5AV5A

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5A00
3AZFB 3REJC 5B33B 4JJNA 5CPKC 3VH6A 3LELD 1P3PD 2PYOB 5DNMB 5E5AC 2AROD 3W96A 3KUYD 3AZJD 3WKJD 3UTBD 3AZHA 4H9RB 3KSYA 1EQZC 3AN2B 3O62D 5AY8B 5JA4B 3AZHB 3MGRA 1M19C 1EQZA 5CPKB 3LELA 1P3PA 5GT0C 4H9QB 4XUJB 4JJNC 5CPKA 4ZUXD 5B2JB 1P3FA 3O62A 1P3IC 3B6FD 3C1CD 2YFVA 4H9QA 3MGPC 1U35A 3X1SA 1M1AB 3O62C 5BO0A 3AZGB 4E45A 5AV5A 1TAFB 1KX3C 3AFAC 3REKB 3X1VC 1N1JB 1S32C 1P3GB 3MGQB 3VH5W 1P3KB 5AV5B 4KUDB 4KUDD 4CSRB 4LD9B 5B2ID 4Z5TB 3UTAA 3TU4C 3LJAA 3W98C 4J8XA 3AV1D 3MGQA 5AV8C 1P3KA 5AVCA 1P3FC 3X1SD 5B24B 1F1EA 3C1CC 1P34B 4J8VB 3X1TC 3V9RA 1KX4A 5B40A 4R8PA 3RELA 4M6BA 5AV5C 3AYWC 1B67A 4J8WC 5JRGB 1F66B 3B6GB 4QLCA 3NQJA 5B2JC 3MVDC 3AYWD 1JFIA 4E44A 3WTPB 3VH6T 3AZMC 5JRGA 1F66A 3B6GA 2IO5B 3AZEC 3C1BD 1P3BD 5GXQA 5AV8A 5FUGB 4J8UB 5GT3B 5GT0A 5GT3D 2BYKB 4YS3B 3WTPA 4X23A 1KX3B 1H3OA 5CPKD 3WTPD 5B33A 4KHAA 4CAYB 3AYWB 1S32A 4XZQD 3REHB 3MGPA 4WU9C 2HUEB 2LY8A 4CAYA 3AYWA 1S32B 4H9RA 3REHA 5AVCD 5AV6D 4WU9A 5B0YD 1P3MC 3REHD 1HQ3C 5JA4A 3W99D 3MNNA 3KXBD 3KWQB 4ZUXB 3B0DC 5B33D 5CPJB 3NQUA 3REJA 3MNNB 1KX5C 5AVCC 3KWQA 4YM6B 1A7WA 1KU5A 4WU8D 4KGCD 5BNXA 4LD9D 3A6NB 3C1CA 2CV5C 3NQUB 3REJB 2NZDD 5DNNC 5B2JA 3LZ1B 2L5AA 1M19A 4H9OB 5B1MB 5DNMC 5AV6A 3WTPC 4J8UD 5JRGD 5B1LD 1P3MB 1TZYB 1F66D 3B6GD 3AZLB 3RELC 2F8NG 5B2IA 3UTAD 2NQBA 5GT3C 3R45A 3UTBB 2CV5D 3C1BC 1P3BC 1P3MA 3X1UD 4X23C 3AZLA 3REKA 1BFMA 3AFAA 4YM6C 1EQZD 5AY8A 2BYMA 1M19D 1KX5D 3W98A 3X1UB 4J8XB 3B0CW 5AV9D 5KDMA 3LELC 3VH5T 3AZNC 1P3PC 5B32D 3REJD 5AVBB 3VH5A 5B32G 4QLCD 1P3MD 3REKD 4H9SC 5CP6B 1P3AC 5E5AD 1KX4B 1ID3D 3W96B 3LJAC 4R8PB 2YFVB 3AV1C 2CWEA 3MGSC 4WU9D 5CPIC 5B31B 4XZQC 1U35D 4ZBJB 3WAAB 3AZID 3WA9D 5BO0B 3AZGA 5CPJD 4J8XC 2NQBC 4Z66B 5GSUD 4DRBA 1P3GA 4NE3A 5AV8B 5GSUA 5AV9C 2CV5A 1P34C 4X23B 3LJAB 2FJ7D 3AZLD 1TZYD 1ZLAC 4YM6D 3MGSB 3AZIA 3AZKB 5CPIB 3WA9A 5CHLB 5B24A 1P34A 2NZDB 3A6ND 4AWLB 5BS7C 4J8WB 5CPIA 1P3OC 4YS3D 5E5AA 3AZHD 4WU8A 4KGCA 5DNMD 5AVBC 3RELD 4H9PA 1P3LC 5BT1D 3KWQD 3KXBB 5AV8D 4WU8C 4KGCC 5CPJA 5F99B 1P3AD 3W98D 1KX5A 3X1VD 5B24D 5B31C 3KXBA 1BH9A 1KX3D 3AZJC 3A6NA 4J8UA 5CP6D 3AFAD 1AOIA 1KX3A 4J8VD 3AZFC 2FJ7A 5BS7A 4G91B 1ID3A 1TZYA 4KHAB 4HGAB 5B32B 2HIOD 3MGPB 3LZ0C 2NQBB 1P3OD 3W97C 3REIA 5B32A 4EO5C 5GXQD 3AN2C 3AZGD 5BT1C 1M1AD 5AV9B 3AZMB 1P3GC 5B0ZA 3AN2A 4J8UC 3X1UA 4G91C 3AZMA 5DNNB 3MVDD 5AVBA 1P3FB 4YM6A 3LZ1C 3AZMD 2F8NK 4J8WD 1TZYC 1ZLAD 5B0YA 5CP6A 1P3IB 5B2JD 1M1AA 5F99C 1KX4D 5G49A 1AOIC 5CPID 2AROC 3KUYC 4XUJA 3MGSD 5GXQC 5B31A 3KXBC 5B2IB 3AZJA 3O62B 1M1AC 3UTBA 3AZGC 3REID 4KUDA 3REKC 4CSRA 4Z5TA 3AZJB 4QLCC 3AV2A 1M18A 2HIOA 3MNND 3MGQC 1P3KC 3B6FB 3AZNB 5AVCB 3LZ0A 1TAFA 2BYMB 3TU4B 4WZSB 2RVQD 1N1JA 4Z5TC 4UUZB 4EO5B 3W98B 5B0ZC 3LZ0B 3MGSA 3UT9D 3V9RB 2PYOD 5CP6C 5B40B 4LD9A 1R4VA 3UTAB 1S32D 2NZDA 5B24C 3RELB 3AZND 5C3IC 3MGRC 2AROA 3KUYA 3W96D 4J8WA 3WKJA 4XZQB 1P3OA 4WNNB 5AVBD 2F8NA 1P3LD 5B1LC 3WKJB 3AZKD 3C1BA 1P3BA 4NFTA 4WNNA 1ULYA 4ZUXC 5F99A 3X1TD 3AN2D 5B31G 3AZEB 4Z66A 5C3IB 3AZKC 1AOIB 1ZLAA 2NZDC 3AZFA 5GXQB 2FJ7C 3UT9C 1ID3B 1HQ3D 3W99C 2HIOC 5GT0B 2BYKA 4YS3A 4R8PC 4XUJC 2PYOA 3AV1B 5DNMA 5AV6C 4WU9B 5BNVA 4G92B 4Z2MG 2NQBD 3W96C 3REIB 1P3LB 1HTAA 3UTBC 3WAAC 5E5AB 1B6WA 1WWSA 4WU8B 4ZUXA 2RVQC 5BNVB 2PYOC 4KGCB 3AV2D 1HQ3B 1M18D 4Z5TD 5B0ZB 3MGRB 1BH8B 4NE5A 1EQZB 5B40C 3UT9B 1ID3C 1HQ3A 2IO5C 1KX5B 1BH8A 5AV6B 3A6NC 1BH9B 4G92C 3UT9A 4HGAC 5B32C 4XUJD 4DRAA 4AWLC 5F99D 3X1TA 1P3AB 1KX4C 5BNXB 4JJNB 3C1CB 1P34D 3X1SB 5B1MA 3X1TB 1P3AA 2F8NH 4ZBJC 5B1MD 3LZ1D 3R45B 2HIOB 5JRGC 5GSUC 5AV9A 3AZNA 4Z66C 5B40D 1F66C 3B6GC 4H9NB 1P3GD 3AFAB 1P3FD 5AY8D 4H9NA 3LELB 1P3PB 5DNNA 3AZFD 3X1SC 4WV4B 3AV2C 1M18C 4LD9C 3LZ0D 3WAAD 5KDMB 2AROB 3KUYB 5B0YB 4J8VA 1P3IA 3W97B 3WAAA 5B2IC 3TU4D 4R8PD 3REHC 5G49B 2HUEC 5B0ZD 2F8NB 1U35B 4J8VC 5B31D 3W97A 3B6FC 3C1BB 4QLCB 1P3BB 3NQJB 3MGPD 1JFIB 3AV2B 1M18B 3KWQC 3B6FA 3MVDB 2JSSA 5GT3A 5GT0D 5AY8C 3UTAC 3TU4A 3X1UC 4X23D 1P3ID 1H3OB 4UUZA 3AZHC 1ZLAB 1AOID 4JJND 3MVDA 4Z2MH 3WTPE 5GSUB 5B1LA 4Z66D 2CV5B 4YS3C 5DNND 3AV1A 3AZED 5B1MC 3MGRD 1P3LA 3WKJC 3AZIB 5B1LB 3AZKA 3B0BA 3WA9B 4XZQA 4NE6A 3AZLC 1P3OB 5B33C 3VH6W 5AV5D 3B0CT 2YFWA 1Q9CA 1WWIA 4H9PB 3W99A 3AZEA 3LJAD 3X1VB 5B0YC 2YFWB 1U35C 2FJ7B 3W97D 3B0DB 3MNNC 5FUGA 3MGQD 1P3KD 4J8XD 5CPJC 3W99B 3AZIC 3LZ1A 4H9SA 1M19B 3WA9C 4H9OA 4KUDC 2F8ND 3REIC 3X1VA
chains in the Genus database with same CATH superfamily
3AZFB 3REJC 5B33B 4JJNA 5CPKC 3VH6A 3LELD 1P3PD 2PYOB 5DNMB 5E5AC 2AROD 3W96A 3KUYD 3AZJD 3WKJD 3UTBD 3AZHA 4H9RB 3KSYA 2ZY4A 1EQZC 3AN2B 3O62D 5AY8B 5JA4B 4UPKA 3AZHB 3MGRA 1M19C 1EQZA 5CPKB 3LELA 1P3PA 2RIQA 5GT0C 4H9QB 4XUJB 4JJNC 5CPKA 4ZUXD 5B2JB 1P3FA 3O62A 1P3IC 3B6FD 3C1CD 2YFVA 2Y2JA 2XD5A 4H9QA 3MGPC 3P5JB 1U35A 3X1SA 1M1AB 1W2EA 2VQRA 3O62C 5BO0A 3AZGB 4E45A 3H0MC 1Z2CB 5AV5A 1TAFB 1KX3C 3AFAC 3REKB 3X1VC 1N1JB 3EPJA 2J8PA 1S32C 1P3GB 3MGQB 3VH5W 1P3KB 5AV5B 4KUDB 4KUDD 4CSRB 2Y2LA 5B2ID 4Z5TB 3UTAA 3TU4C 3LJAA 3W98C 4LD9B 4J8XA 3AV1D 3MGQA 5AV8C 2Y2HA 5AVCA 1P3KA 1P3FC 2DQNC 2Y2KA 3X1SD 5B24B 1F1EA 3C1CC 1P34B 4J8VB 3X1TC 3V9RA 1KX4A 5B40A 4R8PA 3RELA 4M6BA 5AV5C 3AYWC 1B67A 2Y2OA 4J8WC 5JRGB 1F66B 3B6GB 4QLCA 3NQJA 5B2JC 3MVDC 3AYWD 1JFIA 4E44A 3WTPB 3VH6T 3AZMC 5JRGA 1F66A 3B6GA 2IO5B 3AZEC 3C1BD 1P3BD 5GXQA 5AV8A 5FUGB 4J8UB 5GT3B 5GT0A 5GT3D 2BYKB 4YS3B 3WTPA 4X23A 1KX3B 1H3OA 5CPKD 3WTPD 5B33A 4KHAA 4CAYB 3AYWB 1S32A 4XZQD 3REHB 3MGPA 4WU9C 2HUEB 3EPLA 2LY8A 4CAYA 3AYWA 1S32B 4H9RA 3REHA 5AVCD 5AV6D 4WU9A 5B0YD 2F2AC 1P3MC 3REHD 5JA4A 3W99D 1HQ3C 3MNNA 3KXBD 3KWQB 4ZUXB 3B0DC 5B33D 5CPJB 3NQUA 3REJA 3MNNB 1KX5C 5AVCC 3KWQA 4YM6B 1A7WA 1KU5A 4WU8D 4KGCD 5BNXA 2XD1A 4LD9D 3A6NB 3C1CA 2CV5C 3NQUB 3REJB 2NZDD 5DNNC 5B2JA 3LZ1B 2L5AA 1M19A 4H9OB 5B1MB 5DNMC 5AV6A 3WTPC 4J8UD 5JRGD 5B1LD 1P3MB 1TZYB 1F66D 3B6GD 3AZLB 3RELC 2F8NG 5B2IA 3UTAD 2NQBA 5GT3C 3R45A 3UTBB 2CV5D 3C1BC 2ZY3A 1P3BC 3X1UD 4X23C 1P3MA 3AZLA 3REKA 1BFMA 3AFAA 4YM6C 1EQZD 5AY8A 2BYMA 1M19D 1KX5D 3W98A 3X1UB 4J8XB 3B0CW 5AV9D 5KDMA 3LELC 3VH5T 3AZNC 1P3PC 5B32D 3REJD 2FFFB 5AVBB 3VH5A 5B32G 4QLCD 1P3MD 3EPHA 3REKD 4H9SC 5CP6B 1P3AC 5E5AD 1KX4B 1ID3D 3W96B 3LJAC 4R8PB 2YFVB 3AV1C 2CWEA 3MGSC 4WU9D 5CPIC 5B31B 4XZQC 1U35D 4ZBJB 3WAAB 3AZID 3WA9D 5BO0B 3AZGA 1T3UA 5CPJD 4J8XC 2NQBC 4Z66B 5GSUD 4DRBA 1P3GA 4NE3A 5AV8B 5GSUA 5AV9C 2CV5A 1P34C 4X23B 3LJAB 2FJ7D 3AZLD 1TZYD 1ZLAC 4YM6D 3MGSB 3AZIA 3AZKB 5CPIB 3WA9A 5CHLB 5B24A 1P34A 2NZDB 3A6ND 4AWLB 5BS7C 4J8WB 5CPIA 1P3OC 4YS3D 5E5AA 3AZHD 4WU8A 4KGCA 5DNMD 5AVBC 3RELD 4H9PA 1P3LC 5BT1D 3KWQD 3KXBB 5AV8D 4WU8C 4KGCC 5CPJA 5F99B 1P3AD 3W98D 1KX5A 3X1VD 5B24D 5B31C 3KXBA 1BH9A 1KX3D 3AZJC 2ZY5A 3A6NA 4J8UA 5CP6D 3AFAD 1AOIA 1KX3A 4J8VD 3AZFC 2FJ7A 5BS7A 4G91B 1ID3A 1TZYA 4KHAB 4HGAB 5B32B 2HIOD 2G5HC 3MGPB 3LZ0C 2NQBB 1P3OD 3W97C 3REIA 3EG5B 5B32A 4EO5C 5GXQD 3AN2C 3AZGD 5BT1C 1M1AD 3A1IA 5AV9B 3AZMB 1P3GC 5B0ZA 2JE5A 3AN2A 4J8UC 3X1UA 4G91C 3KFUG 3AZMA 5DNNB 3MVDD 5AVBA 1P3FB 4YM6A 3LZ1C 3AZMD 2F8NK 4J8WD 1TZYC 1ZLAD 5B0YA 5CP6A 1P3IB 5B2JD 1M1AA 5F99C 1KX4D 5G49A 1AOIC 5CPID 2AROC 3KUYC 4XUJA 3MGSD 5GXQC 5B31A 3KXBC 5B2IB 3AZJA 3O62B 1M1AC 3UTBA 3AZGC 3REID 4KUDA 3REKC 4CSRA 4Z5TA 3AZJB 4QLCC 3AV2A 1M18A 2HIOA 3MNND 1PZRA 3MGQC 1P3KC 3B6FB 3AZNB 2W8SA 5AVCB 3LZ0A 1TAFA 2BYMB 3TU4B 4WZSB 2RVQD 1N1JA 4Z5TC 4UUZB 4EO5B 3W98B 5B0ZC 3LZ0B 3MGSA 3UT9D 3V9RB 2PYOD 5CP6C 5B40B 4LD9A 1R4VA 3UTAB 1S32D 2NZDA 5B24C 3RELB 3AZND 5C3IC 3MGRC 2AROA 3KUYA 3W96D 4J8WA 2G5IC 3WKJA 4XZQB 1P3OA 4WNNB 5AVBD 2F8NA 1P3LD 5B1LC 3WKJB 3AZKD 3C1BA 1P3BA 4NFTA 4WNNA 1ULYA 4ZUXC 5F99A 3X1TD 3AN2D 2ZY2A 5B31G 3AZEB 4Z66A 5C3IB 2JCHA 2Y2IA 3AZKC 1AOIB 1ZLAA 2NZDC 2Y2MA 5GXQB 3AZFA 3UT9C 1ID3B 2FJ7C 1HQ3D 3W99C 2HIOC 5GT0B 2BYKA 4YS3A 4R8PC 4XUJC 2PYOA 3AV1B 5DNMA 5AV6C 4WU9B 5BNVA 2Y2QA 4G92B 4Z2MG 2NQBD 3W96C 3REIB 1P3LB 1HTAA 3UTBC 3WAAC 5E5AB 1B6WA 1WWSA 4WU8B 4ZUXA 2RVQC 5BNVB 2PYOC 4KGCB 3AV2D 1HQ3B 1M18D 4Z5TD 5B0ZB 3MGRB 3H0LC 1BH8B 4DQYB 4NE5A 1EQZB 5B40C 3UT9B 1ID3C 2Y2PA 1HQ3A 2BG1A 2IO5C 1KX5B 1BH8A 5AV6B 3A6NC 1BH9B 2DF4C 4G92C 3UT9A 4HGAC 5B32C 4XUJD 4DRAA 4AWLC 5F99D 3X1TA 1P3AB 1KX4C 5BNXB 4JJNB 3C1CB 1P34D 3A1KA 3X1SB 5B1MA 3X1TB 1P3AA 2F8NH 2UWXA 4ZBJC 5B1MD 3LZ1D 2Y2NA 3R45B 2HIOB 5JRGC 5GSUC 5AV9A 3AZNA 4Z66C 5B40D 1F66C 3B6GC 4H9NB 1P3GD 3AFAB 1P3FD 5AY8D 4H9NA 3FDDA 3LELB 1P3PB 5DNNA 3AZFD 3X1SC 4WV4B 3AV2C 1M18C 4LD9C 3LZ0D 3WAAD 5KDMB 2AROB 3KUYB 5B0YB 4J8VA 1P3IA 3AL0C 3W97B 3WAAA 5B2IC 3TU4D 4R8PD 3F6TA 3REHC 5G49B 2HUEC 5B0ZD 2F8NB 1U35B 4J8VC 5B31D 3W97A 3B6FC 3C1BB 4QLCB 1P3BB 3NQJB 3MGPD 3EPKA 1JFIB 3AV2B 1M18B 3KWQC 3B6FA 2Y2GA 3MVDB 2JSSA 5GT3A 5GT0D 5AY8C 3UTAC 3TU4A 3X1UC 4X23D 1P3ID 1H3OB 4UUZA 3AZHC 1ZLAB 1AOID 4JJND 3IP4C 3MVDA 4Z2MH 2ZM5A 5GSUB 4Z66D 5B1LA 3WTPE 2CV5B 4YS3C 5DNND 4WJ3C 3AV1A 3AZED 5B1MC 3MGRD 1P3LA 3WKJC 3H0RC 3AZIB 5B1LB 3AZKA 3B0BA 3WA9B 4XZQA 4NE6A 3AZLC 1P3OB 5B33C 3VH6W 5AV5D 3B0CT 2YFWA 1Q9CA 1WWIA 4H9PB 3W99A 3AZEA 3LJAD 3X1VB 5B0YC 2YFWB 1U35C 2FJ7B 3W97D 3B0DB 5FUGA 3MNNC 3MGQD 1P3KD 4J8XD 5CPJC 3W99B 3AZIC 3LZ1A 4H9SA 1M19B 3WA9C 4H9OA 4KUDC 2F8ND 3REIC 3X1VA
chains in the Genus database with same CATH topology
3AZFB 3REJC 5B33B 4JJNA 5CPKC 3VH6A 3LELD 1P3PD 2PYOB 5DNMB 5E5AC 2AROD 3W96A 3KUYD 3AZJD 3WKJD 3UTBD 3AZHA 4H9RB 3KSYA 2ZY4A 1EQZC 3AN2B 3O62D 5AY8B 5JA4B 4UPKA 3AZHB 3MGRA 1M19C 1EQZA 5CPKB 3LELA 1P3PA 2RIQA 5GT0C 4H9QB 4XUJB 4JJNC 5CPKA 4ZUXD 5B2JB 1P3FA 3O62A 1P3IC 3B6FD 3C1CD 2YFVA 2Y2JA 2XD5A 4H9QA 3MGPC 3P5JB 1U35A 3X1SA 1M1AB 1W2EA 2VQRA 3O62C 5BO0A 3AZGB 4E45A 3H0MC 1Z2CB 5AV5A 1TAFB 1KX3C 3AFAC 3REKB 3X1VC 1N1JB 3EPJA 2J8PA 1S32C 1P3GB 3MGQB 3VH5W 1P3KB 5AV5B 4KUDB 4KUDD 4CSRB 2Y2LA 5B2ID 4Z5TB 3UTAA 3TU4C 3LJAA 3W98C 4LD9B 4J8XA 3AV1D 3MGQA 5AV8C 2Y2HA 5AVCA 1P3KA 1P3FC 2DQNC 2Y2KA 3X1SD 5B24B 1F1EA 3C1CC 1P34B 4J8VB 3X1TC 3V9RA 1KX4A 5B40A 4R8PA 3RELA 4M6BA 5AV5C 3AYWC 1B67A 2Y2OA 4J8WC 5JRGB 1F66B 3B6GB 4QLCA 3NQJA 5B2JC 3MVDC 3AYWD 1JFIA 4E44A 3WTPB 3VH6T 3AZMC 5JRGA 1F66A 3B6GA 2IO5B 3AZEC 3C1BD 1P3BD 5GXQA 5AV8A 5FUGB 4J8UB 5GT3B 5GT0A 5GT3D 2BYKB 4YS3B 3WTPA 4X23A 1KX3B 1H3OA 5CPKD 3WTPD 5B33A 4KHAA 4CAYB 3AYWB 1S32A 4XZQD 3REHB 3MGPA 4WU9C 2HUEB 3EPLA 2LY8A 4CAYA 3AYWA 1S32B 4H9RA 3REHA 5AVCD 5AV6D 4WU9A 5B0YD 2F2AC 1P3MC 3REHD 5JA4A 3W99D 1HQ3C 3MNNA 3KXBD 3KWQB 4ZUXB 3B0DC 5B33D 5CPJB 3NQUA 3REJA 3MNNB 1KX5C 5AVCC 3KWQA 4YM6B 1A7WA 1KU5A 4WU8D 4KGCD 5BNXA 2XD1A 4LD9D 3A6NB 3C1CA 2CV5C 3NQUB 3REJB 2NZDD 5DNNC 5B2JA 3LZ1B 2L5AA 1M19A 4H9OB 5B1MB 5DNMC 5AV6A 3WTPC 4J8UD 5JRGD 5B1LD 1P3MB 1TZYB 1F66D 3B6GD 3AZLB 3RELC 2F8NG 5B2IA 3UTAD 2NQBA 5GT3C 3R45A 3UTBB 2CV5D 3C1BC 2ZY3A 1P3BC 3X1UD 4X23C 1P3MA 3AZLA 3REKA 1BFMA 3AFAA 4YM6C 1EQZD 5AY8A 2BYMA 1M19D 1KX5D 3W98A 3X1UB 4J8XB 3B0CW 5AV9D 5KDMA 3LELC 3VH5T 3AZNC 1P3PC 5B32D 3REJD 2FFFB 5AVBB 3VH5A 5B32G 4QLCD 1P3MD 3EPHA 3REKD 4H9SC 5CP6B 1P3AC 5E5AD 1KX4B 1ID3D 3W96B 3LJAC 4R8PB 2YFVB 3AV1C 2CWEA 3MGSC 4WU9D 5CPIC 5B31B 4XZQC 1U35D 4ZBJB 3WAAB 3AZID 3WA9D 5BO0B 3AZGA 1T3UA 5CPJD 4J8XC 2NQBC 4Z66B 5GSUD 4DRBA 1P3GA 4NE3A 5AV8B 5GSUA 5AV9C 2CV5A 1P34C 4X23B 3LJAB 2FJ7D 3AZLD 1TZYD 1ZLAC 4YM6D 3MGSB 3AZIA 3AZKB 5CPIB 3WA9A 5CHLB 5B24A 1P34A 2NZDB 3A6ND 4AWLB 5BS7C 4J8WB 5CPIA 1P3OC 4YS3D 5E5AA 3AZHD 4WU8A 4KGCA 5DNMD 5AVBC 3RELD 4H9PA 1P3LC 5BT1D 3KWQD 3KXBB 5AV8D 4WU8C 4KGCC 5CPJA 5F99B 1P3AD 3W98D 1KX5A 3X1VD 5B24D 5B31C 3KXBA 1BH9A 1KX3D 3AZJC 2ZY5A 3A6NA 4J8UA 5CP6D 3AFAD 1AOIA 1KX3A 4J8VD 3AZFC 2FJ7A 5BS7A 4G91B 1ID3A 1TZYA 4KHAB 4HGAB 5B32B 2HIOD 2G5HC 3MGPB 3LZ0C 2NQBB 1P3OD 3W97C 3REIA 3EG5B 5B32A 4EO5C 5GXQD 3AN2C 3AZGD 5BT1C 1M1AD 3A1IA 5AV9B 3AZMB 1P3GC 5B0ZA 2JE5A 3AN2A 4J8UC 3X1UA 4G91C 3KFUG 3AZMA 5DNNB 3MVDD 5AVBA 1P3FB 4YM6A 3LZ1C 3AZMD 2F8NK 4J8WD 1TZYC 1ZLAD 5B0YA 5CP6A 1P3IB 5B2JD 1M1AA 5F99C 1KX4D 5G49A 1AOIC 5CPID 2AROC 3KUYC 4XUJA 3MGSD 5GXQC 5B31A 3KXBC 5B2IB 3AZJA 3O62B 1M1AC 3UTBA 3AZGC 3REID 4KUDA 3REKC 4CSRA 4Z5TA 3AZJB 4QLCC 3AV2A 1M18A 2HIOA 3MNND 1PZRA 3MGQC 1P3KC 3B6FB 3AZNB 2W8SA 5AVCB 3LZ0A 1TAFA 2BYMB 3TU4B 4WZSB 2RVQD 1N1JA 4Z5TC 4UUZB 4EO5B 3W98B 5B0ZC 3LZ0B 3MGSA 3UT9D 3V9RB 2PYOD 5CP6C 5B40B 4LD9A 1R4VA 3UTAB 1S32D 2NZDA 5B24C 3RELB 3AZND 5C3IC 3MGRC 2AROA 3KUYA 3W96D 4J8WA 2G5IC 3WKJA 4XZQB 1P3OA 4WNNB 5AVBD 2F8NA 1P3LD 5B1LC 3WKJB 3AZKD 3C1BA 1P3BA 4NFTA 4WNNA 1ULYA 4ZUXC 5F99A 3X1TD 3AN2D 2ZY2A 5B31G 3AZEB 4Z66A 5C3IB 2JCHA 2Y2IA 3AZKC 1AOIB 1ZLAA 2NZDC 2Y2MA 5GXQB 3AZFA 3UT9C 1ID3B 2FJ7C 1HQ3D 3W99C 2HIOC 5GT0B 2BYKA 4YS3A 4R8PC 4XUJC 2PYOA 3AV1B 5DNMA 5AV6C 4WU9B 5BNVA 2Y2QA 4G92B 4Z2MG 2NQBD 3W96C 3REIB 1P3LB 1HTAA 3UTBC 3WAAC 5E5AB 1B6WA 1WWSA 4WU8B 4ZUXA 2RVQC 5BNVB 2PYOC 4KGCB 3AV2D 1HQ3B 1M18D 4Z5TD 5B0ZB 3MGRB 3H0LC 1BH8B 4DQYB 4NE5A 1EQZB 5B40C 3UT9B 1ID3C 2Y2PA 1HQ3A 2BG1A 2IO5C 1KX5B 1BH8A 5AV6B 3A6NC 1BH9B 2DF4C 4G92C 3UT9A 4HGAC 5B32C 4XUJD 4DRAA 4AWLC 5F99D 3X1TA 1P3AB 1KX4C 5BNXB 4JJNB 3C1CB 1P34D 3A1KA 3X1SB 5B1MA 3X1TB 1P3AA 2F8NH 2UWXA 4ZBJC 5B1MD 3LZ1D 2Y2NA 3R45B 2HIOB 5JRGC 5GSUC 5AV9A 3AZNA 4Z66C 5B40D 1F66C 3B6GC 4H9NB 1P3GD 3AFAB 1P3FD 5AY8D 4H9NA 3FDDA 3LELB 1P3PB 5DNNA 3AZFD 3X1SC 4WV4B 3AV2C 1M18C 4LD9C 3LZ0D 3WAAD 5KDMB 2AROB 3KUYB 5B0YB 4J8VA 1P3IA 3AL0C 3W97B 3WAAA 5B2IC 3TU4D 4R8PD 3F6TA 3REHC 5G49B 2HUEC 5B0ZD 2F8NB 1U35B 4J8VC 5B31D 3W97A 3B6FC 3C1BB 4QLCB 1P3BB 3NQJB 3MGPD 3EPKA 1JFIB 3AV2B 1M18B 3KWQC 3B6FA 2Y2GA 3MVDB 2JSSA 5GT3A 5GT0D 5AY8C 3UTAC 3TU4A 3X1UC 4X23D 1P3ID 1H3OB 4UUZA 3AZHC 1ZLAB 1AOID 4JJND 3IP4C 3MVDA 4Z2MH 2ZM5A 5GSUB 4Z66D 5B1LA 3WTPE 2CV5B 4YS3C 5DNND 4WJ3C 3AV1A 3AZED 5B1MC 3MGRD 1P3LA 3WKJC 3H0RC 3AZIB 5B1LB 3AZKA 3B0BA 3WA9B 4XZQA 4NE6A 3AZLC 1P3OB 5B33C 3VH6W 5AV5D 3B0CT 2YFWA 1Q9CA 1WWIA 4H9PB 3W99A 3AZEA 3LJAD 3X1VB 5B0YC 2YFWB 1U35C 2FJ7B 3W97D 3B0DB 5FUGA 3MNNC 3MGQD 1P3KD 4J8XD 5CPJC 3W99B 3AZIC 3LZ1A 4H9SA 1M19B 3WA9C 4H9OA 4KUDC 2F8ND 3REIC 3X1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF B;  3REJ C;  5B33 B;  4JJN A;  5CPK C;  3VH6 A;  3LEL D;  1P3P D;  2PYO B;  5DNM B;  5E5A C;  2ARO D;  3W96 A;  3KUY D;  3AZJ D;  3WKJ D;  3UTB D;  3AZH A;  4H9R B;  3KSY A;  1EQZ C;  3AN2 B;  3O62 D;  5AY8 B;  5JA4 B;  3AZH B;  3MGR A;  1M19 C;  1EQZ A;  5CPK B;  3LEL A;  1P3P A;  5GT0 C;  4H9Q B;  4XUJ B;  4JJN C;  5CPK A;  4ZUX D;  5B2J B;  1P3F A;  3O62 A;  1P3I C;  3B6F D;  3C1C D;  2YFV A;  4H9Q A;  3MGP C;  1U35 A;  3X1S A;  1M1A B;  3O62 C;  5BO0 A;  3AZG B;  4E45 A;  5AV5 A;  1TAF B;  1KX3 C;  3AFA C;  3REK B;  3X1V C;  1N1J B;  1S32 C;  1P3G B;  3MGQ B;  3VH5 W;  1P3K B;  5AV5 B;  4KUD B;  4KUD D;  4CSR B;  4LD9 B;  5B2I D;  4Z5T B;  3UTA A;  3TU4 C;  3LJA A;  3W98 C;  4J8X A;  3AV1 D;  3MGQ A;  5AV8 C;  1P3K A;  5AVC A;  1P3F C;  3X1S D;  5B24 B;  1F1E A;  3C1C C;  1P34 B;  4J8V B;  3X1T C;  3V9R A;  1KX4 A;  5B40 A;  4R8P A;  3REL A;  4M6B A;  5AV5 C;  3AYW C;  1B67 A;  4J8W C;  5JRG B;  1F66 B;  3B6G B;  4QLC A;  3NQJ A;  5B2J C;  3MVD C;  3AYW D;  1JFI A;  4E44 A;  3WTP B;  3VH6 T;  3AZM C;  5JRG A;  1F66 A;  3B6G A;  2IO5 B;  3AZE C;  3C1B D;  1P3B D;  5GXQ A;  5AV8 A;  5FUG B;  4J8U B;  5GT3 B;  5GT0 A;  5GT3 D;  2BYK B;  4YS3 B;  3WTP A;  4X23 A;  1KX3 B;  1H3O A;  5CPK D;  3WTP D;  5B33 A;  4KHA A;  4CAY B;  3AYW B;  1S32 A;  4XZQ D;  3REH B;  3MGP A;  4WU9 C;  2HUE B;  2LY8 A;  4CAY A;  3AYW A;  1S32 B;  4H9R A;  3REH A;  5AVC D;  5AV6 D;  4WU9 A;  5B0Y D;  1P3M C;  3REH D;  1HQ3 C;  5JA4 A;  3W99 D;  3MNN A;  3KXB D;  3KWQ B;  4ZUX B;  3B0D C;  5B33 D;  5CPJ B;  3NQU A;  3REJ A;  3MNN B;  1KX5 C;  5AVC C;  3KWQ A;  4YM6 B;  1A7W A;  1KU5 A;  4WU8 D;  4KGC D;  5BNX A;  4LD9 D;  3A6N B;  3C1C A;  2CV5 C;  3NQU B;  3REJ B;  2NZD D;  5DNN C;  5B2J A;  3LZ1 B;  2L5A A;  1M19 A;  4H9O B;  5B1M B;  5DNM C;  5AV6 A;  3WTP C;  4J8U D;  5JRG D;  5B1L D;  1P3M B;  1TZY B;  1F66 D;  3B6G D;  3AZL B;  3REL C;  2F8N G;  5B2I A;  3UTA D;  2NQB A;  5GT3 C;  3R45 A;  3UTB B;  2CV5 D;  3C1B C;  1P3B C;  1P3M A;  3X1U D;  4X23 C;  3AZL A;  3REK A;  1BFM A;  3AFA A;  4YM6 C;  1EQZ D;  5AY8 A;  2BYM A;  1M19 D;  1KX5 D;  3W98 A;  3X1U B;  4J8X B;  3B0C W;  5AV9 D;  5KDM A;  3LEL C;  3VH5 T;  3AZN C;  1P3P C;  5B32 D;  3REJ D;  5AVB B;  3VH5 A;  5B32 G;  4QLC D;  1P3M D;  3REK D;  4H9S C;  5CP6 B;  1P3A C;  5E5A D;  1KX4 B;  1ID3 D;  3W96 B;  3LJA C;  4R8P B;  2YFV B;  3AV1 C;  2CWE A;  3MGS C;  4WU9 D;  5CPI C;  5B31 B;  4XZQ C;  1U35 D;  4ZBJ B;  3WAA B;  3AZI D;  3WA9 D;  5BO0 B;  3AZG A;  5CPJ D;  4J8X C;  2NQB C;  4Z66 B;  5GSU D;  4DRB A;  1P3G A;  4NE3 A;  5AV8 B;  5GSU A;  5AV9 C;  2CV5 A;  1P34 C;  4X23 B;  3LJA B;  2FJ7 D;  3AZL D;  1TZY D;  1ZLA C;  4YM6 D;  3MGS B;  3AZI A;  3AZK B;  5CPI B;  3WA9 A;  5CHL B;  5B24 A;  1P34 A;  2NZD B;  3A6N D;  4AWL B;  5BS7 C;  4J8W B;  5CPI A;  1P3O C;  4YS3 D;  5E5A A;  3AZH D;  4WU8 A;  4KGC A;  5DNM D;  5AVB C;  3REL D;  4H9P A;  1P3L C;  5BT1 D;  3KWQ D;  3KXB B;  5AV8 D;  4WU8 C;  4KGC C;  5CPJ A;  5F99 B;  1P3A D;  3W98 D;  1KX5 A;  3X1V D;  5B24 D;  5B31 C;  3KXB A;  1BH9 A;  1KX3 D;  3AZJ C;  3A6N A;  4J8U A;  5CP6 D;  3AFA D;  1AOI A;  1KX3 A;  4J8V D;  3AZF C;  2FJ7 A;  5BS7 A;  4G91 B;  1ID3 A;  1TZY A;  4KHA B;  4HGA B;  5B32 B;  2HIO D;  3MGP B;  3LZ0 C;  2NQB B;  1P3O D;  3W97 C;  3REI A;  5B32 A;  4EO5 C;  5GXQ D;  3AN2 C;  3AZG D;  5BT1 C;  1M1A D;  5AV9 B;  3AZM B;  1P3G C;  5B0Z A;  3AN2 A;  4J8U C;  3X1U A;  4G91 C;  3AZM A;  5DNN B;  3MVD D;  5AVB A;  1P3F B;  4YM6 A;  3LZ1 C;  3AZM D;  2F8N K;  4J8W D;  1TZY C;  1ZLA D;  5B0Y A;  5CP6 A;  1P3I B;  5B2J D;  1M1A A;  5F99 C;  1KX4 D;  5G49 A;  1AOI C;  5CPI D;  2ARO C;  3KUY C;  4XUJ A;  3MGS D;  5GXQ C;  5B31 A;  3KXB C;  5B2I B;  3AZJ A;  3O62 B;  1M1A C;  3UTB A;  3AZG C;  3REI D;  4KUD A;  3REK C;  4CSR A;  4Z5T A;  3AZJ B;  4QLC C;  3AV2 A;  1M18 A;  2HIO A;  3MNN D;  3MGQ C;  1P3K C;  3B6F B;  3AZN B;  5AVC B;  3LZ0 A;  1TAF A;  2BYM B;  3TU4 B;  4WZS B;  2RVQ D;  1N1J A;  4Z5T C;  4UUZ B;  4EO5 B;  3W98 B;  5B0Z C;  3LZ0 B;  3MGS A;  3UT9 D;  3V9R B;  2PYO D;  5CP6 C;  5B40 B;  4LD9 A;  1R4V A;  3UTA B;  1S32 D;  2NZD A;  5B24 C;  3REL B;  3AZN D;  5C3I C;  3MGR C;  2ARO A;  3KUY A;  3W96 D;  4J8W A;  3WKJ A;  4XZQ B;  1P3O A;  4WNN B;  5AVB D;  2F8N A;  1P3L D;  5B1L C;  3WKJ B;  3AZK D;  3C1B A;  1P3B A;  4NFT A;  4WNN A;  1ULY A;  4ZUX C;  5F99 A;  3X1T D;  3AN2 D;  5B31 G;  3AZE B;  4Z66 A;  5C3I B;  3AZK C;  1AOI B;  1ZLA A;  2NZD C;  3AZF A;  5GXQ B;  2FJ7 C;  3UT9 C;  1ID3 B;  1HQ3 D;  3W99 C;  2HIO C;  5GT0 B;  2BYK A;  4YS3 A;  4R8P C;  4XUJ C;  2PYO A;  3AV1 B;  5DNM A;  5AV6 C;  4WU9 B;  5BNV A;  4G92 B;  4Z2M G;  2NQB D;  3W96 C;  3REI B;  1P3L B;  1HTA A;  3UTB C;  3WAA C;  5E5A B;  1B6W A;  1WWS A;  4WU8 B;  4ZUX A;  2RVQ C;  5BNV B;  2PYO C;  4KGC B;  3AV2 D;  1HQ3 B;  1M18 D;  4Z5T D;  5B0Z B;  3MGR B;  1BH8 B;  4NE5 A;  1EQZ B;  5B40 C;  3UT9 B;  1ID3 C;  1HQ3 A;  2IO5 C;  1KX5 B;  1BH8 A;  5AV6 B;  3A6N C;  1BH9 B;  4G92 C;  3UT9 A;  4HGA C;  5B32 C;  4XUJ D;  4DRA A;  4AWL C;  5F99 D;  3X1T A;  1P3A B;  1KX4 C;  5BNX B;  4JJN B;  3C1C B;  1P34 D;  3X1S B;  5B1M A;  3X1T B;  1P3A A;  2F8N H;  4ZBJ C;  5B1M D;  3LZ1 D;  3R45 B;  2HIO B;  5JRG C;  5GSU C;  5AV9 A;  3AZN A;  4Z66 C;  5B40 D;  1F66 C;  3B6G C;  4H9N B;  1P3G D;  3AFA B;  1P3F D;  5AY8 D;  4H9N A;  3LEL B;  1P3P B;  5DNN A;  3AZF D;  3X1S C;  4WV4 B;  3AV2 C;  1M18 C;  4LD9 C;  3LZ0 D;  3WAA D;  5KDM B;  2ARO B;  3KUY B;  5B0Y B;  4J8V A;  1P3I A;  3W97 B;  3WAA A;  5B2I C;  3TU4 D;  4R8P D;  3REH C;  5G49 B;  2HUE C;  5B0Z D;  2F8N B;  1U35 B;  4J8V C;  5B31 D;  3W97 A;  3B6F C;  3C1B B;  4QLC B;  1P3B B;  3NQJ B;  3MGP D;  1JFI B;  3AV2 B;  1M18 B;  3KWQ C;  3B6F A;  3MVD B;  2JSS A;  5GT3 A;  5GT0 D;  5AY8 C;  3UTA C;  3TU4 A;  3X1U C;  4X23 D;  1P3I D;  1H3O B;  4UUZ A;  3AZH C;  1ZLA B;  1AOI D;  4JJN D;  3MVD A;  4Z2M H;  3WTP E;  5GSU B;  5B1L A;  4Z66 D;  2CV5 B;  4YS3 C;  5DNN D;  3AV1 A;  3AZE D;  5B1M C;  3MGR D;  1P3L A;  3WKJ C;  3AZI B;  5B1L B;  3AZK A;  3B0B A;  3WA9 B;  4XZQ A;  4NE6 A;  3AZL C;  1P3O B;  5B33 C;  3VH6 W;  5AV5 D;  3B0C T;  2YFW A;  1Q9C A;  1WWI A;  4H9P B;  3W99 A;  3AZE A;  3LJA D;  3X1V B;  5B0Y C;  2YFW B;  1U35 C;  2FJ7 B;  3W97 D;  3B0D B;  3MNN C;  5FUG A;  3MGQ D;  1P3K D;  4J8X D;  5CPJ C;  3W99 B;  3AZI C;  3LZ1 A;  4H9S A;  1M19 B;  3WA9 C;  4H9O A;  4KUD C;  2F8N D;  3REI C;  3X1V A; 
#chains in the Genus database with same CATH topology
 3AZF B;  3REJ C;  5B33 B;  4JJN A;  5CPK C;  3VH6 A;  3LEL D;  1P3P D;  2PYO B;  5DNM B;  5E5A C;  2ARO D;  3W96 A;  3KUY D;  3AZJ D;  3WKJ D;  3UTB D;  3AZH A;  4H9R B;  3KSY A;  2ZY4 A;  1EQZ C;  3AN2 B;  3O62 D;  5AY8 B;  5JA4 B;  4UPK A;  3AZH B;  3MGR A;  1M19 C;  1EQZ A;  5CPK B;  3LEL A;  1P3P A;  2RIQ A;  5GT0 C;  4H9Q B;  4XUJ B;  4JJN C;  5CPK A;  4ZUX D;  5B2J B;  1P3F A;  3O62 A;  1P3I C;  3B6F D;  3C1C D;  2YFV A;  2Y2J A;  2XD5 A;  4H9Q A;  3MGP C;  3P5J B;  1U35 A;  3X1S A;  1M1A B;  1W2E A;  2VQR A;  3O62 C;  5BO0 A;  3AZG B;  4E45 A;  3H0M C;  1Z2C B;  5AV5 A;  1TAF B;  1KX3 C;  3AFA C;  3REK B;  3X1V C;  1N1J B;  3EPJ A;  2J8P A;  1S32 C;  1P3G B;  3MGQ B;  3VH5 W;  1P3K B;  5AV5 B;  4KUD B;  4KUD D;  4CSR B;  2Y2L A;  5B2I D;  4Z5T B;  3UTA A;  3TU4 C;  3LJA A;  3W98 C;  4LD9 B;  4J8X A;  3AV1 D;  3MGQ A;  5AV8 C;  2Y2H A;  5AVC A;  1P3K A;  1P3F C;  2DQN C;  2Y2K A;  3X1S D;  5B24 B;  1F1E A;  3C1C C;  1P34 B;  4J8V B;  3X1T C;  3V9R A;  1KX4 A;  5B40 A;  4R8P A;  3REL A;  4M6B A;  5AV5 C;  3AYW C;  1B67 A;  2Y2O A;  4J8W C;  5JRG B;  1F66 B;  3B6G B;  4QLC A;  3NQJ A;  5B2J C;  3MVD C;  3AYW D;  1JFI A;  4E44 A;  3WTP B;  3VH6 T;  3AZM C;  5JRG A;  1F66 A;  3B6G A;  2IO5 B;  3AZE C;  3C1B D;  1P3B D;  5GXQ A;  5AV8 A;  5FUG B;  4J8U B;  5GT3 B;  5GT0 A;  5GT3 D;  2BYK B;  4YS3 B;  3WTP A;  4X23 A;  1KX3 B;  1H3O A;  5CPK D;  3WTP D;  5B33 A;  4KHA A;  4CAY B;  3AYW B;  1S32 A;  4XZQ D;  3REH B;  3MGP A;  4WU9 C;  2HUE B;  3EPL A;  2LY8 A;  4CAY A;  3AYW A;  1S32 B;  4H9R A;  3REH A;  5AVC D;  5AV6 D;  4WU9 A;  5B0Y D;  2F2A C;  1P3M C;  3REH D;  5JA4 A;  3W99 D;  1HQ3 C;  3MNN A;  3KXB D;  3KWQ B;  4ZUX B;  3B0D C;  5B33 D;  5CPJ B;  3NQU A;  3REJ A;  3MNN B;  1KX5 C;  5AVC C;  3KWQ A;  4YM6 B;  1A7W A;  1KU5 A;  4WU8 D;  4KGC D;  5BNX A;  2XD1 A;  4LD9 D;  3A6N B;  3C1C A;  2CV5 C;  3NQU B;  3REJ B;  2NZD D;  5DNN C;  5B2J A;  3LZ1 B;  2L5A A;  1M19 A;  4H9O B;  5B1M B;  5DNM C;  5AV6 A;  3WTP C;  4J8U D;  5JRG D;  5B1L D;  1P3M B;  1TZY B;  1F66 D;  3B6G D;  3AZL B;  3REL C;  2F8N G;  5B2I A;  3UTA D;  2NQB A;  5GT3 C;  3R45 A;  3UTB B;  2CV5 D;  3C1B C;  2ZY3 A;  1P3B C;  3X1U D;  4X23 C;  1P3M A;  3AZL A;  3REK A;  1BFM A;  3AFA A;  4YM6 C;  1EQZ D;  5AY8 A;  2BYM A;  1M19 D;  1KX5 D;  3W98 A;  3X1U B;  4J8X B;  3B0C W;  5AV9 D;  5KDM A;  3LEL C;  3VH5 T;  3AZN C;  1P3P C;  5B32 D;  3REJ D;  2FFF B;  5AVB B;  3VH5 A;  5B32 G;  4QLC D;  1P3M D;  3EPH A;  3REK D;  4H9S C;  5CP6 B;  1P3A C;  5E5A D;  1KX4 B;  1ID3 D;  3W96 B;  3LJA C;  4R8P B;  2YFV B;  3AV1 C;  2CWE A;  3MGS C;  4WU9 D;  5CPI C;  5B31 B;  4XZQ C;  1U35 D;  4ZBJ B;  3WAA B;  3AZI D;  3WA9 D;  5BO0 B;  3AZG A;  1T3U A;  5CPJ D;  4J8X C;  2NQB C;  4Z66 B;  5GSU D;  4DRB A;  1P3G A;  4NE3 A;  5AV8 B;  5GSU A;  5AV9 C;  2CV5 A;  1P34 C;  4X23 B;  3LJA B;  2FJ7 D;  3AZL D;  1TZY D;  1ZLA C;  4YM6 D;  3MGS B;  3AZI A;  3AZK B;  5CPI B;  3WA9 A;  5CHL B;  5B24 A;  1P34 A;  2NZD B;  3A6N D;  4AWL B;  5BS7 C;  4J8W B;  5CPI A;  1P3O C;  4YS3 D;  5E5A A;  3AZH D;  4WU8 A;  4KGC A;  5DNM D;  5AVB C;  3REL D;  4H9P A;  1P3L C;  5BT1 D;  3KWQ D;  3KXB B;  5AV8 D;  4WU8 C;  4KGC C;  5CPJ A;  5F99 B;  1P3A D;  3W98 D;  1KX5 A;  3X1V D;  5B24 D;  5B31 C;  3KXB A;  1BH9 A;  1KX3 D;  3AZJ C;  2ZY5 A;  3A6N A;  4J8U A;  5CP6 D;  3AFA D;  1AOI A;  1KX3 A;  4J8V D;  3AZF C;  2FJ7 A;  5BS7 A;  4G91 B;  1ID3 A;  1TZY A;  4KHA B;  4HGA B;  5B32 B;  2HIO D;  2G5H C;  3MGP B;  3LZ0 C;  2NQB B;  1P3O D;  3W97 C;  3REI A;  3EG5 B;  5B32 A;  4EO5 C;  5GXQ D;  3AN2 C;  3AZG D;  5BT1 C;  1M1A D;  3A1I A;  5AV9 B;  3AZM B;  1P3G C;  5B0Z A;  2JE5 A;  3AN2 A;  4J8U C;  3X1U A;  4G91 C;  3KFU G;  3AZM A;  5DNN B;  3MVD D;  5AVB A;  1P3F B;  4YM6 A;  3LZ1 C;  3AZM D;  2F8N K;  4J8W D;  1TZY C;  1ZLA D;  5B0Y A;  5CP6 A;  1P3I B;  5B2J D;  1M1A A;  5F99 C;  1KX4 D;  5G49 A;  1AOI C;  5CPI D;  2ARO C;  3KUY C;  4XUJ A;  3MGS D;  5GXQ C;  5B31 A;  3KXB C;  5B2I B;  3AZJ A;  3O62 B;  1M1A C;  3UTB A;  3AZG C;  3REI D;  4KUD A;  3REK C;  4CSR A;  4Z5T A;  3AZJ B;  4QLC C;  3AV2 A;  1M18 A;  2HIO A;  3MNN D;  1PZR A;  3MGQ C;  1P3K C;  3B6F B;  3AZN B;  2W8S A;  5AVC B;  3LZ0 A;  1TAF A;  2BYM B;  3TU4 B;  4WZS B;  2RVQ D;  1N1J A;  4Z5T C;  4UUZ B;  4EO5 B;  3W98 B;  5B0Z C;  3LZ0 B;  3MGS A;  3UT9 D;  3V9R B;  2PYO D;  5CP6 C;  5B40 B;  4LD9 A;  1R4V A;  3UTA B;  1S32 D;  2NZD A;  5B24 C;  3REL B;  3AZN D;  5C3I C;  3MGR C;  2ARO A;  3KUY A;  3W96 D;  4J8W A;  2G5I C;  3WKJ A;  4XZQ B;  1P3O A;  4WNN B;  5AVB D;  2F8N A;  1P3L D;  5B1L C;  3WKJ B;  3AZK D;  3C1B A;  1P3B A;  4NFT A;  4WNN A;  1ULY A;  4ZUX C;  5F99 A;  3X1T D;  3AN2 D;  2ZY2 A;  5B31 G;  3AZE B;  4Z66 A;  5C3I B;  2JCH A;  2Y2I A;  3AZK C;  1AOI B;  1ZLA A;  2NZD C;  2Y2M A;  5GXQ B;  3AZF A;  3UT9 C;  1ID3 B;  2FJ7 C;  1HQ3 D;  3W99 C;  2HIO C;  5GT0 B;  2BYK A;  4YS3 A;  4R8P C;  4XUJ C;  2PYO A;  3AV1 B;  5DNM A;  5AV6 C;  4WU9 B;  5BNV A;  2Y2Q A;  4G92 B;  4Z2M G;  2NQB D;  3W96 C;  3REI B;  1P3L B;  1HTA A;  3UTB C;  3WAA C;  5E5A B;  1B6W A;  1WWS A;  4WU8 B;  4ZUX A;  2RVQ C;  5BNV B;  2PYO C;  4KGC B;  3AV2 D;  1HQ3 B;  1M18 D;  4Z5T D;  5B0Z B;  3MGR B;  3H0L C;  1BH8 B;  4DQY B;  4NE5 A;  1EQZ B;  5B40 C;  3UT9 B;  1ID3 C;  2Y2P A;  1HQ3 A;  2BG1 A;  2IO5 C;  1KX5 B;  1BH8 A;  5AV6 B;  3A6N C;  1BH9 B;  2DF4 C;  4G92 C;  3UT9 A;  4HGA C;  5B32 C;  4XUJ D;  4DRA A;  4AWL C;  5F99 D;  3X1T A;  1P3A B;  1KX4 C;  5BNX B;  4JJN B;  3C1C B;  1P34 D;  3A1K A;  3X1S B;  5B1M A;  3X1T B;  1P3A A;  2F8N H;  2UWX A;  4ZBJ C;  5B1M D;  3LZ1 D;  2Y2N A;  3R45 B;  2HIO B;  5JRG C;  5GSU C;  5AV9 A;  3AZN A;  4Z66 C;  5B40 D;  1F66 C;  3B6G C;  4H9N B;  1P3G D;  3AFA B;  1P3F D;  5AY8 D;  4H9N A;  3FDD A;  3LEL B;  1P3P B;  5DNN A;  3AZF D;  3X1S C;  4WV4 B;  3AV2 C;  1M18 C;  4LD9 C;  3LZ0 D;  3WAA D;  5KDM B;  2ARO B;  3KUY B;  5B0Y B;  4J8V A;  1P3I A;  3AL0 C;  3W97 B;  3WAA A;  5B2I C;  3TU4 D;  4R8P D;  3F6T A;  3REH C;  5G49 B;  2HUE C;  5B0Z D;  2F8N B;  1U35 B;  4J8V C;  5B31 D;  3W97 A;  3B6F C;  3C1B B;  4QLC B;  1P3B B;  3NQJ B;  3MGP D;  3EPK A;  1JFI B;  3AV2 B;  1M18 B;  3KWQ C;  3B6F A;  2Y2G A;  3MVD B;  2JSS A;  5GT3 A;  5GT0 D;  5AY8 C;  3UTA C;  3TU4 A;  3X1U C;  4X23 D;  1P3I D;  1H3O B;  4UUZ A;  3AZH C;  1ZLA B;  1AOI D;  4JJN D;  3IP4 C;  3MVD A;  4Z2M H;  2ZM5 A;  5GSU B;  4Z66 D;  5B1L A;  3WTP E;  2CV5 B;  4YS3 C;  5DNN D;  4WJ3 C;  3AV1 A;  3AZE D;  5B1M C;  3MGR D;  1P3L A;  3WKJ C;  3H0R C;  3AZI B;  5B1L B;  3AZK A;  3B0B A;  3WA9 B;  4XZQ A;  4NE6 A;  3AZL C;  1P3O B;  5B33 C;  3VH6 W;  5AV5 D;  3B0C T;  2YFW A;  1Q9C A;  1WWI A;  4H9P B;  3W99 A;  3AZE A;  3LJA D;  3X1V B;  5B0Y C;  2YFW B;  1U35 C;  2FJ7 B;  3W97 D;  3B0D B;  5FUG A;  3MNN C;  3MGQ D;  1P3K D;  4J8X D;  5CPJ C;  3W99 B;  3AZI C;  3LZ1 A;  4H9S A;  1M19 B;  3WA9 C;  4H9O A;  4KUD C;  2F8N D;  3REI C;  3X1V A; 
#chains in the Genus database with same CATH homology
 3AZF B;  3REJ C;  5B33 B;  4JJN A;  5CPK C;  3VH6 A;  3LEL D;  1P3P D;  2PYO B;  5DNM B;  5E5A C;  2ARO D;  3W96 A;  3KUY D;  3AZJ D;  3WKJ D;  3UTB D;  3AZH A;  4H9R B;  3KSY A;  2ZY4 A;  1EQZ C;  3AN2 B;  3O62 D;  5AY8 B;  5JA4 B;  4UPK A;  3AZH B;  3MGR A;  1M19 C;  1EQZ A;  5CPK B;  3LEL A;  1P3P A;  2RIQ A;  5GT0 C;  4H9Q B;  4XUJ B;  4JJN C;  5CPK A;  4ZUX D;  5B2J B;  1P3F A;  3O62 A;  1P3I C;  3B6F D;  3C1C D;  2YFV A;  2Y2J A;  2XD5 A;  4H9Q A;  3MGP C;  3P5J B;  1U35 A;  3X1S A;  1M1A B;  1W2E A;  2VQR A;  3O62 C;  5BO0 A;  3AZG B;  4E45 A;  3H0M C;  1Z2C B;  5AV5 A;  1TAF B;  1KX3 C;  3AFA C;  3REK B;  3X1V C;  1N1J B;  3EPJ A;  2J8P A;  1S32 C;  1P3G B;  3MGQ B;  3VH5 W;  1P3K B;  5AV5 B;  4KUD B;  4KUD D;  4CSR B;  2Y2L A;  5B2I D;  4Z5T B;  3UTA A;  3TU4 C;  3LJA A;  3W98 C;  4LD9 B;  4J8X A;  3AV1 D;  3MGQ A;  5AV8 C;  2Y2H A;  5AVC A;  1P3K A;  1P3F C;  2DQN C;  2Y2K A;  3X1S D;  5B24 B;  1F1E A;  3C1C C;  1P34 B;  4J8V B;  3X1T C;  3V9R A;  1KX4 A;  5B40 A;  4R8P A;  3REL A;  4M6B A;  5AV5 C;  3AYW C;  1B67 A;  2Y2O A;  4J8W C;  5JRG B;  1F66 B;  3B6G B;  4QLC A;  3NQJ A;  5B2J C;  3MVD C;  3AYW D;  1JFI A;  4E44 A;  3WTP B;  3VH6 T;  3AZM C;  5JRG A;  1F66 A;  3B6G A;  2IO5 B;  3AZE C;  3C1B D;  1P3B D;  5GXQ A;  5AV8 A;  5FUG B;  4J8U B;  5GT3 B;  5GT0 A;  5GT3 D;  2BYK B;  4YS3 B;  3WTP A;  4X23 A;  1KX3 B;  1H3O A;  5CPK D;  3WTP D;  5B33 A;  4KHA A;  4CAY B;  3AYW B;  1S32 A;  4XZQ D;  3REH B;  3MGP A;  4WU9 C;  2HUE B;  3EPL A;  2LY8 A;  4CAY A;  3AYW A;  1S32 B;  4H9R A;  3REH A;  5AVC D;  5AV6 D;  4WU9 A;  5B0Y D;  2F2A C;  1P3M C;  3REH D;  5JA4 A;  3W99 D;  1HQ3 C;  3MNN A;  3KXB D;  3KWQ B;  4ZUX B;  3B0D C;  5B33 D;  5CPJ B;  3NQU A;  3REJ A;  3MNN B;  1KX5 C;  5AVC C;  3KWQ A;  4YM6 B;  1A7W A;  1KU5 A;  4WU8 D;  4KGC D;  5BNX A;  2XD1 A;  4LD9 D;  3A6N B;  3C1C A;  2CV5 C;  3NQU B;  3REJ B;  2NZD D;  5DNN C;  5B2J A;  3LZ1 B;  2L5A A;  1M19 A;  4H9O B;  5B1M B;  5DNM C;  5AV6 A;  3WTP C;  4J8U D;  5JRG D;  5B1L D;  1P3M B;  1TZY B;  1F66 D;  3B6G D;  3AZL B;  3REL C;  2F8N G;  5B2I A;  3UTA D;  2NQB A;  5GT3 C;  3R45 A;  3UTB B;  2CV5 D;  3C1B C;  2ZY3 A;  1P3B C;  3X1U D;  4X23 C;  1P3M A;  3AZL A;  3REK A;  1BFM A;  3AFA A;  4YM6 C;  1EQZ D;  5AY8 A;  2BYM A;  1M19 D;  1KX5 D;  3W98 A;  3X1U B;  4J8X B;  3B0C W;  5AV9 D;  5KDM A;  3LEL C;  3VH5 T;  3AZN C;  1P3P C;  5B32 D;  3REJ D;  2FFF B;  5AVB B;  3VH5 A;  5B32 G;  4QLC D;  1P3M D;  3EPH A;  3REK D;  4H9S C;  5CP6 B;  1P3A C;  5E5A D;  1KX4 B;  1ID3 D;  3W96 B;  3LJA C;  4R8P B;  2YFV B;  3AV1 C;  2CWE A;  3MGS C;  4WU9 D;  5CPI C;  5B31 B;  4XZQ C;  1U35 D;  4ZBJ B;  3WAA B;  3AZI D;  3WA9 D;  5BO0 B;  3AZG A;  1T3U A;  5CPJ D;  4J8X C;  2NQB C;  4Z66 B;  5GSU D;  4DRB A;  1P3G A;  4NE3 A;  5AV8 B;  5GSU A;  5AV9 C;  2CV5 A;  1P34 C;  4X23 B;  3LJA B;  2FJ7 D;  3AZL D;  1TZY D;  1ZLA C;  4YM6 D;  3MGS B;  3AZI A;  3AZK B;  5CPI B;  3WA9 A;  5CHL B;  5B24 A;  1P34 A;  2NZD B;  3A6N D;  4AWL B;  5BS7 C;  4J8W B;  5CPI A;  1P3O C;  4YS3 D;  5E5A A;  3AZH D;  4WU8 A;  4KGC A;  5DNM D;  5AVB C;  3REL D;  4H9P A;  1P3L C;  5BT1 D;  3KWQ D;  3KXB B;  5AV8 D;  4WU8 C;  4KGC C;  5CPJ A;  5F99 B;  1P3A D;  3W98 D;  1KX5 A;  3X1V D;  5B24 D;  5B31 C;  3KXB A;  1BH9 A;  1KX3 D;  3AZJ C;  2ZY5 A;  3A6N A;  4J8U A;  5CP6 D;  3AFA D;  1AOI A;  1KX3 A;  4J8V D;  3AZF C;  2FJ7 A;  5BS7 A;  4G91 B;  1ID3 A;  1TZY A;  4KHA B;  4HGA B;  5B32 B;  2HIO D;  2G5H C;  3MGP B;  3LZ0 C;  2NQB B;  1P3O D;  3W97 C;  3REI A;  3EG5 B;  5B32 A;  4EO5 C;  5GXQ D;  3AN2 C;  3AZG D;  5BT1 C;  1M1A D;  3A1I A;  5AV9 B;  3AZM B;  1P3G C;  5B0Z A;  2JE5 A;  3AN2 A;  4J8U C;  3X1U A;  4G91 C;  3KFU G;  3AZM A;  5DNN B;  3MVD D;  5AVB A;  1P3F B;  4YM6 A;  3LZ1 C;  3AZM D;  2F8N K;  4J8W D;  1TZY C;  1ZLA D;  5B0Y A;  5CP6 A;  1P3I B;  5B2J D;  1M1A A;  5F99 C;  1KX4 D;  5G49 A;  1AOI C;  5CPI D;  2ARO C;  3KUY C;  4XUJ A;  3MGS D;  5GXQ C;  5B31 A;  3KXB C;  5B2I B;  3AZJ A;  3O62 B;  1M1A C;  3UTB A;  3AZG C;  3REI D;  4KUD A;  3REK C;  4CSR A;  4Z5T A;  3AZJ B;  4QLC C;  3AV2 A;  1M18 A;  2HIO A;  3MNN D;  1PZR A;  3MGQ C;  1P3K C;  3B6F B;  3AZN B;  2W8S A;  5AVC B;  3LZ0 A;  1TAF A;  2BYM B;  3TU4 B;  4WZS B;  2RVQ D;  1N1J A;  4Z5T C;  4UUZ B;  4EO5 B;  3W98 B;  5B0Z C;  3LZ0 B;  3MGS A;  3UT9 D;  3V9R B;  2PYO D;  5CP6 C;  5B40 B;  4LD9 A;  1R4V A;  3UTA B;  1S32 D;  2NZD A;  5B24 C;  3REL B;  3AZN D;  5C3I C;  3MGR C;  2ARO A;  3KUY A;  3W96 D;  4J8W A;  2G5I C;  3WKJ A;  4XZQ B;  1P3O A;  4WNN B;  5AVB D;  2F8N A;  1P3L D;  5B1L C;  3WKJ B;  3AZK D;  3C1B A;  1P3B A;  4NFT A;  4WNN A;  1ULY A;  4ZUX C;  5F99 A;  3X1T D;  3AN2 D;  2ZY2 A;  5B31 G;  3AZE B;  4Z66 A;  5C3I B;  2JCH A;  2Y2I A;  3AZK C;  1AOI B;  1ZLA A;  2NZD C;  2Y2M A;  5GXQ B;  3AZF A;  3UT9 C;  1ID3 B;  2FJ7 C;  1HQ3 D;  3W99 C;  2HIO C;  5GT0 B;  2BYK A;  4YS3 A;  4R8P C;  4XUJ C;  2PYO A;  3AV1 B;  5DNM A;  5AV6 C;  4WU9 B;  5BNV A;  2Y2Q A;  4G92 B;  4Z2M G;  2NQB D;  3W96 C;  3REI B;  1P3L B;  1HTA A;  3UTB C;  3WAA C;  5E5A B;  1B6W A;  1WWS A;  4WU8 B;  4ZUX A;  2RVQ C;  5BNV B;  2PYO C;  4KGC B;  3AV2 D;  1HQ3 B;  1M18 D;  4Z5T D;  5B0Z B;  3MGR B;  3H0L C;  1BH8 B;  4DQY B;  4NE5 A;  1EQZ B;  5B40 C;  3UT9 B;  1ID3 C;  2Y2P A;  1HQ3 A;  2BG1 A;  2IO5 C;  1KX5 B;  1BH8 A;  5AV6 B;  3A6N C;  1BH9 B;  2DF4 C;  4G92 C;  3UT9 A;  4HGA C;  5B32 C;  4XUJ D;  4DRA A;  4AWL C;  5F99 D;  3X1T A;  1P3A B;  1KX4 C;  5BNX B;  4JJN B;  3C1C B;  1P34 D;  3A1K A;  3X1S B;  5B1M A;  3X1T B;  1P3A A;  2F8N H;  2UWX A;  4ZBJ C;  5B1M D;  3LZ1 D;  2Y2N A;  3R45 B;  2HIO B;  5JRG C;  5GSU C;  5AV9 A;  3AZN A;  4Z66 C;  5B40 D;  1F66 C;  3B6G C;  4H9N B;  1P3G D;  3AFA B;  1P3F D;  5AY8 D;  4H9N A;  3FDD A;  3LEL B;  1P3P B;  5DNN A;  3AZF D;  3X1S C;  4WV4 B;  3AV2 C;  1M18 C;  4LD9 C;  3LZ0 D;  3WAA D;  5KDM B;  2ARO B;  3KUY B;  5B0Y B;  4J8V A;  1P3I A;  3AL0 C;  3W97 B;  3WAA A;  5B2I C;  3TU4 D;  4R8P D;  3F6T A;  3REH C;  5G49 B;  2HUE C;  5B0Z D;  2F8N B;  1U35 B;  4J8V C;  5B31 D;  3W97 A;  3B6F C;  3C1B B;  4QLC B;  1P3B B;  3NQJ B;  3MGP D;  3EPK A;  1JFI B;  3AV2 B;  1M18 B;  3KWQ C;  3B6F A;  2Y2G A;  3MVD B;  2JSS A;  5GT3 A;  5GT0 D;  5AY8 C;  3UTA C;  3TU4 A;  3X1U C;  4X23 D;  1P3I D;  1H3O B;  4UUZ A;  3AZH C;  1ZLA B;  1AOI D;  4JJN D;  3IP4 C;  3MVD A;  4Z2M H;  2ZM5 A;  5GSU B;  4Z66 D;  5B1L A;  3WTP E;  2CV5 B;  4YS3 C;  5DNN D;  4WJ3 C;  3AV1 A;  3AZE D;  5B1M C;  3MGR D;  1P3L A;  3WKJ C;  3H0R C;  3AZI B;  5B1L B;  3AZK A;  3B0B A;  3WA9 B;  4XZQ A;  4NE6 A;  3AZL C;  1P3O B;  5B33 C;  3VH6 W;  5AV5 D;  3B0C T;  2YFW A;  1Q9C A;  1WWI A;  4H9P B;  3W99 A;  3AZE A;  3LJA D;  3X1V B;  5B0Y C;  2YFW B;  1U35 C;  2FJ7 B;  3W97 D;  3B0D B;  5FUG A;  3MNN C;  3MGQ D;  1P3K D;  4J8X D;  5CPJ C;  3W99 B;  3AZI C;  3LZ1 A;  4H9S A;  1M19 B;  3WA9 C;  4H9O A;  4KUD C;  2F8N D;  3REI C;  3X1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...