4ARUA 4DXDA 1IATA 5FIUA 1YDMA 2LZ0A 1KJ8A 3U7HB 2P3LA 5DGTA 2D54A 1SKMA 5KQLA 1QF9A 3OECA 3HU1A 4RVGA 1QK5A 1Z25A 1OGYA 1M75A 2LTAA 2QRZA 5AKGA 1ZIOA 3MTEA 3UV6A 4FJ1A 3NUZA 3YASA 5FV4A 3I53A 6NULA 5HKOA 4NMLA 5D1NA 1SCIA 2VJLA 1H3EA 4TZ6A 1S2GA 4YJFB 1VSTA 3D4LA 4OQXA 3RTCA 2JA1A 2V8OA 2NO7A 4BQSA 1QE0A 4EJFA 1Z82A 4O33A 5FCDA 1ISHA 3UKOA 2B7LA 1UH5A 4I50B 4ND8B 2HIAA 4AQYB 5EG5A 3NYQA 1DO8A 3G7UA 4KQ1A 5EE0A 3DKVA 1EFDN 4GOKA 4PM4A 2IUSA 1L7DA 1SCNE 2B4YA 3FXAA 1L5QA 3IA2A 3ANTA 1SHZA 3B9BA 4G5OA 4WK0B 1NTOA 5H4GA 4O2LA 1TA9A 2OV3A 3INYA 3VZDA 1NYRA 4ESOA 3AI1A 4QUBA 2IKQA 4PICA 3F5DA 4NFLA 1GADO 3RANA 3W9BA 1CUVA 4D92A 4DKXA 3LO8A 2E87A 3GMTA 4E11A 4EJ6A 4LRSB 4LYJA 4JLUA 5LA6F 2GEJA 3LP8A 5LU8A 1KI8A 2R60A 1MAUA 1J42A 1VG8A 4HQFA 4KRGA 4Q1FA 2WSYB 1TK2A 2YR0A 5FWYB 4DFDA 4OJNA 4TQAA 3C2QA 1Q21A 3ACBA 2ECOA 2CJPA 1N7JA 3NU1A 4EQ6A 2VTDA 1R7RA 4UMVA 3NI2A 3ZUGA 2Z5VA 1FS4A 1T5HX 3S4YA 3JATA 3WK6A 1XN4A 2W37A 5AO9A 1LB1B 4XR9A 3O8RA 3WRYC 5DWQA 3EGOA 3ZJYA 3PDIA 2QTVB 2HI0A 5DNUA 2H1WA 4N40A 4DNPA 3UXYA 1L2TA 2XX3A 5AM4A 4RLQA 3WIDA 3X2FA 3LV8A 4HQNA 4CFZA 2FPOA 1YFJA 4QJ5A 3ELBA 3HB7A 2IEGA 3TNLA 4B09A 3RSSA 3I1IA 4A6EA 1G3IA 4YJFA 3TGPA 1ID8A 5CFLA 3R09A 4N5NA 3I5MA 2XGSA 3F97A 2NO5A 3ND6A 4BMPB 4DAEA 3FN4A 1F8UA 1JWBB 5CDGA 2DWOA 3OBBA 4MS4B 2G7MC 1CX9B 1CUUA 1I7PA 1DOHA 3N8NA 4KO4S 3T38A 5A2QA 3C3EA 3T1YB 4QFCA 3OKFA 2PSEA 2WMYA 3DGFC 4IDAA 1FFGA 1KYIA 1ZD9A 3K20A 1SWVA 1YJ5A 2W5UA 2WUEA 1VHQA 3HDQA 2PGDA 1ZY2A 3LT5A 3QY9A 1EE1A 2ZJFA 3N6RA 1V1RB 3QXXA 5B1IA 4WI1A 2DPLA 2ORYA 2PSHA 5LYYA 4J91A 4OJTA 5JLAA 4PYIA 1K5HA 2HQBA 3TI9A 1CUGA 3L43A 3N6XA 3NFRA 5IABA 1EG2A 2WP0A 5AKIA 4UBNA 3KSRA 1JT9A 5AI8A 1CF2O 3AQ4A 3HKEA 4JBYA 4PTZA 3Q40A 3EDMA 3ZGNA 1JV2B 1RMQA 4GI1A 3GUZA 1U2EA 4KVZA 4L4RA 4BX3A 3UMSA 4N7MA 2RGRA 4J16A 4EFKA 4IIFA 1HDEA 3IEIA 4G1BA 3UICA 1IQRA 4DEXA 4I66A 2NVUA 1W5FA 2VDUE 2GPBA 4M9SA 4CE6A 4IIDA 4BRWA 2CT8A 3FUTA 1SQGA 2VAPA 3R3VA 3ZOZA 4ROSA 4IMPA 3KVVA 1SBHA 1A8HA 2B4RO 4RL4A 2HIHA 2EFJA 3M6UA 5JTTA 4X66B 3ZWXA 1E9VA 1WLSA 3OQIB 1YS4A 5FR2A 3ZBTA 4NCHA 1DINA 3KV3O 4PTYA 4XIGS 1OYWA 3JQDA 4QRHA 2YH2A 4LJSA 1ZJ6A 4DY4A 2FP4A 2OUIA 2VDMB 3E7DA 4QARA 1HLPA 2Y1DA 2RHTA 1ZYUA 1E5XA 2O2CA 4IS2A 4JASB 2BH2A 4UBKA 1QYVA 3LKZA 3W6UA 1U1IA 4HI0E 2FN9A 4HZUB 3SF8B 3SIPA 3AG6A 2GD1O 2QPTA 3DZBA 3H17A 3VYWA 3GJ3A 2PHZA 4L2IA 4H7JA 3V2IA 1ZOSA 1XMOB 2NZVG 1P74A 2J33A 3A10A 3A6EA 1RLMA 2WJZB 4WOBA 2NZXA 4RFVA 1IG0A 1SOWA 1ECFA 1J0BA 3HPRA 1ABFA 1WDMA 1CY2A 1ZK3A 3QH4A 4LC0A 4ERXA 1JDUA 2OGTA 4EUKA 2NOAA 3AO0B 5ALIA 5ECDA 1J7KA 2R8PA 3IAM1 3NUQA 4KIJA 1JHMA 3IIMA 2IRWA 1JZQA 3UA3A 4HTFB 1EJ2A 2ZFUA 3GZNA 3WGOA 3E22A 3C70A 3M7IA 4JLPA 1GAJA 1CUIA 3Q9UA 4G5SA 2HHLA 3IOBA 3NBMA 3RHTA 1LNSA 5ES3A 2I65A 3ZV3A 1JF8A 1ZBQA 2FR8A 1FLDA 4JX9A 3FDJA 3PICA 1U7XA 1X0VA 2OXEA 1DQZA 3ZCUA 4KHZA 3TBKA 1P2VA 5AK5A 2ZWMA 4Z86A 3NYIA 2Z8YA 3N39C 4II7A 2O5EA 3EJWA 1JG6A 3INGA 2WABA 3LT2A 1NKSA 3RC3A 4XLTA 2AYXA 1PSZA 1QWOA 2I4LA 2PGNA 3AJRA 5GZ6A 4KXNA 2Z8ZA 2C29D 2OSVA 1L5LA 2FJPA 2HHCA 3BERA 3MMPA 5CCBA 3ITKA 3O9ZA 3SEZA 1ZN7A 4GPBA 1GAWA 5KQSA 4PWZA 1VRWA 3RABA 4MPRA 5GZ1A 2I1LA 1PGPA 3BXGA 1CE8B 1K8RA 2VP3A 2VPQA 2WB4A 5IUKC 5J2UB 3FOEC 4MTLA 4DSZA 2WTAA 2WJ4A 5T57A 4HPWA 1EVIA 4NV0A 1W1UA 5BN5B 4D9BA 4BGDA 3B6JA 3OOWA 4YI3A 1NM5A 4MI6A 4MO2A 4D8UA 4K3VA 2Q3HA 1SIOA 3DCNA 1LU9A 3EFOB 1XTTA 4UZEA 2IV7A 1KOGA 3G17A 2PXCA 1AN9A 2XIJA 1TFUA 3KWMA 5BWLA 2REQB 1HE5A 1ZC3A 3ZQKA 4QM7A 2GUGA 4F9EA 4JT8A 2CUNA 4J0CA 4IGKA 3B2QA 4LX8A 1BXGB 4LJ6A 2XCIA 4W5RA 1KVQA 2NGRA 2QXYA 3R6TA 4Q9DA 3V1TC 2ARKA 1TYZA 2C4UA 2VSNA 3P2EA 5FI0B 3CUWA 2F8TA 5LMZA 5ARCA 1G21A