5AV5A

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5A00
3KXBC 5AVCA 3MVDC 3AZLB 3TU4D 1N1JB 3AZLC 4ZBJB 3REJA 2AROC 5F99A 3LJAA 3LELD 4Z66B 3KUYB 4H9RB 5BO0B 1P3AA 3W97D 4ZBJC 3W99B 1S32A 3W96D 2JSSA 3A6NA 3KUYC 4Z66C 3AN2D 5GXQD 1P3FA 4YS3B 3RELA 3AZJB 5AVCD 5GT0C 5AV9B 5B33A 4YS3C 4J8VB 3AZJC 1KX4A 2RVQC 2NZDC 5AV9C 3KWQA 1H3OA 4J8VC 1HQ3C 5F99D 3LJAD 3REIB 2F8NB 1S32D 1KX3C 3A6ND 3REIC 5AVBD 3VH6W 1ID3A 1P3FD 1P34A 3RELD 3R45A 3NQUA 5B33D 1P3BA 1KX4D 4NFTA 5AV5A 5BT1D 3LELB 5AV8A 3AV1B 4LD9B 5CP6B 5KDMA 5B1LA 3AV1C 1ID3D 3C1BA 5B1MB 5CP6C 3MGRA 1P34D 3MGPB 4ZUXB 3LZ0A 5DNMA 3X1VD 4XZQA 1P3BD 3UTAA 1P3ID 4Z5TA 3MGPC 3UT9C 1U35A 3B6FD 3VH6A 4XUJB 5AV5D 4WNNB 4R8PA 3C1BD 3WTPA 3MGRD 4KUDB 5AY8A 1EQZB 5BNXB 1TZYB 3LZ0D 5DNMD 4KUDC 4XZQD 1EQZC 4NE3A 5GT3B 5B0YD 3AZMB 5GT3C 4R8PD 4WU9D 5B24B 4X23B 3WA9B 3AZMC 1P3PA 3WTPD 3B6GA 2HIOC 4X23C 3REHC 3X1SB 3MNNB 4G92B 3AZFB 1P3GB 4J8UD 3AZGB 5B2IB 3X1SC 3MNNC 3AFAD 4G92C 5FUGA 3AZFC 1P3GC 5BNVA 5G49B 3AZGC 4G91B 2PYOB 2BYKA 3AZHD 1A7WA 3KXBA 5B32A 4J8WA 4UUZA 1AOIA 5B32G 3AZLA 5B2JD 4JJNA 1N1JA 3UTBB 2YFWB 3WKJB 3UTBC 3KUYA 4Z66A 4H9RA 5BO0A 3WKJC 3W99A 1ZLAB 3KXBD 3X1UB 4Z2MH 5B32D 3MVDD 4YS3A 3AZJA 3X1UC 3AZLD 4CSRB 5BS7C 5AV9A 4J8VA 3MGSB 3AZIB 1HTAA 4H9NA 4AWLB 3B0BA 3MGSC 3MGQB 3REIA 3AZIC 3KUYD 4Z66D 2F8NA 4AWLC 4KHAB 3W99D 3MGQC 2F8NG 4DRAA 3AV2B 1Q9CA 3WAAA 4YS3D 1P3MB 3AZJD 2RVQD 2NZDD 5AV9D 1ULYA 4J8VD 1HQ3D 1P3KC 3LZ1C 5AV6B 3LELA 3REID 5E5AC 3AZNB 3AV1A 4LD9A 3AZKB 5CP6A 3VH5T 5AV6C 3AZNC 4WZSB 3AZKC 5B1MA 2NQBB 4ZUXA 5B0ZB 4H9QB 3W98B 3O62B 2NQBC 2AROB 3REKB 2CWEA 5B0ZC 3W98C 2YFVB 3AZEC 3O62C 1KX5B 3REKC 5CPIB 4XUJA 3AV1D 4LD9D 5B31B 1KX5C 5CP6D 5CPIC 5AVBA 5B31C 5B1MD 5GT0B 4KUDA 5BNXA 1TZYA 3MGPD 4ZUXD 1KU5A 3NQJA 2NZDB 2FJ7B 1HQ3B 3WTPE 5JRGB 2HUEC 2FJ7C 2BYMB 1P3OB 1KX3B 4XUJD 5JRGC 2IO5B 1P3OC 3X1TB 5B24A 3WA9A 1M19B 4EO5B 2IO5C 4KUDD 3X1TC 1EQZD 1TZYD 1M19C 4EO5C 4M6BA 3MNNA 3X1VA 4H9OB 1P3IA 3AZGA 5B2IA 3B6FA 2CV5B 5GT3D 5G49A 4WV4B 2CV5C 3AZMD 2PYOA 2F8NK 2HIOD 5B24D 4X23D 3WA9D 3UT9B 3X1SD 3MNND 5CPKB 4E44A 3UTBA 3AZFD 1P3GD 2YFWA 5B2ID 3AZGD 5CPKC 3WKJA 5GSUC 4H9SA 5B0YA 2PYOD 4WU9A 1F66B 1ZLAA 3X1UA 1M18B 1F66C 4J8XB 1TAFB 1B67A 1M18C 4J8XC 3MGSA 3UTBD 3AZIA 4J8UA 3W97C 3WKJD 3AFAA 3C1CB 5GXQC 3C1CC 3AZHA 2HIOB 5AVCC 3AV2A 1ZLAD 3REHB 3X1UD 4KGCB 1P3AB 5JA4A 1P3MA 3B0CT 4KGCC 3REJC 5B2JA 4YM6B 1P3AC 3MGSD 3AZID 1P3LB 4YM6C 4NE5A 3A6NC 5C3IB 3MGQD 1P3LC 3AZNA 3AZKA 5C3IC 3RELC 3AV2D 3MVDA 3KWQB 5B33C 5B40B 3AYWB 1P3MD 3KWQC 3O62A 4E45A 5B40C 2AROA 3REKA 3AYWC 1F1EA 3LZ1D 5E5AD 5CPIA 5AV6D 3AZND 3NQUB 5B31A 3AZKD 1P34C 1BH8B 5GT0A 2NQBD 5AV8B 5B0ZD 3W98D 2NZDA 3O62D 5B1LB 2FJ7A 2AROD 3REKD 1HQ3A 3MVDB 5AV8C 5B1LC 1KX5D 1KX3A 5CPID 4HGAB 5B31D 3UTAB 4Z5TB 1U35B 1M19A 4HGAC 3LZ0C 3KSYA 5GT0D 3UTAC 4Z5TC 1U35C 3VH6T 1P3KB 2FJ7D 4H9OA 3LZ1B 5JRGD 5E5AB 2CV5A 4R8PC 5AY8B 1P3OD 1KX3D 1BFMA 3WTPC 5AY8C 3X1TD 1M19D 3MGPA 3UT9A 3AZEB 5CPKA 1P3PB 3B6GB 2CV5D 3WAAD 5CPJB 1P3PC 4WNNA 3B6GC 1M1AB 5CPJC 1F66A 1M1AC 1EQZA 5BNVB 1TAFA 3UT9D 2HUEB 5DNNB 5CPKD 5DNNC 5GT3A 1JFIB 1AOIB 5B32C 4JJNB 3B0DB 4J8WC 3AZMA 1F66D 1AOIC 2HIOA 4X23A 4JJNC 3REHA 4KGCA 3B0DC 1M18D 4J8XD 3X1SA 4H9PB 4YM6A 3V9RB 1BH9B 3AZFA 1P3GA 1P3LA 3W99C 3C1CD 4DRBA 4WU8B 4Z2MG 4H9NB 3REHD 4WU8C 3REJD 4KGCD 5B40A 1P3AD 3AYWA 4QLCB 4YM6D 4QLCC 5GSUB 1P3LD 3WAAB 4CAYB 3TU4B 3WAAC 3TU4C 3VH5W 1BH8A 3KWQD 5BS7A 5B40D 3AYWD 3W97B 3W96B 1WWIA 4CSRA 3LELC 3AN2B 4LD9C 5GXQB 3W96C 2F8NH 3MGQA 3AN2C 5AVCB 5B1MC 4KHAA 4ZUXC 3REJB 5F99B 3LJAB 5AV8D 1S32B 1P3KA 5B1LD 4XUJC 5F99C 5AVBB 3A6NB 3LJAC 3LZ1A 5E5AA 2LY8A 1S32C 1P3FB 5AVBC 3RELB 5AV6A 3VH5A 1P3FC 3NQJB 5B33B 1TZYC 3UTAD 4Z5TD 1KX4B 1U35D 1H3OB 2NQBA 1KX4C 5B0ZA 3W98A 4H9QA 3AZEA 1P3KD 5BT1C 1ID3B 2YFVA 1P34B 1KX5A 5AY8D 5B24C 5CPJA 3WA9C 1ID3C 3R45B 3X1VB 1M1AA 1P3BB 1P3IB 5B31G 3X1VC 3B6FB 1P3BC 5AV5B 1P3IC 5B2IC 3B6FC 5DNNA 3AZED 5KDMB 5AV5C 5CHLB 5JRGA 4G91C 3C1BB 2PYOC 3MGRB 1P3PD 3B6GD 2BYMA 1P3OA 1JFIA 5CPJD 3C1BC 3LZ0B 3MGRC 5DNMB 4XZQB 1M1AD 3X1TA 5DNMC 4NE6A 1R4VA 4XZQC 5B0YB 5DNND 4H9PA 3V9RA 4R8PB 4WU9B 1BH9A 4H9SC 5B0YC 3WTPB 4J8WD 4WU9C 1ZLAC 1AOID 4JJND 4WU8A 4J8UB 3AFAB 4J8UC 4QLCA 3AFAC 3AZHB 3B0CW 5GSUA 1WWSA 3AZHC 5JA4B 3AV2C 4CAYA 5B2JB 3TU4A 4WU8D 1P3MC 5B2JC 5FUGB 1M18A 4J8XA 2F8ND 2L5AA 3W97A 4QLCD 3W96A 2BYKB 3AN2A 3KXBB 1B6WA 5GSUD 5B32B 5GXQA 4J8WB 4UUZB 3C1CA
chains in the Genus database with same CATH superfamily
3KXBC 5AVCA 3MVDC 3AZLB 3TU4D 1N1JB 3AZLC 4ZBJB 3REJA 2AROC 3FDDA 5F99A 3LJAA 3LELD 4Z66B 3KUYB 4H9RB 5BO0B 1P3AA 3W97D 4ZBJC 3W99B 1S32A 3W96D 2JSSA 3A6NA 3KUYC 4Z66C 3AN2D 5GXQD 1P3FA 4YS3B 2UWXA 3RELA 3AZJB 5AVCD 5GT0C 5AV9B 5B33A 4YS3C 4J8VB 3AZJC 1KX4A 2RVQC 2NZDC 5AV9C 3KWQA 1H3OA 4J8VC 1HQ3C 5F99D 3LJAD 3REIB 2F8NB 2F2AC 2ZY2A 1S32D 1KX3C 3A6ND 2ZM5A 3REIC 5AVBD 3VH6W 1ID3A 1P3FD 1P34A 3RELD 2XD1A 3R45A 3NQUA 5B33D 1P3BA 2ZY4A 1KX4D 4NFTA 5AV5A 5BT1D 3LELB 5AV8A 3AV1B 4LD9B 5CP6B 5KDMA 5B1LA 3AV1C 1ID3D 3C1BA 5B1MB 5CP6C 3MGRA 2G5HC 1P34D 3MGPB 4ZUXB 3LZ0A 5DNMA 3X1VD 4XZQA 1P3BD 3UTAA 1P3ID 4Z5TA 3MGPC 3UT9C 1U35A 3B6FD 3VH6A 4XUJB 5AV5D 4WNNB 4R8PA 3C1BD 3WTPA 3MGRD 4KUDB 5AY8A 1EQZB 5BNXB 1TZYB 3F6TA 3LZ0D 5DNMD 4KUDC 2W8SA 4XZQD 1EQZC 4NE3A 5GT3B 5B0YD 3AZMB 5GT3C 4R8PD 4WU9D 5B24B 4X23B 3WA9B 3A1KA 3AZMC 1P3PA 3WTPD 3B6GA 2HIOC 4X23C 2G5IC 3REHC 3X1SB 3MNNB 3EPKA 4G92B 3AZFB 1P3GB 4UPKA 4J8UD 5B2IB 3AZGB 3MNNC 3X1SC 3AFAD 4G92C 4WJ3C 5FUGA 2ZY5A 3AZFC 1P3GC 5BNVA 5G49B 3AZGC 3EG5B 4G91B 2PYOB 2BYKA 3AZHD 1A7WA 3KXBA 5B32A 4J8WA 4UUZA 1AOIA 5B32G 2FFFB 3AZLA 5B2JD 4JJNA 1N1JA 3UTBB 2YFWB 3WKJB 3UTBC 3KUYA 4Z66A 4H9RA 5BO0A 3WKJC 3W99A 1ZLAB 3KXBD 3X1UB 4Z2MH 5B32D 3MVDD 4YS3A 3EPLA 3AZJA 3X1UC 3AZLD 2Y2PA 4CSRB 5BS7C 2DF4C 5AV9A 4J8VA 3MGSB 3AZIB 1HTAA 4H9NA 4AWLB 3B0BA 3MGSC 3MGQB 3REIA 3AZIC 3KUYD 4Z66D 2F8NA 1W2EA 4AWLC 4KHAB 3W99D 3MGQC 2F8NG 4DRAA 3AV2B 1T3UA 1Q9CA 3WAAA 4YS3D 1P3MB 3AZJD 2RVQD 2NZDD 5AV9D 1ULYA 4J8VD 1HQ3D 2Y2OA 1P3KC 3LZ1C 5AV6B 3LELA 3REID 5E5AC 3AZNB 3AV1A 4LD9A 3AZKB 5CP6A 3VH5T 5AV6C 3AZNC 4WZSB 3AZKC 5B1MA 2NQBB 4ZUXA 5B0ZB 4H9QB 3W98B 3O62B 2NQBC 2AROB 3REKB 2CWEA 5B0ZC 3W98C 2YFVB 3AZEC 3O62C 1KX5B 3REKC 5CPIB 4XUJA 3AV1D 4LD9D 5B31B 1KX5C 5CP6D 5CPIC 5AVBA 5B31C 5B1MD 5GT0B 4KUDA 2Y2QA 5BNXA 1TZYA 3MGPD 4ZUXD 1KU5A 3NQJA 2NZDB 2FJ7B 1HQ3B 3WTPE 5JRGB 2HUEC 2FJ7C 2BYMB 1P3OB 1KX3B 4XUJD 5JRGC 2IO5B 1P3OC 3X1TB 5B24A 3WA9A 1M19B 4EO5B 2IO5C 4KUDD 3X1TC 1EQZD 1TZYD 1M19C 4EO5C 4M6BA 3MNNA 3X1VA 4H9OB 1P3IA 3AZGA 5B2IA 3B6FA 2CV5B 5GT3D 5G49A 4WV4B 2CV5C 3AZMD 2PYOA 2J8PA 2F8NK 2HIOD 5B24D 4X23D 3IP4C 3WA9D 3UT9B 3X1SD 3MNND 5CPKB 3KFUG 4E44A 3UTBA 3AZFD 1P3GD 2YFWA 5B2ID 3AZGD 5CPKC 3WKJA 5GSUC 4H9SA 5B0YA 2PYOD 4WU9A 1F66B 1ZLAA 3X1UA 1M18B 1F66C 4J8XB 1TAFB 1B67A 1M18C 4J8XC 3MGSA 3UTBD 3AZIA 4J8UA 3W97C 3WKJD 3AFAA 2Y2JA 3C1CB 5GXQC 2Y2IA 2Y2HA 3C1CC 3AZHA 2HIOB 5AVCC 3AV2A 1ZLAD 3REHB 3X1UD 4KGCB 1P3AB 5JA4A 1P3MA 3B0CT 4KGCC 3REJC 5B2JA 4YM6B 1P3AC 2Y2KA 3MGSD 3AZID 1P3LB 2BG1A 4YM6C 4NE5A 3EPJA 3A6NC 5C3IB 3MGQD 2JE5A 1P3LC 3AZNA 3AZKA 5C3IC 3RELC 3AV2D 3MVDA 3KWQB 5B33C 5B40B 3AYWB 1P3MD 3KWQC 3O62A 4E45A 5B40C 2AROA 3REKA 3AYWC 1F1EA 3LZ1D 5E5AD 5CPIA 5AV6D 3AZND 3NQUB 5B31A 3AZKD 1P34C 1BH8B 2Y2MA 5GT0A 2NQBD 5AV8B 5B0ZD 3W98D 4DQYB 2NZDA 3O62D 5B1LB 2FJ7A 2AROD 3REKD 1HQ3A 3MVDB 5AV8C 5B1LC 1KX5D 2XD5A 1KX3A 5CPID 4HGAB 5B31D 3UTAB 4Z5TB 1U35B 1M19A 4HGAC 3LZ0C 3KSYA 5GT0D 3UTAC 4Z5TC 1U35C 3VH6T 1P3KB 2FJ7D 4H9OA 3LZ1B 5JRGD 5E5AB 2CV5A 4R8PC 5AY8B 1P3OD 1KX3D 1BFMA 3WTPC 5AY8C 3X1TD 1M19D 3MGPA 3UT9A 3AZEB 5CPKA 1P3PB 3B6GB 2CV5D 3WAAD 5CPJB 1P3PC 3H0LC 4WNNA 3B6GC 1M1AB 5CPJC 1F66A 1M1AC 1EQZA 5BNVB 1TAFA 3UT9D 2HUEB 5DNNB 5CPKD 5DNNC 5GT3A 1JFIB 1AOIB 5B32C 4JJNB 3B0DB 4J8WC 3AZMA 1F66D 1AOIC 2HIOA 4X23A 4JJNC 3REHA 4KGCA 3B0DC 1M18D 4J8XD 3X1SA 4H9PB 4YM6A 3V9RB 1BH9B 3AZFA 1P3GA 1P3LA 3W99C 3C1CD 4DRBA 4WU8B 4Z2MG 4H9NB 3REHD 4WU8C 3REJD 4KGCD 5B40A 1P3AD 3AYWA 4QLCB 3H0RC 4YM6D 4QLCC 5GSUB 1P3LD 2ZY3A 3WAAB 4CAYB 3TU4B 3WAAC 3TU4C 3VH5W 1BH8A 3KWQD 5BS7A 5B40D 2Y2NA 3AYWD 3W97B 3W96B 1WWIA 4CSRA 3LELC 3AN2B 4LD9C 5GXQB 3W96C 2F8NH 3MGQA 3AN2C 5AVCB 5B1MC 4KHAA 4ZUXC 3REJB 5F99B 3LJAB 5AV8D 1Z2CB 1S32B 1P3KA 5B1LD 4XUJC 5F99C 5AVBB 3A6NB 3A1IA 3LZ1A 3LJAC 5E5AA 2LY8A 1S32C 1P3FB 5AVBC 3RELB 5AV6A 3VH5A 1P3FC 3NQJB 5B33B 1TZYC 3UTAD 4Z5TD 1KX4B 1U35D 1H3OB 2NQBA 1KX4C 3H0MC 5B0ZA 3W98A 4H9QA 3AZEA 1P3KD 5BT1C 1ID3B 2RIQA 2YFVA 1P34B 1KX5A 5AY8D 5B24C 5CPJA 3WA9C 1ID3C 3R45B 3X1VB 1M1AA 1P3BB 1P3IB 5B31G 3X1VC 3B6FB 1P3BC 5AV5B 1P3IC 5B2IC 3B6FC 5DNNA 3AZED 5KDMB 5AV5C 5CHLB 5JRGA 4G91C 3C1BB 2PYOC 3MGRB 1P3PD 3B6GD 2BYMA 1P3OA 1JFIA 5CPJD 3C1BC 3LZ0B 3MGRC 5DNMB 4XZQB 1M1AD 3X1TA 5DNMC 4NE6A 1R4VA 4XZQC 5B0YB 2DQNC 3AL0C 3P5JB 5DNND 4H9PA 3V9RA 4R8PB 4WU9B 1BH9A 4H9SC 5B0YC 3WTPB 4J8WD 4WU9C 1ZLAC 1AOID 4JJND 4WU8A 1PZRA 4J8UB 3AFAB 4J8UC 4QLCA 3EPHA 3AFAC 3AZHB 3B0CW 2Y2GA 5GSUA 1WWSA 2JCHA 3AZHC 5JA4B 3AV2C 4CAYA 2Y2LA 5B2JB 3TU4A 4WU8D 1P3MC 5B2JC 5FUGB 1M18A 4J8XA 2F8ND 2L5AA 3W97A 4QLCD 3W96A 2BYKB 3AN2A 3KXBB 1B6WA 5GSUD 5B32B 5GXQA 2VQRA 4J8WB 4UUZB 3C1CA
chains in the Genus database with same CATH topology
3KXBC 5AVCA 3MVDC 3AZLB 3TU4D 1N1JB 3AZLC 4ZBJB 3REJA 2AROC 3FDDA 5F99A 3LJAA 3LELD 4Z66B 3KUYB 4H9RB 5BO0B 1P3AA 3W97D 4ZBJC 3W99B 1S32A 3W96D 2JSSA 3A6NA 3KUYC 4Z66C 3AN2D 5GXQD 1P3FA 4YS3B 2UWXA 3RELA 3AZJB 5AVCD 5GT0C 5AV9B 5B33A 4YS3C 4J8VB 3AZJC 1KX4A 2RVQC 2NZDC 5AV9C 3KWQA 1H3OA 4J8VC 1HQ3C 5F99D 3LJAD 3REIB 2F8NB 2F2AC 2ZY2A 1S32D 1KX3C 3A6ND 2ZM5A 3REIC 5AVBD 3VH6W 1ID3A 1P3FD 1P34A 3RELD 2XD1A 3R45A 3NQUA 5B33D 1P3BA 2ZY4A 1KX4D 4NFTA 5AV5A 5BT1D 3LELB 5AV8A 3AV1B 4LD9B 5CP6B 5KDMA 5B1LA 3AV1C 1ID3D 3C1BA 5B1MB 5CP6C 3MGRA 2G5HC 1P34D 3MGPB 4ZUXB 3LZ0A 5DNMA 3X1VD 4XZQA 1P3BD 3UTAA 1P3ID 4Z5TA 3MGPC 3UT9C 1U35A 3B6FD 3VH6A 4XUJB 5AV5D 4WNNB 4R8PA 3C1BD 3WTPA 3MGRD 4KUDB 5AY8A 1EQZB 5BNXB 1TZYB 3F6TA 3LZ0D 5DNMD 4KUDC 2W8SA 4XZQD 1EQZC 4NE3A 5GT3B 5B0YD 3AZMB 5GT3C 4R8PD 4WU9D 5B24B 4X23B 3WA9B 3A1KA 3AZMC 1P3PA 3WTPD 3B6GA 2HIOC 4X23C 2G5IC 3REHC 3X1SB 3MNNB 3EPKA 4G92B 3AZFB 1P3GB 4UPKA 4J8UD 5B2IB 3AZGB 3MNNC 3X1SC 3AFAD 4G92C 4WJ3C 5FUGA 2ZY5A 3AZFC 1P3GC 5BNVA 5G49B 3AZGC 3EG5B 4G91B 2PYOB 2BYKA 3AZHD 1A7WA 3KXBA 5B32A 4J8WA 4UUZA 1AOIA 5B32G 2FFFB 3AZLA 5B2JD 4JJNA 1N1JA 3UTBB 2YFWB 3WKJB 3UTBC 3KUYA 4Z66A 4H9RA 5BO0A 3WKJC 3W99A 1ZLAB 3KXBD 3X1UB 4Z2MH 5B32D 3MVDD 4YS3A 3EPLA 3AZJA 3X1UC 3AZLD 2Y2PA 4CSRB 5BS7C 2DF4C 5AV9A 4J8VA 3MGSB 3AZIB 1HTAA 4H9NA 4AWLB 3B0BA 3MGSC 3MGQB 3REIA 3AZIC 3KUYD 4Z66D 2F8NA 1W2EA 4AWLC 4KHAB 3W99D 3MGQC 2F8NG 4DRAA 3AV2B 1T3UA 1Q9CA 3WAAA 4YS3D 1P3MB 3AZJD 2RVQD 2NZDD 5AV9D 1ULYA 4J8VD 1HQ3D 2Y2OA 1P3KC 3LZ1C 5AV6B 3LELA 3REID 5E5AC 3AZNB 3AV1A 4LD9A 3AZKB 5CP6A 3VH5T 5AV6C 3AZNC 4WZSB 3AZKC 5B1MA 2NQBB 4ZUXA 5B0ZB 4H9QB 3W98B 3O62B 2NQBC 2AROB 3REKB 2CWEA 5B0ZC 3W98C 2YFVB 3AZEC 3O62C 1KX5B 3REKC 5CPIB 4XUJA 3AV1D 4LD9D 5B31B 1KX5C 5CP6D 5CPIC 5AVBA 5B31C 5B1MD 5GT0B 4KUDA 2Y2QA 5BNXA 1TZYA 3MGPD 4ZUXD 1KU5A 3NQJA 2NZDB 2FJ7B 1HQ3B 3WTPE 5JRGB 2HUEC 2FJ7C 2BYMB 1P3OB 1KX3B 4XUJD 5JRGC 2IO5B 1P3OC 3X1TB 5B24A 3WA9A 1M19B 4EO5B 2IO5C 4KUDD 3X1TC 1EQZD 1TZYD 1M19C 4EO5C 4M6BA 3MNNA 3X1VA 4H9OB 1P3IA 3AZGA 5B2IA 3B6FA 2CV5B 5GT3D 5G49A 4WV4B 2CV5C 3AZMD 2PYOA 2J8PA 2F8NK 2HIOD 5B24D 4X23D 3IP4C 3WA9D 3UT9B 3X1SD 3MNND 5CPKB 3KFUG 4E44A 3UTBA 3AZFD 1P3GD 2YFWA 5B2ID 3AZGD 5CPKC 3WKJA 5GSUC 4H9SA 5B0YA 2PYOD 4WU9A 1F66B 1ZLAA 3X1UA 1M18B 1F66C 4J8XB 1TAFB 1B67A 1M18C 4J8XC 3MGSA 3UTBD 3AZIA 4J8UA 3W97C 3WKJD 3AFAA 2Y2JA 3C1CB 5GXQC 2Y2IA 2Y2HA 3C1CC 3AZHA 2HIOB 5AVCC 3AV2A 1ZLAD 3REHB 3X1UD 4KGCB 1P3AB 5JA4A 1P3MA 3B0CT 4KGCC 3REJC 5B2JA 4YM6B 1P3AC 2Y2KA 3MGSD 3AZID 1P3LB 2BG1A 4YM6C 4NE5A 3EPJA 3A6NC 5C3IB 3MGQD 2JE5A 1P3LC 3AZNA 3AZKA 5C3IC 3RELC 3AV2D 3MVDA 3KWQB 5B33C 5B40B 3AYWB 1P3MD 3KWQC 3O62A 4E45A 5B40C 2AROA 3REKA 3AYWC 1F1EA 3LZ1D 5E5AD 5CPIA 5AV6D 3AZND 3NQUB 5B31A 3AZKD 1P34C 1BH8B 2Y2MA 5GT0A 2NQBD 5AV8B 5B0ZD 3W98D 4DQYB 2NZDA 3O62D 5B1LB 2FJ7A 2AROD 3REKD 1HQ3A 3MVDB 5AV8C 5B1LC 1KX5D 2XD5A 1KX3A 5CPID 4HGAB 5B31D 3UTAB 4Z5TB 1U35B 1M19A 4HGAC 3LZ0C 3KSYA 5GT0D 3UTAC 4Z5TC 1U35C 3VH6T 1P3KB 2FJ7D 4H9OA 3LZ1B 5JRGD 5E5AB 2CV5A 4R8PC 5AY8B 1P3OD 1KX3D 1BFMA 3WTPC 5AY8C 3X1TD 1M19D 3MGPA 3UT9A 3AZEB 5CPKA 1P3PB 3B6GB 2CV5D 3WAAD 5CPJB 1P3PC 3H0LC 4WNNA 3B6GC 1M1AB 5CPJC 1F66A 1M1AC 1EQZA 5BNVB 1TAFA 3UT9D 2HUEB 5DNNB 5CPKD 5DNNC 5GT3A 1JFIB 1AOIB 5B32C 4JJNB 3B0DB 4J8WC 3AZMA 1F66D 1AOIC 2HIOA 4X23A 4JJNC 3REHA 4KGCA 3B0DC 1M18D 4J8XD 3X1SA 4H9PB 4YM6A 3V9RB 1BH9B 3AZFA 1P3GA 1P3LA 3W99C 3C1CD 4DRBA 4WU8B 4Z2MG 4H9NB 3REHD 4WU8C 3REJD 4KGCD 5B40A 1P3AD 3AYWA 4QLCB 3H0RC 4YM6D 4QLCC 5GSUB 1P3LD 2ZY3A 3WAAB 4CAYB 3TU4B 3WAAC 3TU4C 3VH5W 1BH8A 3KWQD 5BS7A 5B40D 2Y2NA 3AYWD 3W97B 3W96B 1WWIA 4CSRA 3LELC 3AN2B 4LD9C 5GXQB 3W96C 2F8NH 3MGQA 3AN2C 5AVCB 5B1MC 4KHAA 4ZUXC 3REJB 5F99B 3LJAB 5AV8D 1Z2CB 1S32B 1P3KA 5B1LD 4XUJC 5F99C 5AVBB 3A6NB 3A1IA 3LZ1A 3LJAC 5E5AA 2LY8A 1S32C 1P3FB 5AVBC 3RELB 5AV6A 3VH5A 1P3FC 3NQJB 5B33B 1TZYC 3UTAD 4Z5TD 1KX4B 1U35D 1H3OB 2NQBA 1KX4C 3H0MC 5B0ZA 3W98A 4H9QA 3AZEA 1P3KD 5BT1C 1ID3B 2RIQA 2YFVA 1P34B 1KX5A 5AY8D 5B24C 5CPJA 3WA9C 1ID3C 3R45B 3X1VB 1M1AA 1P3BB 1P3IB 5B31G 3X1VC 3B6FB 1P3BC 5AV5B 1P3IC 5B2IC 3B6FC 5DNNA 3AZED 5KDMB 5AV5C 5CHLB 5JRGA 4G91C 3C1BB 2PYOC 3MGRB 1P3PD 3B6GD 2BYMA 1P3OA 1JFIA 5CPJD 3C1BC 3LZ0B 3MGRC 5DNMB 4XZQB 1M1AD 3X1TA 5DNMC 4NE6A 1R4VA 4XZQC 5B0YB 2DQNC 3AL0C 3P5JB 5DNND 4H9PA 3V9RA 4R8PB 4WU9B 1BH9A 4H9SC 5B0YC 3WTPB 4J8WD 4WU9C 1ZLAC 1AOID 4JJND 4WU8A 1PZRA 4J8UB 3AFAB 4J8UC 4QLCA 3EPHA 3AFAC 3AZHB 3B0CW 2Y2GA 5GSUA 1WWSA 2JCHA 3AZHC 5JA4B 3AV2C 4CAYA 2Y2LA 5B2JB 3TU4A 4WU8D 1P3MC 5B2JC 5FUGB 1M18A 4J8XA 2F8ND 2L5AA 3W97A 4QLCD 3W96A 2BYKB 3AN2A 3KXBB 1B6WA 5GSUD 5B32B 5GXQA 2VQRA 4J8WB 4UUZB 3C1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXB C;  5AVC A;  3MVD C;  3AZL B;  3TU4 D;  1N1J B;  3AZL C;  4ZBJ B;  3REJ A;  2ARO C;  5F99 A;  3LJA A;  3LEL D;  4Z66 B;  3KUY B;  4H9R B;  5BO0 B;  1P3A A;  3W97 D;  4ZBJ C;  3W99 B;  1S32 A;  3W96 D;  2JSS A;  3A6N A;  3KUY C;  4Z66 C;  3AN2 D;  5GXQ D;  1P3F A;  4YS3 B;  3REL A;  3AZJ B;  5AVC D;  5GT0 C;  5AV9 B;  5B33 A;  4YS3 C;  4J8V B;  3AZJ C;  1KX4 A;  2RVQ C;  2NZD C;  5AV9 C;  3KWQ A;  1H3O A;  4J8V C;  1HQ3 C;  5F99 D;  3LJA D;  3REI B;  2F8N B;  1S32 D;  1KX3 C;  3A6N D;  3REI C;  5AVB D;  3VH6 W;  1ID3 A;  1P3F D;  1P34 A;  3REL D;  3R45 A;  3NQU A;  5B33 D;  1P3B A;  1KX4 D;  4NFT A;  5AV5 A;  5BT1 D;  3LEL B;  5AV8 A;  3AV1 B;  4LD9 B;  5CP6 B;  5KDM A;  5B1L A;  3AV1 C;  1ID3 D;  3C1B A;  5B1M B;  5CP6 C;  3MGR A;  1P34 D;  3MGP B;  4ZUX B;  3LZ0 A;  5DNM A;  3X1V D;  4XZQ A;  1P3B D;  3UTA A;  1P3I D;  4Z5T A;  3MGP C;  3UT9 C;  1U35 A;  3B6F D;  3VH6 A;  4XUJ B;  5AV5 D;  4WNN B;  4R8P A;  3C1B D;  3WTP A;  3MGR D;  4KUD B;  5AY8 A;  1EQZ B;  5BNX B;  1TZY B;  3LZ0 D;  5DNM D;  4KUD C;  4XZQ D;  1EQZ C;  4NE3 A;  5GT3 B;  5B0Y D;  3AZM B;  5GT3 C;  4R8P D;  4WU9 D;  5B24 B;  4X23 B;  3WA9 B;  3AZM C;  1P3P A;  3WTP D;  3B6G A;  2HIO C;  4X23 C;  3REH C;  3X1S B;  3MNN B;  4G92 B;  3AZF B;  1P3G B;  4J8U D;  3AZG B;  5B2I B;  3X1S C;  3MNN C;  3AFA D;  4G92 C;  5FUG A;  3AZF C;  1P3G C;  5BNV A;  5G49 B;  3AZG C;  4G91 B;  2PYO B;  2BYK A;  3AZH D;  1A7W A;  3KXB A;  5B32 A;  4J8W A;  4UUZ A;  1AOI A;  5B32 G;  3AZL A;  5B2J D;  4JJN A;  1N1J A;  3UTB B;  2YFW B;  3WKJ B;  3UTB C;  3KUY A;  4Z66 A;  4H9R A;  5BO0 A;  3WKJ C;  3W99 A;  1ZLA B;  3KXB D;  3X1U B;  4Z2M H;  5B32 D;  3MVD D;  4YS3 A;  3AZJ A;  3X1U C;  3AZL D;  4CSR B;  5BS7 C;  5AV9 A;  4J8V A;  3MGS B;  3AZI B;  1HTA A;  4H9N A;  4AWL B;  3B0B A;  3MGS C;  3MGQ B;  3REI A;  3AZI C;  3KUY D;  4Z66 D;  2F8N A;  4AWL C;  4KHA B;  3W99 D;  3MGQ C;  2F8N G;  4DRA A;  3AV2 B;  1Q9C A;  3WAA A;  4YS3 D;  1P3M B;  3AZJ D;  2RVQ D;  2NZD D;  5AV9 D;  1ULY A;  4J8V D;  1HQ3 D;  1P3K C;  3LZ1 C;  5AV6 B;  3LEL A;  3REI D;  5E5A C;  3AZN B;  3AV1 A;  4LD9 A;  3AZK B;  5CP6 A;  3VH5 T;  5AV6 C;  3AZN C;  4WZS B;  3AZK C;  5B1M A;  2NQB B;  4ZUX A;  5B0Z B;  4H9Q B;  3W98 B;  3O62 B;  2NQB C;  2ARO B;  3REK B;  2CWE A;  5B0Z C;  3W98 C;  2YFV B;  3AZE C;  3O62 C;  1KX5 B;  3REK C;  5CPI B;  4XUJ A;  3AV1 D;  4LD9 D;  5B31 B;  1KX5 C;  5CP6 D;  5CPI C;  5AVB A;  5B31 C;  5B1M D;  5GT0 B;  4KUD A;  5BNX A;  1TZY A;  3MGP D;  4ZUX D;  1KU5 A;  3NQJ A;  2NZD B;  2FJ7 B;  1HQ3 B;  3WTP E;  5JRG B;  2HUE C;  2FJ7 C;  2BYM B;  1P3O B;  1KX3 B;  4XUJ D;  5JRG C;  2IO5 B;  1P3O C;  3X1T B;  5B24 A;  3WA9 A;  1M19 B;  4EO5 B;  2IO5 C;  4KUD D;  3X1T C;  1EQZ D;  1TZY D;  1M19 C;  4EO5 C;  4M6B A;  3MNN A;  3X1V A;  4H9O B;  1P3I A;  3AZG A;  5B2I A;  3B6F A;  2CV5 B;  5GT3 D;  5G49 A;  4WV4 B;  2CV5 C;  3AZM D;  2PYO A;  2F8N K;  2HIO D;  5B24 D;  4X23 D;  3WA9 D;  3UT9 B;  3X1S D;  3MNN D;  5CPK B;  4E44 A;  3UTB A;  3AZF D;  1P3G D;  2YFW A;  5B2I D;  3AZG D;  5CPK C;  3WKJ A;  5GSU C;  4H9S A;  5B0Y A;  2PYO D;  4WU9 A;  1F66 B;  1ZLA A;  3X1U A;  1M18 B;  1F66 C;  4J8X B;  1TAF B;  1B67 A;  1M18 C;  4J8X C;  3MGS A;  3UTB D;  3AZI A;  4J8U A;  3W97 C;  3WKJ D;  3AFA A;  3C1C B;  5GXQ C;  3C1C C;  3AZH A;  2HIO B;  5AVC C;  3AV2 A;  1ZLA D;  3REH B;  3X1U D;  4KGC B;  1P3A B;  5JA4 A;  1P3M A;  3B0C T;  4KGC C;  3REJ C;  5B2J A;  4YM6 B;  1P3A C;  3MGS D;  3AZI D;  1P3L B;  4YM6 C;  4NE5 A;  3A6N C;  5C3I B;  3MGQ D;  1P3L C;  3AZN A;  3AZK A;  5C3I C;  3REL C;  3AV2 D;  3MVD A;  3KWQ B;  5B33 C;  5B40 B;  3AYW B;  1P3M D;  3KWQ C;  3O62 A;  4E45 A;  5B40 C;  2ARO A;  3REK A;  3AYW C;  1F1E A;  3LZ1 D;  5E5A D;  5CPI A;  5AV6 D;  3AZN D;  3NQU B;  5B31 A;  3AZK D;  1P34 C;  1BH8 B;  5GT0 A;  2NQB D;  5AV8 B;  5B0Z D;  3W98 D;  2NZD A;  3O62 D;  5B1L B;  2FJ7 A;  2ARO D;  3REK D;  1HQ3 A;  3MVD B;  5AV8 C;  5B1L C;  1KX5 D;  1KX3 A;  5CPI D;  4HGA B;  5B31 D;  3UTA B;  4Z5T B;  1U35 B;  1M19 A;  4HGA C;  3LZ0 C;  3KSY A;  5GT0 D;  3UTA C;  4Z5T C;  1U35 C;  3VH6 T;  1P3K B;  2FJ7 D;  4H9O A;  3LZ1 B;  5JRG D;  5E5A B;  2CV5 A;  4R8P C;  5AY8 B;  1P3O D;  1KX3 D;  1BFM A;  3WTP C;  5AY8 C;  3X1T D;  1M19 D;  3MGP A;  3UT9 A;  3AZE B;  5CPK A;  1P3P B;  3B6G B;  2CV5 D;  3WAA D;  5CPJ B;  1P3P C;  4WNN A;  3B6G C;  1M1A B;  5CPJ C;  1F66 A;  1M1A C;  1EQZ A;  5BNV B;  1TAF A;  3UT9 D;  2HUE B;  5DNN B;  5CPK D;  5DNN C;  5GT3 A;  1JFI B;  1AOI B;  5B32 C;  4JJN B;  3B0D B;  4J8W C;  3AZM A;  1F66 D;  1AOI C;  2HIO A;  4X23 A;  4JJN C;  3REH A;  4KGC A;  3B0D C;  1M18 D;  4J8X D;  3X1S A;  4H9P B;  4YM6 A;  3V9R B;  1BH9 B;  3AZF A;  1P3G A;  1P3L A;  3W99 C;  3C1C D;  4DRB A;  4WU8 B;  4Z2M G;  4H9N B;  3REH D;  4WU8 C;  3REJ D;  4KGC D;  5B40 A;  1P3A D;  3AYW A;  4QLC B;  4YM6 D;  4QLC C;  5GSU B;  1P3L D;  3WAA B;  4CAY B;  3TU4 B;  3WAA C;  3TU4 C;  3VH5 W;  1BH8 A;  3KWQ D;  5BS7 A;  5B40 D;  3AYW D;  3W97 B;  3W96 B;  1WWI A;  4CSR A;  3LEL C;  3AN2 B;  4LD9 C;  5GXQ B;  3W96 C;  2F8N H;  3MGQ A;  3AN2 C;  5AVC B;  5B1M C;  4KHA A;  4ZUX C;  3REJ B;  5F99 B;  3LJA B;  5AV8 D;  1S32 B;  1P3K A;  5B1L D;  4XUJ C;  5F99 C;  5AVB B;  3A6N B;  3LJA C;  3LZ1 A;  5E5A A;  2LY8 A;  1S32 C;  1P3F B;  5AVB C;  3REL B;  5AV6 A;  3VH5 A;  1P3F C;  3NQJ B;  5B33 B;  1TZY C;  3UTA D;  4Z5T D;  1KX4 B;  1U35 D;  1H3O B;  2NQB A;  1KX4 C;  5B0Z A;  3W98 A;  4H9Q A;  3AZE A;  1P3K D;  5BT1 C;  1ID3 B;  2YFV A;  1P34 B;  1KX5 A;  5AY8 D;  5B24 C;  5CPJ A;  3WA9 C;  1ID3 C;  3R45 B;  3X1V B;  1M1A A;  1P3B B;  1P3I B;  5B31 G;  3X1V C;  3B6F B;  1P3B C;  5AV5 B;  1P3I C;  5B2I C;  3B6F C;  5DNN A;  3AZE D;  5KDM B;  5AV5 C;  5CHL B;  5JRG A;  4G91 C;  3C1B B;  2PYO C;  3MGR B;  1P3P D;  3B6G D;  2BYM A;  1P3O A;  1JFI A;  5CPJ D;  3C1B C;  3LZ0 B;  3MGR C;  5DNM B;  4XZQ B;  1M1A D;  3X1T A;  5DNM C;  4NE6 A;  1R4V A;  4XZQ C;  5B0Y B;  5DNN D;  4H9P A;  3V9R A;  4R8P B;  4WU9 B;  1BH9 A;  4H9S C;  5B0Y C;  3WTP B;  4J8W D;  4WU9 C;  1ZLA C;  1AOI D;  4JJN D;  4WU8 A;  4J8U B;  3AFA B;  4J8U C;  4QLC A;  3AFA C;  3AZH B;  3B0C W;  5GSU A;  1WWS A;  3AZH C;  5JA4 B;  3AV2 C;  4CAY A;  5B2J B;  3TU4 A;  4WU8 D;  1P3M C;  5B2J C;  5FUG B;  1M18 A;  4J8X A;  2F8N D;  2L5A A;  3W97 A;  4QLC D;  3W96 A;  2BYK B;  3AN2 A;  3KXB B;  1B6W A;  5GSU D;  5B32 B;  5GXQ A;  4J8W B;  4UUZ B;  3C1C A; 
#chains in the Genus database with same CATH topology
 3KXB C;  5AVC A;  3MVD C;  3AZL B;  3TU4 D;  1N1J B;  3AZL C;  4ZBJ B;  3REJ A;  2ARO C;  3FDD A;  5F99 A;  3LJA A;  3LEL D;  4Z66 B;  3KUY B;  4H9R B;  5BO0 B;  1P3A A;  3W97 D;  4ZBJ C;  3W99 B;  1S32 A;  3W96 D;  2JSS A;  3A6N A;  3KUY C;  4Z66 C;  3AN2 D;  5GXQ D;  1P3F A;  4YS3 B;  2UWX A;  3REL A;  3AZJ B;  5AVC D;  5GT0 C;  5AV9 B;  5B33 A;  4YS3 C;  4J8V B;  3AZJ C;  1KX4 A;  2RVQ C;  2NZD C;  5AV9 C;  3KWQ A;  1H3O A;  4J8V C;  1HQ3 C;  5F99 D;  3LJA D;  3REI B;  2F8N B;  2F2A C;  2ZY2 A;  1S32 D;  1KX3 C;  3A6N D;  2ZM5 A;  3REI C;  5AVB D;  3VH6 W;  1ID3 A;  1P3F D;  1P34 A;  3REL D;  2XD1 A;  3R45 A;  3NQU A;  5B33 D;  1P3B A;  2ZY4 A;  1KX4 D;  4NFT A;  5AV5 A;  5BT1 D;  3LEL B;  5AV8 A;  3AV1 B;  4LD9 B;  5CP6 B;  5KDM A;  5B1L A;  3AV1 C;  1ID3 D;  3C1B A;  5B1M B;  5CP6 C;  3MGR A;  2G5H C;  1P34 D;  3MGP B;  4ZUX B;  3LZ0 A;  5DNM A;  3X1V D;  4XZQ A;  1P3B D;  3UTA A;  1P3I D;  4Z5T A;  3MGP C;  3UT9 C;  1U35 A;  3B6F D;  3VH6 A;  4XUJ B;  5AV5 D;  4WNN B;  4R8P A;  3C1B D;  3WTP A;  3MGR D;  4KUD B;  5AY8 A;  1EQZ B;  5BNX B;  1TZY B;  3F6T A;  3LZ0 D;  5DNM D;  4KUD C;  2W8S A;  4XZQ D;  1EQZ C;  4NE3 A;  5GT3 B;  5B0Y D;  3AZM B;  5GT3 C;  4R8P D;  4WU9 D;  5B24 B;  4X23 B;  3WA9 B;  3A1K A;  3AZM C;  1P3P A;  3WTP D;  3B6G A;  2HIO C;  4X23 C;  2G5I C;  3REH C;  3X1S B;  3MNN B;  3EPK A;  4G92 B;  3AZF B;  1P3G B;  4UPK A;  4J8U D;  5B2I B;  3AZG B;  3MNN C;  3X1S C;  3AFA D;  4G92 C;  4WJ3 C;  5FUG A;  2ZY5 A;  3AZF C;  1P3G C;  5BNV A;  5G49 B;  3AZG C;  3EG5 B;  4G91 B;  2PYO B;  2BYK A;  3AZH D;  1A7W A;  3KXB A;  5B32 A;  4J8W A;  4UUZ A;  1AOI A;  5B32 G;  2FFF B;  3AZL A;  5B2J D;  4JJN A;  1N1J A;  3UTB B;  2YFW B;  3WKJ B;  3UTB C;  3KUY A;  4Z66 A;  4H9R A;  5BO0 A;  3WKJ C;  3W99 A;  1ZLA B;  3KXB D;  3X1U B;  4Z2M H;  5B32 D;  3MVD D;  4YS3 A;  3EPL A;  3AZJ A;  3X1U C;  3AZL D;  2Y2P A;  4CSR B;  5BS7 C;  2DF4 C;  5AV9 A;  4J8V A;  3MGS B;  3AZI B;  1HTA A;  4H9N A;  4AWL B;  3B0B A;  3MGS C;  3MGQ B;  3REI A;  3AZI C;  3KUY D;  4Z66 D;  2F8N A;  1W2E A;  4AWL C;  4KHA B;  3W99 D;  3MGQ C;  2F8N G;  4DRA A;  3AV2 B;  1T3U A;  1Q9C A;  3WAA A;  4YS3 D;  1P3M B;  3AZJ D;  2RVQ D;  2NZD D;  5AV9 D;  1ULY A;  4J8V D;  1HQ3 D;  2Y2O A;  1P3K C;  3LZ1 C;  5AV6 B;  3LEL A;  3REI D;  5E5A C;  3AZN B;  3AV1 A;  4LD9 A;  3AZK B;  5CP6 A;  3VH5 T;  5AV6 C;  3AZN C;  4WZS B;  3AZK C;  5B1M A;  2NQB B;  4ZUX A;  5B0Z B;  4H9Q B;  3W98 B;  3O62 B;  2NQB C;  2ARO B;  3REK B;  2CWE A;  5B0Z C;  3W98 C;  2YFV B;  3AZE C;  3O62 C;  1KX5 B;  3REK C;  5CPI B;  4XUJ A;  3AV1 D;  4LD9 D;  5B31 B;  1KX5 C;  5CP6 D;  5CPI C;  5AVB A;  5B31 C;  5B1M D;  5GT0 B;  4KUD A;  2Y2Q A;  5BNX A;  1TZY A;  3MGP D;  4ZUX D;  1KU5 A;  3NQJ A;  2NZD B;  2FJ7 B;  1HQ3 B;  3WTP E;  5JRG B;  2HUE C;  2FJ7 C;  2BYM B;  1P3O B;  1KX3 B;  4XUJ D;  5JRG C;  2IO5 B;  1P3O C;  3X1T B;  5B24 A;  3WA9 A;  1M19 B;  4EO5 B;  2IO5 C;  4KUD D;  3X1T C;  1EQZ D;  1TZY D;  1M19 C;  4EO5 C;  4M6B A;  3MNN A;  3X1V A;  4H9O B;  1P3I A;  3AZG A;  5B2I A;  3B6F A;  2CV5 B;  5GT3 D;  5G49 A;  4WV4 B;  2CV5 C;  3AZM D;  2PYO A;  2J8P A;  2F8N K;  2HIO D;  5B24 D;  4X23 D;  3IP4 C;  3WA9 D;  3UT9 B;  3X1S D;  3MNN D;  5CPK B;  3KFU G;  4E44 A;  3UTB A;  3AZF D;  1P3G D;  2YFW A;  5B2I D;  3AZG D;  5CPK C;  3WKJ A;  5GSU C;  4H9S A;  5B0Y A;  2PYO D;  4WU9 A;  1F66 B;  1ZLA A;  3X1U A;  1M18 B;  1F66 C;  4J8X B;  1TAF B;  1B67 A;  1M18 C;  4J8X C;  3MGS A;  3UTB D;  3AZI A;  4J8U A;  3W97 C;  3WKJ D;  3AFA A;  2Y2J A;  3C1C B;  5GXQ C;  2Y2I A;  2Y2H A;  3C1C C;  3AZH A;  2HIO B;  5AVC C;  3AV2 A;  1ZLA D;  3REH B;  3X1U D;  4KGC B;  1P3A B;  5JA4 A;  1P3M A;  3B0C T;  4KGC C;  3REJ C;  5B2J A;  4YM6 B;  1P3A C;  2Y2K A;  3MGS D;  3AZI D;  1P3L B;  2BG1 A;  4YM6 C;  4NE5 A;  3EPJ A;  3A6N C;  5C3I B;  3MGQ D;  2JE5 A;  1P3L C;  3AZN A;  3AZK A;  5C3I C;  3REL C;  3AV2 D;  3MVD A;  3KWQ B;  5B33 C;  5B40 B;  3AYW B;  1P3M D;  3KWQ C;  3O62 A;  4E45 A;  5B40 C;  2ARO A;  3REK A;  3AYW C;  1F1E A;  3LZ1 D;  5E5A D;  5CPI A;  5AV6 D;  3AZN D;  3NQU B;  5B31 A;  3AZK D;  1P34 C;  1BH8 B;  2Y2M A;  5GT0 A;  2NQB D;  5AV8 B;  5B0Z D;  3W98 D;  4DQY B;  2NZD A;  3O62 D;  5B1L B;  2FJ7 A;  2ARO D;  3REK D;  1HQ3 A;  3MVD B;  5AV8 C;  5B1L C;  1KX5 D;  2XD5 A;  1KX3 A;  5CPI D;  4HGA B;  5B31 D;  3UTA B;  4Z5T B;  1U35 B;  1M19 A;  4HGA C;  3LZ0 C;  3KSY A;  5GT0 D;  3UTA C;  4Z5T C;  1U35 C;  3VH6 T;  1P3K B;  2FJ7 D;  4H9O A;  3LZ1 B;  5JRG D;  5E5A B;  2CV5 A;  4R8P C;  5AY8 B;  1P3O D;  1KX3 D;  1BFM A;  3WTP C;  5AY8 C;  3X1T D;  1M19 D;  3MGP A;  3UT9 A;  3AZE B;  5CPK A;  1P3P B;  3B6G B;  2CV5 D;  3WAA D;  5CPJ B;  1P3P C;  3H0L C;  4WNN A;  3B6G C;  1M1A B;  5CPJ C;  1F66 A;  1M1A C;  1EQZ A;  5BNV B;  1TAF A;  3UT9 D;  2HUE B;  5DNN B;  5CPK D;  5DNN C;  5GT3 A;  1JFI B;  1AOI B;  5B32 C;  4JJN B;  3B0D B;  4J8W C;  3AZM A;  1F66 D;  1AOI C;  2HIO A;  4X23 A;  4JJN C;  3REH A;  4KGC A;  3B0D C;  1M18 D;  4J8X D;  3X1S A;  4H9P B;  4YM6 A;  3V9R B;  1BH9 B;  3AZF A;  1P3G A;  1P3L A;  3W99 C;  3C1C D;  4DRB A;  4WU8 B;  4Z2M G;  4H9N B;  3REH D;  4WU8 C;  3REJ D;  4KGC D;  5B40 A;  1P3A D;  3AYW A;  4QLC B;  3H0R C;  4YM6 D;  4QLC C;  5GSU B;  1P3L D;  2ZY3 A;  3WAA B;  4CAY B;  3TU4 B;  3WAA C;  3TU4 C;  3VH5 W;  1BH8 A;  3KWQ D;  5BS7 A;  5B40 D;  2Y2N A;  3AYW D;  3W97 B;  3W96 B;  1WWI A;  4CSR A;  3LEL C;  3AN2 B;  4LD9 C;  5GXQ B;  3W96 C;  2F8N H;  3MGQ A;  3AN2 C;  5AVC B;  5B1M C;  4KHA A;  4ZUX C;  3REJ B;  5F99 B;  3LJA B;  5AV8 D;  1Z2C B;  1S32 B;  1P3K A;  5B1L D;  4XUJ C;  5F99 C;  5AVB B;  3A6N B;  3A1I A;  3LZ1 A;  3LJA C;  5E5A A;  2LY8 A;  1S32 C;  1P3F B;  5AVB C;  3REL B;  5AV6 A;  3VH5 A;  1P3F C;  3NQJ B;  5B33 B;  1TZY C;  3UTA D;  4Z5T D;  1KX4 B;  1U35 D;  1H3O B;  2NQB A;  1KX4 C;  3H0M C;  5B0Z A;  3W98 A;  4H9Q A;  3AZE A;  1P3K D;  5BT1 C;  1ID3 B;  2RIQ A;  2YFV A;  1P34 B;  1KX5 A;  5AY8 D;  5B24 C;  5CPJ A;  3WA9 C;  1ID3 C;  3R45 B;  3X1V B;  1M1A A;  1P3B B;  1P3I B;  5B31 G;  3X1V C;  3B6F B;  1P3B C;  5AV5 B;  1P3I C;  5B2I C;  3B6F C;  5DNN A;  3AZE D;  5KDM B;  5AV5 C;  5CHL B;  5JRG A;  4G91 C;  3C1B B;  2PYO C;  3MGR B;  1P3P D;  3B6G D;  2BYM A;  1P3O A;  1JFI A;  5CPJ D;  3C1B C;  3LZ0 B;  3MGR C;  5DNM B;  4XZQ B;  1M1A D;  3X1T A;  5DNM C;  4NE6 A;  1R4V A;  4XZQ C;  5B0Y B;  2DQN C;  3AL0 C;  3P5J B;  5DNN D;  4H9P A;  3V9R A;  4R8P B;  4WU9 B;  1BH9 A;  4H9S C;  5B0Y C;  3WTP B;  4J8W D;  4WU9 C;  1ZLA C;  1AOI D;  4JJN D;  4WU8 A;  1PZR A;  4J8U B;  3AFA B;  4J8U C;  4QLC A;  3EPH A;  3AFA C;  3AZH B;  3B0C W;  2Y2G A;  5GSU A;  1WWS A;  2JCH A;  3AZH C;  5JA4 B;  3AV2 C;  4CAY A;  2Y2L A;  5B2J B;  3TU4 A;  4WU8 D;  1P3M C;  5B2J C;  5FUG B;  1M18 A;  4J8X A;  2F8N D;  2L5A A;  3W97 A;  4QLC D;  3W96 A;  2BYK B;  3AN2 A;  3KXB B;  1B6W A;  5GSU D;  5B32 B;  5GXQ A;  2VQR A;  4J8W B;  4UUZ B;  3C1C A; 
#chains in the Genus database with same CATH homology
 3KXB C;  5AVC A;  3MVD C;  3AZL B;  3TU4 D;  1N1J B;  3AZL C;  4ZBJ B;  3REJ A;  2ARO C;  3FDD A;  5F99 A;  3LJA A;  3LEL D;  4Z66 B;  3KUY B;  4H9R B;  5BO0 B;  1P3A A;  3W97 D;  4ZBJ C;  3W99 B;  1S32 A;  3W96 D;  2JSS A;  3A6N A;  3KUY C;  4Z66 C;  3AN2 D;  5GXQ D;  1P3F A;  4YS3 B;  2UWX A;  3REL A;  3AZJ B;  5AVC D;  5GT0 C;  5AV9 B;  5B33 A;  4YS3 C;  4J8V B;  3AZJ C;  1KX4 A;  2RVQ C;  2NZD C;  5AV9 C;  3KWQ A;  1H3O A;  4J8V C;  1HQ3 C;  5F99 D;  3LJA D;  3REI B;  2F8N B;  2F2A C;  2ZY2 A;  1S32 D;  1KX3 C;  3A6N D;  2ZM5 A;  3REI C;  5AVB D;  3VH6 W;  1ID3 A;  1P3F D;  1P34 A;  3REL D;  2XD1 A;  3R45 A;  3NQU A;  5B33 D;  1P3B A;  2ZY4 A;  1KX4 D;  4NFT A;  5AV5 A;  5BT1 D;  3LEL B;  5AV8 A;  3AV1 B;  4LD9 B;  5CP6 B;  5KDM A;  5B1L A;  3AV1 C;  1ID3 D;  3C1B A;  5B1M B;  5CP6 C;  3MGR A;  2G5H C;  1P34 D;  3MGP B;  4ZUX B;  3LZ0 A;  5DNM A;  3X1V D;  4XZQ A;  1P3B D;  3UTA A;  1P3I D;  4Z5T A;  3MGP C;  3UT9 C;  1U35 A;  3B6F D;  3VH6 A;  4XUJ B;  5AV5 D;  4WNN B;  4R8P A;  3C1B D;  3WTP A;  3MGR D;  4KUD B;  5AY8 A;  1EQZ B;  5BNX B;  1TZY B;  3F6T A;  3LZ0 D;  5DNM D;  4KUD C;  2W8S A;  4XZQ D;  1EQZ C;  4NE3 A;  5GT3 B;  5B0Y D;  3AZM B;  5GT3 C;  4R8P D;  4WU9 D;  5B24 B;  4X23 B;  3WA9 B;  3A1K A;  3AZM C;  1P3P A;  3WTP D;  3B6G A;  2HIO C;  4X23 C;  2G5I C;  3REH C;  3X1S B;  3MNN B;  3EPK A;  4G92 B;  3AZF B;  1P3G B;  4UPK A;  4J8U D;  5B2I B;  3AZG B;  3MNN C;  3X1S C;  3AFA D;  4G92 C;  4WJ3 C;  5FUG A;  2ZY5 A;  3AZF C;  1P3G C;  5BNV A;  5G49 B;  3AZG C;  3EG5 B;  4G91 B;  2PYO B;  2BYK A;  3AZH D;  1A7W A;  3KXB A;  5B32 A;  4J8W A;  4UUZ A;  1AOI A;  5B32 G;  2FFF B;  3AZL A;  5B2J D;  4JJN A;  1N1J A;  3UTB B;  2YFW B;  3WKJ B;  3UTB C;  3KUY A;  4Z66 A;  4H9R A;  5BO0 A;  3WKJ C;  3W99 A;  1ZLA B;  3KXB D;  3X1U B;  4Z2M H;  5B32 D;  3MVD D;  4YS3 A;  3EPL A;  3AZJ A;  3X1U C;  3AZL D;  2Y2P A;  4CSR B;  5BS7 C;  2DF4 C;  5AV9 A;  4J8V A;  3MGS B;  3AZI B;  1HTA A;  4H9N A;  4AWL B;  3B0B A;  3MGS C;  3MGQ B;  3REI A;  3AZI C;  3KUY D;  4Z66 D;  2F8N A;  1W2E A;  4AWL C;  4KHA B;  3W99 D;  3MGQ C;  2F8N G;  4DRA A;  3AV2 B;  1T3U A;  1Q9C A;  3WAA A;  4YS3 D;  1P3M B;  3AZJ D;  2RVQ D;  2NZD D;  5AV9 D;  1ULY A;  4J8V D;  1HQ3 D;  2Y2O A;  1P3K C;  3LZ1 C;  5AV6 B;  3LEL A;  3REI D;  5E5A C;  3AZN B;  3AV1 A;  4LD9 A;  3AZK B;  5CP6 A;  3VH5 T;  5AV6 C;  3AZN C;  4WZS B;  3AZK C;  5B1M A;  2NQB B;  4ZUX A;  5B0Z B;  4H9Q B;  3W98 B;  3O62 B;  2NQB C;  2ARO B;  3REK B;  2CWE A;  5B0Z C;  3W98 C;  2YFV B;  3AZE C;  3O62 C;  1KX5 B;  3REK C;  5CPI B;  4XUJ A;  3AV1 D;  4LD9 D;  5B31 B;  1KX5 C;  5CP6 D;  5CPI C;  5AVB A;  5B31 C;  5B1M D;  5GT0 B;  4KUD A;  2Y2Q A;  5BNX A;  1TZY A;  3MGP D;  4ZUX D;  1KU5 A;  3NQJ A;  2NZD B;  2FJ7 B;  1HQ3 B;  3WTP E;  5JRG B;  2HUE C;  2FJ7 C;  2BYM B;  1P3O B;  1KX3 B;  4XUJ D;  5JRG C;  2IO5 B;  1P3O C;  3X1T B;  5B24 A;  3WA9 A;  1M19 B;  4EO5 B;  2IO5 C;  4KUD D;  3X1T C;  1EQZ D;  1TZY D;  1M19 C;  4EO5 C;  4M6B A;  3MNN A;  3X1V A;  4H9O B;  1P3I A;  3AZG A;  5B2I A;  3B6F A;  2CV5 B;  5GT3 D;  5G49 A;  4WV4 B;  2CV5 C;  3AZM D;  2PYO A;  2J8P A;  2F8N K;  2HIO D;  5B24 D;  4X23 D;  3IP4 C;  3WA9 D;  3UT9 B;  3X1S D;  3MNN D;  5CPK B;  3KFU G;  4E44 A;  3UTB A;  3AZF D;  1P3G D;  2YFW A;  5B2I D;  3AZG D;  5CPK C;  3WKJ A;  5GSU C;  4H9S A;  5B0Y A;  2PYO D;  4WU9 A;  1F66 B;  1ZLA A;  3X1U A;  1M18 B;  1F66 C;  4J8X B;  1TAF B;  1B67 A;  1M18 C;  4J8X C;  3MGS A;  3UTB D;  3AZI A;  4J8U A;  3W97 C;  3WKJ D;  3AFA A;  2Y2J A;  3C1C B;  5GXQ C;  2Y2I A;  2Y2H A;  3C1C C;  3AZH A;  2HIO B;  5AVC C;  3AV2 A;  1ZLA D;  3REH B;  3X1U D;  4KGC B;  1P3A B;  5JA4 A;  1P3M A;  3B0C T;  4KGC C;  3REJ C;  5B2J A;  4YM6 B;  1P3A C;  2Y2K A;  3MGS D;  3AZI D;  1P3L B;  2BG1 A;  4YM6 C;  4NE5 A;  3EPJ A;  3A6N C;  5C3I B;  3MGQ D;  2JE5 A;  1P3L C;  3AZN A;  3AZK A;  5C3I C;  3REL C;  3AV2 D;  3MVD A;  3KWQ B;  5B33 C;  5B40 B;  3AYW B;  1P3M D;  3KWQ C;  3O62 A;  4E45 A;  5B40 C;  2ARO A;  3REK A;  3AYW C;  1F1E A;  3LZ1 D;  5E5A D;  5CPI A;  5AV6 D;  3AZN D;  3NQU B;  5B31 A;  3AZK D;  1P34 C;  1BH8 B;  2Y2M A;  5GT0 A;  2NQB D;  5AV8 B;  5B0Z D;  3W98 D;  4DQY B;  2NZD A;  3O62 D;  5B1L B;  2FJ7 A;  2ARO D;  3REK D;  1HQ3 A;  3MVD B;  5AV8 C;  5B1L C;  1KX5 D;  2XD5 A;  1KX3 A;  5CPI D;  4HGA B;  5B31 D;  3UTA B;  4Z5T B;  1U35 B;  1M19 A;  4HGA C;  3LZ0 C;  3KSY A;  5GT0 D;  3UTA C;  4Z5T C;  1U35 C;  3VH6 T;  1P3K B;  2FJ7 D;  4H9O A;  3LZ1 B;  5JRG D;  5E5A B;  2CV5 A;  4R8P C;  5AY8 B;  1P3O D;  1KX3 D;  1BFM A;  3WTP C;  5AY8 C;  3X1T D;  1M19 D;  3MGP A;  3UT9 A;  3AZE B;  5CPK A;  1P3P B;  3B6G B;  2CV5 D;  3WAA D;  5CPJ B;  1P3P C;  3H0L C;  4WNN A;  3B6G C;  1M1A B;  5CPJ C;  1F66 A;  1M1A C;  1EQZ A;  5BNV B;  1TAF A;  3UT9 D;  2HUE B;  5DNN B;  5CPK D;  5DNN C;  5GT3 A;  1JFI B;  1AOI B;  5B32 C;  4JJN B;  3B0D B;  4J8W C;  3AZM A;  1F66 D;  1AOI C;  2HIO A;  4X23 A;  4JJN C;  3REH A;  4KGC A;  3B0D C;  1M18 D;  4J8X D;  3X1S A;  4H9P B;  4YM6 A;  3V9R B;  1BH9 B;  3AZF A;  1P3G A;  1P3L A;  3W99 C;  3C1C D;  4DRB A;  4WU8 B;  4Z2M G;  4H9N B;  3REH D;  4WU8 C;  3REJ D;  4KGC D;  5B40 A;  1P3A D;  3AYW A;  4QLC B;  3H0R C;  4YM6 D;  4QLC C;  5GSU B;  1P3L D;  2ZY3 A;  3WAA B;  4CAY B;  3TU4 B;  3WAA C;  3TU4 C;  3VH5 W;  1BH8 A;  3KWQ D;  5BS7 A;  5B40 D;  2Y2N A;  3AYW D;  3W97 B;  3W96 B;  1WWI A;  4CSR A;  3LEL C;  3AN2 B;  4LD9 C;  5GXQ B;  3W96 C;  2F8N H;  3MGQ A;  3AN2 C;  5AVC B;  5B1M C;  4KHA A;  4ZUX C;  3REJ B;  5F99 B;  3LJA B;  5AV8 D;  1Z2C B;  1S32 B;  1P3K A;  5B1L D;  4XUJ C;  5F99 C;  5AVB B;  3A6N B;  3A1I A;  3LZ1 A;  3LJA C;  5E5A A;  2LY8 A;  1S32 C;  1P3F B;  5AVB C;  3REL B;  5AV6 A;  3VH5 A;  1P3F C;  3NQJ B;  5B33 B;  1TZY C;  3UTA D;  4Z5T D;  1KX4 B;  1U35 D;  1H3O B;  2NQB A;  1KX4 C;  3H0M C;  5B0Z A;  3W98 A;  4H9Q A;  3AZE A;  1P3K D;  5BT1 C;  1ID3 B;  2RIQ A;  2YFV A;  1P34 B;  1KX5 A;  5AY8 D;  5B24 C;  5CPJ A;  3WA9 C;  1ID3 C;  3R45 B;  3X1V B;  1M1A A;  1P3B B;  1P3I B;  5B31 G;  3X1V C;  3B6F B;  1P3B C;  5AV5 B;  1P3I C;  5B2I C;  3B6F C;  5DNN A;  3AZE D;  5KDM B;  5AV5 C;  5CHL B;  5JRG A;  4G91 C;  3C1B B;  2PYO C;  3MGR B;  1P3P D;  3B6G D;  2BYM A;  1P3O A;  1JFI A;  5CPJ D;  3C1B C;  3LZ0 B;  3MGR C;  5DNM B;  4XZQ B;  1M1A D;  3X1T A;  5DNM C;  4NE6 A;  1R4V A;  4XZQ C;  5B0Y B;  2DQN C;  3AL0 C;  3P5J B;  5DNN D;  4H9P A;  3V9R A;  4R8P B;  4WU9 B;  1BH9 A;  4H9S C;  5B0Y C;  3WTP B;  4J8W D;  4WU9 C;  1ZLA C;  1AOI D;  4JJN D;  4WU8 A;  1PZR A;  4J8U B;  3AFA B;  4J8U C;  4QLC A;  3EPH A;  3AFA C;  3AZH B;  3B0C W;  2Y2G A;  5GSU A;  1WWS A;  2JCH A;  3AZH C;  5JA4 B;  3AV2 C;  4CAY A;  2Y2L A;  5B2J B;  3TU4 A;  4WU8 D;  1P3M C;  5B2J C;  5FUG B;  1M18 A;  4J8X A;  2F8N D;  2L5A A;  3W97 A;  4QLC D;  3W96 A;  2BYK B;  3AN2 A;  3KXB B;  1B6W A;  5GSU D;  5B32 B;  5GXQ A;  2VQR A;  4J8W B;  4UUZ B;  3C1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...