5AUQA

Crystal structure of atpase-type hypb in the nucleotide free state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
245
structure length
232
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLRKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
publication title Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb
source organism Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
total genus 71
structure length 232
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5auqA01
3SYNA 1RKBA 2FDCA 1P61B 1XTSA 4NZYA 2C03A 1DPFA 4A92A 1E2DA 1QHHA 3H1TA 2B7BA 2X8AA 5HE8A 2ANCA 4R71A 4AYWA 1ETUA 1G8FA 2BJWA 2QGNA 2FSFA 2V1UA 1G19A 3TLXA 1G5PA 3U3MA 4G5RA 2NG1A 1P62B 3O8DA 4UXIA 2UKDA 5FL7D 4NYMQ 5JRZA 1KK2A 2C04A 2ATVA 3BFKA 3GJ5A 4MKHA 1AQYA 4N1AA 4C4PA 3W9YA 3GLHB 1DE0A 3E70C 1E2JA 1MKYA 3KQUA 1ZM3A 3IUYA 2DR3A 1EFTA 1AZSC 1CR2A 3CR7A 4TQUS 3Q5DA 4OJQA 3K09C 4AD8A 3A8TA 4MH0R 2O0HA 2CDNA 1S9DA 1WF3A 1RC8A 4JVLA 2QT0A 1OXXK 2BBTA 4JMPA 3I1FA 1ZIOA 1Z0DA 2ZI5A 2ZYVX 5EJEA 5LD2B 1JXMA 1NVWQ 5KHOC 2BEJA 1TQ4A 5L3QA 2DWPA 2IYRA 3F5FA 4OQNA 3RRNA 4YQFA 2OG2A 3TGPA 4PSAA 4LBYA 4EFMA 1I4LD 2IXFA 1N6PA 1X3SA 2IUSA 3UPUA 4MRSA 4OHZA 2B21A 5LPNA 4ESVA 3EC1A 1TMKA 1SKYB 1ZIPA 1ZU4A 2IT1A 1JECA 5AWFC 4GZMA 1E0SA 5FUVA 3ZLJA 1KMQA 1E1QD 5EXSA 1HQYE 2OBNA 1BH2A 2FNAA 4YLGA 4BLTA 3TAUA 3GPLA 2V54A 4XTCS 2X77A 3SC3A 5F9FA 1UKVY 3SU8A 3K09A 2VQSA 1QHIA 2FMXA 2CK3A 2NTYC 5AR1A 5HZHA 3CZPA 4RVCA 4WXPA 4RJLA 1FX0B 1I4TD 3SN6A 3LV8A 2C9OA 4DLVA 1SVMA 4ZCLA 4M2LA 1GKIA 1XPUA 4LBVA 3NIBA 4UXHA 2WAYA 1Q3HA 3EIEA 5FTLA 4YONB 5CM8B 1G64A 5CYPA 2XJ9A 2XB2A 4BLRA 4F7WA 3AVVA 4M1WA 1ZP6A 1N0UA 1LTQA 2V7QD 2F43B 3K9LA 4OQLA 2OSBA 3C14C 5IK2A 2YWHA 3EZ7A 4Q7MB 2YKGA 2FPKA 1R5NA 3HDTA 3KUDA 2PMKA 1JR3E 3KFXA 4FCWA 1G3IA 2FPMA 2P3SA 3NH9A 1KAGA 1AA9A 3HR8A 5FI1B 2CJWA 3ZVMA 2UZ3A 3J81k 2XGJA 3LXXA 4U5XA 4V0MA 4EUNA 5JCZA 1T0JB 2O8EB 2NO0A 1XZPA 1N6NA 3MWKA 1Z63A 5JEDA 1TUIA 1EWQA 1UJ2A 1KAOA 2AL7A 4IDOA 2JLYA 2ZRPA 1ZNWA 2IHBA 2AFHE 4MGYR 3WMEA 4W5JA 1D9ZA 4C7OA 3F0TA 1G17A 1SVIA 5CM9C 1Z28A 3TK1A 1QRAA 2O5VA 2ZJAA 3DM9B 1NN0A 4NYIQ 4Q47A 3K53A 1CIPA 3NBZC 1WB9A 4Q7LA 4QG7A 1EXMA 3A1WA 2AXNA 1WDTA 1QBKC 1UBCA 4G5GA 2QI9C 2XXAA 2PJRA 2WJHA 2NO7A 4IFBA 1X1RA 5KTYA 1OH6A 2PLFA 3LWNA 3KKMA 4Q4HA 3PITA 1ZNYA 3B85A 4US2R 2OO7A 3QPVA 4P0TA 3GLHE 4QM7A 1SVLA 2ECKA 4PO8A 3SR0A 1U0JA 1GTVA 4WIAA 2QBYB 1A5TA 1TF2A 3AEZA 4BFVA 1QHSA 2IS6A 1G7CA 2FSIA 5IRCD 2OZEA 1P5ZB 3PUVA 2OBLA 1RVDA 4URUR 5A0FA 1GRQA 4LZZA 5L3RA 2D3WA 2Z0MA 4MYUA 2JDIA 4JL8A 1RZ3A 4ZO4A 3K0AA 2FZ4A 3OEHA 4PPGA 3R7WA 1UBFA 3A1SA 4FIDA 2HF8A 4NKRA 2CVHA 4IXNA 4C0HA 2F1RA 3Q72A 2LKDA 4QNMA 2PCLA 2UVQA 3EZFA 1KIMA 3IGFA 2ZETA 1Q12A 1N6LA 1OXUA 4KFSA 1SKYE 5AJWA 1ZRHA 1N6OA 1H65A 1U99A 4P4SA 3RWOA 5K8TA 5JEEA 5BN4A 3FTQA 2RGDA 1UDXA 2PLRA 1XB2A 4JLBA 4ERNA 2O8CA 3QF7A 4BFTA 1ZUHA 4AC9A 2QORA 4WBSA 1KO5A 1W36C 4B74A 1AK2A 4Q1DA 4B6EA 2VTKA 2OESA 3QE0A 2R6FA 4HAZA 3IIMA 1GSIA 2ZYTX 1U9IC 2ZRDA 1P2UA 2QE7D 4L9SA 2FU5C 1AS0A 1EFHA 4NE2A 3EWAA 3FHOA 1EG7A 4BLQA 2JLXA 2C98A 3U4QA 1I2DA 2WWFA 3PVSA 4ZIRA 1G8GA 1NG1A 5HE9A 2O8BB 1TQDA 1W5SA 2NQ2C 3B8HA 3U3KA 2ODWA 4DDUA 4UKDA 3O8CA 5DE3A 1R0WA 4JLAA 4OQMA 1E2FA 1I4DD 1KJYA 2QPOA 1MV5A 3UIEA 3HWSA 4EJSB 1QG4A 3W90A 3BAFA 3DHWC 4DVGA 1XJ0A 4URZR 3RVBA 4Z1MD 4WVFA 4URXR 4MGIR 1KI2A 2QENA 1ZM9A 4XVQA 5DGXA 1IXRC 3QI2A 4OHVA 1PLLA 3CONA 3WNCA 4ZCMA 1D2NA 1KI7A 2GJKA 3PENA 3I5YA 3QXCA 2KE5A 3W3ZB 2ZSBA 5CJPA 1P2SA 2YWGA 4MITA 3U3JA 3LAWA 2V6IA 2HCBA 2O0JA 5BYKA 2ZI9A 2AD5A 4CRWB 3P27A 4DXAA 4BZPA 1JB1A 4G5OA 2XEXA 2WSMA 4R9UC 1JALA 4DLXA 2CL7X 3HU1A 2GESA 3N2IA 3ZVNA 1U9IA 1EX7A 1R0XA 4UNRA 3WHKA 2W6IA 3FKSD 1X1SA 2E1RA 4UJ3A 2PZEA 4Z51A 2D74A 3RS2A 2N1BA 3W8RA 2GAOA 1OH5A 2PJZA 1KSHA 3HPRA 4CF7A 1DG3A 2C8VA 4LI0A 1KKLA 1TQ2A 4V0OA 5E7JA 5EP3A 4GRAA 1SVOA 4PFSA 4J0QA 5HKKD 2F9MA 4C2UA 5JJLA 4KVAA 5FTKA 5DHFA 4PSKA 3GJ4A 4GT1A 4PC1A 5A5GA 1P2TA 1PV4A 4NCKA 4DT1B 5CDFE 1E0AA 1GRRA 2ZS9A 2G88A 1NN3A 1LV7A 1Q0UA 1W5TA 3BFVA 1TEXA 1WA5A 4V0NA 3U7FB 1WQ1R 2RGBA 2WSSA 3ZGXA 4JZKA 2F55A 2C9CA 3SBDA 1DO0A 3TH5A 4Q5IA 2GJSA 1XEWY 3U44B 2OCPA 2JCSA 3WNDA 1P6XA 2W00A 5J4LA 2EFGA 4Q9LA 4K46A 3P4YA 4I1OA 3T35A 3EX7C 3Q85A 1H8ED 4PTLA 4TMWA 2WPDA 3FYHA 2DFKB 4A1FA 4C0LA 2IEZA 2ZJ2A 3EIHA 1W0JD 2IXEA 4BGDA 2GETA 1GNQA 1IJFA 4JBWA 3E2IA 4Q48A 2QMEA 3G82C 1YU9A 3K0CC 1A7JA 2H92A 3RC3A 2GF0A 4HEJA 5B2ZA 1SGWA 4ESHA 3LA6A 1HE8B 2FGJA 1VIYA 3EZ2A 1IN8A 3KXIA 2KWIA 1IAQA 2ORWA 3CB4A 4PR0A 4A4DA 1CJKC 5AJXA 4KFUA 4P3YA 1X8JA 2MSEB 1IM2A 4YMSA 4YMTA 2RAPA 1Z6GA 3Q5EA 4QJ5A 1J7KA 2P6UA 1NVUQ 3QSYA 3TJZA 4C0JA 3TQFA 3ZH9B 3ASYA 3K9GA 2GVDC 3UKDA 4DLYA 3GJ8A 2V8OA 5KPJA 1ESNA 4LJ9A 2CL0X 5JSZB 4Q19A 2ZJ8A 2CEAA 4KYUA 1S8FA 3R8FA 2HJGA 3U5ZB 4EQ6A 5DN6A 5FBVB 5FH9A 1EK0A 4I81A 1P9NA 3KJIA 4NH0A 1X86B 2QGZA 3ZZTA 1UBGA 1DAHA 4DIDA 3AH8A 4EDHA 5L3SB 2R6CA 3VR5A 4HDCA 3M4YA 2WZQA 2XOKD 2ZUBA 4H9GA 3K0CA 3SJBA 4GOXA 1XD2B 5E7IA 1OIXA 4RZXA 3AKYA 3SHWA 1U0LA 4JSYA 5J40A 4DEYA 3QKSA 2KI5A 5J4YA 3R20A 3GEHA 4IVPA 3C5HA 1OE0A 1R5OA 2G9NA 1AGRA 4MA4A 2J45A 2MMCA 3U7EB 4LCBA 4JVNA 3IEVA 2GJ8A 4M1KA 1UDWA 3TUJC 1TTTA 2OLJA 2FV8A 1T3LA 2X19A 3OE7D 4MDFA 3FE2A 4OYHA 4KLZA 1KDOA 2LKCA 2JLQA 1E2HA 1Z0AA 1NBMD 3GLIB 2ZRHA 2JJ2D 2YC4C 2IXGA 3PIRA 2ZQ5A 5AJZA 5D3MA 4AURA 2CNWD 1CR4A 3OAAD 4RSGA 2R2AA 2RGAA 1FW6A 2QP3A 3X1ZA 1YVDA 1CR0A 1H8HD 4QGFA 4TMZA 3LQRA 4GZLA 3UG7A 2L0XA 2ZYUX 1KSFX 4YMWA 4TL7A 4XVUA 2I1QA 1R8QA 4IOKA 3TAHA 5IHPA 2H7VA 3AP3A 421PA 2FSGA 5JJIA 1D5CA 1M7GA 4RZ3A 3LBNA 3GP8A 2HF9A 3IEUA 2X2EA 4UNNA 4G0NA 1MABA 2ODBA 2Q9CA 3QXJA 2OXRA 4Q00A 3TRFA 4JLPA 1T5LA 1WXQA 4IEIA 1QVAA 2G0NA 1DAGA 1E2GA 1T91A 2OCBA 3VR4A 4QM6A 4R98A 4BFWA 2ZRBA 4A2QA 1ZUNB 4LJ5A 4TMKA 1U98A 5JI2E 1LW7A 2FFQA 4RCZA 1Z07A 3THYB 1US8B 1Z6TA 4FWIB 3L8YA 1ZAKA 3I3SR 1W4CA 3I4LA 1M2OB 4AI6A 4GDFA 2QQ0A 1U8YA 4LDJA 1G8PA 3GFPA 2BEKA 1PUJA 2HJVA 3UMSA 1XMSA 1FP6A 2ZE7A 2IYYA 3BS4A 3EWSA 2WJYA 3T5DA 4FD2A 2HV8A 5FTJA 1AN0A 1AGPA 3NKVA 3B2EA 2A7QA 4GOJA 4GPTA 3RRMA 1IN6A 1YZGA 5FOTA 3B6EA 3BBPA 5JI3E 5LDDC 2AD1A 1G20E 3NHBA 4PHHA 2HXSA 4M4SA 1N2CE 3DL0A 1ZD9A 4DCUA 4CEJB 1GM5A 4KV9A 2NO6A 3X1XA 5TY0A 1G3RA 3A6PC 3B78A 3S1AB 1BS1A 3AV0B 2W2TA 4GNKA 2YWEA 1SXJE 1XZQA 3BRWD 4BLSA 1E1RD 2PCJA 4U02A 3DM5A 1A2BA 1CKEA 4R2IA 2B6HA 2V9PA 3EC2A 1E69A 2BMFA 4PQFA 3BB3A 2YWFA 3LY5A 5CIQA 3TMKA 1NVVQ 1Z06A 2GHIA 2FFBA 3LX8A 1A1VA 3SFVA 1AIPA 3WMFA 4PAMA 4BLOA 3VKGA 2OAQ1 2VP5A 4X8HA 1S0UA 1O3YA 3SZRA 5TDHA 1D2EA 2J59A 1N3BA 2DCUA 2J0SA 1FOEB 3UXMA 3CW2A 4S35A 3O47A 5DHAA 3SI7A 4B34A 4DKXA 4JLNA 2Q3FA 1A82A 4TLDA 1CS4C 2ZROA 2FWRA 4G5QA 4KXFB 4CVNA 2ZRKA 1AJEA 3BE4A 2Q6TA 1GITA 1CRPA 2AKAB 5JWHA 1P72A 4HDOB 1OYYA 2QAGB 4WZAE 3ONWA 5FR2A 5A4JA 1X8KA 2H8KA 5L3VA 2KJQA 3OFNA 1DEKA 4B43A 1HYQA 4OHWA 4TT3D 3MGCA 5DSZA 3UWKA 2D2EA 2YJTD 1KY2A 3B1XA 2B7CA 3RANA 1O87A 1KGDA 2CL6X 3NC0C 2QL6A 5LB2A 2C9YA 3EASA 3OF5A 3AUXA 4LC0A 4TTQA 2TMKA 4JSTA 4B3DA 3TIFA 1IHUA 2WTUA 1B23P 4P32A 3QKTA 1CU1A 3SYKA 1P73A 3UK6A 2YOFA 3P4XA 4XD7A 1DADA 1F2TB 2IF2A 2A78A 1ZNXA 3BERA 2JJ1D 2XZLA 4OQFA 4HZUA 1NBME 3PUZA 1G5TA 1K8RA 5SZIA 5JZVA 2C2HA 2DHRA 2RMKA 3PQCA 1E96A 5AJVB 1JQJC 3NH6A 3W34A 4QNRA 1DAKA 1KI9A 4LYAA 4NTZA 4OKSA 1KZGB 1L4YA 2GAAA 5EZ6B 3SS8A 5KSPA 3ZS9A 2BMDA 4EKDA 2WKQA 1E9DA 2QT1A 4TLEA 1DAIA 3FMOB 4ASUD 4DUGA 5C2JB 2BM0A 5FOUA 4ON9A 3IILA 3GLGA 1GL6A 1YRAA 1W4BA 2HLDD 3TNFA 1LS1A 4I1SA 1YR6A 4IDNA 2BCJQ 3PUYA 4YXWA 3Q9LA 4DLZA 3X1DA 4I1VA 2IUTA 1J8MF 2PT7A 1OKKA 4RZUA 1Z6AA 4TWZA 4QOSA 2F3RA 2ONKA 2XNSA 4TQ9A 4LHVA 4H1VA 2QRZA 2GK6A 2Q3MA 3DVLA 1GWNA 3C15C 3K70C 2JLVA 5FFMA 5C1BA 1NSFA 2ZSDA 1BO6A 2V55B 4D0NA 4CEIA 1I2MA 4A0GA 2ZJZA 3T1VA 3MUFA 5DI3B 4MYHA 4Z8XA 3CZQA 3RSOA 3MWJA 1PJRA 3GLFB 3ADKA 3TBKA 1BKDR 4QBHA 3CWQA 3U3OA 3AVPA 1Z0KA 3MRSA 4Q4AB 4F92B 4IRUB 3VNUA 4QBIA 4QXAA 1CJVC 4QRHA 5CK4A 1BMFA 3LD9A 4N0EA 3WRXC 2FE4A 3RC8A 2PH1A 4UNPA 1KMHA 2AX4A 4O2LA 4Z8YA 1OH8A 1A2KC 1FNNA 3CUEF 3QY0A 2HYIC 3PEYA 3N70A 2BOVA 3QXSA 4HATA 5EZ5A 5FUXA 3LH5A 4D26A 5G40A 5JCPA 1R0ZA 1NY5A 4BEJA 3X1WA 1G3QA 2ASEA 2JLZA 4LK2A 5JBQA 3JVUA 2FH5B 4R2HA 4A82A 1RFLA 2BWJA 4II7A 1AS3A 1D8TA 1E79A 2Z5FA 5IF9A 4ZDWA 4PQYA 3BD9A 1XTIA 2FEMA 4LSGA 4GBMA 5AJYA 5GJWC 4WOPA 2XB4A 4PPQA 2P5TB 1G8HA 2J7PD 3QG1A 2FJUA 4HLCA 3AM1A 4BFUA 1OSNA 1COWA 4Q66C 5BYJA 3ZQ6A 4CGZA 1NLYA 2ERYA 1G7RA 5KDDA 1T5IA 5KSOA 2W2VA 2W2XA 2GCOB 3CX8A 4B2IA 1XEFA 2EQBA 2ZREA 1G6OA 3JZAA 4CEHA 4E22A 3GJXC 4V03A 1E9SA 2PEYA 5E3HA 3FKQA 4XVRA 4D82A 1T8UA 2E87A 4ARZA 2IBMA 5DO9A 2ZVQX 4D4MA 1S2MA 3TW4A 1WP9A 5TV2A 3THXB 1JJ7A 4O3MA 2IHYA 1UPTA 3GQBA 2J5XA 1RRGA 4ZDIA 4F93B 4C0KA 4LV8B 3HPQA 3DEFA 1IY1A 1TEVA 1VYVA 4HAUA 4L15A 2JLSA 2XNDD 4MRNA 3RRZA 1L8QA 3BC1A 5BXQC 4B73A 2ZS7A 2YC2C 1ODFA 3TE6A 4A2PA 1X6VA 4A0RA 5JLJA 1E9BA 1JEDA 1UBEA 1UEIA 3Q7QA 3QF4A 4NL4H 4A0FA 4URWR 2O8DB 4OQXA 1Z0IA 2H57A 3KX2A 3CO5A 5JJKA 4GP6A 1CXZA 1KI4A 1YE8A 4IOMA 2QZ4A 2OCAA 4PC7A 3L0IB 2QSZA 2GTPA 3K0FA 3V00A 4DCVA 4DLWA 1IN7A 1MRNA 3MFYA 2I1VB 1TUEA 2PZFA 5HZKA 1KO7A 3ADDA 2ZJ5A 4P4UA 4UQOA 2C78A 4TLBA 3VTKA 4C0SA 3O8BA 1JBKA 3NDBB 1IJEA 1X8LA 2ZRFA 4Q01A 5DIFA 3DZ8A 3KQNA 3VKHA 2BIFA 2OV2A 4TLCA 3VR3A 4KVGA 3M1IA 4XOIA 4XSGA 3ZIAD 3ZD7A 1HH4A 1FP7A 2AWNA 3PEWA 2FN4A 1Z22A 2ODEA 3KXLA 1XEXA 1VG0B 3CPJB 2RGEA 4Q9HA 4US0R 4IOLA 3GLFE 1H8EA 1CJUC 5C4GB 1Z5ZA 4OK3A 5CB8A 1E3MA 5HTKA 2P65A 1Q1QA 4CW7A 4MQBA 4ZPXA 1N25A 5BWMA 3H84A 3IO5A 3U2QA 4LBZA 2BBOA 1DS6A 4B76A 2P6RA 3SBEA 4CIDA 3CRW1 2ZRJA 3BFXA 4DLUA 2WKRA 1FMLA 4Q4JB 1YHNA 4B3FX 1GP2A 1U90A 3OEED 3I5XA 4B48A 2ZI4A 3I92A 1OLOA 4D81A 1VCMA 2ANBA 3WRYC 3OIYA 2REXB 1J90A 2P6NA 4LJYA 2XSZD 2GXQA 1KDRA 1FTSA 1OXVA 1XXHA 1Z47A 2IUUA 3THWB 1XPRA 2CHQA 2WICA 3QBTA 4N3NA 2W58A 4DLSA 1IQPA 4OJKA 3EPHA 1CF4A 2QP4A 4JLDA 2GVZC 2H1LA 1YZKA 2B92A 2FFHA 3QKRB 3ZQJA 2ZU0C 1EESA 4D80A 2ZJYA 1VCIA 1XTRA 1R10A 2GZHA 3ECCA 2ZANA 3VU9B 1WBBA 2QM7A 3MAAC 1KK3A 3ZYCA 3GLIA 3PV0A 4PC3A 3VHXA 4Q1FA 1Z0JA 1JAHA 1NIPA 2ODNA 4LPSA 4HB4A 1XBTA 4MKGA 4PHGA 4Q1CA 2ONJA 2KBEA 1J8YF 1QHXA 2AN9A 4LJ8A 4WXRA 1U94A 3E5HA 1IY0A 4LJ6A 2XZOA 1RJ9A 4M9SA 3X1YA 4KSCA 1OFIA 3C5CA 1KOFA 3LO5A 2GEDA 5K8IA 3IDQA 3FGNA 2CLSA 1NI3A 2XAUA 4YC7A 4G3XA 1NMYA 1NJGA 5F9HA 2AKYA 2ZJOA 3C16C 4JBYA 1HQCA 1NN1A 3D6TB 4RFSB 5FOSA 1GAJA 3TSOA 1UKYA 3EIQA 1GG2A 2NPFA 4G5SA 2P0EA 1R6BX 1NG9A 4LYHA 2X2FA 2CHGA 4M22A 1XX6A 4AG5A 4DB4A 2GILA 2J1LA 2JLUA 2R6GA 4XIGS 3SQWA 2VP9A 1S1MA 2J0UA 4TYPA 4HZIA 2D06A 4AKGA 4A0HA 2VEDA 3A1TA 1JI0A 4RKEA 4AKIA 1XU4A 2D7CA 2W6JA 5EXXA 1GILA 3LW8A 3VFDA 1GFIA 1QHHB 4PHFA 4M1TA 1II8A 1NKSA 5BQ5A 4C9BA 2IA5A 2BM1A 2F6RA 5HCIA 4YMUA 5B30A 1MR3F 2J0QA 5K8UA 1MO6A 5KSYA 3BGWA 5FR1A 5C46F 5EP1A 4PQRA 4XTRA 1IXSB 2J41A 1TPZA 3EPKA 3CRRA 5E7MA 3B1YA 3HP1A 1VCOA 2OAP1 3V4RA 3QXHA 4PO1A 3AGPA 2O8FA 1T4GA 4TYQA 2VRWA 3L2OB 8OHMA 5FPSA 1EFRA 2KB0A 1ZBDA 3KQHA 4PHTA 4UJ5A 5FPKA 1R0YA 4FCTA 1E9EA 1N6KA 1Y3AA 2V3CC 1Z08A 3VAAA 1E2MA 2Q9BA 4AYTA 3VR2A 1E2LA 2IC5A 3G0HA 4L16A 1PLKA 1Z8FA 2CK3D 1QDEA 2SHKA 3NBXX 1KYIA 4D6PA 1MRSA 4TZ0A 2QMOA 2GF9A 5CYOA 4RZ2A 1GVNB 1Q20A 2QP9X 5L3QB 3U6BA 3OIVA 2GZAA 4JT4A 5TXGA 1PLJA 5EXPA 4Q4LA 4NDZA 3CRMA 1LY1A 2D2FA 3GJ6A 5IK2D 1N0VC 4JJZA 4JIMA 2WV9A 3CWZA 2HUPA 5ELXA 1NMXA 3I73A 2WWXA 4HLDA 4QHYA 2YNMA 1W7AA 3FDIA 1S3GA 3T61A 3IPXA 1CJTC 1NY6A 5E95A 1F48A 4QL3A 2YYZA 3R9IA 1WBDA 3PXGA 3AVUA 3QXXA 1V43A 1ZINA 1HA3A 1SXJD 1ZMXA 1KI6A 4KAXA 4URVR 1NKTA 2QA5A 3KQLA 1JPJA 2CHVA 3RRYA 1G5RA 1S3SA 1M1YE 2VF7A 2OFWA 2QU8A 3KJHA 1E1RA 2VH5R 3IHLA 2FOLA 5FPHA 2YV5A 3RDPA 4JLKA 3A1UA 5G3ZA 3KZ1E 1R8SA 3MJRA 3SJAA 3UMRA 4OK5A 4JKYA 5J4KA 3DZDA 2ZRCA 4ZDKA 4V0LA 2RKOA 3H2YA 1SVKA 4HUQA 3VKWA 4NYJR 3WYFA 3QNUA 2AHOA 3OHMA 4MRVA 3RYTC 3U60B 4AY2A 3L0PA 3FWYA 5IT5A 4LHWA 2IK8A 1XCGB 5EP2A 1B0UA 5IDVA 4TYNA 3CPHA 2DWOA 2D4HA 1N5KA 4Q21A 2R8RA 3FVQA 2J7KA 2W83A 4JT2A 2JLWA 4LYJA 2ZI6A 3FFBA 3NTUA 4F91B 2CJWB 4GOKA 4DBLC 1W4AA 1F2TA 3CKLA 3WXMA 1YR7A 1Z6XA 4HDQB 3OIUA 5H68A 3K9HA 3NWJA 4D25A 2GEVA 1SXJB 1NN5A 4IDPA 2AXPA 4B71A 5FL3A 2FGKA 5HR5A 4WZBE 2JDID 3WYGA 4C7OB 3ZD6A 2QUZA 4Q1BA 4ACBA 3EPLA 1DARA 3OEHD 5JS7A 4FINA 1W0KA 1RW4A 1QF9A 2RGCA 3PUWA 4MUAA 1OXSC 2BCGY 4A6PA 3LBHA 1JR3A 2X1VA 3LQQA 1ZD8A 4G1UC 3MJHA 5AUOB 1J99A 1Q21A 5FPYA 1GKUB 4BRWA 4NP6A 3QVUA 4DEXA 2XXAB 2C95A 2ZEJA 4MGKR 1E0JA 4A36A 2GCNA 1KI3A 4PC2A 1F3OA 1KY3A 3CBQA 1N6HA 1VECA 1K6MA 4Q4HB 2HT6A 3ND8A 1MOZA 2ZRAA 5D3QA 3TSWA 1TQ6A 5CK5A 2VP4A 3SDZA 3ASZA 3E1SA 3IBGA 4G01B 4MRPA 2NOAA 5LD2C 1F2UB 1T3HA 5KUTA 4CYMA 4B33A 2GXSA 3EA5A 4HYYA 2F1IA 4O25A 4POAA 5KO2A 3AP2A 4KFTA 2GEUA 3AF4A 4CT4B 3QEJA 3V9PA 6Q21A 3QQ5A 4BE7B 1M6NA 3GMTA 2FEOA 3MD0A 4TSFA 1T0HB 4L8GA 1ZM4A 1FZQA 2RGGA 3QBVA 1II9A 4NU0A 3K0AB 4OI4A 3R7WB 3PCRB 4PAQA 4IW3B 3L8ZA 2CVFA 2ZS8A 3SYLA 4BZQA 3AF0A 1XMVA 2G1JA 4DSTA 3PJRA 2ORVA 3PG5A 3W6OA 2V6JA 1VKJA 1W44A 4QBFA 1G4AE 3GLHA 2QY9A 4GSYA 4I4LA 5G53C 4URYR 3ZS8A 3K9NA 4A2WA 5FBRB 3SNHA 4AYXA 1T3SA 1G291 2ZJBA 3VQTA 3IIKA 2CCGA 2QEQA 4LYFA 1IN5A 2IYVA 4F38A 4TZ6A 3H4MA 4P4SB 1G21E 4IOJA 2LCFA 2Q3HA 4PO9A 4BZXA 3K1JA 1ZC4A 1P7CA 3REFA 3RHFA 2O8CB 2XZPA 2G83A 3ZVRA 4NCHA 5B64A 1W36D 2DB3A 2GBLC 4FMDB 1ELOA 1S1CA 2J0VA 2JATA 4M1MA 1ZUIA 3VMFA 3U4QB 2EFEB 2G3YA 2W6ID 5FL7A 4B3BA 1Z2CA 3HR7A 4B3XA 4YMVA 4X8OA 1S9HA 2MMGA 1RIFA 3X2SA 4ZIRB 2IX3A 2R9VA 1LFDB 3G5UA 5M04A 1KDTA 2I4IA 4LJ7A 4Q1EA 2IS4A 4I99A 4RD3A 1DO2A 1GKYA 3OESA 5BN3A 5F98A 2F9LA 3REGA 4KLNA 2DYKA 4B75A 1ZM7A 2G6BA 4OHYA 3DMNA 4NYMR 1PUIA 3QPUA 2R6AA 1EFCA 2HXYA 3A37A 5KSZA 3LDAA 2CBZA 4BFXA 4IJMA 5EE1A 2EU8A 3VR6A 1BIFA 1LB1B 2YOGA 1R5BA 2WIBA 4XH9B 2R6DA 5FUYA 1XDBA 4KSBA 3ZZUA 2WOJA 2PMDA 1NP6A 2WSSD 1KKMA 4IFEA 5LBIA 1FUUA 4V0ME 1FX0A 3RSLA 3LNCA 4KJZA 3W6PA 1KDPA 1JJVA 1ZU5A 1W36B 4GP7A 1TU4A 2V4ZA 3KXKA 3BK7A 1WMSA 2GBLA 1XPOA 3ZDQA 1YZUA 4DSUA 2D62A 3AVTA 4O0MA 2OT3B 1RRFA 1W46A 2WPDD 2ZU6A 1Z83A 3C41J 2F43A 1KTVA 1VDZA 2DFTA 1OFHA 1W47A 1AZTA 5KNDA 1E1QA 3L82B 1MO4A 1ZC3A 4JVSB 4DCSA 1OPXA 4OI2A 3EAQA 3D31A 4EIWA 2O8EA 4LV5B 2Y8EA 2JGNA 1VYTA 2Q21A 1VG8A 2CCKA 4HB2A 1E2EA 4IDQA 4UNSA 4HI0E 2C96A 4IVRA 4AKHA 4FWTA 5FBQB 3QG5A 3FHTA 1YR9A 2WWIA 2A5JA 2FG5A 2ZE6A 2J87A 4ZKEA 2NZJA 4NCIA 2C99A 3LW7A 5SZJA 3T1QA 3B60A 1N6RA 3W8NA 2WJIA 4MYCA 3L43A 2V7QA 1XEWX 3HU3A 3NDPA 4P33A 1JEEA 5KDOA 4BUJA 1EGAA 3IPYA 3Q7PA 3AVQA 4P4TA 4W5WA 3B9QA 1OFUX 1YZLA 4RFVA 5CDFA 4L9WA 3N2EA 2FZLA 4PANA 4KBGA 1G7TA 1NL3A 4R7ZA 4B44A 4HB0A 4PPNA 2QBYA 2GCPA 1A4RA 2LWIA 2XTZA 3T06B 1AS2A 1GL9B 1SQ5A 1YRBA 3JZMA 1HEIA 1SHKA 4US1R 3LLMA 2QRNA 2H17A 3CRQA 1TL7C 1LNZA 1ZYUA 3D8BA 1U81A 4MKFA 1Q22A 4P31A 3A36A 4FCVA 3B5JA 3R8CA 1BYIA 2PT5A 2FA9A 2NMVA 1VG1A 3D3QA 4EJSC 1E9AA 2WVJA 2RGNC 4K81B 2BVNA 2CCJA 4EQ6B 1XP8A 3I8XA 2D7DA 4BWYA 5FTNA 2HT1A 2HCJB 4NYIR 2VLIA 5KOYA 2GKSA 2IS2A 3EARA 3QJYA 3TVDA 4PAOA 1TF5A 5C4MA 3HJNA 1II0A 3M0EA 4TL8A 1R7RA 4LPKA 1KI1A 1DELA 3R9XA 1IXZA 4U00A 1E2NA 5SZHB 1FNMA 2ZRNA 3CR8A 3MSXA 3I62A 2VHUA 1XD8A 3NXSA 2YZ2A 4QC2A 1XWIA 4RD0A 4D4LA 4N0DA 5EUQB 1ZVQA 1XCMA 1ZM2A 4RD2A 4HAYA 1P75A 4RCYA 2NPIA 4C0BA 5J4VA 5TARA 2O8BA 1NMZA 2RHDA 2JIZD 2QPTA 3AVWA 2CXXA 1OIVA 3T12A 3PEVA 2JEOA 1G1MA 5DI9A 4CDGA 3EZ6A 4L4UA 1RRCA 2ZRMA 2WWGA 1N6IA 4LHXA 2ERXA 4TQAA 1KO8A 4D0LB 4EJSA 3K0EA 3K8YA 2RGNA 2MSCB 3TR0A 4OK6A 3FMPB 3LVRE 2WJGA 2IYSA 2MSDB 2PBRA 4UXJA 1P4SA 3CF6R 1G9XA 5D3MB 1DG1G 4HUTA 4ZI3A 4PPFA 1XD9A 3NBYC 1G8YA 2QM8A 3LBIA 4K8OA 4KYIB 4NONA 4TMVA 2NO1A 4LJ4A 3AGQA 5AUNB 1FUKA 1GZSA 2H16A 2JA1A 3I61A 4KI0A 1G3MA 1IBRA 2QE7A 2ZSFA 2VP0A 2WMOB 2UZIR 4JBXA 3TKLA 5L8VA 3CF2A 2CLDX 2QG6A 2RGXA 4C0AC 1JR6A 2PL3A 1MABB 4TLAA 1UADA 1VHTA 521PA 4U7DA 1E2PA 4BECA 2IF0A 3BOSA 1OJLA 1CEEA 2IEYA 1NLZA 3FPAA 2OHFA 2PX3A 5GVSA 4Z1MA 3AF1A 4I1UA 1YQTA 2P5SA 2QPAA 4V0KA 3FFAA 4B2LA 4WAUA 5P21A 3FMFA 5KPDA 4DT1A 1JQLB 1FL9A 1NSTA 2WHXA 4ITRC 3T1OA 2A5YB 1TNDA 3EG5A 1E9RA 2WKPA 2GA8A 3DOEA 2NGRA 1AQUA 2QMHA 3A4NA 3W3AA 4DHEA 4YDSA 3NEYA 1N5LA 1G4UR 1ZNZA 2ZUDA 1XTJA 5BW8A 3U44A 5F2EA 1GOTA 2BBWA 3WYAA 3VHLB 1OB5A 1GNRA 3BB4A 3GJ3A 1DTSA 5KDLA 3L0SA 4LX0A 3FKSA 4EPXA 3T15A 4Q7KA 2H18A 1JXOA 2ZITA 4QBGB 5EXTA 2DBYA 1SXJC 3EA0A 5JWRA 2H5EA 4NMMA 3BH0A 1OHHD 4LHZA 721PA 1YKSA 4ZI2A 2C5LA 2JJ8A 4XWKA 2QMUA 4QGAA 1UF9A 5HKKA 2F7SA 4EPRA 3BJIC 1G7SA 4Q1AA 2PX0A 4JLJA 3NBFA 1Z3IX 1Y63A 4C30A 4XWOA 1FQKA 4FMCB 2A3RA 2REBA 4E09A 4F4CA 3OZXA 3A4MA 4M9ZA 1U8ZA 1NRJB 2G77B 5SZKB 1SHZA 4WA7A 3IQXA 1T8TA 4QGGA 3OFND 3W6NA 4JYBA 4FXPA 1HT1E 4TMTA 1Z29A 4FMDF 1W1WA 2P2LA 4DDVA 1E32A 1HUQA 1LS6A 4A8JB 4KO8A 1D6JA 5F3WB 3RS0A 2ZSEA 5ANRB 3EXAA 5JSZA 1W49A 2G1KA 1Q44A 1W2HA 4JJKA 3R9WA 3RS4A 1L7VC 1U8AA 2VO1A 2Z6VA 3K0SA 3DO6A 1W0JA 3SJCA 4GMDA 3TUIC 3VX4A 1E0KA 3CIOA 4DLRA 5L3SA 3IHWA 1C1YA 2JAQA 1SXJA 3GD7A 1HV8A 2ZIAA 4XD7D 2EWVA 1RPZA 2EWWA 1SKQA 1CLUA 1E98A 4HAWA 4AG6A 5BN5A 1VG9B 1XD2A 4E5UA 2ZM5A 4PX9A 4HAXA 5DYIA 3T5GA 1WCV1 1BOFA 3ADBA 2OE2A 1E94E 3KB2A 3RS3A 1V5WA 1J70A 4IKEA 4BLPA 2J3EA 3AQ4A 1XTKA 1E2KA 1PVOA 2IYZA 3UANA 3RNLA 4DUGD 1K5DA 4IDHA 4JL6A 3M6AA 2ZI7A 1W48A 1HE1C 1QG2A 2ZAOA 3AVXA 4EFLA 1OH7A 4B35A 5HCNA 5G41A 2KBFA 1GDDA 3RS5A 2EYQA 4YXWD 2NO9A 4BFYA 4EPWA 2A2ZA 2VL7A 3ICQB 2VSFA 1OKKD 2WWYA 3AVYA 3SJZA 3LLUA 1YZNA 1F2UA 2Q9AA 2ZVPX 3DOFA 4RD4A 4Q9JA 4NBSA 5E4FA 1VCNA 2VP2A 3I8SA 3GFTA 2XOKA 1OYWA 2QTFA 4HLUC 4PC6A 4HB3A 2W0SA 2IYTA 1K5GA 1OB2A 4F4JA 2OUKA 5EQTA 4HZUB 3KTAB 1N5JA 1ZJ6A 2AFIE 4NCNA 3CM0A 4FW9A 3CPEA 1BMFD 4W7SA 5FI0B 1KK0A 3U61B 1ANKA 3B82A 3DKPA 1E4YA 4DIEA 4TTRA 2QAJA 1M7HA 2YINC 3KKOA 3WY9A 4D0GA 3NHAA 1TX4B 2WWWA 3WNBA 1P3JA 3GLGB 1W2GA 3TVTA 1ZCAA 2N42A 4DC9A 3CH5A 2WWHA 4DZZA 1Z6YA 1KZ7B 2OBMA 4LWZA 3OE7A 3MCAA 3CLVA 3GEIA 2R62A 3IKJA 1T9HA 1HT2E 1RRPA 1NBMA 1L2TA 1E79D 1SVSA 2AK2A 2JJ2A 3LRPA 2IWHA 2IL1A 4Q9IA 3THYA 2WMNB 3KKNA 4CEIB 1US8A 4A6XA 3K70D 2K5UA 2WAXA 4B3GA 3CNNA 2CNWA 3OAAA 2NZ8A 2QN6A 1P9WA 2ZRIA 3Q8XB 3NVAA 4HLUA 3WP0A 1H8HA 2XJ4A 1MT0A 1COWD 2Z83A 3GJ7A 3W5JA 3MG9A 3LFUA 1N5IA 2FSHA 1SZPA 5EP4A 2CMKA 4ZKDA 5KNBA 5AK0A 4Q02A 2ZR9A 2B8WA 1RYFA 4M53A 1EX6A 4Y0AA 3A4LA 1KMHB 1UKZA 2GDJA 4S2EA 3CNLA 4C2TA 4TYYA 4ABYA 2A30A 4DB2A 4D4KA 4LGMA 4QHTA 5FPTA 4IVQA 4C3ZA 2BV3A 5JHGB 3SOPA 3AVOA 4X8MA 3DPUA 2OFXA 4BFSA 4M8NE 4Z54A 4W9MC 4IHQA 1D2MA 4CEJA 3H86A 1XMIA 5K8LA 2OM2A 2QAGC 4IEEA 4RKFA 2AWOA 1TU3A 1OW3B 4IXMA 3S1AA 3LVQE 1Q57A 2GJAA 2BKUA 1F60A 3HYRA 1CP2A 3T1TA 3K70B 3TUZC 1ZW6A 3VX3A 5CITA 4FI3C 2HEIA 2EFHB 4BPBA 1JAIA 3IIJA 4GFDA 4JKIA 1DOAA 2QQEA 2ZE5A 5EE9A 2A5FA 2BMEA 4D4JA 1NVXQ 2ZYWX 2ZR0A 3GEEA 1F5NA 5JHHB 1OIWA 3SHFA 2RHMA 4CEHB 3QEOA 1GL7A 1OFTA 4LY6A 3AF3A 1AKYA 2VHJA 3DMDA 3UATA 4E03A 4D2IA 2DFNA 2QTVB 1EFUA 3I32A 4HAVA 1ZCBA 1KK1A 3FB4A 4B32A 4ARZB 5TB5A 1FQJA 5H8WA 3B1VA 3P32A 3U7HB 1DAMA 3DDCA 3B7GA 1Q1ZA 1VMAA 3C8UA 2EYUA 1CULC 3CF0A 3A1VA 2QAGA 3SFZA 2WIAA 2ORIA 1AM4D 2R65A 3P20A 5KU1A 4EPYA 4Q18A 3TR5A 3UG6A 1MO5A 3QOFA 4NPHA 4M9QA 3PUXA 2O52A 3JVVA 4DJTA 2VSOA 3QF4B 5FOXA 5C18A 2EVWX 3RWMB 3WBJA 1J2JA 4JS0A 2A9KA 1E6CA 1KHTA 3EZ9A 2V1XA 1ZD1A 1YJ5A 2ZR7A 1NVVR 5AUPB 1NLFA 1M7BA 3K0FB 1AKEA 1XNJA 3MWLA 4FN5A 1TF7A 2XTMA 3GLGE 2IYWA 3IBYA 3CX6A 5TMPA 3U7GA 5LB4A 821PA 2DWQA 1XTQA 3KJGA 5CLLA 3QVVA 1OF1A 4LRWA 2I3BA 3IQWA 4HLQB 1LVGA 1Q3TA 1U2RA 4MKIA 3BH7A 2REOA 3O8RA 2BKEA 4JL5A 1CTQA 3ZJYA 4A9AA 3PFIA 2WBLC 1DAFA 4M1YA 3U3RA 2GXUA 1XEXB 2FF7A 3A58B 4UNQA 1KSJA 1MO3A 2VHCA 4TT3A 1JNYA 2GRJA 1VHLA 5EE5B 5GJBA 5J47A 1KI8A 4PXAA 2IYQA 1NNEA 5EUMA 3RAPR 1E2QA 3RS7A 2DPXA 2E9SA 2Z43A 3UWOA 2ZXUA 1MH1A 4OI1A 5JMTA 4PZYA 4O2RA 2OFOA 4M1SA 1ESMA 5DLQC 1G3UA 3KQKA 1LF5A 2WJVA 5CB6A 1XMJA 121PA 1Z2AA 2QSYA 3FMIA 1HTWA 4TMXA 4RY2A 2J46A 1FFHA 3WMGA 2CE7A 2VBCA 3B13B 4QJ3A 1IOZA 5DI3A 1CRQA 621PA 4OI0A 2JJ1A 3QPWA 4FMCF 4B3CA 3GLFA 1XXHB 3QIAA 4Q4AA 3GFOA 3QKUA 4KCGA 4LUCA 3EPJA 4EPVA 3KDSE 2QTHA 3BWDD 3LXRA 2WJJA 4LHYA 4V02A 2GNOA 3B9PA 1M8PA 4MGZR 4LJAA 2YHSA 4DDWA 5TVKA 2N46A 1E99A 5DYGA 3P1JA 1GNPA 1NJFA 1OT3A 2WOOA 2VPPA 4ASUA 2OILA 4OBEA 4DDTA 1QZXA 2RH5A 2HLDA 3IO3A 1FMJA 2QNRA 1E9FA 3QENA 2BMJA 2C77A 5AUQA 4RD6A 5FBLB 1DVRA 2W6JD 2YOHA 4TYWA 1CJMA 1P2VA 2PZGA 3AF2A 4KFRA 1QHNA 3L0OA 5JWOA 2BBSA 3RABA 3QUSA 1RJ9B 3AUYA 4Q9KA 4OL0A 3WHLA 2VF8A 4AK9A 4QJ4A 1T6NA 2ZUCA 3MMPA 3U6KA 3P26A 1IONA 2O0KA 4PZZA 2IS1A 3MWYW 1KO1A 2EFDB 3AKCA 4ILEA 4C0QC 3BIFA 3FHCB 1XFAA 5H1YA 1OXTA 3D7MA 1IN4A 4DRZA 2F1HA 1QVRA 4QGHA 5JECA 5FTMA 4E07A 5G3YA 2JIZA 1HY3A 2G0TA 2RB4A 2ZE8A 3AKDA 4EFNA 2B8TA 4NHOA 1NF3A 221PA 1UEJA 1SULA 2GCOA 2VIIA 4LV6A 1E9CA 1EFRD 1UAAA 4B47A 1KJZA 1Q1BA 2J0UB 5CIWA 4TN1A 4BQSA 3ETLA 5H70A 1KSGA 4CZ2A 2XTNA 3Q3JB 3B1WA 4XJXA 4WW0A 2JLRA 4KODA 1NIJA 3DKVA 2YVUA 1E4VA 3AKEA 3B1ZA 4FMBB 3ICEA 5CJ2A 4X8LA 1C9KA 3THXA 2F1JA 2WM9B 4JVMA 1II8B 1DAEA 1G41A 4RD1A 1IY2A 4BEBA 2R44A 4A8JC 4KU4A 1KNQA 4LBWA 1UM8A 4AKEA 4KHZA 4OHXA 1R2QA 3ZZ0A 1M74A 2VSXA 4KBFA 4GL2A 4ZCIA 3ADCA 1VPLA 2W0MA 2IYUA 4XSHA 3NG1A 3KKQA 1FTNA 2J7PA 4DCTA 3SE0A 1G18A 1KJWA 2XITA 3BB1A 4BFZA 1VIAA 1N0WA 1E2IA 1Q1EA 2J9RA 4M9XA 2KSQA 2O8DA 1KNXA 2O8FB 3OIWA 1RYHA 2ZAMA 5GJCA 4QHSA 4EPTA 2FFAA 4PZLA 1UKEA 1VYUA 4DCNA 5DNYB 3TW8B 5FUWA 4AIIA 4MDEA 2FPLA 1EWRA 4GI7A 3W5IA 4ACAA 2IYLD 1CR1A 3PR1A 2BDTA 1OV4A 3C4JA 4ZDJA 1QHYA 2BJVA 2Z4SA 2QROA 1TAGA 4NYJQ 5B57C 1L4UA 5HPYB 2BC9A 2CLCX 1G16A 2HYDA 2A5GA 1GIAA 2EFCB 3KFVA 5J5CA 4AWXA 1C4OA 4QKQA 5JRJA 1GUAA 4GMXA 4A8JA 4Q7JB 3F8TA 4M21A 3NC1C 2OCYC 3UMFA 5CLQA 4M1OA 3CX7A 2XNDA 1YZQA 1XF9A 3HU2A 3TSZA 5J4HA 1XXHE 4PSVA 4DWJA 3BH6A 1YZTA 3WP1B 4A15A 4B2PA 1HURA 1KO4A 5DN6D 1TADA 2DFLA 1F6BA 2F3TA 1QHGA 2Q0HA 3CNOA 3ND9A 3CH4B 3VNVA 1OHHA 1XJQA 4JLMA 5UKDA 1YR8A 3SQXA 2NIPA 3HYTA 1ONBA 4QFMA 3KL4A 4Q4JA 4MYTA 4JYCA 3KUCA 2GZDA 3KB1A 4M0LA 3WBKA 1KI6B 1XCPA 2ATXA 3GLIE 2PEZA 2ZRLA 2VA8A 5EE0A 4KITB 5JFGA 1G6HA 3RLFA 1RE0A 4L5BA 4CT5A 4W5HA 4F4IA 1W0KD 3BORA 3THWA 1P60A 2RCNA 4WZ6A 2VHQA 4JLVA 4DSNA 1DBSA 2Z4RA 3KKPA 2BHRA 4HSEA 1JR3D 2GK7A 1JPNA 2FX3A 2OEPA 3ZIAA 2JASA 3I72A 4HUQB 2HDNB 2IW3A 2P67A 1WE2A 1S96A 3KJEA 3PEUA 3QKRA 4YDHB 5FBWB 3TQCA 3FOZA 4TTPA 3VU9A 2CE2X 5B58C 4DSOA 2GWHA 3N5CA 2EW1A 3V4FA 5KNCA 4TL6A 2GXAA 3MLEA 1XJCA 3AP1A 2DY1A 2AR7A 4MRRA 3ZVLA 4ZV4A 5JS8A 5GVRA 1WRBA 1CBUA 1U0HC 4Q03A 4DLTA 2AK3A 2IWRA 3OEEA 2ZTSA 5KYKA 1D9XA 3KTAA 3VR1A 2VHTA 1XRJA 2IYXA 3NEJA 1LF0A 4H1UA 1GRNA 1R4AA 1SVWA 2XX3A 3THOA 5EE3A 4BASA 4TSFD 4LOAA 1BYUA 3AB3A 4MUBA 4Y0VA 5DISB 1S4QA 5FOVA 2A5DA 1VTKA 2XSZA 3H0KA 4B6FA 3CRVA 4RFSA 3GCGA 3BXZA 2VP6A 4NCJA 3SEAA 3QKSB 4EAQA 3LX5A 2VYFA 2ZI3A 3F3YA 4BRUA 1PZNA 1W4RA 3T34A 2OXCA 1FPMA 4JLOA 5GJVC 2GJ9A 1Z0FA 3EW9A 3GJ0A 2OLKA 5DH9A 4XWAA 1UFQA 5GADl 5FOWA 1M34E 4LC1A 4TL9A 3C7KA 2ZRGA 2ZSAA 1P9RA 2ZPTX
chains in the Genus database with same CATH superfamily
1U6JA 4PFJA 5C51B 4ZK6A 3H9JA 5TJ9A 1O54A 2FDCA 2ZTLA 1XTSA 4GPAA 2VTDA 4A92A 4ZQHA 1Q14A 3GGJA 4OEHA 3H1TA 1SU6A 4RAQA 2P9CA 2Z1DA 4IDCA 1H2BA 3MXOA 2HF7A 3GA0A 1D0IA 3ENNA 3B1KA 2QGNA 1HNWB 1G19A 1GUYA 2QAIA 3NHZA 3SXUA 5ALHA 3U3MA 4LX8A 3MBKA 4DCGA 4KQ9A 2IHJA 5KKNB 3T5AA 2QVCA 2UKDA 1BHSA 2F3QA 3DDUA 4NYMQ 3DAOA 3VVCA 4NPCA 1KK2A 4LF9B 1TJYA 4MKHA 4QDXA 4MVJG 3EF0A 4C4PA 4O02B 1UMDB 5ALQA 2WJPA 4PLPA 4FLFA 3D4BA 1KRWA 1F38A 3UWPA 4ED9A 1SA0B 1ZO8A 1ZM3A 1THZA 2DR3A 1CR2A 3CR7A 1BNCA 2MJLA 1CT9A 3BL8A 4B4DA 3K09C 4KWHA 1IATA 4MH0R 1GZDA 3NRJA 1JRLA 1S9DA 2CYCA 2V7TA 2E0IA 3DUFB 2PXAA 3JV7A 4OM8A 1OXXK 3TB4A 2NXNA 2BBTA 2EIHA 2BEUB 2HI0A 3M5CA 4UHBA 4E5PA 4MV1A 6NULA 1PWYE 1E5LA 3OTOB 3AZPA 3TLGB 2P9YA 4GGOA 2AFIB 2ZI5A 3DMGA 4ZZ1A 1YQUA 2B8NA 4W4TA 1JXMA 3CLRC 5F2OA 4YPFA 5C7YA 2JGJA 2BEJA 1TQ4A 2IYRA 2GK3A 3TZEA 1NLMA 5H16A 3S2IA 3W9BA 3WI7A 2OG2A 5BSUA 1E62A 1LRJA 4HDAA 4XA8A 5LQAA 4LBYA 4RZIA 1N6PA 3H3JA 1I8TA 2ZDQA 3AUSA 3UPUA 1P5JA 4MRSA 4OHZA 4ESVA 4ZOBA 1NSYA 3TI9A 3OZWA 1I7PA 4U63A 5AWFC 5M7EA 3PVCA 1YULA 2Z98A 1E0SA 1XZMA 5FUVA 1KMQA 5BN3B 1PEAA 1U0EA 4L5AA 5KNDD 1UBRS 4AS1A 2OBNA 3FCOA 3NTVA 1CUEA 3QQPA 1PO7A 4BLTA 2IH5A 4LFAB 1PZHA 4JK3A 1CZLA 4D8VA 4FSDA 4J7CA 3RJZA 3TAUA 2V54A 3S4YA 2ZVJA 1MX3A 4D8XA 3V80A 1ORRA 4JODA 1QIKA 4QARA 3LXUX 1SBYA 2PBZA 4P82A 2HMAA 3K09A 2GM9A 1QP7A 3HB5X 3WLKX 4KH0A 1YV9A 4AMYA 4TLMB 3QY9A 4BNXA 1NAIA 2GZSA 2XB6A 3PNMA 1QIJA 4KN9S 1E6WA 5A3VA 5C3MA 4WXPA 1FX0B 2C9OA 2PGAA 1N1EA 3K4HA 5I9NA 2J48A 3BWCA 2YCLA 4Z53A 1YA4A 1ZZGA 3DVQX 4PR3A 5HXAA 3OM9A 1GKIA 3NJRA 4Y2HA 1KH2A 1U7DA 3AWDA 3JD2A 3QH4A 4G1CA 3V1YA 3WB2A 4YONB 3QE3A 2XJ9A 4BLRA 4EUHA 4BNZA 3OOHA 3AVVA 1ZP6A 1N0UA 1N8SA 4XM1A 2F43B 3A6DA 4FFBA 3EZ7A 3I5UA 3CA8A 4HEQA 1RR6A 2VYNA 3CF4G 3JWPA 2YKGA 1R5NA 5CDYA 2ZTVA 1YZHA 1ONOA 5REQB 3FW1A 1ID8A 3DZBA 4ERNA 3EGCA 2GJ4A 1C4KA 3NHUA 1RCUA 4LVOA 5DWDA 1E66A 4DKJA 3J81k 3GYBA 4Q9NA 5G4KB 1AUVA 3TAXA 1I10A 1X0XA 3GARA 3ZWAA 2ICAA 3G2PA 3BVPA 1N6NA 1P4HA 2B0JA 3AHEA 3D6VA 3GUCA 1BEZA 1KAOA 4OB6A 4HPWA 2CXHA 5IZ4A 1IE3A 4EYQA 5J58A 2P9GA 5J2UA 2Q8NA 2DETA 3HKDA 4G0QA 3OFSA 5T67A 1D9ZA 1RBMA 2UYCA 1EVQA 1SVIA 1Z28A 2KLHA 1QRAA 2O5VA 3N8GA 3DM9B 4LDZA 1Y5RA 4MWSA 3TK1A 1STOA 4GXRA 5EHGA 4B09A 5EAIA 2EARA 1SKMA 5JAMA 4JYAB 4Q47A 2WU4A 3K53A 3NBZC 3GGOA 4R8LA 2VWHA 2FUEA 1JVBA 2JGFA 2RG7A 4DMRA 3DEZA 1MQ8B 3IOEA 3OO1A 4JI6B 1GFWA 1DV1A 1ECGA 4FFMA 4JP5A 4D3YA 1QBKC 4G5GA 4U8GA 4X3CA 1PJLA 2J0EA 2NO5A 2YZNA 5JY6A 2PJRA 2XXAA 3WQHA 3T3DA 1X1RA 5IVHA 1THMA 1BXRB 3MSCA 5KYVA 3B6IA 3O8LA 2Q5FA 2PLFA 4KR9A 2Z57A 3LWNA 3FPJA 1E3DA 2V4UA 3ZXSA 1UFRA 5T8KC 2OO7A 2FXIA 1K6JA 3QPVA 1I1HA 1SVLA 4WX2B 3COJA 4IGIA 4B3SB 3KEMA 2FN8A 4G5YA 5C0OE 4F9TA 5K3FB 1SIOA 2OYSA 3LFHA 5K2MA 2QBYB 5MDHA 4BFVA 1XMPA 2XQVA 2IS6A 1BGWA 4S2UA 5L3RA 5A0FA 3N2YA 1XMXA 2R48A 2ODAA 3IUQA 2PUTA 3O1HB 3R3HA 4MYUA 5LZ2A 1VA5A 1EEXB 4F8YA 5LA6B 3CG4A 1PSWA 1FFAA 1OI4A 3K0AA 1T6BY 2EF1A 2RHJA 3R3SA 1QIMA 4C7XA 2HMYB 2QN2A 1QIIA 2JF0A 4FIDA 3ADBA 3VV2A 2Z30A 2F1RA 2R1VB 4R81A 4S1VA 4IFIA 2AOTA 1LZKA 1WKBA 2CF5A 2UVQA 4F11A 3ABOB 1KIMA 1J07A 2XYGA 2ID9A 4EI2A 2UZ4A 4Q37A 1WPXA 4BMZA 5ALKA 4CKZA 4KFSA 1CZKA 1E3TA 1HFKA 1Y5LA 5KMGB 2OBBA 3K9WA 1N6OA 1H65A 3UFBA 5IBCA 2QK4A 4Y67A 4ZVMA 3ZNQA 3LL4A 2C00A 1PBTA 5BN4A 1I13A 4ECEA 2R2GA 4BMYA 5ISMA 1AOXA 1RC1A 1XB2A 2Q1WA 5T8KA 3JQGA 1AC5A 2PWZA 3COWA 3Q3CA 4BFTA 3I42A 5DM60 3BDAA 3BDVA 1TW3A 2C9BA 1K3TA 5COQA 1IUOA 4EMSA 2EJWA 2VTKA 2ZULA 1UC9A 2R6FA 2UYHA 1RKUA 3K96A 2ZYTX 3W5AA 1GGHA 3JQ7A 2LE0A 4ZTZB 4U7GA 2WJ6A 3TZLA 4CFYA 3ZDZB 1AKNA 1GAEO 4P9NA 2QVGA 3EWAA 3FHOA 2V3VA 4BLQA 2WWFA 4ZIRA 3LMKA 3RQSA 2B4KA 2MSLA 1BDIA 3B8HA 4IMRA 3SQLA 1WB5A 2JFQA 2E82A 3UTDA 4ND2A 5EJIA 3SGLA 2PK3A 3UIEA 1WO8A 4KJXA 1DQRA 3V7UA 4CDMA 2TMDA 3DAFA 4EJSB 3EVZA 3ZQKA 3EK2A 4BIIA 3RVBA 4YS6A 1KZ6A 1MEEA 2ZATA 3COPA 2XMSA 1ZM9A 1TU0A 4O1HA 4P08A 3W78A 3WNCA 2HH9A 2ZOSA 1KI7A 3RBAA 5I7EA 3PENA 5EIWA 1CHNA 3UJPA 4Y6LA 1N2OA 1QGYA 2X8JA 3DTTA 2YWGA 5I9BA 1NZFA 4KG7A 2VFAA 4BPRA 1TM7E 3CEMA 1HYGA 2O0JA 2ZI9A 2AD5A 5CMLA 1L1RA 3UJ9A 4YUAA 1VBFA 3KPUA 2DY0A 5KYXA 2EZ8A 1M2NA 2NU6B 2J3LA 4IL5A 2G71A 3FHJA 5LMCA 4R9UC 3G9XA 1JALA 3GOQA 2Q6IA 1UT6A 2CL7X 3SX4A 4CI9A 2GESA 3ZVNA 3OKAA 2W6ZA 1ZSVA 3MTJA 2XYRA 2W6IA 4PW0A 4IQ0A 1BCSA 5TGDA 1X1SA 5ALYA 4UJ3A 4DPLA 2PZEA 1P44A 1PZXA 2D74A 3RS2A 4W7IA 2PJZA 2CFRA 5SYAA 1RHKA 2G4VA 4V0OA 2V74B 2ZR8A 1KKLA 1TQ2A 1MQAA 1D4OA 4NR0A 3SM3A 2E5WA 3ERCA 1O7JA 4GOLD 1Q74A 1SVOA 3DJYA 4PFSA 3DHEA 1I3LA 2JI9A 3N07A 4OIFA 4TKUA 1JHOA 4JC8A 4F5DA 5BRAA 4M86A 5JJLA 1E7RA 2ZBRA 5FTKA 4BX9A 3VVBA 4COOA 3TIIA 2RGWA 4PC1A 2GPWA 1P2TA 1E1YA 1KPIA 3GEMA 4ZYLA 4I5DA 1E0AA 3ZE7A 2HQRA 1NN3A 1W5TA 2ZZKA 3LX4A 2YWRA 3NTRA 3ZC3A 4P81A 4TMFA 5EI5A 4DWOA 2BAGA 5HG0A 4Z49A 4F6CA 3EXIB 1JKIA 3DBRA 4BBPA 1DO0A 2B1JA 3TH5A 4TWIA 3GL9A 3CVUA 1Y4ZA 1XEWY 3U44B 1E4EB 1GUDA 2JCSA 3WNDA 3OCWA 1P1HA 4NS1A 1L7DA 1DRWA 1K4KA 3RVOA 2VPZA 4Q9LA 5J4LA 4EL0A 1KJ8A 3QFTA 5IT0A 3HJCA 4I1OA 3VZRA 4PTLA 3DONA 1V8FA 3KZCA 4TMWA 1X15A 4A1FA 1JIQA 2XKBA 1W0JD 3I28A 2DGDA 1GPDG 1EJ0A 3JQFC 5IJAA 1JTVA 2YWCA 4JBWA 4Q48A 4WDQA 1D04A 3VU1A 2QMEA 3F9CA 3K0CC 1QS0B 4LYEA 4Z4IA 4OXRA 2Q5QA 2GF0A 4IHAA 4J7AA 3T38A 1KU0A 5B2ZA 5T3UA 1NQ5A 3SEZA 4GYJA 2VK1A 2I7VA 1WUJS 4PLFA 5E6UB 5F51A 5GTDA 2I87A 3RM3A 5FI3A 3MWEA 1ZK0A 2EBWA 4HGOA 5AJXA 1GAXA 3BXGA 1X8JA 4YEDA 3IDOA 3PL1A 1UKBA 2RKWA 3WYEA 1J7KA 2P6UA 4ITVA 4IPTA 5JC8A 1UXJA 4GPZA 5LZ4A 3QSYA 3TJZA 3TQFA 3ILXA 1ZI6A 1ULAA 5IARA 4RV9A 5K3SA 4F56A 2X9LA 2JI6A 4DLYA 4KR2A 3GJ8A 5KPJA 4ERXA 2BFPA 4L73A 5TQ0B 4FBGA 4HK4A 3RODA 1USWA 1H2FA 1VLZA 3OLXA 4U6NA 5K45A 4CLOA 5A7HA 2ZJ8A 2CEAA 4KPYA 1KARA 4L5YA 4EQ6A 1JHMA 1ATZA 3TL6A 3FUVA 3RC7A 1EK0A 2H4WA 4F12A 3W1VA 3AV3A 2CNBA 1XKQA 2P2ZA 1UBGA 1DAHA 2NXWA 3AH8A 3EVFA 3ONVA 3EPPA 5DTEA 5PGMA 2RE8A 2WHRA 3HN6A 3M4YA 3JQFA 4HDCA 2WZQA 2A14A 1EDEA 1KFKB 2Q4OA 1ULBA 3K0CA 4ZVVA 2D4AA 4AMVA 1IUNA 3PQDA 4QICA 4Y98A 4D3SA 2XB8A 4GOXA 4W9NC 5NULA 2JD1A 3H4VA 3I1IA 1JQEA 4ZI7A 1E89A 3NWOA 5E7IA 1OIXA 4OGGA 5C34B 1Q0LA 3AKYA 1S2GA 2P90A 2IXAA 2RAFA 3GDWA 1JFFA 5C37A 3SZLA 2ST1A 4EM6A 3WKEA 3E03A 4JSYA 3C6XA 5J40A 3QKSA 2KI5A 4J4BA 5J4YA 3R20A 1B6TA 3I8OA 1WY7A 2VVTA 4MO9A 5ER9A 2PUDA 3G17A 3H18A 4Y6GB 1HDYA 3RF6A 1R5OA 2C42A 1AGRA 1KBZA 4MA4A 3FCEA 2QX9A 4ETMA 5KYWA 4LCBA 2D6FA 4JVNA 5B1DA 3VZCA 4Y2JA 2WJZB 1JSLA 3PDCA 5A4MS 5ALRA 4M1KA 3KV3O 1BQ4A 3AFGA 4H35A 1XKTA 3KZVA 4HPJB 2MDTA 3TUJC 2I6FA 2OLJA 1PK9A 4X1IA 4IZOA 5ALWA 1DWQA 3I9FA 1EYZA 3RU9A 5AW2A 4EUFA 4YRLA 3U80A 4YT5A 5AKXA 1T34A 2IYNA 1DAPA 4OU4A 5DYYA 3X2FA 6GPBA 2BH2A 2CD9A 2YC4C 4FR5A 2J5QA 3EVGA 4MIOA 4TWAA 4D6YA 4WZAB 1LTHR 2VK4A 5MGBA 3PIRA 3PHBE 5AJZA 3LC2O 4YJDA 1QC5A 4OJYA 5FB3A 2CNWD 1CR4A 3OAAD 4AURA 1K3FA 4EY8A 4QBKA 5H83A 1M1NB 4L0MA 3OX1A 2VZ0A 2WW8A 4QGFA 1CR0A 1H8HD 2IH2A 3H8SA 1W29A 3OP1A 4GZLA 4KXUA 4W9NA 5I47A 4NFHA 2FRVA 4UD2A 3CHYA 2XR1A 4TL7A 1Z3CA 1ZK3A 2XUAA 2ZIGA 3HMQA 3Q15C 5IVIA 1KAHA 1N2HA 2HB6A 3H6GA 3KELA 1YUNA 3LPAA 4ABTA 2JGLA 3R44A 2X2EA 1M1ZA 1BMTA 1FFXB 3S44A 5JD5A 1H0KA 3NMUF 4KDCA 3H9GA 1FZTA 2FPPA 1KZHA 3NR2A 4OUDB 3S99A 2IZ6A 3V1NA 3QFHA 3DF7A 1DCFA 2OXRA 5K8JB 5AM3A 3NZEA 3TRFA 2ZBVA 1T5LA 1DAGA 1E2GA 1T91A 4RXUA 4BFWA 1N1MA 1L8OA 4NATA 2ZRBA 4YRAA 3J80A 3PUIA 5CPBA 4GLLA 2Y27A 1Z7BA 3K8QA 2LDBA 2DHDA 3EXHB 2VJQA 1PR6A 1T2FA 3LY7A 4P98A 5BYAA 3CVVA 1US8B 1YU6A 2DG2A 2WIJA 2DBQA 3JPWA 3P0RA 1W59A 3FIJA 5HIIA 5A9RA 3L7KA 2WSLA 3LWBA 2XF2A 4GDFA 4CFSA 2QQ0A 2HX1A 2EAUA 4LDJA 3TOCA 5M34A 4KMOA 2XNHA 3GFPA 2IZ0A 3SHTA 5IDXA 5H5JA 1PUJA 2HJVA 3KAJA 4YUXA 5A7FA 4WQMA 2ZE7A 1ZJJA 4JCOA 2HNAA 3YASA 4C2BA 2IU4A 2F4NA 2WJYA 3JRNA 4RQAA 4FD2A 2OVFA 3SQOA 2ZUVA 1JMVA 2HDWA 3R9KA 1AN0A 1LU9A 2C2BA 2JGIA 3GFBA 4V1CB 3B2EA 3MCZA 3N05A 4EG0A 5CNMA 3ZGVA 2A7QA 2X6QA 2QYOA 3C7CB 3EVTA 3N6VA 3NFRA 5JI3E 2QJWA 4GQIA 3S5JA 5E4YA 4BO0A 4ZA2A 4JENA 1K68A 3OOEA 2UXBB 2EZ4A 2C4HA 4X1KB 1DUVG 3M33A 1SUPA 3NYQA 1ZD9A 4NABA 2PRYA 2PZ8A 4NZOA 3ZWQA 2C4NA 4DCUA 4C5AA 2W48A 1ZJ4A 1PKEA 3MCVA 4M99A 3EVCA 2CXRA 2PXHA 1Y48E 2ZIEA 3AV0B 2I0FA 3GC6A 3ILSA 4I14A 4J4HA 5TNXA 4QRIA 2OMEA 4D9JA 1E1NA 1OUMA 5BMVA 1M66A 4XWWA 1A2BA 1CKEA 4G2TA 4JQYA 2V9PA 3EC2A 4KDRA 3V2IA 4YUWA 4KREA 4RC9A 1RWXA 3UW1A 1YIOA 3V6MA 1OGIA 4L76A 4Y9DA 3B7WA 3CCCA 3PYXA 2JAUA 1CJBA 3L6OO 1A5SB 3Q6IA 4FHCA 3HGQA 3IAM1 3BYZA 3O3MB 1TO6A 5COBA 2INGX 3F1KA 4TTTS 4JMLA 2QUHA 4YP7A 1X9GA 2DH5A 3DTVB 2J0SA 1FOEB 1HLFA 4RHFA 3ZTTA 5DULA 3R75A 3CW9A 3O47A 2HGSA 3OZCA 1T8PA 1P7PA 1NPTO 1XKXA 3IP1A 4S35A 4NZ9A 2YHUA 4FS8A 4JLOA 4DF3A 1IXYA 2ZROA 2ZYDA 1Y3IA 2VT3A 4BIMA 1BE0A 1TO1E 1TYEB 1BDBA 4MB0A 3RT9A 4CVNA 4AF7A 3H11A 2Q6TA 1QGDA 1A72A 1ES9A 3FY4A 2QYHA 2HHCA 1BD4A 3ZKWB 5JOQA 1K7XB 4ZOEA 3OIFA 3MTAA 1VE6A 3OPMA 3KQTA 3FDFA 3LOPA 3T7KA 2H8KA 2GA9A 1DEKA 3PZBA 1OZAA 3KVVA 3CEPB 4TKMA 1OROA 2QN8A 3MQFA 1PSDA 1MN6A 1VBNA 4G86A 4RDCA 1T9DA 3DUWA 1E5VA 3UWKA 4K9SA 3VAZA 2ZUFA 2LGJA 2B7CA 2APJA 2YV3A 3B1XA 3OC0A 4WZZA 3CUUA 4DABA 1R0SA 2QL6A 3IIIA 1DFIA 3GXBA 2H1OA 1X80B 5FUMA 1OX5A 3EASA 5AJUA 2YWJA 2N0SA 1L9KA 1XEAA 4LC0A 4RGBA 1K4MA 3GJRA 4B3DA 5C8XA 3TIFA 5BVGA 4A1OA 4ZHQF 1IHUA 2JAHA 4Y6OA 3GEPA 1JPUA 3KQQA 3QKTA 1CU1A 3E82A 4ZZIA 5IASA 1P73A 1R9MA 3L7MA 3HG7A 3PYLA 3GPDG 5CH3A 3ZBQA 3GRFA 2VHYA 5AVVA 2UVPB 3BERA 2JJ1D 4HTFA 4ZMBA 4BNDA 2Y1GA 4O29A 5A4KA 5IUNC 3VJKA 2QTBA 4N7MA 1JHUA 1FFSA 5JZVA 4EB3A 2DHRA 1O08A 3D54D 3PQCA 1E96A 3PBKA 3NAGA 4CM8B 3S27A 2DUMA 4C6HA 1KI9A 4KZPA 3AC0A 3E23A 1KZGB 1V1MA 3H2HA 1M8GA 1DEXA 3ED1A 2DZDA 1BGXT 3D5QA 3MXTA 1BW9A 1ML4A 1E9DA 4URHA 4EEXA 4EX6A 1ISRA 2VDRB 5JJCA 1NDUA 4QT4A 2YWDA 1CY1A 2BM0A 1R5JA 2WF8A 5BNFA 3IILA 5FEMA 1YRAA 4CG1A 1K6EA 5JJ5A 3KFLA 2GPSA 3RS8A 3JVIA 5C8YA 2NVBA 3KJZA 3T7IA 1YF3A 4YXWA 3NOOA 3Q9LA 4I1VA 1NFQA 2JBAB 2VEOA 1RYBA 3B1JA 1Z6AA 3KDAA 4GXQA 2D00A 3UXEA 3W1WA 2XNSA 1A71A 2ONKA 1WD5A 2FW7A 4H1VA 3UO8B 2Q3MA 1IZ9A 3I9V1 5BMVB 5FFMA 3TQOA 1AVTA 3V7FA 1NU6A 2V55B 4TSKA 4D0NA 2CNKA 4W8GA 5FORA 5ETJA 2A67A 5DI3B 1S8OA 1H0SA 1IQUA 3WWCA 4D9NA 2H2HA 3GROA 3EIXA 4YT2A 3U3OA 1BKDR 1LLUA 3EXG1 2PYDA 4QBHA 1Z0KA 1N7IA 4QBIA 2OZLA 3PFGA 2EJUA 1FFEA 3CLKA 3GJZA 5B5SA 1CJVC 1SBTA 2WEKA 3Q98A 4QRHA 5KZMB 2RK6A 2E6KA 3T5TA 2HREA 3E22A 1TK9A 4UU7A 3RC8A 3NIGB 1WZEA 1WOMA 2AX4A 3L40A 2JEZA 1HE2A 5ESDA 3ZJVA 1DBWA 1T2DA 3L8HA 3EMDA 1NNLA 1C3VA 3BGIA 3R4VA 4Z8YA 1O0BA 2D1QA 3KU4A 4PZDA 4ATNA 1NQAO 2DJ5A 2O2HA 3N70A 4D5EA 3OMWA 3FPKA 4WN9A 3HBAA 5G40A 2BFCB 5EKXA 4BV8A 4F45A 2ASEA 2WB4A 1NXOA 3N8IA 3T9EA 1RFLA 4E5DA 2AZ4A 5FYDA 5CGZA 5IF9A 4ZDWA 4K05A 5I8ZA 4DA7A 2KMLA 4NENA 2L17A 3AR3A 1XTIA 5FV4A 1O8CA 1T9GS 2EX1A 2AEEA 4UBMA 3EYWA 2GAJA 4PPQA 3A6KA 1G8HA 3G8BA 3HE3A 2FZKA 3Q10A 4KE7A 4NAUA 2FJUA 2VJNA 3ZGNA 3BSWA 3IVGA 3U4HA 4ZI5A 4AMUA 1UPFA 3DDHA 3IJEB 1Z4IA 2JJYA 3ZQ6A 4DA9A 4CGZA 5BW6B 4X97A 5EKDA 4F9GA 2A1IA 3A6HA 2ERYA 1EK6A 1I7LA 1TVKB 4EW1A 1AMUA 3QU5A 1FYWA 1F17A 2JL1A 1XEFA 2EQBA 3PKZA 1G6OA 1XMOB 3CV3A 1AQIA 1O97C 1TJ4A 3IAS1 2Q2NA 2HK7A 2B6NA 1QVZA 3HR4A 4PTZA 3EAGA 3ZY4A 5BOSA 2QVXX 3VKFA 1U0RA 1NZJA 1T8UA 4C4XA 3KAPA 4ZGWA 1C30B 2IBMA 5DO9A 3AXTA 2ZVQX 2H4XA 1RABA 5AHRA 1WP9A 5IABA 1AKVA 3LA8A 4LSZA 1JJ7A 5EZSA 4EI8A 1SOVA 7REQA 1TAHA 2CLFB 1R16A 1XAGA 3DULA 2OFPA 1E7YA 3D7LA 1YBHA 1JHXA 4AULA 3LQYA 3NGMA 4ZO7A 4X71A 5IN5A 5MFZA 1OPRA 4FKZA 5AHXA 1XCOA 1F0YA 1VYVA 4E5NA 3U3XA 4QUBA 2JLSA 4U2GA 3UH1A 2D1FA 4EKNB 1U3GA 2YC2C 1XUOA 3VSDA 3DEJA 4IIFA 4ZRMA 1X6VA 4A0RA 4MRAA 3ZI4A 4A0FA 1UBEA 3MC1A 5HRCA 5KTOA 4JFRA 3OKCA 2HMSA 5LQDA 3DCYA 1VIDA 3Q7EA 3PL5A 1Z0IA 2H57A 3CO5A 4GP6A 1KEEB 2J30A 2AI1A 3S2UA 4LN1A 1WEKA 3A6ZA 3KLNA 4IOMA 4RS4A 5K3DA 1FTYA 3K0FA 4ZC1A 3EFEA 3ZEIA 2ZIFA 4MHTA 5HZKA 1YC5A 1DDOA 3BCHA 3HCEA 3VOTA 1KO7A 3ADDA 4P4UA 1HTTA 3LUFA 2F67A 3VTKA 3QE4A 2FK8A 3LDUA 2V6GA 3QHAA 5DNEA 4HO1X 3GN1A 2PKQP 1TVEA 2ZRFA 4Q01A 2B4AA 5DIFA 3DZ8A 2WKWA 3K6KA 4K6KA 4BJ6A 1SVUA 3KQNA 3ZD7A 2HSWA 3ZIAD 4Y9RA 3FRIA 1KDYA 1HH4A 3LTNC 1FP7A 3AJ8A 3TTSA 2CDRA 5JQGF 2FN4A 5HJEA 2PS0A 4H3HB 1Z22A 2ODEA 2OVBA 3AHHA 1R00A 1BE6A 1UPXA 1VG0B 3KXLA 4KQ2A 4Q9HA 5G0WA 2O7VA 3GLFE 9LDBA 1IG0A 3I76A 1U1EA 5B2FA 1O57A 3P9CA 2VAPA 3O4RA 1NRWA 4LXIA 1Q1QA 1KU6A 1M10A 4LC9A 1V8BA 4MQBA 4Z3OA 2XTJA 3GAFA 3HUTA 1VHDA 3GWZA 4JNCA 1VOTA 3WLFA 1YI8A 1NI4B 1TUBA 4QXRA 4BQFA 4YQZA 4B76A 3H1FA 1S7GA 1VI2A 3ER6A 3RUAA 1GZ4A 4UMEA 4DLUA 5B1YA 2FZVA 1XC7A 4Q4JB 3HXMA 1PT7A 2DLCX 1V11A 3A4TA 2PUEA 2G4LA 3GYGA 1MH9A 4ZVNA 4ND8B 4L95C 1YL5A 2UXCB 2X8WA 5LYJA 3VDRA 1RAAA 2ANBA 3GLTA 3KSBC 3OIYA 4BKQA 3DF9A 3L93A 1LJUA 2DUUA 4LJYA 1WJGA 3ORYA 5DBGA 5TMEA 1Z47A 1KDRA 1OXVA 1UDCA 3THWB 4WV3A 3P9RA 2ISQA 2WICA 3LCJA 1WM1A 3N0VA 4HX5A 2JLAA 1H93A 4JC5A 4N3NA 2DQYA 3FYUB 4O63O 1IQPA 3AJ9A 4ZJZA 3S1LA 3FNQA 4FP9A 4C76A 3D7RA 1YZKA 2H1LA 2CXTA 3ZQJA 4RTOA 2V7WA 1EESA 3MMNA 4N5IX 1WW3A 4YCNA 3LP6A 1VCIA 3NASA 2B35A 4WNYA 1T9CA 2GZHA 3ECCA 3VU9B 1U2EA 3MAAC 4FDMA 5AI5A 1U0SY 1FNBA 2Y1KA 1F8GA 4OVKA 1ZKDA 3VM6A 4B7UA 4DM3A 4Z4GA 3VC3A 2D54A 1O77A 4O8CA 4GU5A 4PC3A 3LI2A 1Z0JA 1NIPA 2Q3JA 4BLWA 5B1EA 4PHGA 2VN8A 2BZ1A 4Q1CA 1QH1B 4P38A 1J8YF 1QHXA 4H0FA 3GELA 1MW9X 3TBFA 1IY0A 1QCYA 4RA6A 4M9SA 1CJSA 1I4EB 1XTZA 3KZXA 5FKJA 1XA0A 1S2DA 2E4VA 4E6PA 5K8IA 1IAVA 3IDQA 4L1KA 2CLSA 4R68A 4Z2YA 5BQOA 3SPXA 1VE3A 2R3SA 4NV3A 4DRYA 1Y7TA 1NJGA 2AUNA 2X5OA 3KSRA 2AKYA 1P91A 4U0KA 1HQCA 5B6IA 3D6TB 1ULHA 4RFSB 5JPCA 1YKGA 3DBHA 2Q0QA 4KVFA 5CFQA 4JITA 3KKLA 5E8RA 2R6HA 3PNVA 3VU8A 4LYHA 2X2FA 5HX7A 2XNKA 5CTAA 1KRHA 1V25A 2XUDA 3ZXIA 2GILA 1EUCB 2XEDA 1PNQA 2VP9A 2W2KB 3I4FA 4N5DA 4WADA 2IY9A 3DXYA 3KQWA 5TR9A 1L4BA 2AMYA 2EEZA 2FKNA 1YC2A 3DOOA 3FWPA 1ZUNA 2WM2A 3AIIA 5D3KA 1DKRA 2AQKA 5AKLA 3TRIA 4B83A 2QJFA 1M54A 1NR1A 1H6DA 3PNOA 1NFFA 2EGHA 4NXNB 1AB6A 2A88A 4XCQA 4ZV9A 3NX4A 2HA6A 3FMVA 3ILYA 2DX7A 1MIOB 3LCCA 1QHHB 3N0XA 1B1CA 4NH4A 5BQ5A 1MPXA 3FNIA 4C9BA 2GPTA 2H9IA 3MTEA 5AHOA 2J0QA 3MGBA 3WB1A 5K09A 3SC6A 5I01A 3IKLA 1P1IA 5K0EA 3BGWA 2RARA 2Q1UA 4HAOA 2OZVA 5FR1A 4EI7A 1NM5C 1JHAA 2VH1A 3ZU3A 1FSGA 2MYPA 2PVSA 3CRRA 3K9BA 4ROSA 3KSZO 1RNLA 2R87A 1JDPA 1VCOA 4QDKA 4QXPA 2OAP1 2QLFA 4EG1A 3BILA 1MCZA 3ISTA 2IBTA 3RHZA 3AGPA 3PPIA 3O38A 3RSCA 3KEQA 1X7WA 3IB3A 3L2OB 5D01A 3ZH2A 4IWNA 3TSCA 4BJ5A 1AKQA 8OHMA 1O96B 3D3WB 1PYDA 5AKKA 1EFRA 2KB0A 3R2JA 3Q1KA 3C74A 4PHTA 1I33A 2OFFA 1LH0A 3KT8A 4JOBA 5ARDA 3V3TA 3R0IA 4FCTA 1KZ1A 4JV5B 3ER8A 3RWBA 1Y3AA 1WPQA 2FMKA 2D1YA 3GLSA 5CU7A 4BNLA 5BWLA 2D5BA 4RVOA 2WR8A 4MR7A 3G0HA 1YIAA 1Z18A 4L16A 1PLKA 3OLWA 4CQMD 2PG3A 3NBXX 4D6PA 3BKXA 1T3TA 4E31A 4GKJB 4H4EA 1MRSA 3HNRA 1PL0A 3DQZA 2QMOA 4W82A 3AYXB 1N2BA 5CYOA 2WAMA 3KOUA 1QRRA 2XVMA 1WW8A 3GEGA 3NDJA 2DHEA 3QNWA 5AKYA 3V4PB 1SG9A 2GZAA 3FCYA 1MP0A 5TXGA 2B36A 1Z88A 2V0CA 4G09A 1PLJA 4REQA 4UQPA 1PGNA 2CNDA 5CHYA 3S40A 1V41E 3HDJA 3OLCX 3PJDA 1WHTA 1I2AA 5IK2D 2BZGA 2QUIA 1NM5A 5BSEA 3G6KA 5JG7A 5JYEA 4LZNA 1WCYA 1VP3A 2PV0A 4N5MA 4JGIA 2ADOA 1D2GA 1UFVA 3OZFA 1UPBA 4RBNA 4E15A 2HUPA 3KOXA 3I73A 2I9PA 5LKAA 4XCXA 3MJDA 1RWPA 3F46A 4KOAA 4O3FA 2EKDA 3IPXA 1MAHA 3G2LA 3F8SA 4OO3A 1XPJA 1WBDA 3AVUA 2A7XA 1FW8A 5CAEA 4DCOA 2J3KA 2P0YA 2Q2WA 4UDXX 3VU3A 4QTZA 5F77A 1HA3A 1ZMXA 3GGDA 3O8QA 2P8JA 4PSDA 1NKTA 5SY4A 2RG1A 1JPJA 4BVHA 4JB0A 1MC4A 4L75A 2MYUA 3L7YA 5AVUA 1A8IA 1VGVA 2YV5A 3GNSA 2AC7A 3AJDA 3ZW9A 3KB8A 3SJ7A 4OK5A 3D1JA 3CN9A 3PS9A 4JKYA 1Z15A 2SKCA 3S2ZA 3DT9A 1UOQA 1DTWB 2C2MA 4QUAA 2RKOA 4AVYA 4MRMA 2MSWA 5JCJA 3WYFA 3BK2A 3TEFA 4MRVA 4AY2A 3EVBA 2Y1LA 3L0PA 1QRTA 5IT5A 3DO5A 2AX3A 4MI6A 3T8YA 3EQ7A 4DANA 2IK8A 3ZKAA 2R1TB 5IDVA 1EE9A 2AGVA 3LCVB 1KR2A 3V4VB 4TYNA 1ZOSA 1M67A 2DWOA 3QV1A 2Q5EA 1WIWA 1UBNA 2FLKA 1PWEA 1UBMS 4J9UE 4Q21A 4MUFA 2W83A 2GZRA 3CPSA 4LYJA 2Y0PA 4MLPA 1RQGA 3V7WA 4F91B 3DAPA 1XU7A 1P0MA 2P4HX 1AKUA 1W4AA 1WMDA 5DLDA 4W5TA 3DV2A 1BS2A 1F2TA 3CKLA 2FSSA 4KPUB 4PNHA 3WXMA 2C4TA 4HDQB 3OIUA 4RPLA 4EHKA 1KH1A 1NN5A 4IDPA 2AXPA 2Z3WA 3ND6A 3DD1A 5DYWA 3W5VA 4B71A 4YR9A 2FGKA 5HR5A 2EZ9A 4ENVA 1Z17A 5EUCA 3NBKA 2IYFA 4IZ6A 2QUZA 4Q1BA 1B0PA 3OEHD 5JS7A 1NBOA 5IJ0B 3B12A 1W0KA 3KEGA 4QOHA 1BA3A 3BAZA 1QF9A 1M2VB 2RGCA 3AI7A 4MUAA 4UTXA 4WGGA 4ZYYA 5BSKA 5BT8A 5CDTA 2YQZA 1ZD8A 3L4SO 2XMZA 2X5JO 2AG0A 2SECE 4MI3A 1F2VA 4IYRA 3SKVA 1Q21A 5FPYA 1GKUB 2ORYA 4WI1A 5K03A 1PDVA 4NP6A 2GDZA 4PGAA 4HH4A 3RW9A 1GPUA 1QB7A 1L7RA 1ORWA 1BX0A 1E0JA 2H85A 2ZEJA 1PD1A 3H8WA 4WEOA 4ZAZA 5AXDA 3NATA 1JJFA 3B1FA 3EUWA 3HKCB 4PC2A 1YRWA 3RUPA 1KY3A 4CG2A 2HBZA 3EGDB 4MNTA 5FJIA 1MOZA 3MTBA 1TQ6A 2VAWA 4JLSA 3H05A 3PWKA 3ROTA 2PLWA 3P7MA 3V1MA 4G36A 4RMNA 1Z82A 2C4UA 4RXMA 4HYYA 2F1IA 5ECGC 3USCS 2G5TA 4RTQA 4WD3A 3RUEA 5T41A 6Q21A 3V9PA 3ZNNA 2COUA 4FFVA 2F8SA 1OWOA 3MD0A 2ZBDA 4XQEA 4TSFA 1ZM4A 1FZQA 2N1MA 3DZHA 5BSFA 3QBVA 4NU0A 1V16A 3ASUA 2B30A 3PCRB 5MN5A 4IW3B 3L8ZA 2CVFA 3OKFA 4I1RA 4LISA 4Y6RA 3IEIA 3SYLA 1XMVA 1G2QA 3PJRA 1XZLA 2PSSA 2NSLA 3DNPA 4PZPA 4LOKA 1G8MA 1UMDA 1JU4A 2V6JA 1NBAA 4DBVO 2PUFA 4GSYA 1FSZA 1YO6A 4URYR 4ZPJA 3BTUA 1VKHA 1SA0A 3N59A 1XZFA 3GCDA 1CUFA 4LTDA 3SNHA 3V7NA 1T3SA 4A2WA 2JIOA 3SZGA 4EG4A 4YRZA 4I3HA 1BROA 4J03A 2FMTA 1QMGA 4RK5A 2IJGX 1JG7A 1DP4A 3OZRA 2PE5A 1G21E 3DUFA 4PYIA 4YP1A 1JH9A 2LCFA 2O7RA 1QZUA 3STUA 5JAOA 1ZC4A 1P7CA 2OHJA 1AKWA 2W6PA 5CFMA 2PT9A 4MW7A 2BEUA 5JV5A 1IZ0A 2ACVA 2HPAA 2H8GA 2O8CB 2Z4TA 4F2DA 4RH0A 1J09A 2F9FA 1GPAA 2ZTHA 2ET6A 4H3SA 4H7FA 4IUDS 2I4TA 2V65A 2QHXA 4R6XA 1GADO 2HLNA 4FMDB 4NJEB 5F1YA 2GYUA 2JATA 2X9VA 4RVNA 2DLDA 2VKTA 2WVHA 1E2BA 3D8SA 3U4QB 2PUAA 1J8VA 1VE1A 1W9HA 2PWBA 1VHJA 1PT6A 2I7XA 4LXUA 3OPNA 2MMGA 4GXNA 4KAAA 4MVJD 4X8OA 1R9JA 2B34A 2GUGA 5SY9A 2R9VA 2C9ZA 3IFSA 1IZ7A 3VYUB 2IS4A 4Q1EA 4I1IA 5LA6F