5AV5B

Human nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5B00
3B0CW 3AV2B 3UTBA 4KUDB 3VH6W 1P3OB 4XZQC 3X1VD 1KU5A 1P3PD 3WA9C 1KX3B 1ZLAB 4G92C 5B0YB 5B2JC 1P3AD 3MNND 3AV2D 1P3PA 1M1AA 4KUDD 1WWIA 1P3OD 4R8PA 4YS3C 1KX3D 1P3AA 1ZLAD 3A6NB 3AV2A 5B0YD 2BYKB 2IO5B 3W96C 5B32D 4KUDA 1BFMA 5CP6B 1N1JB 5AV6B 1P34C 1ZLAA 4J8WC 1ID3C 5B0YA 3AZFC 3UT9B 4JJNC 3MVDC 3MGSC 3B0CT 5CP6D 3AZJA 4LD9C 5AV6D 4H9NA 3W97B 3A6NA 2F8NK 2BYKA 1EQZC 3AZNB 3REJA 5CP6A 5B1MC 1N1JA 4Z5TC 3W97D 3UT9A 5CPKC 4EO5B 3W98A 5AV5C 3W99B 4KGCB 3AZLC 3W97A 3AZNA 5AY8C 4XUJC 3LJAC 3C1CB 3W99D 4KGCD 3KUYB 5F99C 3AV1C 5GT3B 5AVCC 3AZED 4KGCA 3C1CD 3X1SA 5BS7C 3KUYD 3VH6A 5GT3D 4WZSB 2FJ7B 5GT0B 3KUYA 3UTAA 4J8UA 4J8VB 5GT3A 5B1LC 1P3GC 1KX4B 1M1AC 3KXBB 5DNMB 1M19C 3VH5W 2FJ7D 4R8PC 1P3FB 3X1TB 5GSUB 5B33A 4WU9B 4HGAC 5B40B 3TU4A 5GT0D 3LZ1C 4J8VD 1P3LB 2FJ7A 1P3IC 2F8NB 3KXBD 5DNMD 1P3FD 3X1TD 5JA4B 5GT0A 5GSUD 3NQUB 4WU9D 5B40D 5AV9A 4J8VA 1ULYA 1KX4A 5BNVB 3AZIC 5AVBD 1P3LD 5DNMA 4M6BA 3AZJC 1P3FA 4J8XA 5GSUA 2F8ND 4WU9A 5B40A 3A6NC 5BT1C 5FUGB 1KX5B 1P3LA 1F66C 3REJC 3B6FB 2NZDB 1TZYD 5JRGD 2RVQD 5JA4A 3NQUA 5BNVA 5CPIC 1KX5D 3W98C 4CSRB 3X1UC 1P3KB 3WTPB 4YM6B 5CPJB 5BNXA 5B31B 5FUGA 1M18C 1KX5A 3AZNC 3LELC 3B6FA 1R4VA 2NZDA 2NQBA 4Z66C 5CPKD 1P3KD 4ZUXB 4QLCB 3WTPD 4YM6D 5CPJD 5B31D 3WKJA 4CSRA 3REID 1P3KA 3B0BA 3WTPA 2L5AA 4YM6A 3MGRC 5B31A 5CPJA 4ZUXD 3MGQA 5B0ZC 4QLCD 4WU8B 3B0DC 4G91C 3X1SC 2AROC 5B2IB 3AZGA 1B6WA 1HQ3C 5E5AB 4H9QB 3RELB 3AN2B 3B6GB 4ZUXA 5CHLB 5B32B 3C1BB 3UTAC 3X1VA 3AZHA 4WU8D 1BH9B 4J8UC 5DNNB 5B2ID 3VH5A 3AZKB 2HIOC 4UUZB 5E5AD 3LZ0B 3MNNA 3RELD 3AN2D 3B6GD 5B33C 4WU8A 3TU4C 1P3OA 3C1BD 5B2IA 5E5AA 3RELA 4H9QA 5DNND 4X23B 3REKD 3AYWD 3AN2A 1KX3A 3B6GA 3AZKD 5B32A 3LZ0D 3C1BA 2F8NH 5AV9C 1KX4C 5DNNA 3VH6T 3O62C 3AZKA 4UUZA 3AFAC 5AV8B 4X23D 3LZ0A 3MGPB 2CV5D 4J8XC 4KHAB 1AOIB 5AV6A 4X23A 3WAAC 5AV8D 3MGPD 1P3MC 2PYOC 5GXQD 1AOID 5AV8A 2HUEC 1U35B 3AZEB 3AZMB 1AOIA 4AWLB 5B24B 3B6FC 2NZDC 2NQBC 3REHB 1P3BB 1U35D 3KWQD 3AZMD 1S32B 3W99A 3WKJC 4ZBJB 5B24D 1U35A 3REHD 4H9RB 3WTPE 1P3BD 3AZHC 3AZEA 3UTBC 3MGQC 3AZMA 3C1CA 5B24A 1S32D 3AZGC 1P3BA 1JFIB 4XZQB 3WA9B 4G92B 3X1VC 1P3PC 5B2JB 1S32A 3MGRD 4H9RA 4XZQD 1P3AC 3MNNC 3AV2C 3WA9D 4YS3B 2CWEA 4KUDC 1P3OC 5AVBB 5B2JD 3W96B 1KX3C 4XZQA 1JFIA 1ZLAC 3WA9A 5B0YC 5B32C 1ID3B 4YS3D 1TZYB 5B2JA 5JRGB 3KXBA 3AZFB 5C3IB 3X1TA 4JJNB 3W96D 3MVDB 3MGSB 4LD9B 4YS3A 2IO5C 4WV4B 1P34D 5AVBA 4J8WD 1ID3D 5CP6C 2F8NA 1EQZB 3W96A 3AZFD 5AV6C 5B1MB 4JJND 4Z2MG 3MVDD 3MGSD 3VH5T 4Z5TB 3UT9C 4LD9D 1TZYA 3O62D 3NQJB 4NE3A 5JRGA 3AZFA 5CPKB 1EQZD 3MVDA 3MGSA 1TAFB 3W97C 5B1MD 5AV5B 4LD9A 3AZLB 5G49B 4Z5TD 3REIB 1EQZA 5AY8B 5B1MA 4XUJB 3LJAB 5KDMB 5AV5D 4EO5C 3AZLD 5CPKA 3W99C 5F99B 3AV1B 1TAFA 5AY8D 5AVCB 4KGCC 4XUJD 3LJAD 3R45B 1H3OB 1BH8B 3AZEC 3REIA 3C1CC 5AY8A 4H9PB 4XUJA 5F99D 5KDMA 3AV1D 4QLCA 5AVCD 3KUYC 4DRBA 5GT3C 4H9OB 3REKB 3AYWB 5AVCA 5B1LB 1P3GB 1M1AB 1H3OA 1M19B 1BH8A 3V9RB 2YFWB 4HGAB 4H9PA 5BS7A 2CV5B 3LZ1B 2FJ7C 5B1LD 1P3GD 2BYMB 5GT0C 1P3IB 1M1AD 1BH9A 1M19D 4J8VC 4H9OA 5B32G 4R8PD 3REKA 3AYWA 3KXBC 5DNMC 5B1LA 1P3GA 3LZ1D 1P3FC 3X1TC 5GSUC 3AZIB 4WU9C 4H9SA 5B40C 5GXQB 1M19A 3AZJB 1P3ID 3V9RA 2YFWA 1P3LC 4H9NB 5AVBC 2CV5A 3LZ1A 1F66B 1B67A 3REJB 2BYMA 4WNNB 1P3IA 3AZID 3AZJD 1TZYC 5JRGC 4Z2MH 5BO0B 5BT1D 3A6ND 5C3IC 3MGPA 2RVQC 5CPIB 3AZIA 3KWQB 1F66D 3REJD 3W98B 5GXQA 4KHAA 3X1UB 1KX5C 4NE6A 1M18B 1F66A 4CAYB 3LELB 3UT9D 4WNNA 5CPID 3W98D 4Z66B 3X1UD 5BO0A 4NFTA 1M18D 5CPIA 3AZND 1P3KC 3KWQA 3WTPC 1Q9CA 4YM6C 3LELD 3X1UA 5B31C 5CPJC 1A7WA 4Z66D 4NE5A 3MGRB 3REIC 1M18A 5B0ZB 3KSYA 3REHA 3B0DB 4CAYA 4G91B 3X1SB 3LELA 4ZUXC 2AROB 4QLCC 1HQ3B 4Z66A 3UTAB 5B0ZD 4J8UB 3X1SD 2AROD 4WU8C 1HQ3D 2HIOB 3MGRA 5B33B 5B0ZA 5B2IC 3TU4B 5E5AC 3RELC 3UTAD 3AN2C 3B6GC 4J8UD 2AROA 1HQ3A 1P34B 3C1BC 4J8WB 2HIOD 5DNNC 5B33D 3REKC 3AYWC 5AV9B 3TU4D 3AZKC 3LZ0C 3O62B 2HIOA 4H9SC 3AFAB 1HTAA 4J8XB 2CV5C 4X23C 5AV9D 2F8NG 1KX4D 1P34A 1F1EA 4J8WA 1ID3A 3WAAB 3AFAD 1P3MB 4J8XD 4JJNA 2PYOB 5AV8C 3MGPC 3O62A 5GXQC 3AFAA 2HUEB 1AOIC 3WAAD 5BNXB 1P3MD 2YFVB 2PYOD 4DRAA 4Z5TA 4E44A 2NQBB 3WAAA 3NQJA 1P3MA 4E45A 2PYOA 5AV5A 1U35C 3KWQC 3WKJB 3B6FD 2NZDD 3AZLA 5G49A 3AZMC 5B31G 4AWLC 2NQBD 5B24C 3AZHB 3UTBB 3MGQB 3LJAA 2YFVA 3REHC 1P3BC 2LY8A 3WKJD 3AZGB 2JSSA 1S32C 5F99A 3AV1A 4ZBJC 3AZHD 3UTBD 3X1VB 3MGQD 1P3PB 3R45A 4R8PB 1WWSA 3AZGD 1P3AB 3MNNB
chains in the Genus database with same CATH superfamily
3B0CW 3AV2B 3UTBA 4KUDB 3VH6W 1P3OB 4XZQC 3X1VD 3A1KA 1KU5A 1P3PD 3WA9C 1KX3B 2Y2HA 1ZLAB 4G92C 5B0YB 5B2JC 1Z2CB 1P3AD 3MNND 3AV2D 1P3PA 1M1AA 4KUDD 1WWIA 1P3OD 4R8PA 2ZY3A 4YS3C 1KX3D 1P3AA 1ZLAD 3A6NB 3AV2A 5B0YD 2BYKB 3P5JB 2IO5B 3W96C 5B32D 2Y2MA 4KUDA 1BFMA 5CP6B 1N1JB 5AV6B 1P34C 1ZLAA 4J8WC 1ID3C 5B0YA 2ZY5A 3AZFC 3UT9B 4JJNC 3MVDC 2VQRA 3B0CT 3MGSC 5CP6D 3AZJA 4LD9C 5AV6D 4H9NA 3W97B 1T3UA 3A6NA 2RIQA 2F8NK 2BYKA 1EQZC 3AZNB 3REJA 5CP6A 5B1MC 1N1JA 2XD1A 4Z5TC 3W97D 3UT9A 5CPKC 4EO5B 3W98A 5AV5C 3W99B 4KGCB 3EPJA 3AZLC 3W97A 2DF4C 3AZNA 5AY8C 4DQYB 4XUJC 3LJAC 3C1CB 2W8SA 3W99D 4KGCD 3KUYB 5F99C 3AV1C 5GT3B 5AVCC 3AZED 4KGCA 3C1CD 3A1IA 3X1SA 5BS7C 3KUYD 3VH6A 5GT3D 4WZSB 2FJ7B 5GT0B 3KUYA 3UTAA 4J8UA 4J8VB 5GT3A 5B1LC 1P3GC 1KX4B 1M1AC 3KXBB 5DNMB 1M19C 3VH5W 2FJ7D 4R8PC 1P3FB 3X1TB 5GSUB 5B33A 4WU9B 4HGAC 5B40B 3TU4A 5GT0D 3LZ1C 4J8VD 1P3LB 2FJ7A 1P3IC 2F8NB 3KXBD 5DNMD 1P3FD 5JA4B 5GT0A 5GSUD 3X1TD 3NQUB 4WU9D 5B40D 5AV9A 4J8VA 1ULYA 1KX4A 5BNVB 3AZIC 5AVBD 1P3LD 5DNMA 4M6BA 3AZJC 1P3FA 4J8XA 5GSUA 2F8ND 4WU9A 5B40A 3A6NC 5BT1C 5FUGB 1KX5B 1P3LA 1F66C 3REJC 3B6FB 2NZDB 1TZYD 5JRGD 2RVQD 5JA4A 3NQUA 5BNVA 5CPIC 1KX5D 3W98C 4CSRB 3X1UC 1P3KB 3WTPB 4YM6B 5CPJB 5BNXA 5B31B 5FUGA 1M18C 1KX5A 3AZNC 3LELC 3B6FA 1R4VA 2NZDA 2NQBA 4Z66C 5CPKD 2Y2QA 1P3KD 4ZUXB 4QLCB 3WTPD 4YM6D 5CPJD 5B31D 3WKJA 4CSRA 3REID 1P3KA 2Y2PA 3B0BA 3WTPA 2L5AA 4YM6A 3MGRC 5B31A 5CPJA 4ZUXD 3MGQA 5B0ZC 4QLCD 4WU8B 3KFUG 3B0DC 4G91C 3X1SC 2AROC 5B2IB 3AZGA 1B6WA 1HQ3C 5E5AB 4H9QB 3RELB 2G5IC 3AN2B 3B6GB 4ZUXA 5CHLB 5B32B 3C1BB 3UTAC 3X1VA 3AZHA 4WU8D 1BH9B 4J8UC 5DNNB 5B2ID 3VH5A 3AZKB 2HIOC 2Y2JA 4UUZB 5E5AD 3MNNA 3LZ0B 3RELD 3AN2D 3B6GD 5B33C 2Y2OA 4WU8A 3TU4C 1P3OA 3C1BD 5B2IA 5E5AA 3RELA 4H9QA 5DNND 4X23B 3REKD 3AYWD 3AN2A 1KX3A 3B6GA 3AZKD 5B32A 3LZ0D 2JE5A 3C1BA 2F8NH 3FDDA 3H0RC 5AV9C 1KX4C 5DNNA 2ZY4A 3VH6T 3O62C 3AZKA 4UUZA 3AFAC 2Y2IA 5AV8B 4X23D 3LZ0A 3MGPB 4J8XC 2CV5D 4KHAB 1AOIB 3IP4C 1W2EA 5AV6A 4X23A 3WAAC 5AV8D 3MGPD 1P3MC 2PYOC 5GXQD 1AOID 2Y2LA 5AV8A 2HUEC 1U35B 3AZEB 3AZMB 1AOIA 4AWLB 5B24B 3B6FC 2NZDC 2NQBC 3REHB 1P3BB 1U35D 3KWQD 3AZMD 2XD5A 1S32B 3W99A 3WKJC 4ZBJB 5B24D 1U35A 3REHD 4H9RB 3WTPE 1P3BD 3AZHC 3AZEA 3UTBC 3MGQC 3AZMA 2Y2NA 3C1CA 5B24A 1S32D 3AZGC 1P3BA 1JFIB 4XZQB 3WA9B 2ZY2A 4G92B 3X1VC 1P3PC 5B2JB 1S32A 3MGRD 4H9RA 4XZQD 1P3AC 3MNNC 3AV2C 3WA9D 4YS3B 2CWEA 4KUDC 1P3OC 5AVBB 5B2JD 3W96B 1KX3C 4XZQA 1JFIA 1ZLAC 3WA9A 5B0YC 5B32C 2Y2KA 1ID3B 4YS3D 1TZYB 5B2JA 5JRGB 3KXBA 3AZFB 5C3IB 3X1TA 4JJNB 3W96D 3MVDB 3MGSB 4LD9B 4YS3A 2IO5C 4WV4B 1P34D 5AVBA 4J8WD 1ID3D 5CP6C 2F8NA 1EQZB 3W96A 3AZFD 5AV6C 5B1MB 4JJND 4Z2MG 3MVDD 3MGSD 3VH5T 4Z5TB 3UT9C 4LD9D 1TZYA 3O62D 3NQJB 4NE3A 5JRGA 3AZFA 5CPKB 1EQZD 3MVDA 3MGSA 1TAFB 3H0LC 3F6TA 3W97C 5B1MD 5AV5B 4LD9A 3AZLB 5G49B 4Z5TD 3REIB 1EQZA 5AY8B 5B1MA 2FFFB 4XUJB 3LJAB 5KDMB 5AV5D 4EO5C 3AZLD 2Y2GA 5CPKA 3W99C 5F99B 3AV1B 1TAFA 5AY8D 5AVCB 4KGCC 4XUJD 3LJAD 3R45B 1H3OB 1BH8B 3AZEC 3REIA 3C1CC 5AY8A 4H9PB 4XUJA 5F99D 5KDMA 3AV1D 4QLCA 5AVCD 4WJ3C 3KUYC 4DRBA 5GT3C 4H9OB 3REKB 3AYWB 3H0MC 1PZRA 5AVCA 5B1LB 1P3GB 1M1AB 1H3OA 1M19B 1BH8A 3V9RB 2YFWB 4HGAB 4H9PA 5BS7A 2CV5B 3LZ1B 2DQNC 2FJ7C 5B1LD 1P3GD 2BYMB 5GT0C 1P3IB 1M1AD 1BH9A 1M19D 4J8VC 4H9OA 5B32G 4R8PD 3REKA 3AYWA 3KXBC 5DNMC 5B1LA 1P3GA 3LZ1D 1P3FC 3X1TC 5GSUC 3AZIB 4WU9C 4H9SA 5B40C 5GXQB 1M19A 3EPHA 3AZJB 1P3ID 3V9RA 2ZM5A 2YFWA 1P3LC 4H9NB 5AVBC 2CV5A 3LZ1A 1F66B 1B67A 3REJB 2BYMA 4WNNB 1P3IA 3AZID 3AZJD 1TZYC 5JRGC 4Z2MH 5BO0B 5BT1D 3A6ND 5C3IC 3MGPA 3EG5B 2RVQC 5CPIB 3AZIA 3KWQB 1F66D 3REJD 3W98B 5GXQA 4KHAA 3X1UB 1KX5C 4NE6A 1M18B 1F66A 4CAYB 3LELB 3UT9D 4WNNA 5CPID 3W98D 4Z66B 3X1UD 3AL0C 5BO0A 4NFTA 1M18D 5CPIA 3AZND 1P3KC 3KWQA 3WTPC 1Q9CA 4YM6C 3LELD 3X1UA 5B31C 5CPJC 1A7WA 4Z66D 4NE5A 3MGRB 3REIC 1M18A 5B0ZB 3KSYA 3REHA 3B0DB 4CAYA 4G91B 3X1SB 3LELA 4ZUXC 2AROB 4QLCC 1HQ3B 4Z66A 3UTAB 5B0ZD 4J8UB 3X1SD 2AROD 4WU8C 1HQ3D 2HIOB 3MGRA 5B33B 5B0ZA 5B2IC 3TU4B 5E5AC 3RELC 3UTAD 3AN2C 3B6GC 4J8UD 2AROA 1HQ3A 1P34B 3C1BC 4J8WB 2HIOD 5DNNC 5B33D 3REKC 3AYWC 5AV9B 3TU4D 3AZKC 2F2AC 2J8PA 3LZ0C 3O62B 2HIOA 4H9SC 3AFAB 1HTAA 4J8XB 2CV5C 4X23C 5AV9D 2F8NG 1KX4D 1P34A 1F1EA 4J8WA 1ID3A 3WAAB 3AFAD 1P3MB 4J8XD 3EPKA 2JCHA 4JJNA 2PYOB 5AV8C 3MGPC 3O62A 5GXQC 3AFAA 2HUEB 1AOIC 3WAAD 5BNXB 1P3MD 2YFVB 2PYOD 4DRAA 4Z5TA 4E44A 2NQBB 3WAAA 3NQJA 1P3MA 4UPKA 4E45A 2PYOA 3EPLA 5AV5A 1U35C 3KWQC 3WKJB 2BG1A 3B6FD 2NZDD 3AZLA 5G49A 3AZMC 5B31G 2UWXA 4AWLC 2NQBD 5B24C 3AZHB 3UTBB 3MGQB 3LJAA 2YFVA 3REHC 1P3BC 2LY8A 3WKJD 3AZGB 2JSSA 2G5HC 1S32C 5F99A 3AV1A 4ZBJC 3AZHD 3UTBD 3X1VB 3MGQD 1P3PB 3R45A 4R8PB 1WWSA 3AZGD 1P3AB 3MNNB
chains in the Genus database with same CATH topology
3B0CW 3AV2B 3UTBA 4KUDB 3VH6W 1P3OB 4XZQC 3X1VD 3A1KA 1KU5A 1P3PD 3WA9C 1KX3B 2Y2HA 1ZLAB 4G92C 5B0YB 5B2JC 1Z2CB 1P3AD 3MNND 3AV2D 1P3PA 1M1AA 4KUDD 1WWIA 1P3OD 4R8PA 2ZY3A 4YS3C 1KX3D 1P3AA 1ZLAD 3A6NB 3AV2A 5B0YD 2BYKB 3P5JB 2IO5B 3W96C 5B32D 2Y2MA 4KUDA 1BFMA 5CP6B 1N1JB 5AV6B 1P34C 1ZLAA 4J8WC 1ID3C 5B0YA 2ZY5A 3AZFC 3UT9B 4JJNC 3MVDC 2VQRA 3B0CT 3MGSC 5CP6D 3AZJA 4LD9C 5AV6D 4H9NA 3W97B 1T3UA 3A6NA 2RIQA 2F8NK 2BYKA 1EQZC 3AZNB 3REJA 5CP6A 5B1MC 1N1JA 2XD1A 4Z5TC 3W97D 3UT9A 5CPKC 4EO5B 3W98A 5AV5C 3W99B 4KGCB 3EPJA 3AZLC 3W97A 2DF4C 3AZNA 5AY8C 4DQYB 4XUJC 3LJAC 3C1CB 2W8SA 3W99D 4KGCD 3KUYB 5F99C 3AV1C 5GT3B 5AVCC 3AZED 4KGCA 3C1CD 3A1IA 3X1SA 5BS7C 3KUYD 3VH6A 5GT3D 4WZSB 2FJ7B 5GT0B 3KUYA 3UTAA 4J8UA 4J8VB 5GT3A 5B1LC 1P3GC 1KX4B 1M1AC 3KXBB 5DNMB 1M19C 3VH5W 2FJ7D 4R8PC 1P3FB 3X1TB 5GSUB 5B33A 4WU9B 4HGAC 5B40B 3TU4A 5GT0D 3LZ1C 4J8VD 1P3LB 2FJ7A 1P3IC 2F8NB 3KXBD 5DNMD 1P3FD 5JA4B 5GT0A 5GSUD 3X1TD 3NQUB 4WU9D 5B40D 5AV9A 4J8VA 1ULYA 1KX4A 5BNVB 3AZIC 5AVBD 1P3LD 5DNMA 4M6BA 3AZJC 1P3FA 4J8XA 5GSUA 2F8ND 4WU9A 5B40A 3A6NC 5BT1C 5FUGB 1KX5B 1P3LA 1F66C 3REJC 3B6FB 2NZDB 1TZYD 5JRGD 2RVQD 5JA4A 3NQUA 5BNVA 5CPIC 1KX5D 3W98C 4CSRB 3X1UC 1P3KB 3WTPB 4YM6B 5CPJB 5BNXA 5B31B 5FUGA 1M18C 1KX5A 3AZNC 3LELC 3B6FA 1R4VA 2NZDA 2NQBA 4Z66C 5CPKD 2Y2QA 1P3KD 4ZUXB 4QLCB 3WTPD 4YM6D 5CPJD 5B31D 3WKJA 4CSRA 3REID 1P3KA 2Y2PA 3B0BA 3WTPA 2L5AA 4YM6A 3MGRC 5B31A 5CPJA 4ZUXD 3MGQA 5B0ZC 4QLCD 4WU8B 3KFUG 3B0DC 4G91C 3X1SC 2AROC 5B2IB 3AZGA 1B6WA 1HQ3C 5E5AB 4H9QB 3RELB 2G5IC 3AN2B 3B6GB 4ZUXA 5CHLB 5B32B 3C1BB 3UTAC 3X1VA 3AZHA 4WU8D 1BH9B 4J8UC 5DNNB 5B2ID 3VH5A 3AZKB 2HIOC 2Y2JA 4UUZB 5E5AD 3MNNA 3LZ0B 3RELD 3AN2D 3B6GD 5B33C 2Y2OA 4WU8A 3TU4C 1P3OA 3C1BD 5B2IA 5E5AA 3RELA 4H9QA 5DNND 4X23B 3REKD 3AYWD 3AN2A 1KX3A 3B6GA 3AZKD 5B32A 3LZ0D 2JE5A 3C1BA 2F8NH 3FDDA 3H0RC 5AV9C 1KX4C 5DNNA 2ZY4A 3VH6T 3O62C 3AZKA 4UUZA 3AFAC 2Y2IA 5AV8B 4X23D 3LZ0A 3MGPB 4J8XC 2CV5D 4KHAB 1AOIB 3IP4C 1W2EA 5AV6A 4X23A 3WAAC 5AV8D 3MGPD 1P3MC 2PYOC 5GXQD 1AOID 2Y2LA 5AV8A 2HUEC 1U35B 3AZEB 3AZMB 1AOIA 4AWLB 5B24B 3B6FC 2NZDC 2NQBC 3REHB 1P3BB 1U35D 3KWQD 3AZMD 2XD5A 1S32B 3W99A 3WKJC 4ZBJB 5B24D 1U35A 3REHD 4H9RB 3WTPE 1P3BD 3AZHC 3AZEA 3UTBC 3MGQC 3AZMA 2Y2NA 3C1CA 5B24A 1S32D 3AZGC 1P3BA 1JFIB 4XZQB 3WA9B 2ZY2A 4G92B 3X1VC 1P3PC 5B2JB 1S32A 3MGRD 4H9RA 4XZQD 1P3AC 3MNNC 3AV2C 3WA9D 4YS3B 2CWEA 4KUDC 1P3OC 5AVBB 5B2JD 3W96B 1KX3C 4XZQA 1JFIA 1ZLAC 3WA9A 5B0YC 5B32C 2Y2KA 1ID3B 4YS3D 1TZYB 5B2JA 5JRGB 3KXBA 3AZFB 5C3IB 3X1TA 4JJNB 3W96D 3MVDB 3MGSB 4LD9B 4YS3A 2IO5C 4WV4B 1P34D 5AVBA 4J8WD 1ID3D 5CP6C 2F8NA 1EQZB 3W96A 3AZFD 5AV6C 5B1MB 4JJND 4Z2MG 3MVDD 3MGSD 3VH5T 4Z5TB 3UT9C 4LD9D 1TZYA 3O62D 3NQJB 4NE3A 5JRGA 3AZFA 5CPKB 1EQZD 3MVDA 3MGSA 1TAFB 3H0LC 3F6TA 3W97C 5B1MD 5AV5B 4LD9A 3AZLB 5G49B 4Z5TD 3REIB 1EQZA 5AY8B 5B1MA 2FFFB 4XUJB 3LJAB 5KDMB 5AV5D 4EO5C 3AZLD 2Y2GA 5CPKA 3W99C 5F99B 3AV1B 1TAFA 5AY8D 5AVCB 4KGCC 4XUJD 3LJAD 3R45B 1H3OB 1BH8B 3AZEC 3REIA 3C1CC 5AY8A 4H9PB 4XUJA 5F99D 5KDMA 3AV1D 4QLCA 5AVCD 4WJ3C 3KUYC 4DRBA 5GT3C 4H9OB 3REKB 3AYWB 3H0MC 1PZRA 5AVCA 5B1LB 1P3GB 1M1AB 1H3OA 1M19B 1BH8A 3V9RB 2YFWB 4HGAB 4H9PA 5BS7A 2CV5B 3LZ1B 2DQNC 2FJ7C 5B1LD 1P3GD 2BYMB 5GT0C 1P3IB 1M1AD 1BH9A 1M19D 4J8VC 4H9OA 5B32G 4R8PD 3REKA 3AYWA 3KXBC 5DNMC 5B1LA 1P3GA 3LZ1D 1P3FC 3X1TC 5GSUC 3AZIB 4WU9C 4H9SA 5B40C 5GXQB 1M19A 3EPHA 3AZJB 1P3ID 3V9RA 2ZM5A 2YFWA 1P3LC 4H9NB 5AVBC 2CV5A 3LZ1A 1F66B 1B67A 3REJB 2BYMA 4WNNB 1P3IA 3AZID 3AZJD 1TZYC 5JRGC 4Z2MH 5BO0B 5BT1D 3A6ND 5C3IC 3MGPA 3EG5B 2RVQC 5CPIB 3AZIA 3KWQB 1F66D 3REJD 3W98B 5GXQA 4KHAA 3X1UB 1KX5C 4NE6A 1M18B 1F66A 4CAYB 3LELB 3UT9D 4WNNA 5CPID 3W98D 4Z66B 3X1UD 3AL0C 5BO0A 4NFTA 1M18D 5CPIA 3AZND 1P3KC 3KWQA 3WTPC 1Q9CA 4YM6C 3LELD 3X1UA 5B31C 5CPJC 1A7WA 4Z66D 4NE5A 3MGRB 3REIC 1M18A 5B0ZB 3KSYA 3REHA 3B0DB 4CAYA 4G91B 3X1SB 3LELA 4ZUXC 2AROB 4QLCC 1HQ3B 4Z66A 3UTAB 5B0ZD 4J8UB 3X1SD 2AROD 4WU8C 1HQ3D 2HIOB 3MGRA 5B33B 5B0ZA 5B2IC 3TU4B 5E5AC 3RELC 3UTAD 3AN2C 3B6GC 4J8UD 2AROA 1HQ3A 1P34B 3C1BC 4J8WB 2HIOD 5DNNC 5B33D 3REKC 3AYWC 5AV9B 3TU4D 3AZKC 2F2AC 2J8PA 3LZ0C 3O62B 2HIOA 4H9SC 3AFAB 1HTAA 4J8XB 2CV5C 4X23C 5AV9D 2F8NG 1KX4D 1P34A 1F1EA 4J8WA 1ID3A 3WAAB 3AFAD 1P3MB 4J8XD 3EPKA 2JCHA 4JJNA 2PYOB 5AV8C 3MGPC 3O62A 5GXQC 3AFAA 2HUEB 1AOIC 3WAAD 5BNXB 1P3MD 2YFVB 2PYOD 4DRAA 4Z5TA 4E44A 2NQBB 3WAAA 3NQJA 1P3MA 4UPKA 4E45A 2PYOA 3EPLA 5AV5A 1U35C 3KWQC 3WKJB 2BG1A 3B6FD 2NZDD 3AZLA 5G49A 3AZMC 5B31G 2UWXA 4AWLC 2NQBD 5B24C 3AZHB 3UTBB 3MGQB 3LJAA 2YFVA 3REHC 1P3BC 2LY8A 3WKJD 3AZGB 2JSSA 2G5HC 1S32C 5F99A 3AV1A 4ZBJC 3AZHD 3UTBD 3X1VB 3MGQD 1P3PB 3R45A 4R8PB 1WWSA 3AZGD 1P3AB 3MNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0C W;  3AV2 B;  3UTB A;  4KUD B;  3VH6 W;  1P3O B;  4XZQ C;  3X1V D;  1KU5 A;  1P3P D;  3WA9 C;  1KX3 B;  1ZLA B;  4G92 C;  5B0Y B;  5B2J C;  1P3A D;  3MNN D;  3AV2 D;  1P3P A;  1M1A A;  4KUD D;  1WWI A;  1P3O D;  4R8P A;  4YS3 C;  1KX3 D;  1P3A A;  1ZLA D;  3A6N B;  3AV2 A;  5B0Y D;  2BYK B;  2IO5 B;  3W96 C;  5B32 D;  4KUD A;  1BFM A;  5CP6 B;  1N1J B;  5AV6 B;  1P34 C;  1ZLA A;  4J8W C;  1ID3 C;  5B0Y A;  3AZF C;  3UT9 B;  4JJN C;  3MVD C;  3MGS C;  3B0C T;  5CP6 D;  3AZJ A;  4LD9 C;  5AV6 D;  4H9N A;  3W97 B;  3A6N A;  2F8N K;  2BYK A;  1EQZ C;  3AZN B;  3REJ A;  5CP6 A;  5B1M C;  1N1J A;  4Z5T C;  3W97 D;  3UT9 A;  5CPK C;  4EO5 B;  3W98 A;  5AV5 C;  3W99 B;  4KGC B;  3AZL C;  3W97 A;  3AZN A;  5AY8 C;  4XUJ C;  3LJA C;  3C1C B;  3W99 D;  4KGC D;  3KUY B;  5F99 C;  3AV1 C;  5GT3 B;  5AVC C;  3AZE D;  4KGC A;  3C1C D;  3X1S A;  5BS7 C;  3KUY D;  3VH6 A;  5GT3 D;  4WZS B;  2FJ7 B;  5GT0 B;  3KUY A;  3UTA A;  4J8U A;  4J8V B;  5GT3 A;  5B1L C;  1P3G C;  1KX4 B;  1M1A C;  3KXB B;  5DNM B;  1M19 C;  3VH5 W;  2FJ7 D;  4R8P C;  1P3F B;  3X1T B;  5GSU B;  5B33 A;  4WU9 B;  4HGA C;  5B40 B;  3TU4 A;  5GT0 D;  3LZ1 C;  4J8V D;  1P3L B;  2FJ7 A;  1P3I C;  2F8N B;  3KXB D;  5DNM D;  1P3F D;  3X1T D;  5JA4 B;  5GT0 A;  5GSU D;  3NQU B;  4WU9 D;  5B40 D;  5AV9 A;  4J8V A;  1ULY A;  1KX4 A;  5BNV B;  3AZI C;  5AVB D;  1P3L D;  5DNM A;  4M6B A;  3AZJ C;  1P3F A;  4J8X A;  5GSU A;  2F8N D;  4WU9 A;  5B40 A;  3A6N C;  5BT1 C;  5FUG B;  1KX5 B;  1P3L A;  1F66 C;  3REJ C;  3B6F B;  2NZD B;  1TZY D;  5JRG D;  2RVQ D;  5JA4 A;  3NQU A;  5BNV A;  5CPI C;  1KX5 D;  3W98 C;  4CSR B;  3X1U C;  1P3K B;  3WTP B;  4YM6 B;  5CPJ B;  5BNX A;  5B31 B;  5FUG A;  1M18 C;  1KX5 A;  3AZN C;  3LEL C;  3B6F A;  1R4V A;  2NZD A;  2NQB A;  4Z66 C;  5CPK D;  1P3K D;  4ZUX B;  4QLC B;  3WTP D;  4YM6 D;  5CPJ D;  5B31 D;  3WKJ A;  4CSR A;  3REI D;  1P3K A;  3B0B A;  3WTP A;  2L5A A;  4YM6 A;  3MGR C;  5B31 A;  5CPJ A;  4ZUX D;  3MGQ A;  5B0Z C;  4QLC D;  4WU8 B;  3B0D C;  4G91 C;  3X1S C;  2ARO C;  5B2I B;  3AZG A;  1B6W A;  1HQ3 C;  5E5A B;  4H9Q B;  3REL B;  3AN2 B;  3B6G B;  4ZUX A;  5CHL B;  5B32 B;  3C1B B;  3UTA C;  3X1V A;  3AZH A;  4WU8 D;  1BH9 B;  4J8U C;  5DNN B;  5B2I D;  3VH5 A;  3AZK B;  2HIO C;  4UUZ B;  5E5A D;  3LZ0 B;  3MNN A;  3REL D;  3AN2 D;  3B6G D;  5B33 C;  4WU8 A;  3TU4 C;  1P3O A;  3C1B D;  5B2I A;  5E5A A;  3REL A;  4H9Q A;  5DNN D;  4X23 B;  3REK D;  3AYW D;  3AN2 A;  1KX3 A;  3B6G A;  3AZK D;  5B32 A;  3LZ0 D;  3C1B A;  2F8N H;  5AV9 C;  1KX4 C;  5DNN A;  3VH6 T;  3O62 C;  3AZK A;  4UUZ A;  3AFA C;  5AV8 B;  4X23 D;  3LZ0 A;  3MGP B;  2CV5 D;  4J8X C;  4KHA B;  1AOI B;  5AV6 A;  4X23 A;  3WAA C;  5AV8 D;  3MGP D;  1P3M C;  2PYO C;  5GXQ D;  1AOI D;  5AV8 A;  2HUE C;  1U35 B;  3AZE B;  3AZM B;  1AOI A;  4AWL B;  5B24 B;  3B6F C;  2NZD C;  2NQB C;  3REH B;  1P3B B;  1U35 D;  3KWQ D;  3AZM D;  1S32 B;  3W99 A;  3WKJ C;  4ZBJ B;  5B24 D;  1U35 A;  3REH D;  4H9R B;  3WTP E;  1P3B D;  3AZH C;  3AZE A;  3UTB C;  3MGQ C;  3AZM A;  3C1C A;  5B24 A;  1S32 D;  3AZG C;  1P3B A;  1JFI B;  4XZQ B;  3WA9 B;  4G92 B;  3X1V C;  1P3P C;  5B2J B;  1S32 A;  3MGR D;  4H9R A;  4XZQ D;  1P3A C;  3MNN C;  3AV2 C;  3WA9 D;  4YS3 B;  2CWE A;  4KUD C;  1P3O C;  5AVB B;  5B2J D;  3W96 B;  1KX3 C;  4XZQ A;  1JFI A;  1ZLA C;  3WA9 A;  5B0Y C;  5B32 C;  1ID3 B;  4YS3 D;  1TZY B;  5B2J A;  5JRG B;  3KXB A;  3AZF B;  5C3I B;  3X1T A;  4JJN B;  3W96 D;  3MVD B;  3MGS B;  4LD9 B;  4YS3 A;  2IO5 C;  4WV4 B;  1P34 D;  5AVB A;  4J8W D;  1ID3 D;  5CP6 C;  2F8N A;  1EQZ B;  3W96 A;  3AZF D;  5AV6 C;  5B1M B;  4JJN D;  4Z2M G;  3MVD D;  3MGS D;  3VH5 T;  4Z5T B;  3UT9 C;  4LD9 D;  1TZY A;  3O62 D;  3NQJ B;  4NE3 A;  5JRG A;  3AZF A;  5CPK B;  1EQZ D;  3MVD A;  3MGS A;  1TAF B;  3W97 C;  5B1M D;  5AV5 B;  4LD9 A;  3AZL B;  5G49 B;  4Z5T D;  3REI B;  1EQZ A;  5AY8 B;  5B1M A;  4XUJ B;  3LJA B;  5KDM B;  5AV5 D;  4EO5 C;  3AZL D;  5CPK A;  3W99 C;  5F99 B;  3AV1 B;  1TAF A;  5AY8 D;  5AVC B;  4KGC C;  4XUJ D;  3LJA D;  3R45 B;  1H3O B;  1BH8 B;  3AZE C;  3REI A;  3C1C C;  5AY8 A;  4H9P B;  4XUJ A;  5F99 D;  5KDM A;  3AV1 D;  4QLC A;  5AVC D;  3KUY C;  4DRB A;  5GT3 C;  4H9O B;  3REK B;  3AYW B;  5AVC A;  5B1L B;  1P3G B;  1M1A B;  1H3O A;  1M19 B;  1BH8 A;  3V9R B;  2YFW B;  4HGA B;  4H9P A;  5BS7 A;  2CV5 B;  3LZ1 B;  2FJ7 C;  5B1L D;  1P3G D;  2BYM B;  5GT0 C;  1P3I B;  1M1A D;  1BH9 A;  1M19 D;  4J8V C;  4H9O A;  5B32 G;  4R8P D;  3REK A;  3AYW A;  3KXB C;  5DNM C;  5B1L A;  1P3G A;  3LZ1 D;  1P3F C;  3X1T C;  5GSU C;  3AZI B;  4WU9 C;  4H9S A;  5B40 C;  5GXQ B;  1M19 A;  3AZJ B;  1P3I D;  3V9R A;  2YFW A;  1P3L C;  4H9N B;  5AVB C;  2CV5 A;  3LZ1 A;  1F66 B;  1B67 A;  3REJ B;  2BYM A;  4WNN B;  1P3I A;  3AZI D;  3AZJ D;  1TZY C;  5JRG C;  4Z2M H;  5BO0 B;  5BT1 D;  3A6N D;  5C3I C;  3MGP A;  2RVQ C;  5CPI B;  3AZI A;  3KWQ B;  1F66 D;  3REJ D;  3W98 B;  5GXQ A;  4KHA A;  3X1U B;  1KX5 C;  4NE6 A;  1M18 B;  1F66 A;  4CAY B;  3LEL B;  3UT9 D;  4WNN A;  5CPI D;  3W98 D;  4Z66 B;  3X1U D;  5BO0 A;  4NFT A;  1M18 D;  5CPI A;  3AZN D;  1P3K C;  3KWQ A;  3WTP C;  1Q9C A;  4YM6 C;  3LEL D;  3X1U A;  5B31 C;  5CPJ C;  1A7W A;  4Z66 D;  4NE5 A;  3MGR B;  3REI C;  1M18 A;  5B0Z B;  3KSY A;  3REH A;  3B0D B;  4CAY A;  4G91 B;  3X1S B;  3LEL A;  4ZUX C;  2ARO B;  4QLC C;  1HQ3 B;  4Z66 A;  3UTA B;  5B0Z D;  4J8U B;  3X1S D;  2ARO D;  4WU8 C;  1HQ3 D;  2HIO B;  3MGR A;  5B33 B;  5B0Z A;  5B2I C;  3TU4 B;  5E5A C;  3REL C;  3UTA D;  3AN2 C;  3B6G C;  4J8U D;  2ARO A;  1HQ3 A;  1P34 B;  3C1B C;  4J8W B;  2HIO D;  5DNN C;  5B33 D;  3REK C;  3AYW C;  5AV9 B;  3TU4 D;  3AZK C;  3LZ0 C;  3O62 B;  2HIO A;  4H9S C;  3AFA B;  1HTA A;  4J8X B;  2CV5 C;  4X23 C;  5AV9 D;  2F8N G;  1KX4 D;  1P34 A;  1F1E A;  4J8W A;  1ID3 A;  3WAA B;  3AFA D;  1P3M B;  4J8X D;  4JJN A;  2PYO B;  5AV8 C;  3MGP C;  3O62 A;  5GXQ C;  3AFA A;  2HUE B;  1AOI C;  3WAA D;  5BNX B;  1P3M D;  2YFV B;  2PYO D;  4DRA A;  4Z5T A;  4E44 A;  2NQB B;  3WAA A;  3NQJ A;  1P3M A;  4E45 A;  2PYO A;  5AV5 A;  1U35 C;  3KWQ C;  3WKJ B;  3B6F D;  2NZD D;  3AZL A;  5G49 A;  3AZM C;  5B31 G;  4AWL C;  2NQB D;  5B24 C;  3AZH B;  3UTB B;  3MGQ B;  3LJA A;  2YFV A;  3REH C;  1P3B C;  2LY8 A;  3WKJ D;  3AZG B;  2JSS A;  1S32 C;  5F99 A;  3AV1 A;  4ZBJ C;  3AZH D;  3UTB D;  3X1V B;  3MGQ D;  1P3P B;  3R45 A;  4R8P B;  1WWS A;  3AZG D;  1P3A B;  3MNN B; 
#chains in the Genus database with same CATH topology
 3B0C W;  3AV2 B;  3UTB A;  4KUD B;  3VH6 W;  1P3O B;  4XZQ C;  3X1V D;  3A1K A;  1KU5 A;  1P3P D;  3WA9 C;  1KX3 B;  2Y2H A;  1ZLA B;  4G92 C;  5B0Y B;  5B2J C;  1Z2C B;  1P3A D;  3MNN D;  3AV2 D;  1P3P A;  1M1A A;  4KUD D;  1WWI A;  1P3O D;  4R8P A;  2ZY3 A;  4YS3 C;  1KX3 D;  1P3A A;  1ZLA D;  3A6N B;  3AV2 A;  5B0Y D;  2BYK B;  3P5J B;  2IO5 B;  3W96 C;  5B32 D;  2Y2M A;  4KUD A;  1BFM A;  5CP6 B;  1N1J B;  5AV6 B;  1P34 C;  1ZLA A;  4J8W C;  1ID3 C;  5B0Y A;  2ZY5 A;  3AZF C;  3UT9 B;  4JJN C;  3MVD C;  2VQR A;  3B0C T;  3MGS C;  5CP6 D;  3AZJ A;  4LD9 C;  5AV6 D;  4H9N A;  3W97 B;  1T3U A;  3A6N A;  2RIQ A;  2F8N K;  2BYK A;  1EQZ C;  3AZN B;  3REJ A;  5CP6 A;  5B1M C;  1N1J A;  2XD1 A;  4Z5T C;  3W97 D;  3UT9 A;  5CPK C;  4EO5 B;  3W98 A;  5AV5 C;  3W99 B;  4KGC B;  3EPJ A;  3AZL C;  3W97 A;  2DF4 C;  3AZN A;  5AY8 C;  4DQY B;  4XUJ C;  3LJA C;  3C1C B;  2W8S A;  3W99 D;  4KGC D;  3KUY B;  5F99 C;  3AV1 C;  5GT3 B;  5AVC C;  3AZE D;  4KGC A;  3C1C D;  3A1I A;  3X1S A;  5BS7 C;  3KUY D;  3VH6 A;  5GT3 D;  4WZS B;  2FJ7 B;  5GT0 B;  3KUY A;  3UTA A;  4J8U A;  4J8V B;  5GT3 A;  5B1L C;  1P3G C;  1KX4 B;  1M1A C;  3KXB B;  5DNM B;  1M19 C;  3VH5 W;  2FJ7 D;  4R8P C;  1P3F B;  3X1T B;  5GSU B;  5B33 A;  4WU9 B;  4HGA C;  5B40 B;  3TU4 A;  5GT0 D;  3LZ1 C;  4J8V D;  1P3L B;  2FJ7 A;  1P3I C;  2F8N B;  3KXB D;  5DNM D;  1P3F D;  5JA4 B;  5GT0 A;  5GSU D;  3X1T D;  3NQU B;  4WU9 D;  5B40 D;  5AV9 A;  4J8V A;  1ULY A;  1KX4 A;  5BNV B;  3AZI C;  5AVB D;  1P3L D;  5DNM A;  4M6B A;  3AZJ C;  1P3F A;  4J8X A;  5GSU A;  2F8N D;  4WU9 A;  5B40 A;  3A6N C;  5BT1 C;  5FUG B;  1KX5 B;  1P3L A;  1F66 C;  3REJ C;  3B6F B;  2NZD B;  1TZY D;  5JRG D;  2RVQ D;  5JA4 A;  3NQU A;  5BNV A;  5CPI C;  1KX5 D;  3W98 C;  4CSR B;  3X1U C;  1P3K B;  3WTP B;  4YM6 B;  5CPJ B;  5BNX A;  5B31 B;  5FUG A;  1M18 C;  1KX5 A;  3AZN C;  3LEL C;  3B6F A;  1R4V A;  2NZD A;  2NQB A;  4Z66 C;  5CPK D;  2Y2Q A;  1P3K D;  4ZUX B;  4QLC B;  3WTP D;  4YM6 D;  5CPJ D;  5B31 D;  3WKJ A;  4CSR A;  3REI D;  1P3K A;  2Y2P A;  3B0B A;  3WTP A;  2L5A A;  4YM6 A;  3MGR C;  5B31 A;  5CPJ A;  4ZUX D;  3MGQ A;  5B0Z C;  4QLC D;  4WU8 B;  3KFU G;  3B0D C;  4G91 C;  3X1S C;  2ARO C;  5B2I B;  3AZG A;  1B6W A;  1HQ3 C;  5E5A B;  4H9Q B;  3REL B;  2G5I C;  3AN2 B;  3B6G B;  4ZUX A;  5CHL B;  5B32 B;  3C1B B;  3UTA C;  3X1V A;  3AZH A;  4WU8 D;  1BH9 B;  4J8U C;  5DNN B;  5B2I D;  3VH5 A;  3AZK B;  2HIO C;  2Y2J A;  4UUZ B;  5E5A D;  3MNN A;  3LZ0 B;  3REL D;  3AN2 D;  3B6G D;  5B33 C;  2Y2O A;  4WU8 A;  3TU4 C;  1P3O A;  3C1B D;  5B2I A;  5E5A A;  3REL A;  4H9Q A;  5DNN D;  4X23 B;  3REK D;  3AYW D;  3AN2 A;  1KX3 A;  3B6G A;  3AZK D;  5B32 A;  3LZ0 D;  2JE5 A;  3C1B A;  2F8N H;  3FDD A;  3H0R C;  5AV9 C;  1KX4 C;  5DNN A;  2ZY4 A;  3VH6 T;  3O62 C;  3AZK A;  4UUZ A;  3AFA C;  2Y2I A;  5AV8 B;  4X23 D;  3LZ0 A;  3MGP B;  4J8X C;  2CV5 D;  4KHA B;  1AOI B;  3IP4 C;  1W2E A;  5AV6 A;  4X23 A;  3WAA C;  5AV8 D;  3MGP D;  1P3M C;  2PYO C;  5GXQ D;  1AOI D;  2Y2L A;  5AV8 A;  2HUE C;  1U35 B;  3AZE B;  3AZM B;  1AOI A;  4AWL B;  5B24 B;  3B6F C;  2NZD C;  2NQB C;  3REH B;  1P3B B;  1U35 D;  3KWQ D;  3AZM D;  2XD5 A;  1S32 B;  3W99 A;  3WKJ C;  4ZBJ B;  5B24 D;  1U35 A;  3REH D;  4H9R B;  3WTP E;  1P3B D;  3AZH C;  3AZE A;  3UTB C;  3MGQ C;  3AZM A;  2Y2N A;  3C1C A;  5B24 A;  1S32 D;  3AZG C;  1P3B A;  1JFI B;  4XZQ B;  3WA9 B;  2ZY2 A;  4G92 B;  3X1V C;  1P3P C;  5B2J B;  1S32 A;  3MGR D;  4H9R A;  4XZQ D;  1P3A C;  3MNN C;  3AV2 C;  3WA9 D;  4YS3 B;  2CWE A;  4KUD C;  1P3O C;  5AVB B;  5B2J D;  3W96 B;  1KX3 C;  4XZQ A;  1JFI A;  1ZLA C;  3WA9 A;  5B0Y C;  5B32 C;  2Y2K A;  1ID3 B;  4YS3 D;  1TZY B;  5B2J A;  5JRG B;  3KXB A;  3AZF B;  5C3I B;  3X1T A;  4JJN B;  3W96 D;  3MVD B;  3MGS B;  4LD9 B;  4YS3 A;  2IO5 C;  4WV4 B;  1P34 D;  5AVB A;  4J8W D;  1ID3 D;  5CP6 C;  2F8N A;  1EQZ B;  3W96 A;  3AZF D;  5AV6 C;  5B1M B;  4JJN D;  4Z2M G;  3MVD D;  3MGS D;  3VH5 T;  4Z5T B;  3UT9 C;  4LD9 D;  1TZY A;  3O62 D;  3NQJ B;  4NE3 A;  5JRG A;  3AZF A;  5CPK B;  1EQZ D;  3MVD A;  3MGS A;  1TAF B;  3H0L C;  3F6T A;  3W97 C;  5B1M D;  5AV5 B;  4LD9 A;  3AZL B;  5G49 B;  4Z5T D;  3REI B;  1EQZ A;  5AY8 B;  5B1M A;  2FFF B;  4XUJ B;  3LJA B;  5KDM B;  5AV5 D;  4EO5 C;  3AZL D;  2Y2G A;  5CPK A;  3W99 C;  5F99 B;  3AV1 B;  1TAF A;  5AY8 D;  5AVC B;  4KGC C;  4XUJ D;  3LJA D;  3R45 B;  1H3O B;  1BH8 B;  3AZE C;  3REI A;  3C1C C;  5AY8 A;  4H9P B;  4XUJ A;  5F99 D;  5KDM A;  3AV1 D;  4QLC A;  5AVC D;  4WJ3 C;  3KUY C;  4DRB A;  5GT3 C;  4H9O B;  3REK B;  3AYW B;  3H0M C;  1PZR A;  5AVC A;  5B1L B;  1P3G B;  1M1A B;  1H3O A;  1M19 B;  1BH8 A;  3V9R B;  2YFW B;  4HGA B;  4H9P A;  5BS7 A;  2CV5 B;  3LZ1 B;  2DQN C;  2FJ7 C;  5B1L D;  1P3G D;  2BYM B;  5GT0 C;  1P3I B;  1M1A D;  1BH9 A;  1M19 D;  4J8V C;  4H9O A;  5B32 G;  4R8P D;  3REK A;  3AYW A;  3KXB C;  5DNM C;  5B1L A;  1P3G A;  3LZ1 D;  1P3F C;  3X1T C;  5GSU C;  3AZI B;  4WU9 C;  4H9S A;  5B40 C;  5GXQ B;  1M19 A;  3EPH A;  3AZJ B;  1P3I D;  3V9R A;  2ZM5 A;  2YFW A;  1P3L C;  4H9N B;  5AVB C;  2CV5 A;  3LZ1 A;  1F66 B;  1B67 A;  3REJ B;  2BYM A;  4WNN B;  1P3I A;  3AZI D;  3AZJ D;  1TZY C;  5JRG C;  4Z2M H;  5BO0 B;  5BT1 D;  3A6N D;  5C3I C;  3MGP A;  3EG5 B;  2RVQ C;  5CPI B;  3AZI A;  3KWQ B;  1F66 D;  3REJ D;  3W98 B;  5GXQ A;  4KHA A;  3X1U B;  1KX5 C;  4NE6 A;  1M18 B;  1F66 A;  4CAY B;  3LEL B;  3UT9 D;  4WNN A;  5CPI D;  3W98 D;  4Z66 B;  3X1U D;  3AL0 C;  5BO0 A;  4NFT A;  1M18 D;  5CPI A;  3AZN D;  1P3K C;  3KWQ A;  3WTP C;  1Q9C A;  4YM6 C;  3LEL D;  3X1U A;  5B31 C;  5CPJ C;  1A7W A;  4Z66 D;  4NE5 A;  3MGR B;  3REI C;  1M18 A;  5B0Z B;  3KSY A;  3REH A;  3B0D B;  4CAY A;  4G91 B;  3X1S B;  3LEL A;  4ZUX C;  2ARO B;  4QLC C;  1HQ3 B;  4Z66 A;  3UTA B;  5B0Z D;  4J8U B;  3X1S D;  2ARO D;  4WU8 C;  1HQ3 D;  2HIO B;  3MGR A;  5B33 B;  5B0Z A;  5B2I C;  3TU4 B;  5E5A C;  3REL C;  3UTA D;  3AN2 C;  3B6G C;  4J8U D;  2ARO A;  1HQ3 A;  1P34 B;  3C1B C;  4J8W B;  2HIO D;  5DNN C;  5B33 D;  3REK C;  3AYW C;  5AV9 B;  3TU4 D;  3AZK C;  2F2A C;  2J8P A;  3LZ0 C;  3O62 B;  2HIO A;  4H9S C;  3AFA B;  1HTA A;  4J8X B;  2CV5 C;  4X23 C;  5AV9 D;  2F8N G;  1KX4 D;  1P34 A;  1F1E A;  4J8W A;  1ID3 A;  3WAA B;  3AFA D;  1P3M B;  4J8X D;  3EPK A;  2JCH A;  4JJN A;  2PYO B;  5AV8 C;  3MGP C;  3O62 A;  5GXQ C;  3AFA A;  2HUE B;  1AOI C;  3WAA D;  5BNX B;  1P3M D;  2YFV B;  2PYO D;  4DRA A;  4Z5T A;  4E44 A;  2NQB B;  3WAA A;  3NQJ A;  1P3M A;  4UPK A;  4E45 A;  2PYO A;  3EPL A;  5AV5 A;  1U35 C;  3KWQ C;  3WKJ B;  2BG1 A;  3B6F D;  2NZD D;  3AZL A;  5G49 A;  3AZM C;  5B31 G;  2UWX A;  4AWL C;  2NQB D;  5B24 C;  3AZH B;  3UTB B;  3MGQ B;  3LJA A;  2YFV A;  3REH C;  1P3B C;  2LY8 A;  3WKJ D;  3AZG B;  2JSS A;  2G5H C;  1S32 C;  5F99 A;  3AV1 A;  4ZBJ C;  3AZH D;  3UTB D;  3X1V B;  3MGQ D;  1P3P B;  3R45 A;  4R8P B;  1WWS A;  3AZG D;  1P3A B;  3MNN B; 
#chains in the Genus database with same CATH homology
 3B0C W;  3AV2 B;  3UTB A;  4KUD B;  3VH6 W;  1P3O B;  4XZQ C;  3X1V D;  3A1K A;  1KU5 A;  1P3P D;  3WA9 C;  1KX3 B;  2Y2H A;  1ZLA B;  4G92 C;  5B0Y B;  5B2J C;  1Z2C B;  1P3A D;  3MNN D;  3AV2 D;  1P3P A;  1M1A A;  4KUD D;  1WWI A;  1P3O D;  4R8P A;  2ZY3 A;  4YS3 C;  1KX3 D;  1P3A A;  1ZLA D;  3A6N B;  3AV2 A;  5B0Y D;  2BYK B;  3P5J B;  2IO5 B;  3W96 C;  5B32 D;  2Y2M A;  4KUD A;  1BFM A;  5CP6 B;  1N1J B;  5AV6 B;  1P34 C;  1ZLA A;  4J8W C;  1ID3 C;  5B0Y A;  2ZY5 A;  3AZF C;  3UT9 B;  4JJN C;  3MVD C;  2VQR A;  3B0C T;  3MGS C;  5CP6 D;  3AZJ A;  4LD9 C;  5AV6 D;  4H9N A;  3W97 B;  1T3U A;  3A6N A;  2RIQ A;  2F8N K;  2BYK A;  1EQZ C;  3AZN B;  3REJ A;  5CP6 A;  5B1M C;  1N1J A;  2XD1 A;  4Z5T C;  3W97 D;  3UT9 A;  5CPK C;  4EO5 B;  3W98 A;  5AV5 C;  3W99 B;  4KGC B;  3EPJ A;  3AZL C;  3W97 A;  2DF4 C;  3AZN A;  5AY8 C;  4DQY B;  4XUJ C;  3LJA C;  3C1C B;  2W8S A;  3W99 D;  4KGC D;  3KUY B;  5F99 C;  3AV1 C;  5GT3 B;  5AVC C;  3AZE D;  4KGC A;  3C1C D;  3A1I A;  3X1S A;  5BS7 C;  3KUY D;  3VH6 A;  5GT3 D;  4WZS B;  2FJ7 B;  5GT0 B;  3KUY A;  3UTA A;  4J8U A;  4J8V B;  5GT3 A;  5B1L C;  1P3G C;  1KX4 B;  1M1A C;  3KXB B;  5DNM B;  1M19 C;  3VH5 W;  2FJ7 D;  4R8P C;  1P3F B;  3X1T B;  5GSU B;  5B33 A;  4WU9 B;  4HGA C;  5B40 B;  3TU4 A;  5GT0 D;  3LZ1 C;  4J8V D;  1P3L B;  2FJ7 A;  1P3I C;  2F8N B;  3KXB D;  5DNM D;  1P3F D;  5JA4 B;  5GT0 A;  5GSU D;  3X1T D;  3NQU B;  4WU9 D;  5B40 D;  5AV9 A;  4J8V A;  1ULY A;  1KX4 A;  5BNV B;  3AZI C;  5AVB D;  1P3L D;  5DNM A;  4M6B A;  3AZJ C;  1P3F A;  4J8X A;  5GSU A;  2F8N D;  4WU9 A;  5B40 A;  3A6N C;  5BT1 C;  5FUG B;  1KX5 B;  1P3L A;  1F66 C;  3REJ C;  3B6F B;  2NZD B;  1TZY D;  5JRG D;  2RVQ D;  5JA4 A;  3NQU A;  5BNV A;  5CPI C;  1KX5 D;  3W98 C;  4CSR B;  3X1U C;  1P3K B;  3WTP B;  4YM6 B;  5CPJ B;  5BNX A;  5B31 B;  5FUG A;  1M18 C;  1KX5 A;  3AZN C;  3LEL C;  3B6F A;  1R4V A;  2NZD A;  2NQB A;  4Z66 C;  5CPK D;  2Y2Q A;  1P3K D;  4ZUX B;  4QLC B;  3WTP D;  4YM6 D;  5CPJ D;  5B31 D;  3WKJ A;  4CSR A;  3REI D;  1P3K A;  2Y2P A;  3B0B A;  3WTP A;  2L5A A;  4YM6 A;  3MGR C;  5B31 A;  5CPJ A;  4ZUX D;  3MGQ A;  5B0Z C;  4QLC D;  4WU8 B;  3KFU G;  3B0D C;  4G91 C;  3X1S C;  2ARO C;  5B2I B;  3AZG A;  1B6W A;  1HQ3 C;  5E5A B;  4H9Q B;  3REL B;  2G5I C;  3AN2 B;  3B6G B;  4ZUX A;  5CHL B;  5B32 B;  3C1B B;  3UTA C;  3X1V A;  3AZH A;  4WU8 D;  1BH9 B;  4J8U C;  5DNN B;  5B2I D;  3VH5 A;  3AZK B;  2HIO C;  2Y2J A;  4UUZ B;  5E5A D;  3MNN A;  3LZ0 B;  3REL D;  3AN2 D;  3B6G D;  5B33 C;  2Y2O A;  4WU8 A;  3TU4 C;  1P3O A;  3C1B D;  5B2I A;  5E5A A;  3REL A;  4H9Q A;  5DNN D;  4X23 B;  3REK D;  3AYW D;  3AN2 A;  1KX3 A;  3B6G A;  3AZK D;  5B32 A;  3LZ0 D;  2JE5 A;  3C1B A;  2F8N H;  3FDD A;  3H0R C;  5AV9 C;  1KX4 C;  5DNN A;  2ZY4 A;  3VH6 T;  3O62 C;  3AZK A;  4UUZ A;  3AFA C;  2Y2I A;  5AV8 B;  4X23 D;  3LZ0 A;  3MGP B;  4J8X C;  2CV5 D;  4KHA B;  1AOI B;  3IP4 C;  1W2E A;  5AV6 A;  4X23 A;  3WAA C;  5AV8 D;  3MGP D;  1P3M C;  2PYO C;  5GXQ D;  1AOI D;  2Y2L A;  5AV8 A;  2HUE C;  1U35 B;  3AZE B;  3AZM B;  1AOI A;  4AWL B;  5B24 B;  3B6F C;  2NZD C;  2NQB C;  3REH B;  1P3B B;  1U35 D;  3KWQ D;  3AZM D;  2XD5 A;  1S32 B;  3W99 A;  3WKJ C;  4ZBJ B;  5B24 D;  1U35 A;  3REH D;  4H9R B;  3WTP E;  1P3B D;  3AZH C;  3AZE A;  3UTB C;  3MGQ C;  3AZM A;  2Y2N A;  3C1C A;  5B24 A;  1S32 D;  3AZG C;  1P3B A;  1JFI B;  4XZQ B;  3WA9 B;  2ZY2 A;  4G92 B;  3X1V C;  1P3P C;  5B2J B;  1S32 A;  3MGR D;  4H9R A;  4XZQ D;  1P3A C;  3MNN C;  3AV2 C;  3WA9 D;  4YS3 B;  2CWE A;  4KUD C;  1P3O C;  5AVB B;  5B2J D;  3W96 B;  1KX3 C;  4XZQ A;  1JFI A;  1ZLA C;  3WA9 A;  5B0Y C;  5B32 C;  2Y2K A;  1ID3 B;  4YS3 D;  1TZY B;  5B2J A;  5JRG B;  3KXB A;  3AZF B;  5C3I B;  3X1T A;  4JJN B;  3W96 D;  3MVD B;  3MGS B;  4LD9 B;  4YS3 A;  2IO5 C;  4WV4 B;  1P34 D;  5AVB A;  4J8W D;  1ID3 D;  5CP6 C;  2F8N A;  1EQZ B;  3W96 A;  3AZF D;  5AV6 C;  5B1M B;  4JJN D;  4Z2M G;  3MVD D;  3MGS D;  3VH5 T;  4Z5T B;  3UT9 C;  4LD9 D;  1TZY A;  3O62 D;  3NQJ B;  4NE3 A;  5JRG A;  3AZF A;  5CPK B;  1EQZ D;  3MVD A;  3MGS A;  1TAF B;  3H0L C;  3F6T A;  3W97 C;  5B1M D;  5AV5 B;  4LD9 A;  3AZL B;  5G49 B;  4Z5T D;  3REI B;  1EQZ A;  5AY8 B;  5B1M A;  2FFF B;  4XUJ B;  3LJA B;  5KDM B;  5AV5 D;  4EO5 C;  3AZL D;  2Y2G A;  5CPK A;  3W99 C;  5F99 B;  3AV1 B;  1TAF A;  5AY8 D;  5AVC B;  4KGC C;  4XUJ D;  3LJA D;  3R45 B;  1H3O B;  1BH8 B;  3AZE C;  3REI A;  3C1C C;  5AY8 A;  4H9P B;  4XUJ A;  5F99 D;  5KDM A;  3AV1 D;  4QLC A;  5AVC D;  4WJ3 C;  3KUY C;  4DRB A;  5GT3 C;  4H9O B;  3REK B;  3AYW B;  3H0M C;  1PZR A;  5AVC A;  5B1L B;  1P3G B;  1M1A B;  1H3O A;  1M19 B;  1BH8 A;  3V9R B;  2YFW B;  4HGA B;  4H9P A;  5BS7 A;  2CV5 B;  3LZ1 B;  2DQN C;  2FJ7 C;  5B1L D;  1P3G D;  2BYM B;  5GT0 C;  1P3I B;  1M1A D;  1BH9 A;  1M19 D;  4J8V C;  4H9O A;  5B32 G;  4R8P D;  3REK A;  3AYW A;  3KXB C;  5DNM C;  5B1L A;  1P3G A;  3LZ1 D;  1P3F C;  3X1T C;  5GSU C;  3AZI B;  4WU9 C;  4H9S A;  5B40 C;  5GXQ B;  1M19 A;  3EPH A;  3AZJ B;  1P3I D;  3V9R A;  2ZM5 A;  2YFW A;  1P3L C;  4H9N B;  5AVB C;  2CV5 A;  3LZ1 A;  1F66 B;  1B67 A;  3REJ B;  2BYM A;  4WNN B;  1P3I A;  3AZI D;  3AZJ D;  1TZY C;  5JRG C;  4Z2M H;  5BO0 B;  5BT1 D;  3A6N D;  5C3I C;  3MGP A;  3EG5 B;  2RVQ C;  5CPI B;  3AZI A;  3KWQ B;  1F66 D;  3REJ D;  3W98 B;  5GXQ A;  4KHA A;  3X1U B;  1KX5 C;  4NE6 A;  1M18 B;  1F66 A;  4CAY B;  3LEL B;  3UT9 D;  4WNN A;  5CPI D;  3W98 D;  4Z66 B;  3X1U D;  3AL0 C;  5BO0 A;  4NFT A;  1M18 D;  5CPI A;  3AZN D;  1P3K C;  3KWQ A;  3WTP C;  1Q9C A;  4YM6 C;  3LEL D;  3X1U A;  5B31 C;  5CPJ C;  1A7W A;  4Z66 D;  4NE5 A;  3MGR B;  3REI C;  1M18 A;  5B0Z B;  3KSY A;  3REH A;  3B0D B;  4CAY A;  4G91 B;  3X1S B;  3LEL A;  4ZUX C;  2ARO B;  4QLC C;  1HQ3 B;  4Z66 A;  3UTA B;  5B0Z D;  4J8U B;  3X1S D;  2ARO D;  4WU8 C;  1HQ3 D;  2HIO B;  3MGR A;  5B33 B;  5B0Z A;  5B2I C;  3TU4 B;  5E5A C;  3REL C;  3UTA D;  3AN2 C;  3B6G C;  4J8U D;  2ARO A;  1HQ3 A;  1P34 B;  3C1B C;  4J8W B;  2HIO D;  5DNN C;  5B33 D;  3REK C;  3AYW C;  5AV9 B;  3TU4 D;  3AZK C;  2F2A C;  2J8P A;  3LZ0 C;  3O62 B;  2HIO A;  4H9S C;  3AFA B;  1HTA A;  4J8X B;  2CV5 C;  4X23 C;  5AV9 D;  2F8N G;  1KX4 D;  1P34 A;  1F1E A;  4J8W A;  1ID3 A;  3WAA B;  3AFA D;  1P3M B;  4J8X D;  3EPK A;  2JCH A;  4JJN A;  2PYO B;  5AV8 C;  3MGP C;  3O62 A;  5GXQ C;  3AFA A;  2HUE B;  1AOI C;  3WAA D;  5BNX B;  1P3M D;  2YFV B;  2PYO D;  4DRA A;  4Z5T A;  4E44 A;  2NQB B;  3WAA A;  3NQJ A;  1P3M A;  4UPK A;  4E45 A;  2PYO A;  3EPL A;  5AV5 A;  1U35 C;  3KWQ C;  3WKJ B;  2BG1 A;  3B6F D;  2NZD D;  3AZL A;  5G49 A;  3AZM C;  5B31 G;  2UWX A;  4AWL C;  2NQB D;  5B24 C;  3AZH B;  3UTB B;  3MGQ B;  3LJA A;  2YFV A;  3REH C;  1P3B C;  2LY8 A;  3WKJ D;  3AZG B;  2JSS A;  2G5H C;  1S32 C;  5F99 A;  3AV1 A;  4ZBJ C;  3AZH D;  3UTB D;  3X1V B;  3MGQ D;  1P3P B;  3R45 A;  4R8P B;  1WWS A;  3AZG D;  1P3A B;  3MNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...