5AV5A

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5A00
5AV5D 3KXBC 3UT9A 3MGRC 1BFMA 3MGRD 5B40B 5B24B 3AZND 3LELB 3B6FC 5B0ZB 3VH6T 5FUGA 5AVBB 3AV1A 1JFIA 3REJD 5DNNB 3KUYC 2YFVA 1P3BB 2FJ7D 2PYOB 1HQ3B 5DNMC 4KUDA 1ID3B 5B32A 4JJND 3LELC 1ZLAA 3W99A 1P3PA 1P3GC 3LELD 5CPJD 4KUDC 2LY8A 4H9PB 3A6NC 5B0YD 3X1TD 3MGRB 3X1VA 3REKA 2PYOD 5B40C 5GXQC 1TZYC 4XZQC 3MVDB 3MGSA 3X1SC 3UTAD 2F8NG 5B33D 3MGQB 3C1CC 5CPKA 3REID 4QLCB 5B1LD 4WU9C 3AV2C 3KXBD 5B0ZA 4YM6A 3AZJD 1P3LD 5B2JB 3MVDD 3W98A 3AZFC 3X1UD 4YS3B 2NQBD 1BH8B 4WU8C 3O62C 1M18D 1TZYA 3WTPE 5AV8B 5B32B 3WA9B 3MNNB 5JA4B 3LZ0A 3WA9A 2IO5B 5B33B 4Z66D 4YS3C 3WKJB 4J8UA 5BS7C 3MGPC 1N1JB 4J8WC 5KDMB 5DNMD 3AZED 3MNNC 3AZHD 1S32A 5B1MA 3WAAA 5B2IC 5GSUD 4YM6C 1P3GB 5CPKB 5GT0A 5B2JC 1P3MA 1KX5C 3KWQD 3X1SA 1P3IB 5BNXB 5AV8C 5AY8D 5AV6C 2F8NA 2BYKA 4WZSB 5AVBD 4NE6A 5AV6D 3RELA 5AY8C 5AV8A 1TZYB 3B6GD 5GXQA 4J8VD 5CP6B 4M6BA 3AV2D 4H9OB 1KX5D 4H9OA 3X1VC 3AYWC 1P3PC 3KSYA 5GSUC 3B0BA 1A7WA 3WTPD 4Z5TB 5B2IA 1P3ID 1P3BD 4DRAA 5B31A 3AZIB 3AZKA 1P3AC 3UTBA 2YFVB 2CV5A 1P3BA 2AROD 5B2ID 3W96D 1M19C 1B6WA 5B31C 4X23D 3AN2B 1M1AD 3AYWB 1KX5B 1KX4C 4DRBA 3B6GA 5AV6B 5AV9C 5AV6A 3RELD 3NQJA 3WTPC 3W96C 1M18C 4H9RA 5AY8A 5C3IB 3LZ1A 3WKJA 1P34D 5GT3A 3AZFB 1P3FC 1KX3C 4Z5TD 5DNNC 3KUYB 2NZDB 4WNNB 4H9NB 5B1LC 2BYMA 5DNNA 5BS7A 3MGPA 4J8WA 1S32D 5CPKC 3W96B 3AZJB 3B0DB 1P3LB 3AZHA 5B33C 1P3OC 3W98B 1F1EA 3C1BB 1F66C 5B40A 5DNND 4E45A 1U35A 3WA9D 5JRGB 3W98C 2HIOA 5GT3D 1B67A 1P3FB 3MVDA 5B32C 5B0YB 2HIOD 1P3OA 3AZMB 1P3KB 5B1LB 1N1JA 5B1LA 5CP6C 4HGAC 4X23A 1H3OA 3B6GB 5BNVA 3B0CW 3W96A 3MGPB 3MGSC 4J8WB 2AROA 2CV5D 5BO0B 3UTAA 4ZBJB 3O62D 3V9RA 4XUJA 3B0CT 3WTPB 1P3IA 3WTPA 5JRGD 4XUJB 5AVCC 5GT3B 5AV9A 5JRGC 3AN2C 3VH6A 1P3GA 4Z5TA 1Q9CA 3LELA 5GXQD 5AV8D 4X23B 3AN2D 2JSSA 3AZHB 3W99C 2FJ7A 3X1SD 3AN2A 3RELB 1P3OB 2RVQC 3AV1D 4Z66B 1P3MD 5GSUB 1P3GD 5GT0D 3UTBB 5GSUA 5AV9D 1M1AA 5DNMB 5JRGA 5B1MD 3WAAD 4NE5A 4H9RB 4XUJD 5AY8B 3MGRA 3AZEA 3NQJB 3O62A 3REJC 4CSRB 5B31D 3VH5A 1S32B 5AV5A 5KDMA 3KWQB 3LJAC 3KUYD 1KX5A 5AV9B 3AV2A 4J8VA 3AZIC 3X1SB 3MVDC 3REHB 1P3OD 4H9NA 4J8VB 3AZKC 3AZGC 2F8ND 5B31B 3V9RB 1S32C 5B31G 3MGSB 2AROB 2HUEC 4H9QA 5BO0A 3UTAB 4QLCC 1F66D 5CHLB 5BT1C 1HTAA 5B0ZD 4YS3A 1TAFA 1U35D 1EQZB 4AWLC 5B40D 5B33A 1HQ3D 3R45A 3MGSD 4J8UD 3LZ0B 4E44A 1P3FD 4JJNB 4Z66A 2HIOB 2PYOA 3MGPD 4J8WD 3AZHC 2CV5B 3AFAC 2FJ7B 3X1TA 1BH8A 5GT3C 3WAAC 5B1MC 4R8PD 5CPJA 4J8XC 5CPID 1AOIC 1M18A 1F66B 1KX4B 5F99A 3W99D 1P34A 4J8UC 3X1UA 2NQBA 3WKJD 3LZ1D 3W98D 3AFAB 3AZEB 4G91B 5C3IC 4EO5C 4KGCA 3KXBA 4HGAB 3REKC 1WWIA 1KU5A 3B6GC 2L5AA 3KXBB 3REIA 5CPKD 3UTBC 1P3MB 5GT0B 3UTBD 2CV5C 3AZKD 5AVCB 3REKD 3AZMA 1P3KA 1P3PB 2CWEA 1ULYA 4CAYA 4Z5TC 4KGCC 1ID3A 3KWQC 3AYWA 4JJNA 4ZUXB 5B32D 1ZLAD 4KHAA 3R45B 5AVBA 1JFIB 5CPJC 3RELC 4XUJC 4KUDD 3REKB 3NQUA 3KWQA 2AROC 2HUEB 1P3AD 4X23C 3AZMC 1P3KC 1P3MC 5CP6A 1M19D 1ZLAC 3AZNA 3REIB 1EQZC 5DNMA 5BNXA 3UT9D 4KGCB 2NZDC 5BT1D 3LZ0C 3AZLC 4ZBJC 4Z2MH 3LZ0D 4G91C 4CAYB 5F99C 3B0DC 4J8XA 1KX3D 4WU8A 1AOIA 5B24A 3AZGB 3B6FB 1U35B 3AZGA 1EQZD 4WU9D 1TZYD 4WU8B 3UT9C 3C1CD 4J8UB 3AZJA 1P3LA 4YM6D 4G92C 3W99B 4XZQD 3C1CA 4LD9D 3VH6W 5JA4A 4WV4B 4Z66C 3WKJC 1BH9B 4WU9A 3MNNA 5B24D 3AZNB 4J8XD 1KX3A 1AOID 1H3OB 4R8PC 1P34B 1M1AC 1KX4A 3AFAD 4LD9C 3A6NA 4XZQB 3NQUB 4H9QB 3REJB 1P3LC 3X1VD 1U35C 5B0YA 2F8NB 3AZLA 3X1TB 3C1CB 2YFWB 4QLCA 3AZNC 1P3BC 3REHA 3TU4B 3LJAB 3MGQA 1HQ3C 1WWSA 3AZFD 1P3PD 3AV2B 1M19A 3LJAA 3C1BD 3REHC 4LD9B 2NZDD 3REIC 1P3AA 5AV5C 4J8VC 3AZIA 3AZKB 5B0ZC 5AVCD 2F8NH 5AVCA 3A6NB 5AVBC 3REJA 4J8XB 3AZID 1AOIB 3B6FA 4H9SA 3C1BA 4R8PB 3LJAD 5CPIB 3LZ1C 1P34C 5GXQB 3VH5W 3MGQD 3AZEC 1M1AB 1ID3C 2IO5C 4WNNA 1M19B 3W97B 3AZMD 4H9SC 3X1TC 1P3KD 3A6ND 3AFAA 1KX4D 3AZLB 3LZ1B 5GT0C 2FJ7C 5F99B 5CPJB 3MGQC 4LD9A 1KX3B 3B6FD 4KHAB 1P3IC 3UT9B 3WA9C 2BYMB 2RVQD 3AV1C 4KGCD 3X1UC 2NQBC 3TU4A 4G92B 2NZDA 2YFWA 4ZUXC 3W97D 5E5AA 5F99D 3AZFA 5CPIA 1EQZA 3W97C 3AZGD 4ZUXD 4R8PA 3C1BC 3REHD 3UTAC 4QLCD 3AZLD 1TAFB 2PYOC 4UUZB 5B2JA 1P3AB 5B2JD 4YM6B 1ZLAB 1P3FA 4AWLB 2BYKB 4KUDB 1HQ3A 5G49B 3VH5T 4ZUXA 5B32G 3MNND 4JJNC 3TU4C 5G49A 5E5AD 5FUGB 2HIOC 5B0YC 3W97A 5CPIC 5CP6D 3AV1B 2F8NK 5B24C 5E5AC 3X1UB 4YS3D 5B2IB 3TU4D 4XZQA 2NQBB 5BNVB 3AZJC 1M18B 5AV5B 4UUZA 1F66A 5B1MB 3WAAB 3X1VB 1R4VA 3O62B 4CSRA 4NE3A 4H9PA 1BH9A 4WU9B 4Z2MG 4WU8D 5E5AB 3AYWD 4EO5B 3KUYA 1ID3D 4NFTA
chains in the Genus database with same CATH superfamily
5AV5D 3KXBC 3UT9A 3MGRC 1BFMA 3MGRD 5B40B 5B24B 3AZND 3LELB 3B6FC 5B0ZB 3VH6T 5FUGA 5AVBB 3AV1A 1JFIA 2BG1A 3REJD 5DNNB 3KUYC 2YFVA 1P3BB 2FJ7D 2PYOB 1HQ3B 5DNMC 4KUDA 1ID3B 5B32A 4JJND 3LELC 1ZLAA 3W99A 1P3PA 1P3GC 3LELD 3FDDA 5CPJD 4KUDC 2LY8A 3F6TA 2F2AC 4H9PB 3A6NC 5B0YD 3X1TD 3MGRB 3X1VA 3REKA 2PYOD 5B40C 5GXQC 1TZYC 4XZQC 3MVDB 3MGSA 3X1SC 3UTAD 2XD5A 2F8NG 5B33D 3MGQB 3C1CC 2W8SA 5CPKA 3REID 4QLCB 5B1LD 4WU9C 3AV2C 3KXBD 5B0ZA 4YM6A 3AZJD 1P3LD 5B2JB 3MVDD 3W98A 3AZFC 3X1UD 4YS3B 2NQBD 1BH8B 4WU8C 3O62C 1M18D 1TZYA 5AV8B 3WTPE 5B32B 3WA9B 3MNNB 5JA4B 3LZ0A 3WA9A 2IO5B 5B33B 4Z66D 4YS3C 3WKJB 4J8UA 5BS7C 3MGPC 1N1JB 4J8WC 2FFFB 5KDMB 5DNMD 3MNNC 3AZED 3AZHD 1S32A 5B1MA 3WAAA 5B2IC 5GSUD 4YM6C 1P3GB 5CPKB 5GT0A 5B2JC 1P3MA 2DF4C 1KX5C 3KWQD 3X1SA 1P3IB 5BNXB 5AV8C 5AY8D 5AV6C 2F8NA 2BYKA 4WZSB 5AVBD 3P5JB 4NE6A 5AV6D 3RELA 5AY8C 5AV8A 1TZYB 3B6GD 5GXQA 4J8VD 5CP6B 4M6BA 3AV2D 4H9OB 1KX5D 4H9OA 3X1VC 3AYWC 1P3PC 3KSYA 5GSUC 3B0BA 1A7WA 3WTPD 4Z5TB 5B2IA 1P3ID 1P3BD 4DRAA 5B31A 3AZIB 3AZKA 1P3AC 3UTBA 2YFVB 2CV5A 1P3BA 2AROD 5B2ID 3W96D 1M19C 1B6WA 5B31C 4X23D 3AN2B 1M1AD 3AYWB 1KX5B 1KX4C 2Y2LA 4DRBA 2G5HC 3B6GA 1T3UA 5AV6B 5AV9C 5AV6A 3RELD 3NQJA 3WTPC 2ZY4A 3W96C 1M18C 4H9RA 5AY8A 5C3IB 3LZ1A 3WKJA 1P34D 3A1KA 5GT3A 3AZFB 1P3FC 1KX3C 4Z5TD 5DNNC 3KUYB 3EG5B 2NZDB 4WNNB 4H9NB 5B1LC 2BYMA 2JE5A 5DNNA 5BS7A 3MGPA 4J8WA 1S32D 5CPKC 3W96B 3IP4C 3AZJB 3B0DB 1P3LB 3AZHA 5B33C 1P3OC 3W98B 1F1EA 3C1BB 1F66C 5B40A 5DNND 2Y2KA 4E45A 1U35A 3WA9D 2Y2PA 2UWXA 5JRGB 3W98C 2HIOA 5GT3D 1B67A 1P3FB 3MVDA 5B32C 5B0YB 2HIOD 1P3OA 3EPLA 3AZMB 1P3KB 5B1LB 1N1JA 5B1LA 5CP6C 4HGAC 4X23A 1H3OA 3B6GB 5BNVA 3B0CW 3W96A 4UPKA 3MGPB 3MGSC 2AROA 4J8WB 2CV5D 5BO0B 3UTAA 4ZBJB 3O62D 3V9RA 4XUJA 3B0CT 3WTPB 1P3IA 3WTPA 5JRGD 4XUJB 5AVCC 5GT3B 5AV9A 5JRGC 3AN2C 3VH6A 1P3GA 4Z5TA 1Q9CA 3LELA 2Y2OA 5GXQD 5AV8D 4X23B 3AN2D 2JSSA 3AZHB 3W99C 2FJ7A 3X1SD 3AN2A 3RELB 1P3OB 2JCHA 2RVQC 3AV1D 4Z66B 1P3MD 5GSUB 1P3GD 5GT0D 3UTBB 5GSUA 5AV9D 1M1AA 5DNMB 5JRGA 5B1MD 3WAAD 4NE5A 5AY8B 2G5IC 4H9RB 4XUJD 3MGRA 3AZEA 3NQJB 3O62A 3REJC 4CSRB 5B31D 3VH5A 1S32B 5AV5A 5KDMA 3KWQB 3LJAC 3KUYD 1KX5A 5AV9B 3AV2A 3EPKA 4J8VA 3AZIC 3X1SB 3H0LC 3MVDC 3REHB 1P3OD 4H9NA 4J8VB 3AZKC 3AZGC 2F8ND 5B31B 3V9RB 1S32C 5B31G 3MGSB 1Z2CB 2AROB 2HUEC 4H9QA 5BO0A 3UTAB 4QLCC 1F66D 5CHLB 5BT1C 1HTAA 5B0ZD 4YS3A 1TAFA 1U35D 1EQZB 2J8PA 5B40D 2ZM5A 5B33A 4AWLC 3EPHA 1HQ3D 3R45A 3MGSD 4J8UD 3LZ0B 4E44A 1P3FD 4JJNB 4Z66A 2HIOB 2PYOA 3MGPD 4J8WD 3AZHC 2CV5B 3AFAC 2FJ7B 3X1TA 1BH8A 4DQYB 5GT3C 3WAAC 5B1MC 4R8PD 5CPJA 4J8XC 5CPID 1AOIC 1M18A 1F66B 1KX4B 5F99A 3W99D 1P34A 4J8UC 3X1UA 2NQBA 3WKJD 3LZ1D 3W98D 3H0RC 4WJ3C 3AFAB 3AZEB 4G91B 5C3IC 4EO5C 4KGCA 2ZY2A 3KXBA 4HGAB 3REKC 1WWIA 1KU5A 3B6GC 2L5AA 3KXBB 3REIA 5CPKD 3UTBC 1P3MB 5GT0B 3UTBD 2CV5C 3AZKD 5AVCB 3REKD 3AZMA 1P3KA 1P3PB 2CWEA 1ULYA 4CAYA 4Z5TC 4KGCC 1ID3A 3KWQC 3AYWA 4JJNA 4ZUXB 5B32D 1ZLAD 4KHAA 3AL0C 3R45B 5AVBA 1JFIB 5CPJC 3RELC 4XUJC 4KUDD 3REKB 3NQUA 3KWQA 2AROC 2HUEB 2RIQA 2ZY5A 1P3AD 4X23C 3AZMC 1P3KC 1P3MC 2DQNC 5CP6A 1M19D 1ZLAC 3AZNA 3REIB 1EQZC 5DNMA 5BNXA 3UT9D 4KGCB 2NZDC 5BT1D 3LZ0C 3AZLC 4ZBJC 3EPJA 2XD1A 2Y2MA 4Z2MH 3LZ0D 4G91C 4CAYB 5F99C 3B0DC 4J8XA 1KX3D 4WU8A 1AOIA 5B24A 3AZGB 3B6FB 1U35B 3AZGA 1EQZD 4WU9D 1TZYD 4WU8B 3UT9C 3C1CD 4J8UB 3AZJA 1P3LA 4YM6D 4G92C 3W99B 4XZQD 3C1CA 4LD9D 3VH6W 5JA4A 4WV4B 4Z66C 3WKJC 1BH9B 4WU9A 3MNNA 5B24D 3AZNB 4J8XD 1KX3A 1AOID 1H3OB 4R8PC 1P34B 1M1AC 1KX4A 3AFAD 4LD9C 3A6NA 4XZQB 3NQUB 4H9QB 3REJB 1P3LC 3X1VD 1U35C 5B0YA 2F8NB 3AZLA 3X1TB 3C1CB 2YFWB 4QLCA 2ZY3A 3AZNC 1P3BC 3REHA 3TU4B 3LJAB 2Y2IA 3MGQA 1HQ3C 1WWSA 3AZFD 1P3PD 3AV2B 1M19A 3LJAA 3C1BD 3REHC 4LD9B 2NZDD 3REIC 1P3AA 5AV5C 4J8VC 3AZIA 3AZKB 5B0ZC 5AVCD 2F8NH 5AVCA 3A6NB 5AVBC 3REJA 4J8XB 3AZID 1AOIB 3B6FA 4H9SA 3C1BA 4R8PB 3LJAD 5CPIB 3LZ1C 1P34C 5GXQB 3VH5W 3MGQD 3AZEC 1M1AB 1ID3C 2IO5C 4WNNA 1M19B 3W97B 3AZMD 4H9SC 3X1TC 1P3KD 3A1IA 3A6ND 3AFAA 1KX4D 3AZLB 3LZ1B 1PZRA 5GT0C 2FJ7C 5F99B 5CPJB 2Y2GA 3MGQC 4LD9A 1KX3B 3B6FD 2Y2HA 4KHAB 1P3IC 3UT9B 3WA9C 2BYMB 2RVQD 3AV1C 4KGCD 3X1UC 2NQBC 3TU4A 4G92B 2NZDA 1W2EA 2YFWA 4ZUXC 3W97D 5E5AA 5F99D 3AZFA 5CPIA 1EQZA 3W97C 3AZGD 4ZUXD 4R8PA 3C1BC 3REHD 3UTAC 4QLCD 3AZLD 1TAFB 2PYOC 4UUZB 5B2JA 1P3AB 5B2JD 4YM6B 1ZLAB 1P3FA 4AWLB 2BYKB 4KUDB 2Y2JA 1HQ3A 2Y2QA 5G49B 3VH5T 4ZUXA 5B32G 3MNND 4JJNC 3TU4C 5B0YC 5G49A 5E5AD 5FUGB 2HIOC 3W97A 2VQRA 5CPIC 5CP6D 3AV1B 2F8NK 5B24C 5E5AC 3X1UB 4YS3D 5B2IB 3TU4D 4XZQA 2NQBB 3KFUG 5BNVB 3H0MC 3AZJC 5AV5B 4UUZA 1M18B 1F66A 5B1MB 3WAAB 3X1VB 1R4VA 3O62B 4CSRA 4NE3A 4H9PA 1BH9A 4WU9B 4Z2MG 4WU8D 5E5AB 3AYWD 2Y2NA 4EO5B 3KUYA 1ID3D 4NFTA
chains in the Genus database with same CATH topology
5AV5D 3KXBC 3UT9A 3MGRC 1BFMA 3MGRD 5B40B 5B24B 3AZND 3LELB 3B6FC 5B0ZB 3VH6T 5FUGA 5AVBB 3AV1A 1JFIA 2BG1A 3REJD 5DNNB 3KUYC 2YFVA 1P3BB 2FJ7D 2PYOB 1HQ3B 5DNMC 4KUDA 1ID3B 5B32A 4JJND 3LELC 1ZLAA 3W99A 1P3PA 1P3GC 3LELD 3FDDA 5CPJD 4KUDC 2LY8A 3F6TA 2F2AC 4H9PB 3A6NC 5B0YD 3X1TD 3MGRB 3X1VA 3REKA 2PYOD 5B40C 5GXQC 1TZYC 4XZQC 3MVDB 3MGSA 3X1SC 3UTAD 2XD5A 2F8NG 5B33D 3MGQB 3C1CC 2W8SA 5CPKA 3REID 4QLCB 5B1LD 4WU9C 3AV2C 3KXBD 5B0ZA 4YM6A 3AZJD 1P3LD 5B2JB 3MVDD 3W98A 3AZFC 3X1UD 4YS3B 2NQBD 1BH8B 4WU8C 3O62C 1M18D 1TZYA 5AV8B 3WTPE 5B32B 3WA9B 3MNNB 5JA4B 3LZ0A 3WA9A 2IO5B 5B33B 4Z66D 4YS3C 3WKJB 4J8UA 5BS7C 3MGPC 1N1JB 4J8WC 2FFFB 5KDMB 5DNMD 3MNNC 3AZED 3AZHD 1S32A 5B1MA 3WAAA 5B2IC 5GSUD 4YM6C 1P3GB 5CPKB 5GT0A 5B2JC 1P3MA 2DF4C 1KX5C 3KWQD 3X1SA 1P3IB 5BNXB 5AV8C 5AY8D 5AV6C 2F8NA 2BYKA 4WZSB 5AVBD 3P5JB 4NE6A 5AV6D 3RELA 5AY8C 5AV8A 1TZYB 3B6GD 5GXQA 4J8VD 5CP6B 4M6BA 3AV2D 4H9OB 1KX5D 4H9OA 3X1VC 3AYWC 1P3PC 3KSYA 5GSUC 3B0BA 1A7WA 3WTPD 4Z5TB 5B2IA 1P3ID 1P3BD 4DRAA 5B31A 3AZIB 3AZKA 1P3AC 3UTBA 2YFVB 2CV5A 1P3BA 2AROD 5B2ID 3W96D 1M19C 1B6WA 5B31C 4X23D 3AN2B 1M1AD 3AYWB 1KX5B 1KX4C 2Y2LA 4DRBA 2G5HC 3B6GA 1T3UA 5AV6B 5AV9C 5AV6A 3RELD 3NQJA 3WTPC 2ZY4A 3W96C 1M18C 4H9RA 5AY8A 5C3IB 3LZ1A 3WKJA 1P34D 3A1KA 5GT3A 3AZFB 1P3FC 1KX3C 4Z5TD 5DNNC 3KUYB 3EG5B 2NZDB 4WNNB 4H9NB 5B1LC 2BYMA 2JE5A 5DNNA 5BS7A 3MGPA 4J8WA 1S32D 5CPKC 3W96B 3IP4C 3AZJB 3B0DB 1P3LB 3AZHA 5B33C 1P3OC 3W98B 1F1EA 3C1BB 1F66C 5B40A 5DNND 2Y2KA 4E45A 1U35A 3WA9D 2Y2PA 2UWXA 5JRGB 3W98C 2HIOA 5GT3D 1B67A 1P3FB 3MVDA 5B32C 5B0YB 2HIOD 1P3OA 3EPLA 3AZMB 1P3KB 5B1LB 1N1JA 5B1LA 5CP6C 4HGAC 4X23A 1H3OA 3B6GB 5BNVA 3B0CW 3W96A 4UPKA 3MGPB 3MGSC 2AROA 4J8WB 2CV5D 5BO0B 3UTAA 4ZBJB 3O62D 3V9RA 4XUJA 3B0CT 3WTPB 1P3IA 3WTPA 5JRGD 4XUJB 5AVCC 5GT3B 5AV9A 5JRGC 3AN2C 3VH6A 1P3GA 4Z5TA 1Q9CA 3LELA 2Y2OA 5GXQD 5AV8D 4X23B 3AN2D 2JSSA 3AZHB 3W99C 2FJ7A 3X1SD 3AN2A 3RELB 1P3OB 2JCHA 2RVQC 3AV1D 4Z66B 1P3MD 5GSUB 1P3GD 5GT0D 3UTBB 5GSUA 5AV9D 1M1AA 5DNMB 5JRGA 5B1MD 3WAAD 4NE5A 5AY8B 2G5IC 4H9RB 4XUJD 3MGRA 3AZEA 3NQJB 3O62A 3REJC 4CSRB 5B31D 3VH5A 1S32B 5AV5A 5KDMA 3KWQB 3LJAC 3KUYD 1KX5A 5AV9B 3AV2A 3EPKA 4J8VA 3AZIC 3X1SB 3H0LC 3MVDC 3REHB 1P3OD 4H9NA 4J8VB 3AZKC 3AZGC 2F8ND 5B31B 3V9RB 1S32C 5B31G 3MGSB 1Z2CB 2AROB 2HUEC 4H9QA 5BO0A 3UTAB 4QLCC 1F66D 5CHLB 5BT1C 1HTAA 5B0ZD 4YS3A 1TAFA 1U35D 1EQZB 2J8PA 5B40D 2ZM5A 5B33A 4AWLC 3EPHA 1HQ3D 3R45A 3MGSD 4J8UD 3LZ0B 4E44A 1P3FD 4JJNB 4Z66A 2HIOB 2PYOA 3MGPD 4J8WD 3AZHC 2CV5B 3AFAC 2FJ7B 3X1TA 1BH8A 4DQYB 5GT3C 3WAAC 5B1MC 4R8PD 5CPJA 4J8XC 5CPID 1AOIC 1M18A 1F66B 1KX4B 5F99A 3W99D 1P34A 4J8UC 3X1UA 2NQBA 3WKJD 3LZ1D 3W98D 3H0RC 4WJ3C 3AFAB 3AZEB 4G91B 5C3IC 4EO5C 4KGCA 2ZY2A 3KXBA 4HGAB 3REKC 1WWIA 1KU5A 3B6GC 2L5AA 3KXBB 3REIA 5CPKD 3UTBC 1P3MB 5GT0B 3UTBD 2CV5C 3AZKD 5AVCB 3REKD 3AZMA 1P3KA 1P3PB 2CWEA 1ULYA 4CAYA 4Z5TC 4KGCC 1ID3A 3KWQC 3AYWA 4JJNA 4ZUXB 5B32D 1ZLAD 4KHAA 3AL0C 3R45B 5AVBA 1JFIB 5CPJC 3RELC 4XUJC 4KUDD 3REKB 3NQUA 3KWQA 2AROC 2HUEB 2RIQA 2ZY5A 1P3AD 4X23C 3AZMC 1P3KC 1P3MC 2DQNC 5CP6A 1M19D 1ZLAC 3AZNA 3REIB 1EQZC 5DNMA 5BNXA 3UT9D 4KGCB 2NZDC 5BT1D 3LZ0C 3AZLC 4ZBJC 3EPJA 2XD1A 2Y2MA 4Z2MH 3LZ0D 4G91C 4CAYB 5F99C 3B0DC 4J8XA 1KX3D 4WU8A 1AOIA 5B24A 3AZGB 3B6FB 1U35B 3AZGA 1EQZD 4WU9D 1TZYD 4WU8B 3UT9C 3C1CD 4J8UB 3AZJA 1P3LA 4YM6D 4G92C 3W99B 4XZQD 3C1CA 4LD9D 3VH6W 5JA4A 4WV4B 4Z66C 3WKJC 1BH9B 4WU9A 3MNNA 5B24D 3AZNB 4J8XD 1KX3A 1AOID 1H3OB 4R8PC 1P34B 1M1AC 1KX4A 3AFAD 4LD9C 3A6NA 4XZQB 3NQUB 4H9QB 3REJB 1P3LC 3X1VD 1U35C 5B0YA 2F8NB 3AZLA 3X1TB 3C1CB 2YFWB 4QLCA 2ZY3A 3AZNC 1P3BC 3REHA 3TU4B 3LJAB 2Y2IA 3MGQA 1HQ3C 1WWSA 3AZFD 1P3PD 3AV2B 1M19A 3LJAA 3C1BD 3REHC 4LD9B 2NZDD 3REIC 1P3AA 5AV5C 4J8VC 3AZIA 3AZKB 5B0ZC 5AVCD 2F8NH 5AVCA 3A6NB 5AVBC 3REJA 4J8XB 3AZID 1AOIB 3B6FA 4H9SA 3C1BA 4R8PB 3LJAD 5CPIB 3LZ1C 1P34C 5GXQB 3VH5W 3MGQD 3AZEC 1M1AB 1ID3C 2IO5C 4WNNA 1M19B 3W97B 3AZMD 4H9SC 3X1TC 1P3KD 3A1IA 3A6ND 3AFAA 1KX4D 3AZLB 3LZ1B 1PZRA 5GT0C 2FJ7C 5F99B 5CPJB 2Y2GA 3MGQC 4LD9A 1KX3B 3B6FD 2Y2HA 4KHAB 1P3IC 3UT9B 3WA9C 2BYMB 2RVQD 3AV1C 4KGCD 3X1UC 2NQBC 3TU4A 4G92B 2NZDA 1W2EA 2YFWA 4ZUXC 3W97D 5E5AA 5F99D 3AZFA 5CPIA 1EQZA 3W97C 3AZGD 4ZUXD 4R8PA 3C1BC 3REHD 3UTAC 4QLCD 3AZLD 1TAFB 2PYOC 4UUZB 5B2JA 1P3AB 5B2JD 4YM6B 1ZLAB 1P3FA 4AWLB 2BYKB 4KUDB 2Y2JA 1HQ3A 2Y2QA 5G49B 3VH5T 4ZUXA 5B32G 3MNND 4JJNC 3TU4C 5B0YC 5G49A 5E5AD 5FUGB 2HIOC 3W97A 2VQRA 5CPIC 5CP6D 3AV1B 2F8NK 5B24C 5E5AC 3X1UB 4YS3D 5B2IB 3TU4D 4XZQA 2NQBB 3KFUG 5BNVB 3H0MC 3AZJC 5AV5B 4UUZA 1M18B 1F66A 5B1MB 3WAAB 3X1VB 1R4VA 3O62B 4CSRA 4NE3A 4H9PA 1BH9A 4WU9B 4Z2MG 4WU8D 5E5AB 3AYWD 2Y2NA 4EO5B 3KUYA 1ID3D 4NFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 D;  3KXB C;  3UT9 A;  3MGR C;  1BFM A;  3MGR D;  5B40 B;  5B24 B;  3AZN D;  3LEL B;  3B6F C;  5B0Z B;  3VH6 T;  5FUG A;  5AVB B;  3AV1 A;  1JFI A;  3REJ D;  5DNN B;  3KUY C;  2YFV A;  1P3B B;  2FJ7 D;  2PYO B;  1HQ3 B;  5DNM C;  4KUD A;  1ID3 B;  5B32 A;  4JJN D;  3LEL C;  1ZLA A;  3W99 A;  1P3P A;  1P3G C;  3LEL D;  5CPJ D;  4KUD C;  2LY8 A;  4H9P B;  3A6N C;  5B0Y D;  3X1T D;  3MGR B;  3X1V A;  3REK A;  2PYO D;  5B40 C;  5GXQ C;  1TZY C;  4XZQ C;  3MVD B;  3MGS A;  3X1S C;  3UTA D;  2F8N G;  5B33 D;  3MGQ B;  3C1C C;  5CPK A;  3REI D;  4QLC B;  5B1L D;  4WU9 C;  3AV2 C;  3KXB D;  5B0Z A;  4YM6 A;  3AZJ D;  1P3L D;  5B2J B;  3MVD D;  3W98 A;  3AZF C;  3X1U D;  4YS3 B;  2NQB D;  1BH8 B;  4WU8 C;  3O62 C;  1M18 D;  1TZY A;  3WTP E;  5AV8 B;  5B32 B;  3WA9 B;  3MNN B;  5JA4 B;  3LZ0 A;  3WA9 A;  2IO5 B;  5B33 B;  4Z66 D;  4YS3 C;  3WKJ B;  4J8U A;  5BS7 C;  3MGP C;  1N1J B;  4J8W C;  5KDM B;  5DNM D;  3AZE D;  3MNN C;  3AZH D;  1S32 A;  5B1M A;  3WAA A;  5B2I C;  5GSU D;  4YM6 C;  1P3G B;  5CPK B;  5GT0 A;  5B2J C;  1P3M A;  1KX5 C;  3KWQ D;  3X1S A;  1P3I B;  5BNX B;  5AV8 C;  5AY8 D;  5AV6 C;  2F8N A;  2BYK A;  4WZS B;  5AVB D;  4NE6 A;  5AV6 D;  3REL A;  5AY8 C;  5AV8 A;  1TZY B;  3B6G D;  5GXQ A;  4J8V D;  5CP6 B;  4M6B A;  3AV2 D;  4H9O B;  1KX5 D;  4H9O A;  3X1V C;  3AYW C;  1P3P C;  3KSY A;  5GSU C;  3B0B A;  1A7W A;  3WTP D;  4Z5T B;  5B2I A;  1P3I D;  1P3B D;  4DRA A;  5B31 A;  3AZI B;  3AZK A;  1P3A C;  3UTB A;  2YFV B;  2CV5 A;  1P3B A;  2ARO D;  5B2I D;  3W96 D;  1M19 C;  1B6W A;  5B31 C;  4X23 D;  3AN2 B;  1M1A D;  3AYW B;  1KX5 B;  1KX4 C;  4DRB A;  3B6G A;  5AV6 B;  5AV9 C;  5AV6 A;  3REL D;  3NQJ A;  3WTP C;  3W96 C;  1M18 C;  4H9R A;  5AY8 A;  5C3I B;  3LZ1 A;  3WKJ A;  1P34 D;  5GT3 A;  3AZF B;  1P3F C;  1KX3 C;  4Z5T D;  5DNN C;  3KUY B;  2NZD B;  4WNN B;  4H9N B;  5B1L C;  2BYM A;  5DNN A;  5BS7 A;  3MGP A;  4J8W A;  1S32 D;  5CPK C;  3W96 B;  3AZJ B;  3B0D B;  1P3L B;  3AZH A;  5B33 C;  1P3O C;  3W98 B;  1F1E A;  3C1B B;  1F66 C;  5B40 A;  5DNN D;  4E45 A;  1U35 A;  3WA9 D;  5JRG B;  3W98 C;  2HIO A;  5GT3 D;  1B67 A;  1P3F B;  3MVD A;  5B32 C;  5B0Y B;  2HIO D;  1P3O A;  3AZM B;  1P3K B;  5B1L B;  1N1J A;  5B1L A;  5CP6 C;  4HGA C;  4X23 A;  1H3O A;  3B6G B;  5BNV A;  3B0C W;  3W96 A;  3MGP B;  3MGS C;  4J8W B;  2ARO A;  2CV5 D;  5BO0 B;  3UTA A;  4ZBJ B;  3O62 D;  3V9R A;  4XUJ A;  3B0C T;  3WTP B;  1P3I A;  3WTP A;  5JRG D;  4XUJ B;  5AVC C;  5GT3 B;  5AV9 A;  5JRG C;  3AN2 C;  3VH6 A;  1P3G A;  4Z5T A;  1Q9C A;  3LEL A;  5GXQ D;  5AV8 D;  4X23 B;  3AN2 D;  2JSS A;  3AZH B;  3W99 C;  2FJ7 A;  3X1S D;  3AN2 A;  3REL B;  1P3O B;  2RVQ C;  3AV1 D;  4Z66 B;  1P3M D;  5GSU B;  1P3G D;  5GT0 D;  3UTB B;  5GSU A;  5AV9 D;  1M1A A;  5DNM B;  5JRG A;  5B1M D;  3WAA D;  4NE5 A;  4H9R B;  4XUJ D;  5AY8 B;  3MGR A;  3AZE A;  3NQJ B;  3O62 A;  3REJ C;  4CSR B;  5B31 D;  3VH5 A;  1S32 B;  5AV5 A;  5KDM A;  3KWQ B;  3LJA C;  3KUY D;  1KX5 A;  5AV9 B;  3AV2 A;  4J8V A;  3AZI C;  3X1S B;  3MVD C;  3REH B;  1P3O D;  4H9N A;  4J8V B;  3AZK C;  3AZG C;  2F8N D;  5B31 B;  3V9R B;  1S32 C;  5B31 G;  3MGS B;  2ARO B;  2HUE C;  4H9Q A;  5BO0 A;  3UTA B;  4QLC C;  1F66 D;  5CHL B;  5BT1 C;  1HTA A;  5B0Z D;  4YS3 A;  1TAF A;  1U35 D;  1EQZ B;  4AWL C;  5B40 D;  5B33 A;  1HQ3 D;  3R45 A;  3MGS D;  4J8U D;  3LZ0 B;  4E44 A;  1P3F D;  4JJN B;  4Z66 A;  2HIO B;  2PYO A;  3MGP D;  4J8W D;  3AZH C;  2CV5 B;  3AFA C;  2FJ7 B;  3X1T A;  1BH8 A;  5GT3 C;  3WAA C;  5B1M C;  4R8P D;  5CPJ A;  4J8X C;  5CPI D;  1AOI C;  1M18 A;  1F66 B;  1KX4 B;  5F99 A;  3W99 D;  1P34 A;  4J8U C;  3X1U A;  2NQB A;  3WKJ D;  3LZ1 D;  3W98 D;  3AFA B;  3AZE B;  4G91 B;  5C3I C;  4EO5 C;  4KGC A;  3KXB A;  4HGA B;  3REK C;  1WWI A;  1KU5 A;  3B6G C;  2L5A A;  3KXB B;  3REI A;  5CPK D;  3UTB C;  1P3M B;  5GT0 B;  3UTB D;  2CV5 C;  3AZK D;  5AVC B;  3REK D;  3AZM A;  1P3K A;  1P3P B;  2CWE A;  1ULY A;  4CAY A;  4Z5T C;  4KGC C;  1ID3 A;  3KWQ C;  3AYW A;  4JJN A;  4ZUX B;  5B32 D;  1ZLA D;  4KHA A;  3R45 B;  5AVB A;  1JFI B;  5CPJ C;  3REL C;  4XUJ C;  4KUD D;  3REK B;  3NQU A;  3KWQ A;  2ARO C;  2HUE B;  1P3A D;  4X23 C;  3AZM C;  1P3K C;  1P3M C;  5CP6 A;  1M19 D;  1ZLA C;  3AZN A;  3REI B;  1EQZ C;  5DNM A;  5BNX A;  3UT9 D;  4KGC B;  2NZD C;  5BT1 D;  3LZ0 C;  3AZL C;  4ZBJ C;  4Z2M H;  3LZ0 D;  4G91 C;  4CAY B;  5F99 C;  3B0D C;  4J8X A;  1KX3 D;  4WU8 A;  1AOI A;  5B24 A;  3AZG B;  3B6F B;  1U35 B;  3AZG A;  1EQZ D;  4WU9 D;  1TZY D;  4WU8 B;  3UT9 C;  3C1C D;  4J8U B;  3AZJ A;  1P3L A;  4YM6 D;  4G92 C;  3W99 B;  4XZQ D;  3C1C A;  4LD9 D;  3VH6 W;  5JA4 A;  4WV4 B;  4Z66 C;  3WKJ C;  1BH9 B;  4WU9 A;  3MNN A;  5B24 D;  3AZN B;  4J8X D;  1KX3 A;  1AOI D;  1H3O B;  4R8P C;  1P34 B;  1M1A C;  1KX4 A;  3AFA D;  4LD9 C;  3A6N A;  4XZQ B;  3NQU B;  4H9Q B;  3REJ B;  1P3L C;  3X1V D;  1U35 C;  5B0Y A;  2F8N B;  3AZL A;  3X1T B;  3C1C B;  2YFW B;  4QLC A;  3AZN C;  1P3B C;  3REH A;  3TU4 B;  3LJA B;  3MGQ A;  1HQ3 C;  1WWS A;  3AZF D;  1P3P D;  3AV2 B;  1M19 A;  3LJA A;  3C1B D;  3REH C;  4LD9 B;  2NZD D;  3REI C;  1P3A A;  5AV5 C;  4J8V C;  3AZI A;  3AZK B;  5B0Z C;  5AVC D;  2F8N H;  5AVC A;  3A6N B;  5AVB C;  3REJ A;  4J8X B;  3AZI D;  1AOI B;  3B6F A;  4H9S A;  3C1B A;  4R8P B;  3LJA D;  5CPI B;  3LZ1 C;  1P34 C;  5GXQ B;  3VH5 W;  3MGQ D;  3AZE C;  1M1A B;  1ID3 C;  2IO5 C;  4WNN A;  1M19 B;  3W97 B;  3AZM D;  4H9S C;  3X1T C;  1P3K D;  3A6N D;  3AFA A;  1KX4 D;  3AZL B;  3LZ1 B;  5GT0 C;  2FJ7 C;  5F99 B;  5CPJ B;  3MGQ C;  4LD9 A;  1KX3 B;  3B6F D;  4KHA B;  1P3I C;  3UT9 B;  3WA9 C;  2BYM B;  2RVQ D;  3AV1 C;  4KGC D;  3X1U C;  2NQB C;  3TU4 A;  4G92 B;  2NZD A;  2YFW A;  4ZUX C;  3W97 D;  5E5A A;  5F99 D;  3AZF A;  5CPI A;  1EQZ A;  3W97 C;  3AZG D;  4ZUX D;  4R8P A;  3C1B C;  3REH D;  3UTA C;  4QLC D;  3AZL D;  1TAF B;  2PYO C;  4UUZ B;  5B2J A;  1P3A B;  5B2J D;  4YM6 B;  1ZLA B;  1P3F A;  4AWL B;  2BYK B;  4KUD B;  1HQ3 A;  5G49 B;  3VH5 T;  4ZUX A;  5B32 G;  3MNN D;  4JJN C;  3TU4 C;  5G49 A;  5E5A D;  5FUG B;  2HIO C;  5B0Y C;  3W97 A;  5CPI C;  5CP6 D;  3AV1 B;  2F8N K;  5B24 C;  5E5A C;  3X1U B;  4YS3 D;  5B2I B;  3TU4 D;  4XZQ A;  2NQB B;  5BNV B;  3AZJ C;  1M18 B;  5AV5 B;  4UUZ A;  1F66 A;  5B1M B;  3WAA B;  3X1V B;  1R4V A;  3O62 B;  4CSR A;  4NE3 A;  4H9P A;  1BH9 A;  4WU9 B;  4Z2M G;  4WU8 D;  5E5A B;  3AYW D;  4EO5 B;  3KUY A;  1ID3 D;  4NFT A; 
#chains in the Genus database with same CATH topology
 5AV5 D;  3KXB C;  3UT9 A;  3MGR C;  1BFM A;  3MGR D;  5B40 B;  5B24 B;  3AZN D;  3LEL B;  3B6F C;  5B0Z B;  3VH6 T;  5FUG A;  5AVB B;  3AV1 A;  1JFI A;  2BG1 A;  3REJ D;  5DNN B;  3KUY C;  2YFV A;  1P3B B;  2FJ7 D;  2PYO B;  1HQ3 B;  5DNM C;  4KUD A;  1ID3 B;  5B32 A;  4JJN D;  3LEL C;  1ZLA A;  3W99 A;  1P3P A;  1P3G C;  3LEL D;  3FDD A;  5CPJ D;  4KUD C;  2LY8 A;  3F6T A;  2F2A C;  4H9P B;  3A6N C;  5B0Y D;  3X1T D;  3MGR B;  3X1V A;  3REK A;  2PYO D;  5B40 C;  5GXQ C;  1TZY C;  4XZQ C;  3MVD B;  3MGS A;  3X1S C;  3UTA D;  2XD5 A;  2F8N G;  5B33 D;  3MGQ B;  3C1C C;  2W8S A;  5CPK A;  3REI D;  4QLC B;  5B1L D;  4WU9 C;  3AV2 C;  3KXB D;  5B0Z A;  4YM6 A;  3AZJ D;  1P3L D;  5B2J B;  3MVD D;  3W98 A;  3AZF C;  3X1U D;  4YS3 B;  2NQB D;  1BH8 B;  4WU8 C;  3O62 C;  1M18 D;  1TZY A;  5AV8 B;  3WTP E;  5B32 B;  3WA9 B;  3MNN B;  5JA4 B;  3LZ0 A;  3WA9 A;  2IO5 B;  5B33 B;  4Z66 D;  4YS3 C;  3WKJ B;  4J8U A;  5BS7 C;  3MGP C;  1N1J B;  4J8W C;  2FFF B;  5KDM B;  5DNM D;  3MNN C;  3AZE D;  3AZH D;  1S32 A;  5B1M A;  3WAA A;  5B2I C;  5GSU D;  4YM6 C;  1P3G B;  5CPK B;  5GT0 A;  5B2J C;  1P3M A;  2DF4 C;  1KX5 C;  3KWQ D;  3X1S A;  1P3I B;  5BNX B;  5AV8 C;  5AY8 D;  5AV6 C;  2F8N A;  2BYK A;  4WZS B;  5AVB D;  3P5J B;  4NE6 A;  5AV6 D;  3REL A;  5AY8 C;  5AV8 A;  1TZY B;  3B6G D;  5GXQ A;  4J8V D;  5CP6 B;  4M6B A;  3AV2 D;  4H9O B;  1KX5 D;  4H9O A;  3X1V C;  3AYW C;  1P3P C;  3KSY A;  5GSU C;  3B0B A;  1A7W A;  3WTP D;  4Z5T B;  5B2I A;  1P3I D;  1P3B D;  4DRA A;  5B31 A;  3AZI B;  3AZK A;  1P3A C;  3UTB A;  2YFV B;  2CV5 A;  1P3B A;  2ARO D;  5B2I D;  3W96 D;  1M19 C;  1B6W A;  5B31 C;  4X23 D;  3AN2 B;  1M1A D;  3AYW B;  1KX5 B;  1KX4 C;  2Y2L A;  4DRB A;  2G5H C;  3B6G A;  1T3U A;  5AV6 B;  5AV9 C;  5AV6 A;  3REL D;  3NQJ A;  3WTP C;  2ZY4 A;  3W96 C;  1M18 C;  4H9R A;  5AY8 A;  5C3I B;  3LZ1 A;  3WKJ A;  1P34 D;  3A1K A;  5GT3 A;  3AZF B;  1P3F C;  1KX3 C;  4Z5T D;  5DNN C;  3KUY B;  3EG5 B;  2NZD B;  4WNN B;  4H9N B;  5B1L C;  2BYM A;  2JE5 A;  5DNN A;  5BS7 A;  3MGP A;  4J8W A;  1S32 D;  5CPK C;  3W96 B;  3IP4 C;  3AZJ B;  3B0D B;  1P3L B;  3AZH A;  5B33 C;  1P3O C;  3W98 B;  1F1E A;  3C1B B;  1F66 C;  5B40 A;  5DNN D;  2Y2K A;  4E45 A;  1U35 A;  3WA9 D;  2Y2P A;  2UWX A;  5JRG B;  3W98 C;  2HIO A;  5GT3 D;  1B67 A;  1P3F B;  3MVD A;  5B32 C;  5B0Y B;  2HIO D;  1P3O A;  3EPL A;  3AZM B;  1P3K B;  5B1L B;  1N1J A;  5B1L A;  5CP6 C;  4HGA C;  4X23 A;  1H3O A;  3B6G B;  5BNV A;  3B0C W;  3W96 A;  4UPK A;  3MGP B;  3MGS C;  2ARO A;  4J8W B;  2CV5 D;  5BO0 B;  3UTA A;  4ZBJ B;  3O62 D;  3V9R A;  4XUJ A;  3B0C T;  3WTP B;  1P3I A;  3WTP A;  5JRG D;  4XUJ B;  5AVC C;  5GT3 B;  5AV9 A;  5JRG C;  3AN2 C;  3VH6 A;  1P3G A;  4Z5T A;  1Q9C A;  3LEL A;  2Y2O A;  5GXQ D;  5AV8 D;  4X23 B;  3AN2 D;  2JSS A;  3AZH B;  3W99 C;  2FJ7 A;  3X1S D;  3AN2 A;  3REL B;  1P3O B;  2JCH A;  2RVQ C;  3AV1 D;  4Z66 B;  1P3M D;  5GSU B;  1P3G D;  5GT0 D;  3UTB B;  5GSU A;  5AV9 D;  1M1A A;  5DNM B;  5JRG A;  5B1M D;  3WAA D;  4NE5 A;  5AY8 B;  2G5I C;  4H9R B;  4XUJ D;  3MGR A;  3AZE A;  3NQJ B;  3O62 A;  3REJ C;  4CSR B;  5B31 D;  3VH5 A;  1S32 B;  5AV5 A;  5KDM A;  3KWQ B;  3LJA C;  3KUY D;  1KX5 A;  5AV9 B;  3AV2 A;  3EPK A;  4J8V A;  3AZI C;  3X1S B;  3H0L C;  3MVD C;  3REH B;  1P3O D;  4H9N A;  4J8V B;  3AZK C;  3AZG C;  2F8N D;  5B31 B;  3V9R B;  1S32 C;  5B31 G;  3MGS B;  1Z2C B;  2ARO B;  2HUE C;  4H9Q A;  5BO0 A;  3UTA B;  4QLC C;  1F66 D;  5CHL B;  5BT1 C;  1HTA A;  5B0Z D;  4YS3 A;  1TAF A;  1U35 D;  1EQZ B;  2J8P A;  5B40 D;  2ZM5 A;  5B33 A;  4AWL C;  3EPH A;  1HQ3 D;  3R45 A;  3MGS D;  4J8U D;  3LZ0 B;  4E44 A;  1P3F D;  4JJN B;  4Z66 A;  2HIO B;  2PYO A;  3MGP D;  4J8W D;  3AZH C;  2CV5 B;  3AFA C;  2FJ7 B;  3X1T A;  1BH8 A;  4DQY B;  5GT3 C;  3WAA C;  5B1M C;  4R8P D;  5CPJ A;  4J8X C;  5CPI D;  1AOI C;  1M18 A;  1F66 B;  1KX4 B;  5F99 A;  3W99 D;  1P34 A;  4J8U C;  3X1U A;  2NQB A;  3WKJ D;  3LZ1 D;  3W98 D;  3H0R C;  4WJ3 C;  3AFA B;  3AZE B;  4G91 B;  5C3I C;  4EO5 C;  4KGC A;  2ZY2 A;  3KXB A;  4HGA B;  3REK C;  1WWI A;  1KU5 A;  3B6G C;  2L5A A;  3KXB B;  3REI A;  5CPK D;  3UTB C;  1P3M B;  5GT0 B;  3UTB D;  2CV5 C;  3AZK D;  5AVC B;  3REK D;  3AZM A;  1P3K A;  1P3P B;  2CWE A;  1ULY A;  4CAY A;  4Z5T C;  4KGC C;  1ID3 A;  3KWQ C;  3AYW A;  4JJN A;  4ZUX B;  5B32 D;  1ZLA D;  4KHA A;  3AL0 C;  3R45 B;  5AVB A;  1JFI B;  5CPJ C;  3REL C;  4XUJ C;  4KUD D;  3REK B;  3NQU A;  3KWQ A;  2ARO C;  2HUE B;  2RIQ A;  2ZY5 A;  1P3A D;  4X23 C;  3AZM C;  1P3K C;  1P3M C;  2DQN C;  5CP6 A;  1M19 D;  1ZLA C;  3AZN A;  3REI B;  1EQZ C;  5DNM A;  5BNX A;  3UT9 D;  4KGC B;  2NZD C;  5BT1 D;  3LZ0 C;  3AZL C;  4ZBJ C;  3EPJ A;  2XD1 A;  2Y2M A;  4Z2M H;  3LZ0 D;  4G91 C;  4CAY B;  5F99 C;  3B0D C;  4J8X A;  1KX3 D;  4WU8 A;  1AOI A;  5B24 A;  3AZG B;  3B6F B;  1U35 B;  3AZG A;  1EQZ D;  4WU9 D;  1TZY D;  4WU8 B;  3UT9 C;  3C1C D;  4J8U B;  3AZJ A;  1P3L A;  4YM6 D;  4G92 C;  3W99 B;  4XZQ D;  3C1C A;  4LD9 D;  3VH6 W;  5JA4 A;  4WV4 B;  4Z66 C;  3WKJ C;  1BH9 B;  4WU9 A;  3MNN A;  5B24 D;  3AZN B;  4J8X D;  1KX3 A;  1AOI D;  1H3O B;  4R8P C;  1P34 B;  1M1A C;  1KX4 A;  3AFA D;  4LD9 C;  3A6N A;  4XZQ B;  3NQU B;  4H9Q B;  3REJ B;  1P3L C;  3X1V D;  1U35 C;  5B0Y A;  2F8N B;  3AZL A;  3X1T B;  3C1C B;  2YFW B;  4QLC A;  2ZY3 A;  3AZN C;  1P3B C;  3REH A;  3TU4 B;  3LJA B;  2Y2I A;  3MGQ A;  1HQ3 C;  1WWS A;  3AZF D;  1P3P D;  3AV2 B;  1M19 A;  3LJA A;  3C1B D;  3REH C;  4LD9 B;  2NZD D;  3REI C;  1P3A A;  5AV5 C;  4J8V C;  3AZI A;  3AZK B;  5B0Z C;  5AVC D;  2F8N H;  5AVC A;  3A6N B;  5AVB C;  3REJ A;  4J8X B;  3AZI D;  1AOI B;  3B6F A;  4H9S A;  3C1B A;  4R8P B;  3LJA D;  5CPI B;  3LZ1 C;  1P34 C;  5GXQ B;  3VH5 W;  3MGQ D;  3AZE C;  1M1A B;  1ID3 C;  2IO5 C;  4WNN A;  1M19 B;  3W97 B;  3AZM D;  4H9S C;  3X1T C;  1P3K D;  3A1I A;  3A6N D;  3AFA A;  1KX4 D;  3AZL B;  3LZ1 B;  1PZR A;  5GT0 C;  2FJ7 C;  5F99 B;  5CPJ B;  2Y2G A;  3MGQ C;  4LD9 A;  1KX3 B;  3B6F D;  2Y2H A;  4KHA B;  1P3I C;  3UT9 B;  3WA9 C;  2BYM B;  2RVQ D;  3AV1 C;  4KGC D;  3X1U C;  2NQB C;  3TU4 A;  4G92 B;  2NZD A;  1W2E A;  2YFW A;  4ZUX C;  3W97 D;  5E5A A;  5F99 D;  3AZF A;  5CPI A;  1EQZ A;  3W97 C;  3AZG D;  4ZUX D;  4R8P A;  3C1B C;  3REH D;  3UTA C;  4QLC D;  3AZL D;  1TAF B;  2PYO C;  4UUZ B;  5B2J A;  1P3A B;  5B2J D;  4YM6 B;  1ZLA B;  1P3F A;  4AWL B;  2BYK B;  4KUD B;  2Y2J A;  1HQ3 A;  2Y2Q A;  5G49 B;  3VH5 T;  4ZUX A;  5B32 G;  3MNN D;  4JJN C;  3TU4 C;  5B0Y C;  5G49 A;  5E5A D;  5FUG B;  2HIO C;  3W97 A;  2VQR A;  5CPI C;  5CP6 D;  3AV1 B;  2F8N K;  5B24 C;  5E5A C;  3X1U B;  4YS3 D;  5B2I B;  3TU4 D;  4XZQ A;  2NQB B;  3KFU G;  5BNV B;  3H0M C;  3AZJ C;  5AV5 B;  4UUZ A;  1M18 B;  1F66 A;  5B1M B;  3WAA B;  3X1V B;  1R4V A;  3O62 B;  4CSR A;  4NE3 A;  4H9P A;  1BH9 A;  4WU9 B;  4Z2M G;  4WU8 D;  5E5A B;  3AYW D;  2Y2N A;  4EO5 B;  3KUY A;  1ID3 D;  4NFT A; 
#chains in the Genus database with same CATH homology
 5AV5 D;  3KXB C;  3UT9 A;  3MGR C;  1BFM A;  3MGR D;  5B40 B;  5B24 B;  3AZN D;  3LEL B;  3B6F C;  5B0Z B;  3VH6 T;  5FUG A;  5AVB B;  3AV1 A;  1JFI A;  2BG1 A;  3REJ D;  5DNN B;  3KUY C;  2YFV A;  1P3B B;  2FJ7 D;  2PYO B;  1HQ3 B;  5DNM C;  4KUD A;  1ID3 B;  5B32 A;  4JJN D;  3LEL C;  1ZLA A;  3W99 A;  1P3P A;  1P3G C;  3LEL D;  3FDD A;  5CPJ D;  4KUD C;  2LY8 A;  3F6T A;  2F2A C;  4H9P B;  3A6N C;  5B0Y D;  3X1T D;  3MGR B;  3X1V A;  3REK A;  2PYO D;  5B40 C;  5GXQ C;  1TZY C;  4XZQ C;  3MVD B;  3MGS A;  3X1S C;  3UTA D;  2XD5 A;  2F8N G;  5B33 D;  3MGQ B;  3C1C C;  2W8S A;  5CPK A;  3REI D;  4QLC B;  5B1L D;  4WU9 C;  3AV2 C;  3KXB D;  5B0Z A;  4YM6 A;  3AZJ D;  1P3L D;  5B2J B;  3MVD D;  3W98 A;  3AZF C;  3X1U D;  4YS3 B;  2NQB D;  1BH8 B;  4WU8 C;  3O62 C;  1M18 D;  1TZY A;  5AV8 B;  3WTP E;  5B32 B;  3WA9 B;  3MNN B;  5JA4 B;  3LZ0 A;  3WA9 A;  2IO5 B;  5B33 B;  4Z66 D;  4YS3 C;  3WKJ B;  4J8U A;  5BS7 C;  3MGP C;  1N1J B;  4J8W C;  2FFF B;  5KDM B;  5DNM D;  3MNN C;  3AZE D;  3AZH D;  1S32 A;  5B1M A;  3WAA A;  5B2I C;  5GSU D;  4YM6 C;  1P3G B;  5CPK B;  5GT0 A;  5B2J C;  1P3M A;  2DF4 C;  1KX5 C;  3KWQ D;  3X1S A;  1P3I B;  5BNX B;  5AV8 C;  5AY8 D;  5AV6 C;  2F8N A;  2BYK A;  4WZS B;  5AVB D;  3P5J B;  4NE6 A;  5AV6 D;  3REL A;  5AY8 C;  5AV8 A;  1TZY B;  3B6G D;  5GXQ A;  4J8V D;  5CP6 B;  4M6B A;  3AV2 D;  4H9O B;  1KX5 D;  4H9O A;  3X1V C;  3AYW C;  1P3P C;  3KSY A;  5GSU C;  3B0B A;  1A7W A;  3WTP D;  4Z5T B;  5B2I A;  1P3I D;  1P3B D;  4DRA A;  5B31 A;  3AZI B;  3AZK A;  1P3A C;  3UTB A;  2YFV B;  2CV5 A;  1P3B A;  2ARO D;  5B2I D;  3W96 D;  1M19 C;  1B6W A;  5B31 C;  4X23 D;  3AN2 B;  1M1A D;  3AYW B;  1KX5 B;  1KX4 C;  2Y2L A;  4DRB A;  2G5H C;  3B6G A;  1T3U A;  5AV6 B;  5AV9 C;  5AV6 A;  3REL D;  3NQJ A;  3WTP C;  2ZY4 A;  3W96 C;  1M18 C;  4H9R A;  5AY8 A;  5C3I B;  3LZ1 A;  3WKJ A;  1P34 D;  3A1K A;  5GT3 A;  3AZF B;  1P3F C;  1KX3 C;  4Z5T D;  5DNN C;  3KUY B;  3EG5 B;  2NZD B;  4WNN B;  4H9N B;  5B1L C;  2BYM A;  2JE5 A;  5DNN A;  5BS7 A;  3MGP A;  4J8W A;  1S32 D;  5CPK C;  3W96 B;  3IP4 C;  3AZJ B;  3B0D B;  1P3L B;  3AZH A;  5B33 C;  1P3O C;  3W98 B;  1F1E A;  3C1B B;  1F66 C;  5B40 A;  5DNN D;  2Y2K A;  4E45 A;  1U35 A;  3WA9 D;  2Y2P A;  2UWX A;  5JRG B;  3W98 C;  2HIO A;  5GT3 D;  1B67 A;  1P3F B;  3MVD A;  5B32 C;  5B0Y B;  2HIO D;  1P3O A;  3EPL A;  3AZM B;  1P3K B;  5B1L B;  1N1J A;  5B1L A;  5CP6 C;  4HGA C;  4X23 A;  1H3O A;  3B6G B;  5BNV A;  3B0C W;  3W96 A;  4UPK A;  3MGP B;  3MGS C;  2ARO A;  4J8W B;  2CV5 D;  5BO0 B;  3UTA A;  4ZBJ B;  3O62 D;  3V9R A;  4XUJ A;  3B0C T;  3WTP B;  1P3I A;  3WTP A;  5JRG D;  4XUJ B;  5AVC C;  5GT3 B;  5AV9 A;  5JRG C;  3AN2 C;  3VH6 A;  1P3G A;  4Z5T A;  1Q9C A;  3LEL A;  2Y2O A;  5GXQ D;  5AV8 D;  4X23 B;  3AN2 D;  2JSS A;  3AZH B;  3W99 C;  2FJ7 A;  3X1S D;  3AN2 A;  3REL B;  1P3O B;  2JCH A;  2RVQ C;  3AV1 D;  4Z66 B;  1P3M D;  5GSU B;  1P3G D;  5GT0 D;  3UTB B;  5GSU A;  5AV9 D;  1M1A A;  5DNM B;  5JRG A;  5B1M D;  3WAA D;  4NE5 A;  5AY8 B;  2G5I C;  4H9R B;  4XUJ D;  3MGR A;  3AZE A;  3NQJ B;  3O62 A;  3REJ C;  4CSR B;  5B31 D;  3VH5 A;  1S32 B;  5AV5 A;  5KDM A;  3KWQ B;  3LJA C;  3KUY D;  1KX5 A;  5AV9 B;  3AV2 A;  3EPK A;  4J8V A;  3AZI C;  3X1S B;  3H0L C;  3MVD C;  3REH B;  1P3O D;  4H9N A;  4J8V B;  3AZK C;  3AZG C;  2F8N D;  5B31 B;  3V9R B;  1S32 C;  5B31 G;  3MGS B;  1Z2C B;  2ARO B;  2HUE C;  4H9Q A;  5BO0 A;  3UTA B;  4QLC C;  1F66 D;  5CHL B;  5BT1 C;  1HTA A;  5B0Z D;  4YS3 A;  1TAF A;  1U35 D;  1EQZ B;  2J8P A;  5B40 D;  2ZM5 A;  5B33 A;  4AWL C;  3EPH A;  1HQ3 D;  3R45 A;  3MGS D;  4J8U D;  3LZ0 B;  4E44 A;  1P3F D;  4JJN B;  4Z66 A;  2HIO B;  2PYO A;  3MGP D;  4J8W D;  3AZH C;  2CV5 B;  3AFA C;  2FJ7 B;  3X1T A;  1BH8 A;  4DQY B;  5GT3 C;  3WAA C;  5B1M C;  4R8P D;  5CPJ A;  4J8X C;  5CPI D;  1AOI C;  1M18 A;  1F66 B;  1KX4 B;  5F99 A;  3W99 D;  1P34 A;  4J8U C;  3X1U A;  2NQB A;  3WKJ D;  3LZ1 D;  3W98 D;  3H0R C;  4WJ3 C;  3AFA B;  3AZE B;  4G91 B;  5C3I C;  4EO5 C;  4KGC A;  2ZY2 A;  3KXB A;  4HGA B;  3REK C;  1WWI A;  1KU5 A;  3B6G C;  2L5A A;  3KXB B;  3REI A;  5CPK D;  3UTB C;  1P3M B;  5GT0 B;  3UTB D;  2CV5 C;  3AZK D;  5AVC B;  3REK D;  3AZM A;  1P3K A;  1P3P B;  2CWE A;  1ULY A;  4CAY A;  4Z5T C;  4KGC C;  1ID3 A;  3KWQ C;  3AYW A;  4JJN A;  4ZUX B;  5B32 D;  1ZLA D;  4KHA A;  3AL0 C;  3R45 B;  5AVB A;  1JFI B;  5CPJ C;  3REL C;  4XUJ C;  4KUD D;  3REK B;  3NQU A;  3KWQ A;  2ARO C;  2HUE B;  2RIQ A;  2ZY5 A;  1P3A D;  4X23 C;  3AZM C;  1P3K C;  1P3M C;  2DQN C;  5CP6 A;  1M19 D;  1ZLA C;  3AZN A;  3REI B;  1EQZ C;  5DNM A;  5BNX A;  3UT9 D;  4KGC B;  2NZD C;  5BT1 D;  3LZ0 C;  3AZL C;  4ZBJ C;  3EPJ A;  2XD1 A;  2Y2M A;  4Z2M H;  3LZ0 D;  4G91 C;  4CAY B;  5F99 C;  3B0D C;  4J8X A;  1KX3 D;  4WU8 A;  1AOI A;  5B24 A;  3AZG B;  3B6F B;  1U35 B;  3AZG A;  1EQZ D;  4WU9 D;  1TZY D;  4WU8 B;  3UT9 C;  3C1C D;  4J8U B;  3AZJ A;  1P3L A;  4YM6 D;  4G92 C;  3W99 B;  4XZQ D;  3C1C A;  4LD9 D;  3VH6 W;  5JA4 A;  4WV4 B;  4Z66 C;  3WKJ C;  1BH9 B;  4WU9 A;  3MNN A;  5B24 D;  3AZN B;  4J8X D;  1KX3 A;  1AOI D;  1H3O B;  4R8P C;  1P34 B;  1M1A C;  1KX4 A;  3AFA D;  4LD9 C;  3A6N A;  4XZQ B;  3NQU B;  4H9Q B;  3REJ B;  1P3L C;  3X1V D;  1U35 C;  5B0Y A;  2F8N B;  3AZL A;  3X1T B;  3C1C B;  2YFW B;  4QLC A;  2ZY3 A;  3AZN C;  1P3B C;  3REH A;  3TU4 B;  3LJA B;  2Y2I A;  3MGQ A;  1HQ3 C;  1WWS A;  3AZF D;  1P3P D;  3AV2 B;  1M19 A;  3LJA A;  3C1B D;  3REH C;  4LD9 B;  2NZD D;  3REI C;  1P3A A;  5AV5 C;  4J8V C;  3AZI A;  3AZK B;  5B0Z C;  5AVC D;  2F8N H;  5AVC A;  3A6N B;  5AVB C;  3REJ A;  4J8X B;  3AZI D;  1AOI B;  3B6F A;  4H9S A;  3C1B A;  4R8P B;  3LJA D;  5CPI B;  3LZ1 C;  1P34 C;  5GXQ B;  3VH5 W;  3MGQ D;  3AZE C;  1M1A B;  1ID3 C;  2IO5 C;  4WNN A;  1M19 B;  3W97 B;  3AZM D;  4H9S C;  3X1T C;  1P3K D;  3A1I A;  3A6N D;  3AFA A;  1KX4 D;  3AZL B;  3LZ1 B;  1PZR A;  5GT0 C;  2FJ7 C;  5F99 B;  5CPJ B;  2Y2G A;  3MGQ C;  4LD9 A;  1KX3 B;  3B6F D;  2Y2H A;  4KHA B;  1P3I C;  3UT9 B;  3WA9 C;  2BYM B;  2RVQ D;  3AV1 C;  4KGC D;  3X1U C;  2NQB C;  3TU4 A;  4G92 B;  2NZD A;  1W2E A;  2YFW A;  4ZUX C;  3W97 D;  5E5A A;  5F99 D;  3AZF A;  5CPI A;  1EQZ A;  3W97 C;  3AZG D;  4ZUX D;  4R8P A;  3C1B C;  3REH D;  3UTA C;  4QLC D;  3AZL D;  1TAF B;  2PYO C;  4UUZ B;  5B2J A;  1P3A B;  5B2J D;  4YM6 B;  1ZLA B;  1P3F A;  4AWL B;  2BYK B;  4KUD B;  2Y2J A;  1HQ3 A;  2Y2Q A;  5G49 B;  3VH5 T;  4ZUX A;  5B32 G;  3MNN D;  4JJN C;  3TU4 C;  5B0Y C;  5G49 A;  5E5A D;  5FUG B;  2HIO C;  3W97 A;  2VQR A;  5CPI C;  5CP6 D;  3AV1 B;  2F8N K;  5B24 C;  5E5A C;  3X1U B;  4YS3 D;  5B2I B;  3TU4 D;  4XZQ A;  2NQB B;  3KFU G;  5BNV B;  3H0M C;  3AZJ C;  5AV5 B;  4UUZ A;  1M18 B;  1F66 A;  5B1M B;  3WAA B;  3X1V B;  1R4V A;  3O62 B;  4CSR A;  4NE3 A;  4H9P A;  1BH9 A;  4WU9 B;  4Z2M G;  4WU8 D;  5E5A B;  3AYW D;  2Y2N A;  4EO5 B;  3KUY A;  1ID3 D;  4NFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...