5AV5A

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5A00
4KHAA 1S32B 5AV6D 4KGCA 1P3KD 1BH8B 3LZ0B 3B6GA 3AFAC 2CV5A 5B24C 1KX3C 3AZGA 3X1UA 5B32C 3KXBC 3REKD 3KUYC 3AZJC 5AY8D 2NZDB 1F1EA 1KX5A 5B0YD 1P3AB 5KDMA 4EO5C 1M18D 5JA4A 4X23B 4J8VC 5BS7A 3REID 5AV6A 5G49B 3REJB 4ZUXC 5F99B 2RVQD 4H9OA 1TZYA 2NQBB 5GXQD 1P3MB 3V9RB 4XZQC 3AZMB 3W98C 5AY8A 3AZED 3C1CD 4Z5TB 4WZSB 3AZND 5B0YA 3NQUB 3AYWC 1BFMA 1P3ID 4J8UD 1P3BB 2F8NH 1M18A 3LZ1D 3B0CW 3REIA 2F8ND 1U35D 3AV2A 1ID3D 1H3OB 1F66D 2PYOD 3NQJB 5DNNB 4WU9D 3MVDC 5GXQA 1EQZD 5GT0D 4YM6B 3WKJB 3AZEA 5B40D 3C1CA 2HIOD 5B0ZC 3AZNA 4QLCD 5B33D 3O62D 4Z66C 2F8NG 4XUJB 3WA9B 3AZIC 5CPKB 3AZLD 1P3IA 4J8UA 5GT3D 5AV9B 3LZ1A 3X1VB 3X1SB 1M19D 5B2JB 2F8NA 4UUZA 1U35A 1F66A 1ID3A 2PYOA 3AZKA 3MGRB 2HUEB 3MGRC 4J8XC 3AZFC 1P34C 1P3GC 4WU9A 4KUDD 3AFAB 1EQZA 5B24B 5GT0A 4WNNB 5AVCA 3AZHD 5B32B 3KXBB 5B40A 3KUYB 5B1MA 3AZJB 4QLCA 2AROD 5B33A 3O62A 3UTBC 4NE6A 4YS3A 3AZLA 3LJAC 5GT3A 5B31D 3X1TD 1M19A 3WAAC 4H9PB 5JRGC 3W96D 4EO5B 5E5AC 1B67A 4J8VB 5AV8D 1BH9A 4H9QB 1ZLAD 3W97A 4ZUXB 4R8PC 1P3LD 3A6NA 3AZHA 2BYKB 5AVBC 1HQ3D 4XZQB 3W98B 1BH8A 4JJNC 3B6FD 5B31A 4KGCD 3X1TA 3B6GD 3AYWB 3W99C 2CV5C 3AZGC 5AV8A 5CPJD 1ZLAA 3UTAD 1P3PC 3MNND 5GSUD 1P3LA 3MVDB 3B0DC 1KX5C 3MGSD 3AN2C 5B2ID 1AOID 3B6FA 4CAYA 5B0ZB 3MGQC 4NE5A 1P3MA 4Z66B 4H9NB 5AV6C 3AZIB 1P3KC 1TZYD 4H9RB 4Z5TA 5CPJA 4J8XB 3REKC 3AZFB 1P34B 3UTAA 3MNNA 4CSRA 1KU5A 1P3GB 5GSUA 1P3BA 4G92C 3R45A 3B0BA 3B0CT 3VH6W 3MGSA 5BNXA 5B2IA 5BNVA 4G91C 5B0YC 1AOIA 3NQJA 5DNNA 1M18C 3UTBB 3AV2D 3REIC 3KWQD 3LJAB 1A7WA 5BO0B 5DNMD 2RVQC 3WAAB 5JRGB 5GXQC 5E5AB 1P3OD 5CP6D 5CPKA 1JFIA 3AZEC 3C1CC 3UT9D 4R8PB 3AZNC 1KX4D 3AV1D 4H9SA 5AVBB 4WV4B 5CPID 2FJ7D 1P3IC 4J8UC 5B32G 2YFVA 1P3FD 3LZ1C 4JJNB 3KWQA 3AZKD 1U35C 1F66C 5FUGB 1ID3C 2PYOC 5DNMA 4WU9C 1M1AD 3W99B 4J8WD 1P3OA 2CV5B 1EQZC 3LELD 5CP6A 5AVCD 5GT0C 3AZGB 5B1MD 5B40C 3UT9A 3TU4D 1HTAA 2HIOC 1P3PB 3RELD 4H9PA 3VH5W 4QLCC 5B1LC 1KX4A 5AV5D 3AV1A 5B33C 4YS3D 3O62C 3B0DB 5CPIA 1KX5B 2BYMA 3AZLC 2FJ7A 5GT3C 3AN2B 4H9QA 1P3FA 1N1JA 4LD9D 3C1BD 1M19C 5KDMB 3WTPE 4WU8D 3MGQB 5JA4B 4E45A 3W97D 5AV6B 1M1AA 4KUDC 3VH6A 3WTPD 1P3KB 4J8WA 3MGPD 1KX3B 3REHD 3LELA 4HGAC 3A6ND 4H9OB 3AZHC 1S32D 3TU4A 3REKB 3LZ0D 3AYWA 3RELA 5AV5A 2AROC 4G92B 5B31C 5B0YB 4G91B 3X1TC 4LD9A 3C1BA 3W96C 1P3GD 2NZDD 4WU8A 1M18B 3REIB 5AV8C 1P3AD 1ZLAC 3WTPA 3MGPA 3REHA 1P3LC 4X23D 5GXQB 4NE3A 1S32A 3REJD 4Z66A 1HQ3C 3LZ0A 5F99D 3AZIA 1TAFB 3AZEB 2NQBD 3C1CB 3B6FC 3AZNB 1P3MD 2F8NK 4KGCC 3AZMD 4J8XA 3AZFA 1P34A 3B6GC 1P3GA 1P3IB 2NZDA 3KSYA 4J8UB 4Z5TD 3X1UC 3LZ1B 1WWIA 2IO5C 2F8NB 4UUZB 3VH6T 5CPJC 1U35B 1P3AA 1ID3B 1F66B 2PYOB 1P3BD 3UTAC 3MNNC 5GSUC 4X23A 4WU9B 1EQZB 5G49A 3REJA 3MGSC 5GT0B 5F99A 5B2IC 4NFTA 1AOIC 2LY8A 2NQBA 5DNND 5B40B 2HIOB 3WAAA 5JRGA 4QLCB 3V9RA 5B1LB 5E5AA 5BS7C 5B33B 3O62B 3AZMA 4YM6D 3WKJD 3AZLB 5GT3B 1TZYC 2YFWB 1M19B 3NQUA 4XUJD 3WA9D 4Z2MH 5CPKD 5BT1D 5AY8C 5AV9D 1BH9B 3X1VD 3X1SD 4KUDB 5B2JD 4HGAB 1H3OA 3MGRD 3MGQD 5FUGA 3AZHB 3AFAD 3W99A 5B24D 1KX3D 2AROB 3AV2C 3KWQC 5C3IC 5B32D 4YM6A 3KXBD 3WKJA 5B31B 3KUYD 3AZJD 5DNMC 3X1TB 1P3PA 3W96B 4Z2MG 3VH5T 1R4VA 4XUJA 1P3OC 3WA9A 5CP6C 5AV9A 5AV8B 4AWLC 4DRAA 3AN2A 3X1VA 3X1SA 1ZLAB 3UT9C 5B2JA 1P3LB 1KX4C 3MGRA 3MGQA 4J8VD 3AV1C 2JSSA 5CPIC 2FJ7C 1HQ3B 4ZUXD 3AFAA 1P3FC 1P3KA 5B24A 1KX3A 3B6FB 4WNNA 4CAYB 3AZKC 4ZBJC 5B32A 3KXBA 4KHAB 4XZQD 3KUYA 4KGCB 3AZJA 3REKA 3W98D 3B6GB 1M1AC 4J8WC 3X1UB 3LELC 5AVCC 2IO5B 5CPJB 5B1MC 3AYWD 3TU4C 3UTAB 3MNNB 4CSRB 3RELC 5GSUB 5AV5C 4J8VA 4YS3C 3R45B 2CWEA 3MGSB 5BNXB 4ZUXA 5B2IB 5BNVB 1AOIB 4E44A 4LD9C 3C1BC 3MVDD 4WU8C 2BYKA 4XZQA 3W97C 3W98A 1TAFA 3WTPC 3MGPC 1TZYB 5B0ZD 3REHC 3A6NC 2L5AA 4M6BA 5B1LD 4Z66D 1S32C 3AZID 3LZ0C 5AY8B 1JFIB 4J8XD 3AZFD 1P34D 3MVDA 2NZDC 2YFVB 3AV2B 3KWQB 5C3IB 1P3AC 5B0ZA 5DNMB 2HIOA 4X23C 3UTBD 5B1LA 1P3OB 4H9NA 3REJC 5CP6B 3LJAD 1B6WA 5F99C 4AWLB 4H9RA 2NQBC 3WAAD 5JRGD 3UT9B 2YFWA 5E5AD 1P3MC 1KX4B 3AV1B 3AZMC 5CPIB 2BYMB 2FJ7B 4R8PD 1P3FB 4Z5TC 4KUDA 1N1JB 3VH5A 3AZKB 4ZBJB 5AVBD 1P3BC 5B31G 4JJND 3UTBA 1M1AB 4J8WB 2AROA 3LELB 5AVCB 3LJAA 1WWSA 5BO0A 5B1MB 5DNNC 3TU4B 3W99D 3W96A 3RELB 2CV5D 5AV5B 3AZGD 3X1UD 4YS3B 4DRBA 5CHLB 4YM6C 3WKJC 4R8PA 1P3PD 4LD9B 3C1BB 4WU8B 4XUJC 3WA9C 5AVBA 1KX5D 5CPKC 5BT1C 3AN2D 5AV9C 1HQ3A 3W97B 3X1VC 4JJNA 3X1SC 3WTPB 5B2JC 3MGPB 3REHB 1Q9CA 1ULYA 3A6NB 4H9SC 2HUEC
chains in the Genus database with same CATH superfamily
4KHAA 1S32B 5AV6D 4KGCA 1P3KD 1BH8B 3LZ0B 3B6GA 3AFAC 2CV5A 5B24C 1KX3C 3AZGA 3X1UA 5B32C 3KXBC 3REKD 3KUYC 3AZJC 5AY8D 2NZDB 1F1EA 1KX5A 5B0YD 1P3AB 5KDMA 4EO5C 1M18D 5JA4A 4X23B 4J8VC 5BS7A 3REID 5AV6A 5G49B 3REJB 4ZUXC 5F99B 2RVQD 4H9OA 1TZYA 2NQBB 2XD5A 5GXQD 1P3MB 3V9RB 4XZQC 3AZMB 3W98C 5AY8A 3AZED 3C1CD 4Z5TB 4WZSB 3AZND 2Y2LA 5B0YA 3NQUB 3AYWC 1BFMA 1P3ID 4J8UD 2BG1A 1P3BB 2F8NH 1M18A 3LZ1D 3B0CW 3REIA 2F8ND 1U35D 3AV2A 1ID3D 1H3OB 1F66D 2PYOD 3EPKA 3NQJB 5DNNB 4WU9D 3MVDC 5GXQA 1EQZD 5GT0D 3F6TA 4YM6B 3WKJB 3AZEA 2Y2KA 5B40D 3C1CA 2HIOD 5B0ZC 3AZNA 2DF4C 2F2AC 4QLCD 5B33D 3O62D 2ZY3A 4Z66C 2F8NG 4XUJB 3WA9B 3AZIC 5CPKB 3AZLD 1P3IA 4J8UA 5GT3D 5AV9B 3LZ1A 3X1VB 3X1SB 1M19D 5B2JB 2F8NA 4UUZA 1U35A 1F66A 1ID3A 2PYOA 3AZKA 3MGRB 2HUEB 3MGRC 4J8XC 3AZFC 1P34C 1P3GC 2Y2IA 4WU9A 4KUDD 3AFAB 1EQZA 5B24B 5GT0A 4WNNB 5AVCA 3AZHD 5B32B 3KXBB 5B40A 3KUYB 5B1MA 3AZJB 4QLCA 2AROD 5B33A 3O62A 3UTBC 4NE6A 4YS3A 3AZLA 3LJAC 5GT3A 5B31D 3X1TD 2Y2PA 1M19A 3WAAC 4H9PB 5JRGC 3W96D 4EO5B 5E5AC 1B67A 4J8VB 5AV8D 1BH9A 4H9QB 1ZLAD 3W97A 4ZUXB 4R8PC 1P3LD 3A6NA 3AZHA 3EPJA 2BYKB 5AVBC 1HQ3D 4XZQB 3W98B 1BH8A 4JJNC 3B6FD 5B31A 3EPHA 4KGCD 3X1TA 3B6GD 3AYWB 3W99C 2JE5A 2CV5C 3AZGC 5AV8A 5CPJD 2XD1A 1ZLAA 3UTAD 1P3PC 3MNND 4DQYB 5GSUD 1P3LA 3MVDB 3B0DC 1KX5C 3MGSD 3AN2C 2W8SA 5B2ID 2UWXA 1AOID 3B6FA 4CAYA 5B0ZB 3MGQC 4NE5A 1P3MA 4Z66B 4H9NB 5AV6C 3AZIB 1P3KC 1TZYD 4H9RB 4Z5TA 5CPJA 2Y2NA 4J8XB 3REKC 3AZFB 1P34B 3UTAA 3MNNA 4CSRA 1KU5A 3H0MC 5GSUA 1P3GB 1P3BA 4G92C 3R45A 3B0BA 3B0CT 3VH6W 3MGSA 5BNXA 5B2IA 5BNVA 4G91C 5B0YC 1AOIA 3NQJA 5DNNA 2ZY5A 1M18C 3UTBB 3AV2D 3REIC 3KWQD 3LJAB 1A7WA 5BO0B 5DNMD 2RVQC 3WAAB 5JRGB 5GXQC 5E5AB 1P3OD 2FFFB 5CP6D 5CPKA 1JFIA 3AZEC 3C1CC 3UT9D 4R8PB 3AZNC 1KX4D 3AV1D 3H0LC 4H9SA 5AVBB 4WV4B 5CPID 2FJ7D 1P3IC 3EPLA 1PZRA 5B32G 2YFVA 4J8UC 1P3FD 3LZ1C 4JJNB 3KWQA 3AZKD 1U35C 1F66C 5FUGB 1ID3C 2PYOC 5DNMA 4WU9C 1M1AD 3A1KA 3W99B 4J8WD 1P3OA 2CV5B 1EQZC 3LELD 5CP6A 5AVCD 5GT0C 3AZGB 5B1MD 5B40C 3UT9A 3TU4D 1HTAA 2HIOC 1P3PB 3RELD 4H9PA 3VH5W 4QLCC 5B1LC 1KX4A 5AV5D 3AV1A 3FDDA 4YS3D 3O62C 3B0DB 5B33C 5CPIA 1KX5B 2BYMA 3AZLC 2FJ7A 5GT3C 3AN2B 4H9QA 1P3FA 1N1JA 4LD9D 3C1BD 1M19C 5KDMB 3WTPE 4WU8D 3MGQB 5JA4B 4E45A 3W97D 5AV6B 1M1AA 4KUDC 3VH6A 3WTPD 1P3KB 4J8WA 3MGPD 1KX3B 3REHD 3LELA 4HGAC 3A6ND 4H9OB 4UPKA 3AZHC 1S32D 3TU4A 3REKB 3LZ0D 3AYWA 3RELA 5AV5A 2AROC 4G92B 5B31C 4WJ3C 5B0YB 2Y2QA 4G91B 3X1TC 4LD9A 3C1BA 3W96C 1P3GD 2NZDD 4WU8A 1M18B 3REIB 2G5IC 5AV8C 1P3AD 1ZLAC 2Y2HA 3WTPA 3MGPA 3REHA 1P3LC 4X23D 5GXQB 4NE3A 3A1IA 1S32A 3REJD 4Z66A 1HQ3C 3LZ0A 5F99D 3AZIA 1TAFB 3AZEB 2NQBD 3C1CB 3B6FC 3AZNB 1P3MD 2F8NK 4KGCC 3AZMD 4J8XA 3AZFA 1P34A 3B6GC 1P3GA 1P3IB 2NZDA 3KSYA 4J8UB 4Z5TD 3X1UC 3LZ1B 2ZY4A 1WWIA 2IO5C 2F8NB 4UUZB 3VH6T 5CPJC 1U35B 1P3AA 1ID3B 1F66B 2PYOB 1P3BD 3UTAC 3MNNC 5GSUC 4X23A 4WU9B 2DQNC 2Y2JA 1EQZB 5G49A 3REJA 3MGSC 5GT0B 5F99A 5B2IC 4NFTA 1AOIC 2LY8A 2NQBA 5DNND 5B40B 2HIOB 3WAAA 5JRGA 3V9RA 5B1LB 5E5AA 5BS7C 4QLCB 5B33B 3O62B 3AZMA 4YM6D 3WKJD 3AZLB 5GT3B 1TZYC 2YFWB 1M19B 3P5JB 3NQUA 4XUJD 3WA9D 4Z2MH 5CPKD 5BT1D 5AY8C 5AV9D 1BH9B 3X1VD 3X1SD 4KUDB 5B2JD 4HGAB 1H3OA 3MGRD 3MGQD 5FUGA 3AZHB 3AFAD 3W99A 2RIQA 5B24D 1KX3D 2AROB 3AV2C 3KWQC 5C3IC 5B32D 4YM6A 3KXBD 3WKJA 5B31B 3KUYD 3AZJD 5DNMC 3X1TB 1P3PA 3W96B 4Z2MG 3VH5T 1R4VA 4XUJA 1P3OC 3WA9A 2VQRA 5CP6C 5AV9A 5AV8B 4AWLC 1Z2CB 4DRAA 3AN2A 3X1VA 3X1SA 1ZLAB 3UT9C 5B2JA 1W2EA 1P3LB 1KX4C 3MGRA 3MGQA 4J8VD 3AV1C 2JSSA 5CPIC 2FJ7C 1HQ3B 4ZUXD 3AFAA 1P3FC 1P3KA 5B24A 1KX3A 3B6FB 4WNNA 4CAYB 3AZKC 4ZBJC 5B32A 3KXBA 4KHAB 4XZQD 3KUYA 4KGCB 2Y2GA 3AZJA 3REKA 3W98D 3B6GB 1M1AC 4J8WC 3X1UB 3LELC 5AVCC 2IO5B 5CPJB 5B1MC 3AYWD 3TU4C 3UTAB 3MNNB 4CSRB 3RELC 5GSUB 5AV5C 4J8VA 4YS3C 3R45B 2CWEA 3MGSB 5BNXB 4ZUXA 5B2IB 5BNVB 1AOIB 4E44A 4LD9C 3C1BC 3MVDD 4WU8C 2BYKA 4XZQA 3W97C 3W98A 1TAFA 2ZY2A 3WTPC 3MGPC 1TZYB 5B0ZD 3REHC 2Y2OA 3A6NC 2L5AA 4M6BA 5B1LD 4Z66D 1S32C 3AZID 3LZ0C 5AY8B 1JFIB 2ZM5A 4J8XD 3AZFD 1P34D 2Y2MA 3MVDA 2NZDC 2YFVB 1T3UA 3AV2B 2JCHA 3KWQB 5C3IB 1P3AC 5B0ZA 5DNMB 2HIOA 4X23C 3UTBD 5B1LA 1P3OB 4H9NA 3REJC 5CP6B 3LJAD 1B6WA 3IP4C 5F99C 4AWLB 4H9RA 2NQBC 3WAAD 5JRGD 3UT9B 2YFWA 5E5AD 3EG5B 1P3MC 1KX4B 3AL0C 3AV1B 3AZMC 5CPIB 2BYMB 2FJ7B 3H0RC 4R8PD 1P3FB 4Z5TC 4KUDA 1N1JB 3VH5A 3AZKB 4ZBJB 5AVBD 1P3BC 5B31G 4JJND 3UTBA 1M1AB 4J8WB 2AROA 3LELB 2J8PA 5AVCB 3LJAA 1WWSA 5BO0A 5B1MB 5DNNC 3TU4B 3W99D 3W96A 3RELB 2CV5D 5AV5B 3AZGD 3X1UD 4YS3B 4DRBA 5CHLB 4YM6C 3WKJC 4R8PA 1P3PD 4LD9B 3C1BB 4WU8B 4XUJC 3WA9C 5AVBA 1KX5D 2G5HC 5CPKC 5BT1C 3AN2D 5AV9C 1HQ3A 3W97B 3X1VC 4JJNA 3X1SC 3WTPB 5B2JC 3MGPB 3REHB 1Q9CA 3KFUG 1ULYA 3A6NB 4H9SC 2HUEC
chains in the Genus database with same CATH topology
4KHAA 1S32B 5AV6D 4KGCA 1P3KD 1BH8B 3LZ0B 3B6GA 3AFAC 2CV5A 5B24C 1KX3C 3AZGA 3X1UA 5B32C 3KXBC 3REKD 3KUYC 3AZJC 5AY8D 2NZDB 1F1EA 1KX5A 5B0YD 1P3AB 5KDMA 4EO5C 1M18D 5JA4A 4X23B 4J8VC 5BS7A 3REID 5AV6A 5G49B 3REJB 4ZUXC 5F99B 2RVQD 4H9OA 1TZYA 2NQBB 2XD5A 5GXQD 1P3MB 3V9RB 4XZQC 3AZMB 3W98C 5AY8A 3AZED 3C1CD 4Z5TB 4WZSB 3AZND 2Y2LA 5B0YA 3NQUB 3AYWC 1BFMA 1P3ID 4J8UD 2BG1A 1P3BB 2F8NH 1M18A 3LZ1D 3B0CW 3REIA 2F8ND 1U35D 3AV2A 1ID3D 1H3OB 1F66D 2PYOD 3EPKA 3NQJB 5DNNB 4WU9D 3MVDC 5GXQA 1EQZD 5GT0D 3F6TA 4YM6B 3WKJB 3AZEA 2Y2KA 5B40D 3C1CA 2HIOD 5B0ZC 3AZNA 2DF4C 2F2AC 4QLCD 5B33D 3O62D 2ZY3A 4Z66C 2F8NG 4XUJB 3WA9B 3AZIC 5CPKB 3AZLD 1P3IA 4J8UA 5GT3D 5AV9B 3LZ1A 3X1VB 3X1SB 1M19D 5B2JB 2F8NA 4UUZA 1U35A 1F66A 1ID3A 2PYOA 3AZKA 3MGRB 2HUEB 3MGRC 4J8XC 3AZFC 1P34C 1P3GC 2Y2IA 4WU9A 4KUDD 3AFAB 1EQZA 5B24B 5GT0A 4WNNB 5AVCA 3AZHD 5B32B 3KXBB 5B40A 3KUYB 5B1MA 3AZJB 4QLCA 2AROD 5B33A 3O62A 3UTBC 4NE6A 4YS3A 3AZLA 3LJAC 5GT3A 5B31D 3X1TD 2Y2PA 1M19A 3WAAC 4H9PB 5JRGC 3W96D 4EO5B 5E5AC 1B67A 4J8VB 5AV8D 1BH9A 4H9QB 1ZLAD 3W97A 4ZUXB 4R8PC 1P3LD 3A6NA 3AZHA 3EPJA 2BYKB 5AVBC 1HQ3D 4XZQB 3W98B 1BH8A 4JJNC 3B6FD 5B31A 3EPHA 4KGCD 3X1TA 3B6GD 3AYWB 3W99C 2JE5A 2CV5C 3AZGC 5AV8A 5CPJD 2XD1A 1ZLAA 3UTAD 1P3PC 3MNND 4DQYB 5GSUD 1P3LA 3MVDB 3B0DC 1KX5C 3MGSD 3AN2C 2W8SA 5B2ID 2UWXA 1AOID 3B6FA 4CAYA 5B0ZB 3MGQC 4NE5A 1P3MA 4Z66B 4H9NB 5AV6C 3AZIB 1P3KC 1TZYD 4H9RB 4Z5TA 5CPJA 2Y2NA 4J8XB 3REKC 3AZFB 1P34B 3UTAA 3MNNA 4CSRA 1KU5A 3H0MC 5GSUA 1P3GB 1P3BA 4G92C 3R45A 3B0BA 3B0CT 3VH6W 3MGSA 5BNXA 5B2IA 5BNVA 4G91C 5B0YC 1AOIA 3NQJA 5DNNA 2ZY5A 1M18C 3UTBB 3AV2D 3REIC 3KWQD 3LJAB 1A7WA 5BO0B 5DNMD 2RVQC 3WAAB 5JRGB 5GXQC 5E5AB 1P3OD 2FFFB 5CP6D 5CPKA 1JFIA 3AZEC 3C1CC 3UT9D 4R8PB 3AZNC 1KX4D 3AV1D 3H0LC 4H9SA 5AVBB 4WV4B 5CPID 2FJ7D 1P3IC 3EPLA 1PZRA 5B32G 2YFVA 4J8UC 1P3FD 3LZ1C 4JJNB 3KWQA 3AZKD 1U35C 1F66C 5FUGB 1ID3C 2PYOC 5DNMA 4WU9C 1M1AD 3A1KA 3W99B 4J8WD 1P3OA 2CV5B 1EQZC 3LELD 5CP6A 5AVCD 5GT0C 3AZGB 5B1MD 5B40C 3UT9A 3TU4D 1HTAA 2HIOC 1P3PB 3RELD 4H9PA 3VH5W 4QLCC 5B1LC 1KX4A 5AV5D 3AV1A 3FDDA 4YS3D 3O62C 3B0DB 5B33C 5CPIA 1KX5B 2BYMA 3AZLC 2FJ7A 5GT3C 3AN2B 4H9QA 1P3FA 1N1JA 4LD9D 3C1BD 1M19C 5KDMB 3WTPE 4WU8D 3MGQB 5JA4B 4E45A 3W97D 5AV6B 1M1AA 4KUDC 3VH6A 3WTPD 1P3KB 4J8WA 3MGPD 1KX3B 3REHD 3LELA 4HGAC 3A6ND 4H9OB 4UPKA 3AZHC 1S32D 3TU4A 3REKB 3LZ0D 3AYWA 3RELA 5AV5A 2AROC 4G92B 5B31C 4WJ3C 5B0YB 2Y2QA 4G91B 3X1TC 4LD9A 3C1BA 3W96C 1P3GD 2NZDD 4WU8A 1M18B 3REIB 2G5IC 5AV8C 1P3AD 1ZLAC 2Y2HA 3WTPA 3MGPA 3REHA 1P3LC 4X23D 5GXQB 4NE3A 3A1IA 1S32A 3REJD 4Z66A 1HQ3C 3LZ0A 5F99D 3AZIA 1TAFB 3AZEB 2NQBD 3C1CB 3B6FC 3AZNB 1P3MD 2F8NK 4KGCC 3AZMD 4J8XA 3AZFA 1P34A 3B6GC 1P3GA 1P3IB 2NZDA 3KSYA 4J8UB 4Z5TD 3X1UC 3LZ1B 2ZY4A 1WWIA 2IO5C 2F8NB 4UUZB 3VH6T 5CPJC 1U35B 1P3AA 1ID3B 1F66B 2PYOB 1P3BD 3UTAC 3MNNC 5GSUC 4X23A 4WU9B 2DQNC 2Y2JA 1EQZB 5G49A 3REJA 3MGSC 5GT0B 5F99A 5B2IC 4NFTA 1AOIC 2LY8A 2NQBA 5DNND 5B40B 2HIOB 3WAAA 5JRGA 3V9RA 5B1LB 5E5AA 5BS7C 4QLCB 5B33B 3O62B 3AZMA 4YM6D 3WKJD 3AZLB 5GT3B 1TZYC 2YFWB 1M19B 3P5JB 3NQUA 4XUJD 3WA9D 4Z2MH 5CPKD 5BT1D 5AY8C 5AV9D 1BH9B 3X1VD 3X1SD 4KUDB 5B2JD 4HGAB 1H3OA 3MGRD 3MGQD 5FUGA 3AZHB 3AFAD 3W99A 2RIQA 5B24D 1KX3D 2AROB 3AV2C 3KWQC 5C3IC 5B32D 4YM6A 3KXBD 3WKJA 5B31B 3KUYD 3AZJD 5DNMC 3X1TB 1P3PA 3W96B 4Z2MG 3VH5T 1R4VA 4XUJA 1P3OC 3WA9A 2VQRA 5CP6C 5AV9A 5AV8B 4AWLC 1Z2CB 4DRAA 3AN2A 3X1VA 3X1SA 1ZLAB 3UT9C 5B2JA 1W2EA 1P3LB 1KX4C 3MGRA 3MGQA 4J8VD 3AV1C 2JSSA 5CPIC 2FJ7C 1HQ3B 4ZUXD 3AFAA 1P3FC 1P3KA 5B24A 1KX3A 3B6FB 4WNNA 4CAYB 3AZKC 4ZBJC 5B32A 3KXBA 4KHAB 4XZQD 3KUYA 4KGCB 2Y2GA 3AZJA 3REKA 3W98D 3B6GB 1M1AC 4J8WC 3X1UB 3LELC 5AVCC 2IO5B 5CPJB 5B1MC 3AYWD 3TU4C 3UTAB 3MNNB 4CSRB 3RELC 5GSUB 5AV5C 4J8VA 4YS3C 3R45B 2CWEA 3MGSB 5BNXB 4ZUXA 5B2IB 5BNVB 1AOIB 4E44A 4LD9C 3C1BC 3MVDD 4WU8C 2BYKA 4XZQA 3W97C 3W98A 1TAFA 2ZY2A 3WTPC 3MGPC 1TZYB 5B0ZD 3REHC 2Y2OA 3A6NC 2L5AA 4M6BA 5B1LD 4Z66D 1S32C 3AZID 3LZ0C 5AY8B 1JFIB 2ZM5A 4J8XD 3AZFD 1P34D 2Y2MA 3MVDA 2NZDC 2YFVB 1T3UA 3AV2B 2JCHA 3KWQB 5C3IB 1P3AC 5B0ZA 5DNMB 2HIOA 4X23C 3UTBD 5B1LA 1P3OB 4H9NA 3REJC 5CP6B 3LJAD 1B6WA 3IP4C 5F99C 4AWLB 4H9RA 2NQBC 3WAAD 5JRGD 3UT9B 2YFWA 5E5AD 3EG5B 1P3MC 1KX4B 3AL0C 3AV1B 3AZMC 5CPIB 2BYMB 2FJ7B 3H0RC 4R8PD 1P3FB 4Z5TC 4KUDA 1N1JB 3VH5A 3AZKB 4ZBJB 5AVBD 1P3BC 5B31G 4JJND 3UTBA 1M1AB 4J8WB 2AROA 3LELB 2J8PA 5AVCB 3LJAA 1WWSA 5BO0A 5B1MB 5DNNC 3TU4B 3W99D 3W96A 3RELB 2CV5D 5AV5B 3AZGD 3X1UD 4YS3B 4DRBA 5CHLB 4YM6C 3WKJC 4R8PA 1P3PD 4LD9B 3C1BB 4WU8B 4XUJC 3WA9C 5AVBA 1KX5D 2G5HC 5CPKC 5BT1C 3AN2D 5AV9C 1HQ3A 3W97B 3X1VC 4JJNA 3X1SC 3WTPB 5B2JC 3MGPB 3REHB 1Q9CA 3KFUG 1ULYA 3A6NB 4H9SC 2HUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA A;  1S32 B;  5AV6 D;  4KGC A;  1P3K D;  1BH8 B;  3LZ0 B;  3B6G A;  3AFA C;  2CV5 A;  5B24 C;  1KX3 C;  3AZG A;  3X1U A;  5B32 C;  3KXB C;  3REK D;  3KUY C;  3AZJ C;  5AY8 D;  2NZD B;  1F1E A;  1KX5 A;  5B0Y D;  1P3A B;  5KDM A;  4EO5 C;  1M18 D;  5JA4 A;  4X23 B;  4J8V C;  5BS7 A;  3REI D;  5AV6 A;  5G49 B;  3REJ B;  4ZUX C;  5F99 B;  2RVQ D;  4H9O A;  1TZY A;  2NQB B;  5GXQ D;  1P3M B;  3V9R B;  4XZQ C;  3AZM B;  3W98 C;  5AY8 A;  3AZE D;  3C1C D;  4Z5T B;  4WZS B;  3AZN D;  5B0Y A;  3NQU B;  3AYW C;  1BFM A;  1P3I D;  4J8U D;  1P3B B;  2F8N H;  1M18 A;  3LZ1 D;  3B0C W;  3REI A;  2F8N D;  1U35 D;  3AV2 A;  1ID3 D;  1H3O B;  1F66 D;  2PYO D;  3NQJ B;  5DNN B;  4WU9 D;  3MVD C;  5GXQ A;  1EQZ D;  5GT0 D;  4YM6 B;  3WKJ B;  3AZE A;  5B40 D;  3C1C A;  2HIO D;  5B0Z C;  3AZN A;  4QLC D;  5B33 D;  3O62 D;  4Z66 C;  2F8N G;  4XUJ B;  3WA9 B;  3AZI C;  5CPK B;  3AZL D;  1P3I A;  4J8U A;  5GT3 D;  5AV9 B;  3LZ1 A;  3X1V B;  3X1S B;  1M19 D;  5B2J B;  2F8N A;  4UUZ A;  1U35 A;  1F66 A;  1ID3 A;  2PYO A;  3AZK A;  3MGR B;  2HUE B;  3MGR C;  4J8X C;  3AZF C;  1P34 C;  1P3G C;  4WU9 A;  4KUD D;  3AFA B;  1EQZ A;  5B24 B;  5GT0 A;  4WNN B;  5AVC A;  3AZH D;  5B32 B;  3KXB B;  5B40 A;  3KUY B;  5B1M A;  3AZJ B;  4QLC A;  2ARO D;  5B33 A;  3O62 A;  3UTB C;  4NE6 A;  4YS3 A;  3AZL A;  3LJA C;  5GT3 A;  5B31 D;  3X1T D;  1M19 A;  3WAA C;  4H9P B;  5JRG C;  3W96 D;  4EO5 B;  5E5A C;  1B67 A;  4J8V B;  5AV8 D;  1BH9 A;  4H9Q B;  1ZLA D;  3W97 A;  4ZUX B;  4R8P C;  1P3L D;  3A6N A;  3AZH A;  2BYK B;  5AVB C;  1HQ3 D;  4XZQ B;  3W98 B;  1BH8 A;  4JJN C;  3B6F D;  5B31 A;  4KGC D;  3X1T A;  3B6G D;  3AYW B;  3W99 C;  2CV5 C;  3AZG C;  5AV8 A;  5CPJ D;  1ZLA A;  3UTA D;  1P3P C;  3MNN D;  5GSU D;  1P3L A;  3MVD B;  3B0D C;  1KX5 C;  3MGS D;  3AN2 C;  5B2I D;  1AOI D;  3B6F A;  4CAY A;  5B0Z B;  3MGQ C;  4NE5 A;  1P3M A;  4Z66 B;  4H9N B;  5AV6 C;  3AZI B;  1P3K C;  1TZY D;  4H9R B;  4Z5T A;  5CPJ A;  4J8X B;  3REK C;  3AZF B;  1P34 B;  3UTA A;  3MNN A;  4CSR A;  1KU5 A;  1P3G B;  5GSU A;  1P3B A;  4G92 C;  3R45 A;  3B0B A;  3B0C T;  3VH6 W;  3MGS A;  5BNX A;  5B2I A;  5BNV A;  4G91 C;  5B0Y C;  1AOI A;  3NQJ A;  5DNN A;  1M18 C;  3UTB B;  3AV2 D;  3REI C;  3KWQ D;  3LJA B;  1A7W A;  5BO0 B;  5DNM D;  2RVQ C;  3WAA B;  5JRG B;  5GXQ C;  5E5A B;  1P3O D;  5CP6 D;  5CPK A;  1JFI A;  3AZE C;  3C1C C;  3UT9 D;  4R8P B;  3AZN C;  1KX4 D;  3AV1 D;  4H9S A;  5AVB B;  4WV4 B;  5CPI D;  2FJ7 D;  1P3I C;  4J8U C;  5B32 G;  2YFV A;  1P3F D;  3LZ1 C;  4JJN B;  3KWQ A;  3AZK D;  1U35 C;  1F66 C;  5FUG B;  1ID3 C;  2PYO C;  5DNM A;  4WU9 C;  1M1A D;  3W99 B;  4J8W D;  1P3O A;  2CV5 B;  1EQZ C;  3LEL D;  5CP6 A;  5AVC D;  5GT0 C;  3AZG B;  5B1M D;  5B40 C;  3UT9 A;  3TU4 D;  1HTA A;  2HIO C;  1P3P B;  3REL D;  4H9P A;  3VH5 W;  4QLC C;  5B1L C;  1KX4 A;  5AV5 D;  3AV1 A;  5B33 C;  4YS3 D;  3O62 C;  3B0D B;  5CPI A;  1KX5 B;  2BYM A;  3AZL C;  2FJ7 A;  5GT3 C;  3AN2 B;  4H9Q A;  1P3F A;  1N1J A;  4LD9 D;  3C1B D;  1M19 C;  5KDM B;  3WTP E;  4WU8 D;  3MGQ B;  5JA4 B;  4E45 A;  3W97 D;  5AV6 B;  1M1A A;  4KUD C;  3VH6 A;  3WTP D;  1P3K B;  4J8W A;  3MGP D;  1KX3 B;  3REH D;  3LEL A;  4HGA C;  3A6N D;  4H9O B;  3AZH C;  1S32 D;  3TU4 A;  3REK B;  3LZ0 D;  3AYW A;  3REL A;  5AV5 A;  2ARO C;  4G92 B;  5B31 C;  5B0Y B;  4G91 B;  3X1T C;  4LD9 A;  3C1B A;  3W96 C;  1P3G D;  2NZD D;  4WU8 A;  1M18 B;  3REI B;  5AV8 C;  1P3A D;  1ZLA C;  3WTP A;  3MGP A;  3REH A;  1P3L C;  4X23 D;  5GXQ B;  4NE3 A;  1S32 A;  3REJ D;  4Z66 A;  1HQ3 C;  3LZ0 A;  5F99 D;  3AZI A;  1TAF B;  3AZE B;  2NQB D;  3C1C B;  3B6F C;  3AZN B;  1P3M D;  2F8N K;  4KGC C;  3AZM D;  4J8X A;  3AZF A;  1P34 A;  3B6G C;  1P3G A;  1P3I B;  2NZD A;  3KSY A;  4J8U B;  4Z5T D;  3X1U C;  3LZ1 B;  1WWI A;  2IO5 C;  2F8N B;  4UUZ B;  3VH6 T;  5CPJ C;  1U35 B;  1P3A A;  1ID3 B;  1F66 B;  2PYO B;  1P3B D;  3UTA C;  3MNN C;  5GSU C;  4X23 A;  4WU9 B;  1EQZ B;  5G49 A;  3REJ A;  3MGS C;  5GT0 B;  5F99 A;  5B2I C;  4NFT A;  1AOI C;  2LY8 A;  2NQB A;  5DNN D;  5B40 B;  2HIO B;  3WAA A;  5JRG A;  4QLC B;  3V9R A;  5B1L B;  5E5A A;  5BS7 C;  5B33 B;  3O62 B;  3AZM A;  4YM6 D;  3WKJ D;  3AZL B;  5GT3 B;  1TZY C;  2YFW B;  1M19 B;  3NQU A;  4XUJ D;  3WA9 D;  4Z2M H;  5CPK D;  5BT1 D;  5AY8 C;  5AV9 D;  1BH9 B;  3X1V D;  3X1S D;  4KUD B;  5B2J D;  4HGA B;  1H3O A;  3MGR D;  3MGQ D;  5FUG A;  3AZH B;  3AFA D;  3W99 A;  5B24 D;  1KX3 D;  2ARO B;  3AV2 C;  3KWQ C;  5C3I C;  5B32 D;  4YM6 A;  3KXB D;  3WKJ A;  5B31 B;  3KUY D;  3AZJ D;  5DNM C;  3X1T B;  1P3P A;  3W96 B;  4Z2M G;  3VH5 T;  1R4V A;  4XUJ A;  1P3O C;  3WA9 A;  5CP6 C;  5AV9 A;  5AV8 B;  4AWL C;  4DRA A;  3AN2 A;  3X1V A;  3X1S A;  1ZLA B;  3UT9 C;  5B2J A;  1P3L B;  1KX4 C;  3MGR A;  3MGQ A;  4J8V D;  3AV1 C;  2JSS A;  5CPI C;  2FJ7 C;  1HQ3 B;  4ZUX D;  3AFA A;  1P3F C;  1P3K A;  5B24 A;  1KX3 A;  3B6F B;  4WNN A;  4CAY B;  3AZK C;  4ZBJ C;  5B32 A;  3KXB A;  4KHA B;  4XZQ D;  3KUY A;  4KGC B;  3AZJ A;  3REK A;  3W98 D;  3B6G B;  1M1A C;  4J8W C;  3X1U B;  3LEL C;  5AVC C;  2IO5 B;  5CPJ B;  5B1M C;  3AYW D;  3TU4 C;  3UTA B;  3MNN B;  4CSR B;  3REL C;  5GSU B;  5AV5 C;  4J8V A;  4YS3 C;  3R45 B;  2CWE A;  3MGS B;  5BNX B;  4ZUX A;  5B2I B;  5BNV B;  1AOI B;  4E44 A;  4LD9 C;  3C1B C;  3MVD D;  4WU8 C;  2BYK A;  4XZQ A;  3W97 C;  3W98 A;  1TAF A;  3WTP C;  3MGP C;  1TZY B;  5B0Z D;  3REH C;  3A6N C;  2L5A A;  4M6B A;  5B1L D;  4Z66 D;  1S32 C;  3AZI D;  3LZ0 C;  5AY8 B;  1JFI B;  4J8X D;  3AZF D;  1P34 D;  3MVD A;  2NZD C;  2YFV B;  3AV2 B;  3KWQ B;  5C3I B;  1P3A C;  5B0Z A;  5DNM B;  2HIO A;  4X23 C;  3UTB D;  5B1L A;  1P3O B;  4H9N A;  3REJ C;  5CP6 B;  3LJA D;  1B6W A;  5F99 C;  4AWL B;  4H9R A;  2NQB C;  3WAA D;  5JRG D;  3UT9 B;  2YFW A;  5E5A D;  1P3M C;  1KX4 B;  3AV1 B;  3AZM C;  5CPI B;  2BYM B;  2FJ7 B;  4R8P D;  1P3F B;  4Z5T C;  4KUD A;  1N1J B;  3VH5 A;  3AZK B;  4ZBJ B;  5AVB D;  1P3B C;  5B31 G;  4JJN D;  3UTB A;  1M1A B;  4J8W B;  2ARO A;  3LEL B;  5AVC B;  3LJA A;  1WWS A;  5BO0 A;  5B1M B;  5DNN C;  3TU4 B;  3W99 D;  3W96 A;  3REL B;  2CV5 D;  5AV5 B;  3AZG D;  3X1U D;  4YS3 B;  4DRB A;  5CHL B;  4YM6 C;  3WKJ C;  4R8P A;  1P3P D;  4LD9 B;  3C1B B;  4WU8 B;  4XUJ C;  3WA9 C;  5AVB A;  1KX5 D;  5CPK C;  5BT1 C;  3AN2 D;  5AV9 C;  1HQ3 A;  3W97 B;  3X1V C;  4JJN A;  3X1S C;  3WTP B;  5B2J C;  3MGP B;  3REH B;  1Q9C A;  1ULY A;  3A6N B;  4H9S C;  2HUE C; 
#chains in the Genus database with same CATH topology
 4KHA A;  1S32 B;  5AV6 D;  4KGC A;  1P3K D;  1BH8 B;  3LZ0 B;  3B6G A;  3AFA C;  2CV5 A;  5B24 C;  1KX3 C;  3AZG A;  3X1U A;  5B32 C;  3KXB C;  3REK D;  3KUY C;  3AZJ C;  5AY8 D;  2NZD B;  1F1E A;  1KX5 A;  5B0Y D;  1P3A B;  5KDM A;  4EO5 C;  1M18 D;  5JA4 A;  4X23 B;  4J8V C;  5BS7 A;  3REI D;  5AV6 A;  5G49 B;  3REJ B;  4ZUX C;  5F99 B;  2RVQ D;  4H9O A;  1TZY A;  2NQB B;  2XD5 A;  5GXQ D;  1P3M B;  3V9R B;  4XZQ C;  3AZM B;  3W98 C;  5AY8 A;  3AZE D;  3C1C D;  4Z5T B;  4WZS B;  3AZN D;  2Y2L A;  5B0Y A;  3NQU B;  3AYW C;  1BFM A;  1P3I D;  4J8U D;  2BG1 A;  1P3B B;  2F8N H;  1M18 A;  3LZ1 D;  3B0C W;  3REI A;  2F8N D;  1U35 D;  3AV2 A;  1ID3 D;  1H3O B;  1F66 D;  2PYO D;  3EPK A;  3NQJ B;  5DNN B;  4WU9 D;  3MVD C;  5GXQ A;  1EQZ D;  5GT0 D;  3F6T A;  4YM6 B;  3WKJ B;  3AZE A;  2Y2K A;  5B40 D;  3C1C A;  2HIO D;  5B0Z C;  3AZN A;  2DF4 C;  2F2A C;  4QLC D;  5B33 D;  3O62 D;  2ZY3 A;  4Z66 C;  2F8N G;  4XUJ B;  3WA9 B;  3AZI C;  5CPK B;  3AZL D;  1P3I A;  4J8U A;  5GT3 D;  5AV9 B;  3LZ1 A;  3X1V B;  3X1S B;  1M19 D;  5B2J B;  2F8N A;  4UUZ A;  1U35 A;  1F66 A;  1ID3 A;  2PYO A;  3AZK A;  3MGR B;  2HUE B;  3MGR C;  4J8X C;  3AZF C;  1P34 C;  1P3G C;  2Y2I A;  4WU9 A;  4KUD D;  3AFA B;  1EQZ A;  5B24 B;  5GT0 A;  4WNN B;  5AVC A;  3AZH D;  5B32 B;  3KXB B;  5B40 A;  3KUY B;  5B1M A;  3AZJ B;  4QLC A;  2ARO D;  5B33 A;  3O62 A;  3UTB C;  4NE6 A;  4YS3 A;  3AZL A;  3LJA C;  5GT3 A;  5B31 D;  3X1T D;  2Y2P A;  1M19 A;  3WAA C;  4H9P B;  5JRG C;  3W96 D;  4EO5 B;  5E5A C;  1B67 A;  4J8V B;  5AV8 D;  1BH9 A;  4H9Q B;  1ZLA D;  3W97 A;  4ZUX B;  4R8P C;  1P3L D;  3A6N A;  3AZH A;  3EPJ A;  2BYK B;  5AVB C;  1HQ3 D;  4XZQ B;  3W98 B;  1BH8 A;  4JJN C;  3B6F D;  5B31 A;  3EPH A;  4KGC D;  3X1T A;  3B6G D;  3AYW B;  3W99 C;  2JE5 A;  2CV5 C;  3AZG C;  5AV8 A;  5CPJ D;  2XD1 A;  1ZLA A;  3UTA D;  1P3P C;  3MNN D;  4DQY B;  5GSU D;  1P3L A;  3MVD B;  3B0D C;  1KX5 C;  3MGS D;  3AN2 C;  2W8S A;  5B2I D;  2UWX A;  1AOI D;  3B6F A;  4CAY A;  5B0Z B;  3MGQ C;  4NE5 A;  1P3M A;  4Z66 B;  4H9N B;  5AV6 C;  3AZI B;  1P3K C;  1TZY D;  4H9R B;  4Z5T A;  5CPJ A;  2Y2N A;  4J8X B;  3REK C;  3AZF B;  1P34 B;  3UTA A;  3MNN A;  4CSR A;  1KU5 A;  3H0M C;  5GSU A;  1P3G B;  1P3B A;  4G92 C;  3R45 A;  3B0B A;  3B0C T;  3VH6 W;  3MGS A;  5BNX A;  5B2I A;  5BNV A;  4G91 C;  5B0Y C;  1AOI A;  3NQJ A;  5DNN A;  2ZY5 A;  1M18 C;  3UTB B;  3AV2 D;  3REI C;  3KWQ D;  3LJA B;  1A7W A;  5BO0 B;  5DNM D;  2RVQ C;  3WAA B;  5JRG B;  5GXQ C;  5E5A B;  1P3O D;  2FFF B;  5CP6 D;  5CPK A;  1JFI A;  3AZE C;  3C1C C;  3UT9 D;  4R8P B;  3AZN C;  1KX4 D;  3AV1 D;  3H0L C;  4H9S A;  5AVB B;  4WV4 B;  5CPI D;  2FJ7 D;  1P3I C;  3EPL A;  1PZR A;  5B32 G;  2YFV A;  4J8U C;  1P3F D;  3LZ1 C;  4JJN B;  3KWQ A;  3AZK D;  1U35 C;  1F66 C;  5FUG B;  1ID3 C;  2PYO C;  5DNM A;  4WU9 C;  1M1A D;  3A1K A;  3W99 B;  4J8W D;  1P3O A;  2CV5 B;  1EQZ C;  3LEL D;  5CP6 A;  5AVC D;  5GT0 C;  3AZG B;  5B1M D;  5B40 C;  3UT9 A;  3TU4 D;  1HTA A;  2HIO C;  1P3P B;  3REL D;  4H9P A;  3VH5 W;  4QLC C;  5B1L C;  1KX4 A;  5AV5 D;  3AV1 A;  3FDD A;  4YS3 D;  3O62 C;  3B0D B;  5B33 C;  5CPI A;  1KX5 B;  2BYM A;  3AZL C;  2FJ7 A;  5GT3 C;  3AN2 B;  4H9Q A;  1P3F A;  1N1J A;  4LD9 D;  3C1B D;  1M19 C;  5KDM B;  3WTP E;  4WU8 D;  3MGQ B;  5JA4 B;  4E45 A;  3W97 D;  5AV6 B;  1M1A A;  4KUD C;  3VH6 A;  3WTP D;  1P3K B;  4J8W A;  3MGP D;  1KX3 B;  3REH D;  3LEL A;  4HGA C;  3A6N D;  4H9O B;  4UPK A;  3AZH C;  1S32 D;  3TU4 A;  3REK B;  3LZ0 D;  3AYW A;  3REL A;  5AV5 A;  2ARO C;  4G92 B;  5B31 C;  4WJ3 C;  5B0Y B;  2Y2Q A;  4G91 B;  3X1T C;  4LD9 A;  3C1B A;  3W96 C;  1P3G D;  2NZD D;  4WU8 A;  1M18 B;  3REI B;  2G5I C;  5AV8 C;  1P3A D;  1ZLA C;  2Y2H A;  3WTP A;  3MGP A;  3REH A;  1P3L C;  4X23 D;  5GXQ B;  4NE3 A;  3A1I A;  1S32 A;  3REJ D;  4Z66 A;  1HQ3 C;  3LZ0 A;  5F99 D;  3AZI A;  1TAF B;  3AZE B;  2NQB D;  3C1C B;  3B6F C;  3AZN B;  1P3M D;  2F8N K;  4KGC C;  3AZM D;  4J8X A;  3AZF A;  1P34 A;  3B6G C;  1P3G A;  1P3I B;  2NZD A;  3KSY A;  4J8U B;  4Z5T D;  3X1U C;  3LZ1 B;  2ZY4 A;  1WWI A;  2IO5 C;  2F8N B;  4UUZ B;  3VH6 T;  5CPJ C;  1U35 B;  1P3A A;  1ID3 B;  1F66 B;  2PYO B;  1P3B D;  3UTA C;  3MNN C;  5GSU C;  4X23 A;  4WU9 B;  2DQN C;  2Y2J A;  1EQZ B;  5G49 A;  3REJ A;  3MGS C;  5GT0 B;  5F99 A;  5B2I C;  4NFT A;  1AOI C;  2LY8 A;  2NQB A;  5DNN D;  5B40 B;  2HIO B;  3WAA A;  5JRG A;  3V9R A;  5B1L B;  5E5A A;  5BS7 C;  4QLC B;  5B33 B;  3O62 B;  3AZM A;  4YM6 D;  3WKJ D;  3AZL B;  5GT3 B;  1TZY C;  2YFW B;  1M19 B;  3P5J B;  3NQU A;  4XUJ D;  3WA9 D;  4Z2M H;  5CPK D;  5BT1 D;  5AY8 C;  5AV9 D;  1BH9 B;  3X1V D;  3X1S D;  4KUD B;  5B2J D;  4HGA B;  1H3O A;  3MGR D;  3MGQ D;  5FUG A;  3AZH B;  3AFA D;  3W99 A;  2RIQ A;  5B24 D;  1KX3 D;  2ARO B;  3AV2 C;  3KWQ C;  5C3I C;  5B32 D;  4YM6 A;  3KXB D;  3WKJ A;  5B31 B;  3KUY D;  3AZJ D;  5DNM C;  3X1T B;  1P3P A;  3W96 B;  4Z2M G;  3VH5 T;  1R4V A;  4XUJ A;  1P3O C;  3WA9 A;  2VQR A;  5CP6 C;  5AV9 A;  5AV8 B;  4AWL C;  1Z2C B;  4DRA A;  3AN2 A;  3X1V A;  3X1S A;  1ZLA B;  3UT9 C;  5B2J A;  1W2E A;  1P3L B;  1KX4 C;  3MGR A;  3MGQ A;  4J8V D;  3AV1 C;  2JSS A;  5CPI C;  2FJ7 C;  1HQ3 B;  4ZUX D;  3AFA A;  1P3F C;  1P3K A;  5B24 A;  1KX3 A;  3B6F B;  4WNN A;  4CAY B;  3AZK C;  4ZBJ C;  5B32 A;  3KXB A;  4KHA B;  4XZQ D;  3KUY A;  4KGC B;  2Y2G A;  3AZJ A;  3REK A;  3W98 D;  3B6G B;  1M1A C;  4J8W C;  3X1U B;  3LEL C;  5AVC C;  2IO5 B;  5CPJ B;  5B1M C;  3AYW D;  3TU4 C;  3UTA B;  3MNN B;  4CSR B;  3REL C;  5GSU B;  5AV5 C;  4J8V A;  4YS3 C;  3R45 B;  2CWE A;  3MGS B;  5BNX B;  4ZUX A;  5B2I B;  5BNV B;  1AOI B;  4E44 A;  4LD9 C;  3C1B C;  3MVD D;  4WU8 C;  2BYK A;  4XZQ A;  3W97 C;  3W98 A;  1TAF A;  2ZY2 A;  3WTP C;  3MGP C;  1TZY B;  5B0Z D;  3REH C;  2Y2O A;  3A6N C;  2L5A A;  4M6B A;  5B1L D;  4Z66 D;  1S32 C;  3AZI D;  3LZ0 C;  5AY8 B;  1JFI B;  2ZM5 A;  4J8X D;  3AZF D;  1P34 D;  2Y2M A;  3MVD A;  2NZD C;  2YFV B;  1T3U A;  3AV2 B;  2JCH A;  3KWQ B;  5C3I B;  1P3A C;  5B0Z A;  5DNM B;  2HIO A;  4X23 C;  3UTB D;  5B1L A;  1P3O B;  4H9N A;  3REJ C;  5CP6 B;  3LJA D;  1B6W A;  3IP4 C;  5F99 C;  4AWL B;  4H9R A;  2NQB C;  3WAA D;  5JRG D;  3UT9 B;  2YFW A;  5E5A D;  3EG5 B;  1P3M C;  1KX4 B;  3AL0 C;  3AV1 B;  3AZM C;  5CPI B;  2BYM B;  2FJ7 B;  3H0R C;  4R8P D;  1P3F B;  4Z5T C;  4KUD A;  1N1J B;  3VH5 A;  3AZK B;  4ZBJ B;  5AVB D;  1P3B C;  5B31 G;  4JJN D;  3UTB A;  1M1A B;  4J8W B;  2ARO A;  3LEL B;  2J8P A;  5AVC B;  3LJA A;  1WWS A;  5BO0 A;  5B1M B;  5DNN C;  3TU4 B;  3W99 D;  3W96 A;  3REL B;  2CV5 D;  5AV5 B;  3AZG D;  3X1U D;  4YS3 B;  4DRB A;  5CHL B;  4YM6 C;  3WKJ C;  4R8P A;  1P3P D;  4LD9 B;  3C1B B;  4WU8 B;  4XUJ C;  3WA9 C;  5AVB A;  1KX5 D;  2G5H C;  5CPK C;  5BT1 C;  3AN2 D;  5AV9 C;  1HQ3 A;  3W97 B;  3X1V C;  4JJN A;  3X1S C;  3WTP B;  5B2J C;  3MGP B;  3REH B;  1Q9C A;  3KFU G;  1ULY A;  3A6N B;  4H9S C;  2HUE C; 
#chains in the Genus database with same CATH homology
 4KHA A;  1S32 B;  5AV6 D;  4KGC A;  1P3K D;  1BH8 B;  3LZ0 B;  3B6G A;  3AFA C;  2CV5 A;  5B24 C;  1KX3 C;  3AZG A;  3X1U A;  5B32 C;  3KXB C;  3REK D;  3KUY C;  3AZJ C;  5AY8 D;  2NZD B;  1F1E A;  1KX5 A;  5B0Y D;  1P3A B;  5KDM A;  4EO5 C;  1M18 D;  5JA4 A;  4X23 B;  4J8V C;  5BS7 A;  3REI D;  5AV6 A;  5G49 B;  3REJ B;  4ZUX C;  5F99 B;  2RVQ D;  4H9O A;  1TZY A;  2NQB B;  2XD5 A;  5GXQ D;  1P3M B;  3V9R B;  4XZQ C;  3AZM B;  3W98 C;  5AY8 A;  3AZE D;  3C1C D;  4Z5T B;  4WZS B;  3AZN D;  2Y2L A;  5B0Y A;  3NQU B;  3AYW C;  1BFM A;  1P3I D;  4J8U D;  2BG1 A;  1P3B B;  2F8N H;  1M18 A;  3LZ1 D;  3B0C W;  3REI A;  2F8N D;  1U35 D;  3AV2 A;  1ID3 D;  1H3O B;  1F66 D;  2PYO D;  3EPK A;  3NQJ B;  5DNN B;  4WU9 D;  3MVD C;  5GXQ A;  1EQZ D;  5GT0 D;  3F6T A;  4YM6 B;  3WKJ B;  3AZE A;  2Y2K A;  5B40 D;  3C1C A;  2HIO D;  5B0Z C;  3AZN A;  2DF4 C;  2F2A C;  4QLC D;  5B33 D;  3O62 D;  2ZY3 A;  4Z66 C;  2F8N G;  4XUJ B;  3WA9 B;  3AZI C;  5CPK B;  3AZL D;  1P3I A;  4J8U A;  5GT3 D;  5AV9 B;  3LZ1 A;  3X1V B;  3X1S B;  1M19 D;  5B2J B;  2F8N A;  4UUZ A;  1U35 A;  1F66 A;  1ID3 A;  2PYO A;  3AZK A;  3MGR B;  2HUE B;  3MGR C;  4J8X C;  3AZF C;  1P34 C;  1P3G C;  2Y2I A;  4WU9 A;  4KUD D;  3AFA B;  1EQZ A;  5B24 B;  5GT0 A;  4WNN B;  5AVC A;  3AZH D;  5B32 B;  3KXB B;  5B40 A;  3KUY B;  5B1M A;  3AZJ B;  4QLC A;  2ARO D;  5B33 A;  3O62 A;  3UTB C;  4NE6 A;  4YS3 A;  3AZL A;  3LJA C;  5GT3 A;  5B31 D;  3X1T D;  2Y2P A;  1M19 A;  3WAA C;  4H9P B;  5JRG C;  3W96 D;  4EO5 B;  5E5A C;  1B67 A;  4J8V B;  5AV8 D;  1BH9 A;  4H9Q B;  1ZLA D;  3W97 A;  4ZUX B;  4R8P C;  1P3L D;  3A6N A;  3AZH A;  3EPJ A;  2BYK B;  5AVB C;  1HQ3 D;  4XZQ B;  3W98 B;  1BH8 A;  4JJN C;  3B6F D;  5B31 A;  3EPH A;  4KGC D;  3X1T A;  3B6G D;  3AYW B;  3W99 C;  2JE5 A;  2CV5 C;  3AZG C;  5AV8 A;  5CPJ D;  2XD1 A;  1ZLA A;  3UTA D;  1P3P C;  3MNN D;  4DQY B;  5GSU D;  1P3L A;  3MVD B;  3B0D C;  1KX5 C;  3MGS D;  3AN2 C;  2W8S A;  5B2I D;  2UWX A;  1AOI D;  3B6F A;  4CAY A;  5B0Z B;  3MGQ C;  4NE5 A;  1P3M A;  4Z66 B;  4H9N B;  5AV6 C;  3AZI B;  1P3K C;  1TZY D;  4H9R B;  4Z5T A;  5CPJ A;  2Y2N A;  4J8X B;  3REK C;  3AZF B;  1P34 B;  3UTA A;  3MNN A;  4CSR A;  1KU5 A;  3H0M C;  5GSU A;  1P3G B;  1P3B A;  4G92 C;  3R45 A;  3B0B A;  3B0C T;  3VH6 W;  3MGS A;  5BNX A;  5B2I A;  5BNV A;  4G91 C;  5B0Y C;  1AOI A;  3NQJ A;  5DNN A;  2ZY5 A;  1M18 C;  3UTB B;  3AV2 D;  3REI C;  3KWQ D;  3LJA B;  1A7W A;  5BO0 B;  5DNM D;  2RVQ C;  3WAA B;  5JRG B;  5GXQ C;  5E5A B;  1P3O D;  2FFF B;  5CP6 D;  5CPK A;  1JFI A;  3AZE C;  3C1C C;  3UT9 D;  4R8P B;  3AZN C;  1KX4 D;  3AV1 D;  3H0L C;  4H9S A;  5AVB B;  4WV4 B;  5CPI D;  2FJ7 D;  1P3I C;  3EPL A;  1PZR A;  5B32 G;  2YFV A;  4J8U C;  1P3F D;  3LZ1 C;  4JJN B;  3KWQ A;  3AZK D;  1U35 C;  1F66 C;  5FUG B;  1ID3 C;  2PYO C;  5DNM A;  4WU9 C;  1M1A D;  3A1K A;  3W99 B;  4J8W D;  1P3O A;  2CV5 B;  1EQZ C;  3LEL D;  5CP6 A;  5AVC D;  5GT0 C;  3AZG B;  5B1M D;  5B40 C;  3UT9 A;  3TU4 D;  1HTA A;  2HIO C;  1P3P B;  3REL D;  4H9P A;  3VH5 W;  4QLC C;  5B1L C;  1KX4 A;  5AV5 D;  3AV1 A;  3FDD A;  4YS3 D;  3O62 C;  3B0D B;  5B33 C;  5CPI A;  1KX5 B;  2BYM A;  3AZL C;  2FJ7 A;  5GT3 C;  3AN2 B;  4H9Q A;  1P3F A;  1N1J A;  4LD9 D;  3C1B D;  1M19 C;  5KDM B;  3WTP E;  4WU8 D;  3MGQ B;  5JA4 B;  4E45 A;  3W97 D;  5AV6 B;  1M1A A;  4KUD C;  3VH6 A;  3WTP D;  1P3K B;  4J8W A;  3MGP D;  1KX3 B;  3REH D;  3LEL A;  4HGA C;  3A6N D;  4H9O B;  4UPK A;  3AZH C;  1S32 D;  3TU4 A;  3REK B;  3LZ0 D;  3AYW A;  3REL A;  5AV5 A;  2ARO C;  4G92 B;  5B31 C;  4WJ3 C;  5B0Y B;  2Y2Q A;  4G91 B;  3X1T C;  4LD9 A;  3C1B A;  3W96 C;  1P3G D;  2NZD D;  4WU8 A;  1M18 B;  3REI B;  2G5I C;  5AV8 C;  1P3A D;  1ZLA C;  2Y2H A;  3WTP A;  3MGP A;  3REH A;  1P3L C;  4X23 D;  5GXQ B;  4NE3 A;  3A1I A;  1S32 A;  3REJ D;  4Z66 A;  1HQ3 C;  3LZ0 A;  5F99 D;  3AZI A;  1TAF B;  3AZE B;  2NQB D;  3C1C B;  3B6F C;  3AZN B;  1P3M D;  2F8N K;  4KGC C;  3AZM D;  4J8X A;  3AZF A;  1P34 A;  3B6G C;  1P3G A;  1P3I B;  2NZD A;  3KSY A;  4J8U B;  4Z5T D;  3X1U C;  3LZ1 B;  2ZY4 A;  1WWI A;  2IO5 C;  2F8N B;  4UUZ B;  3VH6 T;  5CPJ C;  1U35 B;  1P3A A;  1ID3 B;  1F66 B;  2PYO B;  1P3B D;  3UTA C;  3MNN C;  5GSU C;  4X23 A;  4WU9 B;  2DQN C;  2Y2J A;  1EQZ B;  5G49 A;  3REJ A;  3MGS C;  5GT0 B;  5F99 A;  5B2I C;  4NFT A;  1AOI C;  2LY8 A;  2NQB A;  5DNN D;  5B40 B;  2HIO B;  3WAA A;  5JRG A;  3V9R A;  5B1L B;  5E5A A;  5BS7 C;  4QLC B;  5B33 B;  3O62 B;  3AZM A;  4YM6 D;  3WKJ D;  3AZL B;  5GT3 B;  1TZY C;  2YFW B;  1M19 B;  3P5J B;  3NQU A;  4XUJ D;  3WA9 D;  4Z2M H;  5CPK D;  5BT1 D;  5AY8 C;  5AV9 D;  1BH9 B;  3X1V D;  3X1S D;  4KUD B;  5B2J D;  4HGA B;  1H3O A;  3MGR D;  3MGQ D;  5FUG A;  3AZH B;  3AFA D;  3W99 A;  2RIQ A;  5B24 D;  1KX3 D;  2ARO B;  3AV2 C;  3KWQ C;  5C3I C;  5B32 D;  4YM6 A;  3KXB D;  3WKJ A;  5B31 B;  3KUY D;  3AZJ D;  5DNM C;  3X1T B;  1P3P A;  3W96 B;  4Z2M G;  3VH5 T;  1R4V A;  4XUJ A;  1P3O C;  3WA9 A;  2VQR A;  5CP6 C;  5AV9 A;  5AV8 B;  4AWL C;  1Z2C B;  4DRA A;  3AN2 A;  3X1V A;  3X1S A;  1ZLA B;  3UT9 C;  5B2J A;  1W2E A;  1P3L B;  1KX4 C;  3MGR A;  3MGQ A;  4J8V D;  3AV1 C;  2JSS A;  5CPI C;  2FJ7 C;  1HQ3 B;  4ZUX D;  3AFA A;  1P3F C;  1P3K A;  5B24 A;  1KX3 A;  3B6F B;  4WNN A;  4CAY B;  3AZK C;  4ZBJ C;  5B32 A;  3KXB A;  4KHA B;  4XZQ D;  3KUY A;  4KGC B;  2Y2G A;  3AZJ A;  3REK A;  3W98 D;  3B6G B;  1M1A C;  4J8W C;  3X1U B;  3LEL C;  5AVC C;  2IO5 B;  5CPJ B;  5B1M C;  3AYW D;  3TU4 C;  3UTA B;  3MNN B;  4CSR B;  3REL C;  5GSU B;  5AV5 C;  4J8V A;  4YS3 C;  3R45 B;  2CWE A;  3MGS B;  5BNX B;  4ZUX A;  5B2I B;  5BNV B;  1AOI B;  4E44 A;  4LD9 C;  3C1B C;  3MVD D;  4WU8 C;  2BYK A;  4XZQ A;  3W97 C;  3W98 A;  1TAF A;  2ZY2 A;  3WTP C;  3MGP C;  1TZY B;  5B0Z D;  3REH C;  2Y2O A;  3A6N C;  2L5A A;  4M6B A;  5B1L D;  4Z66 D;  1S32 C;  3AZI D;  3LZ0 C;  5AY8 B;  1JFI B;  2ZM5 A;  4J8X D;  3AZF D;  1P34 D;  2Y2M A;  3MVD A;  2NZD C;  2YFV B;  1T3U A;  3AV2 B;  2JCH A;  3KWQ B;  5C3I B;  1P3A C;  5B0Z A;  5DNM B;  2HIO A;  4X23 C;  3UTB D;  5B1L A;  1P3O B;  4H9N A;  3REJ C;  5CP6 B;  3LJA D;  1B6W A;  3IP4 C;  5F99 C;  4AWL B;  4H9R A;  2NQB C;  3WAA D;  5JRG D;  3UT9 B;  2YFW A;  5E5A D;  3EG5 B;  1P3M C;  1KX4 B;  3AL0 C;  3AV1 B;  3AZM C;  5CPI B;  2BYM B;  2FJ7 B;  3H0R C;  4R8P D;  1P3F B;  4Z5T C;  4KUD A;  1N1J B;  3VH5 A;  3AZK B;  4ZBJ B;  5AVB D;  1P3B C;  5B31 G;  4JJN D;  3UTB A;  1M1A B;  4J8W B;  2ARO A;  3LEL B;  2J8P A;  5AVC B;  3LJA A;  1WWS A;  5BO0 A;  5B1M B;  5DNN C;  3TU4 B;  3W99 D;  3W96 A;  3REL B;  2CV5 D;  5AV5 B;  3AZG D;  3X1U D;  4YS3 B;  4DRB A;  5CHL B;  4YM6 C;  3WKJ C;  4R8P A;  1P3P D;  4LD9 B;  3C1B B;  4WU8 B;  4XUJ C;  3WA9 C;  5AVB A;  1KX5 D;  2G5H C;  5CPK C;  5BT1 C;  3AN2 D;  5AV9 C;  1HQ3 A;  3W97 B;  3X1V C;  4JJN A;  3X1S C;  3WTP B;  5B2J C;  3MGP B;  3REH B;  1Q9C A;  3KFU G;  1ULY A;  3A6N B;  4H9S C;  2HUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...