5AV5D

Human nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 38
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5D00
3UTBB 5BS7C 2HUEC 5AY8D 4Z66B 3KXBD 5AV9D 1P3AC 2FJ7C 3W97D 3B6GB 3MGPA 5BO0B 2CV5B 3AZMD 3UTAC 1M1AA 4ZUXB 4H9RB 3O62B 4E45A 5B33A 1KX4D 5DNNA 5CPID 5JRGC 5B40C 3WTPB 5GXQD 3WKJA 3AZGD 3REIC 5DNNC 5GT3A 5B2IC 4J8WD 3MNNC 3WTPE 3X1SC 3B0CT 3W96D 3UT9C 1Q9CA 4Z5TB 1TAFA 3X1UD 3AZIC 3WAAA 5AV5C 5CPKC 1P34C 4NE3A 3X1SA 3V9RA 5E5AB 5GT3C 5B0YA 2HIOD 5B31A 5BS7A 5DNMA 5AV5B 4CAYA 3KWQC 4J8XD 3B0DC 1KU5A 5B31C 3LELB 3C1CD 3MGRB 3A6NA 3AZKD 3B0DB 5GT3B 4KGCA 1HQ3C 2F8ND 3AZEC 1M19A 3X1TB 1EQZA 3NQJA 3REHB 3AN2A 5FUGB 1EQZC 5B40A 5JRGA 5B24D 4YS3D 3X1TC 1JFIB 5C3IB 1HQ3B 4KUDC 2HUEB 4JJND 4WU8D 3LJAB 3AV2C 3AV2D 3LZ0B 4CSRA 3RELD 1P3BB 3AV1D 5GSUC 4WU9D 5B2ID 4J8WC 1TZYD 5CP6B 3WTPA 3AYWB 4X23B 1KX3D 2PYOD 4KUDB 5FUGA 5F99D 2BYMB 4YM6B 4YS3C 1KX4C 1P3AA 1AOIB 1KX5D 3AZMC 3W98C 3W98D 3MGSA 5CPJC 3W99B 4KHAB 3MGQD 1U35C 3TU4D 5B2JD 5B0ZB 4KUDA 3WKJD 4DRAA 3B6GA 3LELC 1P3KB 3MVDD 3X1SB 1BH8A 3WA9A 3KXBA 3UT9B 3LZ0A 3C1BD 3REIA 3X1UA 4XZQB 1ZLAB 5AVBA 4J8VB 4WU8C 5B0YD 3REHC 1P34A 1BFMA 4E44A 1P3FD 1U35D 3MNND 1M1AB 1R4VA 3B6FA 3KWQA 3NQJB 3LZ1A 3VH5W 1KX5C 5B32B 4R8PB 3AFAC 1P3IB 3LZ1C 3A6NB 3UTBA 5B0YC 3LELA 3UTAA 3AZHB 5AV8B 4Z66C 5AY8B 5AV6D 4CAYB 1F66C 5CP6A 1S32A 2FJ7B 2NQBD 3NQUA 5AY8A 2NZDD 5GT0D 5AV9A 4WNNB 4WU8A 3MVDC 1P3IC 3AZMB 3X1UC 3AZID 3REIB 3AV2A 3TU4C 3LJAC 5JA4A 5G49B 5BNXA 4WU9A 1P3OD 3WTPD 3AN2D 4NE6A 5CPKB 4H9PA 5B1MC 4J8WA 3R45A 4YS3A 1EQZB 3REKB 2F8NK 1KX5A 1P3PC 3KUYD 5BNVA 2YFVA 5AVCA 2CWEA 4G91C 3WAAD 1ID3B 3MGPD 3W98A 4XZQC 5B1MA 1ZLAC 5CPJB 2L5AA 3MGRC 1P3FC 4J8UB 5AVBB 4J8VA 1TZYC 2HIOA 4J8XB 3AV1A 4Z2MH 5DNMD 5B33D 5B0ZC 1P3BA 4X23C 4EO5C 5GT3D 1F66D 4QLCC 1P3BC 3REJC 3W97B 1P3GD 4NFTA 5B24C 3X1TD 1M19D 3A6NC 3AZJD 2CV5D 4R8PC 3AFAB 5B1LD 3AZGC 5JRGB 5B40B 1U35A 2AROB 3MNNA 5BT1D 5B24A 5BT1C 1HQ3D 5DNNB 4QLCB 3REHA 1B6WA 3WTPC 5B1LC 4JJNB 4J8WB 1P3PB 1H3OA 4Z2MG 5CPKA 3X1VD 3VH6T 4H9QA 3LZ0D 3C1BA 1WWSA 5F99C 1M18B 4KGCD 4H9NA 3AZEB 5BNXB 4WU9B 1P3GC 3RELA 2RVQD 3AYWD 4LD9B 4X23D 4J8VC 3AV1C 4AWLB 5F99B 1M18C 2HIOB 1KX3A 3AZFB 1P34D 3C1BC 2NQBA 5B31B 1F1EA 4ZBJB 5AVCC 3MGRD 3AZHA 3AZKB 4JJNA 1A7WA 4XUJD 2F8NB 3VH5T 1P3LB 4R8PA 3AZNC 3TU4A 4ZBJC 3LZ1B 5B2IA 1P3MB 2IO5C 1P3LC 3KWQB 4YM6C 4H9OA 4YS3B 1KX4B 3AZKC 2PYOC 3AZLB 5AV9C 3AZNA 1B67A 5GT0A 3REJB 3W97C 1P3AD 5BO0A 5AVCD 5GSUD 5KDMA 3AZIA 1S32B 1ZLAA 3MGSD 4Z5TC 3AV2B 3C1CB 3AV1B 5GT0C 3MGQA 2RVQC 4Z66D 3KXBB 5AV9B 2NQBC 5B2JA 2AROC 4KUDD 3B6GD 1P3KA 4ZUXC 3O62C 1AOID 1P3GA 5B24B 4HGAC 5B1MD 3UTBD 4H9SA 5AV8C 5GXQB 4G92C 3AZGB 5AV6B 3AN2C 3UTAD 2IO5B 5B2JB 3LJAD 3REHD 3VH6A 2NZDA 1P3BD 3X1UB 3B6FD 3X1VA 1F66A 4ZUXD 3O62D 3WA9B 1P3OB 5CHLB 5AV6C 5AV5D 3W96B 4J8UA 1HTAA 3LZ0C 3LELD 4Z5TD 1P3FB 3W99D 1ID3A 5AV6A 5B2IB 1P3MA 1TZYB 5CP6D 1M1AC 5B0ZA 3KUYA 2PYOB 5CPJD 4YM6D 4XUJA 4UUZA 3VH6W 4QLCA 4NE5A 4R8PD 2CV5C 2YFWB 3C1CC 3AYWA 5CPIB 1KX3C 5AY8C 1P3LA 5B32G 3KXBC 2FJ7D 3MGQB 2NQBB 3W99C 4WU9C 3W97A 3RELB 3AZFC 4J8UC 1BH9B 3WKJC 3REJA 3UT9D 5B1LA 1KX3B 1P3PA 4J8VD 5DNND 3MGQC 5GXQC 4G92B 3AN2B 1P3IA 4LD9A 3B6FC 1HQ3A 3KUYC 3AZGA 4H9NB 5B32D 3AZEA 1M18A 3B0BA 1P3MC 3W98B 1AOIA 3AZND 3AFAA 4G91B 5AV8D 4H9RA 3X1TA 3TU4B 4X23A 3AZJA 2CV5A 4H9SC 5E5AC 5B31D 5CP6C 1ULYA 4WV4B 2JSSA 5JA4B 4Z66A 3B6GC 2NZDC 3AZHD 4EO5B 1BH9A 4WNNA 4WU8B 5CPKD 5B0YB 3WKJB 3AZFA 5B33C 2BYKB 3AZJB 5DNMC 1EQZD 3REKD 3X1SD 5AVBC 1TAFB 4Z5TA 5E5AD 5JRGD 5B40D 1ID3D 5CPIC 3W99A 4XZQD 1ZLAD 3AZLD 2YFVB 5AVCB 1KX5B 3MGRA 4YM6A 5B33B 3A6ND 4ZUXA 3O62A 3AZJC 3AZKA 2AROA 3MNNB 3AZMA 2BYKA 1M1AD 4XUJC 3MGPB 1TZYA 2HIOC 5G49A 3REKC 3V9RB 4J8UD 2FJ7A 5F99A 4DRBA 2F8NG 1P3KD 3MVDB 2F8NH 3B0CW 3W96A 5B1LB 4JJNC 3AZLA 5B1MB 3W96C 5C3IC 5GSUA 5BNVB 5B31G 1H3OB 3UTAB 1P3PD 5GT0B 3WA9C 3X1VC 4UUZB 1M19B 1KX4A 1U35B 4H9PB 5CPIA 5B32A 3AZED 3KUYB 2YFWA 5GXQA 1N1JB 3WA9D 3UTBC 1ID3C 3AZLC 3KSYA 3R45B 1P3AB 5AVBD 2F8NA 5B32C 2BYMA 1AOIC 1WWIA 4HGAB 5AV5A 5DNMB 4J8XC 1M19C 3RELC 3VH5A 1P3FA 4LD9C 4M6BA 4LD9D 1F66B 3WAAB 3AZHC 4J8XA 4AWLC 3LJAA 2NZDB 5B0ZD 3C1CA 2LY8A 3MGSC 3AYWC 5CPJA 1BH8B 3LZ1D 3NQUB 4KHAA 3AFAD 5KDMB 3AZIB 3REID 4KGCC 1N1JA 1JFIA 5AV8A 4H9QB 3C1BB 1S32C 3REKA 3MGPC 3WAAC 4XUJB 4H9OB 1P3LD 2PYOA 1P3GB 1S32D 3MGSB 1P3MD 4WZSB 4KGCB 3B6FB 3KWQD 4CSRB 1P3OC 2AROD 3REJD 3UT9A 4QLCD 3AZFD 1P34B 1P3OA 5GSUB 1P3ID 1P3KC 3X1VB 5E5AA 1M18D 5B2JC 4XZQA 3AZNB 3MVDA
chains in the Genus database with same CATH superfamily
3H0MC 2JE5A 5BS7C 3UTBB 2HUEC 5AY8D 4Z66B 3KXBD 5AV9D 1P3AC 2FJ7C 3A1KA 3W97D 3B6GB 3MGPA 5BO0B 2Y2OA 2CV5B 3AZMD 3UTAC 1M1AA 4ZUXB 4H9RB 3O62B 4E45A 5B33A 1KX4D 5DNNA 5CPID 5JRGC 5B40C 3WTPB 5GXQD 3WKJA 3AZGD 3REIC 5DNNC 5GT3A 5B2IC 4J8WD 3MNNC 3WTPE 3X1SC 3B0CT 3W96D 3UT9C 1Q9CA 4Z5TB 1TAFA 3X1UD 3AZIC 3WAAA 2BG1A 5AV5C 5CPKC 1P34C 2XD1A 4NE3A 3X1SA 3V9RA 5E5AB 5GT3C 5B0YA 2HIOD 5B31A 5BS7A 5DNMA 5AV5B 4CAYA 3KWQC 4J8XD 3B0DC 1KU5A 5B31C 3KFUG 3LELB 3C1CD 3MGRB 3A6NA 3AZKD 3B0DB 4DQYB 5GT3B 4KGCA 1HQ3C 2Y2QA 2F8ND 3AZEC 1M19A 3X1TB 1EQZA 3NQJA 3REHB 3AN2A 5FUGB 1EQZC 2Y2HA 5B40A 5JRGA 5B24D 4YS3D 3X1TC 1JFIB 5C3IB 2Y2JA 1HQ3B 4KUDC 2HUEB 4JJND 4WU8D 3FDDA 3LJAB 3AV2C 3AV2D 3LZ0B 4CSRA 3RELD 1P3BB 3AV1D 5GSUC 4WU9D 5B2ID 4J8WC 1TZYD 5CP6B 3WTPA 3AYWB 4X23B 1KX3D 3H0LC 2PYOD 4KUDB 5FUGA 5F99D 2BYMB 4YM6B 4YS3C 1KX4C 3A1IA 1P3AA 1AOIB 1KX5D 3AZMC 3W98C 3W98D 3MGSA 5CPJC 3W99B 4KHAB 3MGQD 1U35C 2Y2LA 3TU4D 5B2JD 5B0ZB 4KUDA 3WKJD 4DRAA 3B6GA 3LELC 3AL0C 1P3KB 3MVDD 3X1SB 1BH8A 3WA9A 3KXBA 3UT9B 3LZ0A 3C1BD 3REIA 3EG5B 3X1UA 4XZQB 1ZLAB 5AVBA 4J8VB 4WU8C 5B0YD 3REHC 1P34A 1BFMA 4E44A 1P3FD 1U35D 3MNND 1M1AB 1R4VA 3B6FA 3KWQA 3NQJB 3LZ1A 3VH5W 1KX5C 5B32B 4R8PB 3AFAC 1P3IB 3LZ1C 3A6NB 3UTBA 3EPHA 5B0YC 3LELA 2F2AC 3UTAA 3AZHB 5AV8B 1T3UA 4UPKA 4Z66C 5AY8B 5AV6D 4CAYB 1F66C 5CP6A 1S32A 2FJ7B 2NQBD 3NQUA 5AY8A 2NZDD 5GT0D 5AV9A 4WNNB 4WU8A 3MVDC 1P3IC 2ZY4A 3AZMB 3X1UC 3AZID 3REIB 2J8PA 3AV2A 3TU4C 3LJAC 5JA4A 5G49B 5BNXA 4WU9A 1P3OD 3WTPD 3AN2D 4NE6A 5CPKB 4H9PA 3H0RC 5B1MC 4J8WA 3R45A 4YS3A 1EQZB 3REKB 2F8NK 1KX5A 1P3PC 3KUYD 5BNVA 2YFVA 5AVCA 2CWEA 4G91C 3WAAD 1ID3B 3MGPD 3W98A 4XZQC 5B1MA 1ZLAC 5CPJB 2L5AA 3MGRC 1P3FC 4J8UB 5AVBB 4J8VA 1TZYC 2HIOA 2Y2MA 4J8XB 4Z2MH 3AV1A 5DNMD 5B33D 5B0ZC 2ZM5A 1P3BA 4X23C 4EO5C 5GT3D 1F66D 4QLCC 1P3BC 3REJC 3W97B 1P3GD 4NFTA 5B24C 3X1TD 1M19D 3A6NC 3AZJD 2CV5D 2UWXA 4R8PC 2G5HC 3AFAB 5B1LD 3AZGC 5JRGB 5B40B 1U35A 2Y2IA 2AROB 3MNNA 5BT1D 5B24A 5BT1C 1HQ3D 5DNNB 4QLCB 3REHA 1B6WA 3WTPC 4WJ3C 5B1LC 4JJNB 4J8WB 2Y2NA 1P3PB 1H3OA 4Z2MG 5CPKA 3X1VD 3VH6T 4H9QA 3LZ0D 3EPKA 3C1BA 1WWSA 5F99C 1M18B 4KGCD 4H9NA 3AZEB 5BNXB 4WU9B 1P3GC 3RELA 2RVQD 3AYWD 4LD9B 4X23D 4J8VC 3AV1C 4AWLB 5F99B 1M18C 2HIOB 1KX3A 3AZFB 1P34D 3C1BC 2NQBA 5B31B 1F1EA 4ZBJB 5AVCC 3MGRD 3AZHA 3AZKB 4JJNA 1A7WA 4XUJD 2F8NB 3VH5T 1P3LB 4R8PA 3AZNC 3TU4A 4ZBJC 3LZ1B 5B2IA 1P3MB 2IO5C 1P3LC 2DF4C 3KWQB 4YM6C 4H9OA 4YS3B 3EPJA 1KX4B 3AZKC 2PYOC 3AZLB 5AV9C 3AZNA 1B67A 5GT0A 3REJB 3W97C 1P3AD 5BO0A 5AVCD 5GSUD 5KDMA 3AZIA 1S32B 1ZLAA 3MGSD 4Z5TC 3AV2B 1W2EA 3C1CB 3AV1B 5GT0C 3MGQA 2RVQC 4Z66D 3KXBB 5AV9B 2NQBC 5B2JA 2AROC 4KUDD 3B6GD 1P3KA 4ZUXC 3O62C 2ZY2A 1AOID 1P3GA 2Y2KA 5B24B 4HGAC 5B1MD 2JCHA 3UTBD 4H9SA 5AV8C 5GXQB 4G92C 3AZGB 5AV6B 3AN2C 3UTAD 2IO5B 5B2JB 3LJAD 3REHD 3VH6A 2NZDA 1P3BD 3X1UB 3B6FD 3X1VA 1F66A 4ZUXD 3O62D 3WA9B 1P3OB 5CHLB 5AV6C 5AV5D 3W96B 4J8UA 1HTAA 3LZ0C 3LELD 4Z5TD 1P3FB 3W99D 1ID3A 5AV6A 5B2IB 1P3MA 1TZYB 5CP6D 1M1AC 5B0ZA 3P5JB 3KUYA 2PYOB 5CPJD 4YM6D 4XUJA 4UUZA 3VH6W 4QLCA 4NE5A 4R8PD 2CV5C 2YFWB 2Y2GA 3C1CC 3AYWA 5CPIB 1KX3C 5AY8C 1P3LA 5B32G 3KXBC 2FJ7D 3MGQB 2NQBB 3W99C 4WU9C 3W97A 3RELB 3AZFC 4J8UC 1BH9B 3WKJC 3REJA 3UT9D 5B1LA 1KX3B 1P3PA 4J8VD 5DNND 3MGQC 5GXQC 4G92B 3AN2B 1P3IA 4LD9A 3B6FC 1HQ3A 3KUYC 3AZGA 4H9NB 5B32D 3AZEA 1M18A 3B0BA 1P3MC 3W98B 1AOIA 3AZND 2XD5A 3AFAA 4G91B 5AV8D 4H9RA 3X1TA 3TU4B 4X23A 3AZJA 1PZRA 3IP4C 2CV5A 4H9SC 5E5AC 5B31D 5CP6C 1ULYA 4WV4B 2JSSA 5JA4B 4Z66A 3B6GC 2NZDC 3EPLA 3AZHD 4EO5B 1BH9A 4WNNA 4WU8B 2G5IC 5CPKD 5B0YB 3WKJB 3AZFA 5B33C 2BYKB 2VQRA 3AZJB 5DNMC 1EQZD 3REKD 2ZY3A 3X1SD 5AVBC 1TAFB 4Z5TA 5E5AD 5JRGD 5B40D 1ID3D 5CPIC 3W99A 4XZQD 1ZLAD 3AZLD 2YFVB 5AVCB 1KX5B 3MGRA 4YM6A 5B33B 3A6ND 4ZUXA 3O62A 3AZJC 3AZKA 2AROA 3MNNB 3AZMA 2BYKA 2Y2PA 1M1AD 4XUJC 3MGPB 1TZYA 2HIOC 5G49A 3REKC 3V9RB 4J8UD 2FJ7A 5F99A 4DRBA 2F8NG 1P3KD 3MVDB 2F8NH 3B0CW 3W96A 5B1LB 4JJNC 3AZLA 2RIQA 5B1MB 3W96C 5C3IC 5GSUA 5BNVB 5B31G 1H3OB 3UTAB 1P3PD 5GT0B 3WA9C 1Z2CB 3X1VC 4UUZB 1M19B 1KX4A 2W8SA 1U35B 4H9PB 5CPIA 5B32A 3AZED 3KUYB 2YFWA 5GXQA 1N1JB 3WA9D 3UTBC 1ID3C 3AZLC 3KSYA 3R45B 1P3AB 5AVBD 2F8NA 5B32C 2BYMA 1AOIC 1WWIA 4HGAB 5AV5A 5DNMB 4J8XC 1M19C 3RELC 3VH5A 1P3FA 4LD9C 4M6BA 4LD9D 1F66B 3WAAB 3AZHC 4J8XA 4AWLC 3LJAA 2NZDB 5B0ZD 3C1CA 2LY8A 3MGSC 3AYWC 5CPJA 1BH8B 3LZ1D 3NQUB 4KHAA 3AFAD 5KDMB 3AZIB 3REID 4KGCC 1N1JA 1JFIA 5AV8A 4H9QB 3C1BB 1S32C 3REKA 3MGPC 3WAAC 4XUJB 4H9OB 1P3LD 2PYOA 1P3GB 1S32D 3MGSB 1P3MD 4WZSB 4KGCB 3B6FB 3KWQD 4CSRB 1P3OC 2AROD 2FFFB 2DQNC 3REJD 3UT9A 4QLCD 3F6TA 3AZFD 1P34B 1P3OA 5GSUB 1P3ID 1P3KC 3X1VB 5E5AA 1M18D 5B2JC 4XZQA 2ZY5A 3AZNB 3MVDA
chains in the Genus database with same CATH topology
3H0MC 2JE5A 5BS7C 3UTBB 2HUEC 5AY8D 4Z66B 3KXBD 5AV9D 1P3AC 2FJ7C 3A1KA 3W97D 3B6GB 3MGPA 5BO0B 2Y2OA 2CV5B 3AZMD 3UTAC 1M1AA 4ZUXB 4H9RB 3O62B 4E45A 5B33A 1KX4D 5DNNA 5CPID 5JRGC 5B40C 3WTPB 5GXQD 3WKJA 3AZGD 3REIC 5DNNC 5GT3A 5B2IC 4J8WD 3MNNC 3WTPE 3X1SC 3B0CT 3W96D 3UT9C 1Q9CA 4Z5TB 1TAFA 3X1UD 3AZIC 3WAAA 2BG1A 5AV5C 5CPKC 1P34C 2XD1A 4NE3A 3X1SA 3V9RA 5E5AB 5GT3C 5B0YA 2HIOD 5B31A 5BS7A 5DNMA 5AV5B 4CAYA 3KWQC 4J8XD 3B0DC 1KU5A 5B31C 3KFUG 3LELB 3C1CD 3MGRB 3A6NA 3AZKD 3B0DB 4DQYB 5GT3B 4KGCA 1HQ3C 2Y2QA 2F8ND 3AZEC 1M19A 3X1TB 1EQZA 3NQJA 3REHB 3AN2A 5FUGB 1EQZC 2Y2HA 5B40A 5JRGA 5B24D 4YS3D 3X1TC 1JFIB 5C3IB 2Y2JA 1HQ3B 4KUDC 2HUEB 4JJND 4WU8D 3FDDA 3LJAB 3AV2C 3AV2D 3LZ0B 4CSRA 3RELD 1P3BB 3AV1D 5GSUC 4WU9D 5B2ID 4J8WC 1TZYD 5CP6B 3WTPA 3AYWB 4X23B 1KX3D 3H0LC 2PYOD 4KUDB 5FUGA 5F99D 2BYMB 4YM6B 4YS3C 1KX4C 3A1IA 1P3AA 1AOIB 1KX5D 3AZMC 3W98C 3W98D 3MGSA 5CPJC 3W99B 4KHAB 3MGQD 1U35C 2Y2LA 3TU4D 5B2JD 5B0ZB 4KUDA 3WKJD 4DRAA 3B6GA 3LELC 3AL0C 1P3KB 3MVDD 3X1SB 1BH8A 3WA9A 3KXBA 3UT9B 3LZ0A 3C1BD 3REIA 3EG5B 3X1UA 4XZQB 1ZLAB 5AVBA 4J8VB 4WU8C 5B0YD 3REHC 1P34A 1BFMA 4E44A 1P3FD 1U35D 3MNND 1M1AB 1R4VA 3B6FA 3KWQA 3NQJB 3LZ1A 3VH5W 1KX5C 5B32B 4R8PB 3AFAC 1P3IB 3LZ1C 3A6NB 3UTBA 3EPHA 5B0YC 3LELA 2F2AC 3UTAA 3AZHB 5AV8B 1T3UA 4UPKA 4Z66C 5AY8B 5AV6D 4CAYB 1F66C 5CP6A 1S32A 2FJ7B 2NQBD 3NQUA 5AY8A 2NZDD 5GT0D 5AV9A 4WNNB 4WU8A 3MVDC 1P3IC 2ZY4A 3AZMB 3X1UC 3AZID 3REIB 2J8PA 3AV2A 3TU4C 3LJAC 5JA4A 5G49B 5BNXA 4WU9A 1P3OD 3WTPD 3AN2D 4NE6A 5CPKB 4H9PA 3H0RC 5B1MC 4J8WA 3R45A 4YS3A 1EQZB 3REKB 2F8NK 1KX5A 1P3PC 3KUYD 5BNVA 2YFVA 5AVCA 2CWEA 4G91C 3WAAD 1ID3B 3MGPD 3W98A 4XZQC 5B1MA 1ZLAC 5CPJB 2L5AA 3MGRC 1P3FC 4J8UB 5AVBB 4J8VA 1TZYC 2HIOA 2Y2MA 4J8XB 4Z2MH 3AV1A 5DNMD 5B33D 5B0ZC 2ZM5A 1P3BA 4X23C 4EO5C 5GT3D 1F66D 4QLCC 1P3BC 3REJC 3W97B 1P3GD 4NFTA 5B24C 3X1TD 1M19D 3A6NC 3AZJD 2CV5D 2UWXA 4R8PC 2G5HC 3AFAB 5B1LD 3AZGC 5JRGB 5B40B 1U35A 2Y2IA 2AROB 3MNNA 5BT1D 5B24A 5BT1C 1HQ3D 5DNNB 4QLCB 3REHA 1B6WA 3WTPC 4WJ3C 5B1LC 4JJNB 4J8WB 2Y2NA 1P3PB 1H3OA 4Z2MG 5CPKA 3X1VD 3VH6T 4H9QA 3LZ0D 3EPKA 3C1BA 1WWSA 5F99C 1M18B 4KGCD 4H9NA 3AZEB 5BNXB 4WU9B 1P3GC 3RELA 2RVQD 3AYWD 4LD9B 4X23D 4J8VC 3AV1C 4AWLB 5F99B 1M18C 2HIOB 1KX3A 3AZFB 1P34D 3C1BC 2NQBA 5B31B 1F1EA 4ZBJB 5AVCC 3MGRD 3AZHA 3AZKB 4JJNA 1A7WA 4XUJD 2F8NB 3VH5T 1P3LB 4R8PA 3AZNC 3TU4A 4ZBJC 3LZ1B 5B2IA 1P3MB 2IO5C 1P3LC 2DF4C 3KWQB 4YM6C 4H9OA 4YS3B 3EPJA 1KX4B 3AZKC 2PYOC 3AZLB 5AV9C 3AZNA 1B67A 5GT0A 3REJB 3W97C 1P3AD 5BO0A 5AVCD 5GSUD 5KDMA 3AZIA 1S32B 1ZLAA 3MGSD 4Z5TC 3AV2B 1W2EA 3C1CB 3AV1B 5GT0C 3MGQA 2RVQC 4Z66D 3KXBB 5AV9B 2NQBC 5B2JA 2AROC 4KUDD 3B6GD 1P3KA 4ZUXC 3O62C 2ZY2A 1AOID 1P3GA 2Y2KA 5B24B 4HGAC 5B1MD 2JCHA 3UTBD 4H9SA 5AV8C 5GXQB 4G92C 3AZGB 5AV6B 3AN2C 3UTAD 2IO5B 5B2JB 3LJAD 3REHD 3VH6A 2NZDA 1P3BD 3X1UB 3B6FD 3X1VA 1F66A 4ZUXD 3O62D 3WA9B 1P3OB 5CHLB 5AV6C 5AV5D 3W96B 4J8UA 1HTAA 3LZ0C 3LELD 4Z5TD 1P3FB 3W99D 1ID3A 5AV6A 5B2IB 1P3MA 1TZYB 5CP6D 1M1AC 5B0ZA 3P5JB 3KUYA 2PYOB 5CPJD 4YM6D 4XUJA 4UUZA 3VH6W 4QLCA 4NE5A 4R8PD 2CV5C 2YFWB 2Y2GA 3C1CC 3AYWA 5CPIB 1KX3C 5AY8C 1P3LA 5B32G 3KXBC 2FJ7D 3MGQB 2NQBB 3W99C 4WU9C 3W97A 3RELB 3AZFC 4J8UC 1BH9B 3WKJC 3REJA 3UT9D 5B1LA 1KX3B 1P3PA 4J8VD 5DNND 3MGQC 5GXQC 4G92B 3AN2B 1P3IA 4LD9A 3B6FC 1HQ3A 3KUYC 3AZGA 4H9NB 5B32D 3AZEA 1M18A 3B0BA 1P3MC 3W98B 1AOIA 3AZND 2XD5A 3AFAA 4G91B 5AV8D 4H9RA 3X1TA 3TU4B 4X23A 3AZJA 1PZRA 3IP4C 2CV5A 4H9SC 5E5AC 5B31D 5CP6C 1ULYA 4WV4B 2JSSA 5JA4B 4Z66A 3B6GC 2NZDC 3EPLA 3AZHD 4EO5B 1BH9A 4WNNA 4WU8B 2G5IC 5CPKD 5B0YB 3WKJB 3AZFA 5B33C 2BYKB 2VQRA 3AZJB 5DNMC 1EQZD 3REKD 2ZY3A 3X1SD 5AVBC 1TAFB 4Z5TA 5E5AD 5JRGD 5B40D 1ID3D 5CPIC 3W99A 4XZQD 1ZLAD 3AZLD 2YFVB 5AVCB 1KX5B 3MGRA 4YM6A 5B33B 3A6ND 4ZUXA 3O62A 3AZJC 3AZKA 2AROA 3MNNB 3AZMA 2BYKA 2Y2PA 1M1AD 4XUJC 3MGPB 1TZYA 2HIOC 5G49A 3REKC 3V9RB 4J8UD 2FJ7A 5F99A 4DRBA 2F8NG 1P3KD 3MVDB 2F8NH 3B0CW 3W96A 5B1LB 4JJNC 3AZLA 2RIQA 5B1MB 3W96C 5C3IC 5GSUA 5BNVB 5B31G 1H3OB 3UTAB 1P3PD 5GT0B 3WA9C 1Z2CB 3X1VC 4UUZB 1M19B 1KX4A 2W8SA 1U35B 4H9PB 5CPIA 5B32A 3AZED 3KUYB 2YFWA 5GXQA 1N1JB 3WA9D 3UTBC 1ID3C 3AZLC 3KSYA 3R45B 1P3AB 5AVBD 2F8NA 5B32C 2BYMA 1AOIC 1WWIA 4HGAB 5AV5A 5DNMB 4J8XC 1M19C 3RELC 3VH5A 1P3FA 4LD9C 4M6BA 4LD9D 1F66B 3WAAB 3AZHC 4J8XA 4AWLC 3LJAA 2NZDB 5B0ZD 3C1CA 2LY8A 3MGSC 3AYWC 5CPJA 1BH8B 3LZ1D 3NQUB 4KHAA 3AFAD 5KDMB 3AZIB 3REID 4KGCC 1N1JA 1JFIA 5AV8A 4H9QB 3C1BB 1S32C 3REKA 3MGPC 3WAAC 4XUJB 4H9OB 1P3LD 2PYOA 1P3GB 1S32D 3MGSB 1P3MD 4WZSB 4KGCB 3B6FB 3KWQD 4CSRB 1P3OC 2AROD 2FFFB 2DQNC 3REJD 3UT9A 4QLCD 3F6TA 3AZFD 1P34B 1P3OA 5GSUB 1P3ID 1P3KC 3X1VB 5E5AA 1M18D 5B2JC 4XZQA 2ZY5A 3AZNB 3MVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB B;  5BS7 C;  2HUE C;  5AY8 D;  4Z66 B;  3KXB D;  5AV9 D;  1P3A C;  2FJ7 C;  3W97 D;  3B6G B;  3MGP A;  5BO0 B;  2CV5 B;  3AZM D;  3UTA C;  1M1A A;  4ZUX B;  4H9R B;  3O62 B;  4E45 A;  5B33 A;  1KX4 D;  5DNN A;  5CPI D;  5JRG C;  5B40 C;  3WTP B;  5GXQ D;  3WKJ A;  3AZG D;  3REI C;  5DNN C;  5GT3 A;  5B2I C;  4J8W D;  3MNN C;  3WTP E;  3X1S C;  3B0C T;  3W96 D;  3UT9 C;  1Q9C A;  4Z5T B;  1TAF A;  3X1U D;  3AZI C;  3WAA A;  5AV5 C;  5CPK C;  1P34 C;  4NE3 A;  3X1S A;  3V9R A;  5E5A B;  5GT3 C;  5B0Y A;  2HIO D;  5B31 A;  5BS7 A;  5DNM A;  5AV5 B;  4CAY A;  3KWQ C;  4J8X D;  3B0D C;  1KU5 A;  5B31 C;  3LEL B;  3C1C D;  3MGR B;  3A6N A;  3AZK D;  3B0D B;  5GT3 B;  4KGC A;  1HQ3 C;  2F8N D;  3AZE C;  1M19 A;  3X1T B;  1EQZ A;  3NQJ A;  3REH B;  3AN2 A;  5FUG B;  1EQZ C;  5B40 A;  5JRG A;  5B24 D;  4YS3 D;  3X1T C;  1JFI B;  5C3I B;  1HQ3 B;  4KUD C;  2HUE B;  4JJN D;  4WU8 D;  3LJA B;  3AV2 C;  3AV2 D;  3LZ0 B;  4CSR A;  3REL D;  1P3B B;  3AV1 D;  5GSU C;  4WU9 D;  5B2I D;  4J8W C;  1TZY D;  5CP6 B;  3WTP A;  3AYW B;  4X23 B;  1KX3 D;  2PYO D;  4KUD B;  5FUG A;  5F99 D;  2BYM B;  4YM6 B;  4YS3 C;  1KX4 C;  1P3A A;  1AOI B;  1KX5 D;  3AZM C;  3W98 C;  3W98 D;  3MGS A;  5CPJ C;  3W99 B;  4KHA B;  3MGQ D;  1U35 C;  3TU4 D;  5B2J D;  5B0Z B;  4KUD A;  3WKJ D;  4DRA A;  3B6G A;  3LEL C;  1P3K B;  3MVD D;  3X1S B;  1BH8 A;  3WA9 A;  3KXB A;  3UT9 B;  3LZ0 A;  3C1B D;  3REI A;  3X1U A;  4XZQ B;  1ZLA B;  5AVB A;  4J8V B;  4WU8 C;  5B0Y D;  3REH C;  1P34 A;  1BFM A;  4E44 A;  1P3F D;  1U35 D;  3MNN D;  1M1A B;  1R4V A;  3B6F A;  3KWQ A;  3NQJ B;  3LZ1 A;  3VH5 W;  1KX5 C;  5B32 B;  4R8P B;  3AFA C;  1P3I B;  3LZ1 C;  3A6N B;  3UTB A;  5B0Y C;  3LEL A;  3UTA A;  3AZH B;  5AV8 B;  4Z66 C;  5AY8 B;  5AV6 D;  4CAY B;  1F66 C;  5CP6 A;  1S32 A;  2FJ7 B;  2NQB D;  3NQU A;  5AY8 A;  2NZD D;  5GT0 D;  5AV9 A;  4WNN B;  4WU8 A;  3MVD C;  1P3I C;  3AZM B;  3X1U C;  3AZI D;  3REI B;  3AV2 A;  3TU4 C;  3LJA C;  5JA4 A;  5G49 B;  5BNX A;  4WU9 A;  1P3O D;  3WTP D;  3AN2 D;  4NE6 A;  5CPK B;  4H9P A;  5B1M C;  4J8W A;  3R45 A;  4YS3 A;  1EQZ B;  3REK B;  2F8N K;  1KX5 A;  1P3P C;  3KUY D;  5BNV A;  2YFV A;  5AVC A;  2CWE A;  4G91 C;  3WAA D;  1ID3 B;  3MGP D;  3W98 A;  4XZQ C;  5B1M A;  1ZLA C;  5CPJ B;  2L5A A;  3MGR C;  1P3F C;  4J8U B;  5AVB B;  4J8V A;  1TZY C;  2HIO A;  4J8X B;  3AV1 A;  4Z2M H;  5DNM D;  5B33 D;  5B0Z C;  1P3B A;  4X23 C;  4EO5 C;  5GT3 D;  1F66 D;  4QLC C;  1P3B C;  3REJ C;  3W97 B;  1P3G D;  4NFT A;  5B24 C;  3X1T D;  1M19 D;  3A6N C;  3AZJ D;  2CV5 D;  4R8P C;  3AFA B;  5B1L D;  3AZG C;  5JRG B;  5B40 B;  1U35 A;  2ARO B;  3MNN A;  5BT1 D;  5B24 A;  5BT1 C;  1HQ3 D;  5DNN B;  4QLC B;  3REH A;  1B6W A;  3WTP C;  5B1L C;  4JJN B;  4J8W B;  1P3P B;  1H3O A;  4Z2M G;  5CPK A;  3X1V D;  3VH6 T;  4H9Q A;  3LZ0 D;  3C1B A;  1WWS A;  5F99 C;  1M18 B;  4KGC D;  4H9N A;  3AZE B;  5BNX B;  4WU9 B;  1P3G C;  3REL A;  2RVQ D;  3AYW D;  4LD9 B;  4X23 D;  4J8V C;  3AV1 C;  4AWL B;  5F99 B;  1M18 C;  2HIO B;  1KX3 A;  3AZF B;  1P34 D;  3C1B C;  2NQB A;  5B31 B;  1F1E A;  4ZBJ B;  5AVC C;  3MGR D;  3AZH A;  3AZK B;  4JJN A;  1A7W A;  4XUJ D;  2F8N B;  3VH5 T;  1P3L B;  4R8P A;  3AZN C;  3TU4 A;  4ZBJ C;  3LZ1 B;  5B2I A;  1P3M B;  2IO5 C;  1P3L C;  3KWQ B;  4YM6 C;  4H9O A;  4YS3 B;  1KX4 B;  3AZK C;  2PYO C;  3AZL B;  5AV9 C;  3AZN A;  1B67 A;  5GT0 A;  3REJ B;  3W97 C;  1P3A D;  5BO0 A;  5AVC D;  5GSU D;  5KDM A;  3AZI A;  1S32 B;  1ZLA A;  3MGS D;  4Z5T C;  3AV2 B;  3C1C B;  3AV1 B;  5GT0 C;  3MGQ A;  2RVQ C;  4Z66 D;  3KXB B;  5AV9 B;  2NQB C;  5B2J A;  2ARO C;  4KUD D;  3B6G D;  1P3K A;  4ZUX C;  3O62 C;  1AOI D;  1P3G A;  5B24 B;  4HGA C;  5B1M D;  3UTB D;  4H9S A;  5AV8 C;  5GXQ B;  4G92 C;  3AZG B;  5AV6 B;  3AN2 C;  3UTA D;  2IO5 B;  5B2J B;  3LJA D;  3REH D;  3VH6 A;  2NZD A;  1P3B D;  3X1U B;  3B6F D;  3X1V A;  1F66 A;  4ZUX D;  3O62 D;  3WA9 B;  1P3O B;  5CHL B;  5AV6 C;  5AV5 D;  3W96 B;  4J8U A;  1HTA A;  3LZ0 C;  3LEL D;  4Z5T D;  1P3F B;  3W99 D;  1ID3 A;  5AV6 A;  5B2I B;  1P3M A;  1TZY B;  5CP6 D;  1M1A C;  5B0Z A;  3KUY A;  2PYO B;  5CPJ D;  4YM6 D;  4XUJ A;  4UUZ A;  3VH6 W;  4QLC A;  4NE5 A;  4R8P D;  2CV5 C;  2YFW B;  3C1C C;  3AYW A;  5CPI B;  1KX3 C;  5AY8 C;  1P3L A;  5B32 G;  3KXB C;  2FJ7 D;  3MGQ B;  2NQB B;  3W99 C;  4WU9 C;  3W97 A;  3REL B;  3AZF C;  4J8U C;  1BH9 B;  3WKJ C;  3REJ A;  3UT9 D;  5B1L A;  1KX3 B;  1P3P A;  4J8V D;  5DNN D;  3MGQ C;  5GXQ C;  4G92 B;  3AN2 B;  1P3I A;  4LD9 A;  3B6F C;  1HQ3 A;  3KUY C;  3AZG A;  4H9N B;  5B32 D;  3AZE A;  1M18 A;  3B0B A;  1P3M C;  3W98 B;  1AOI A;  3AZN D;  3AFA A;  4G91 B;  5AV8 D;  4H9R A;  3X1T A;  3TU4 B;  4X23 A;  3AZJ A;  2CV5 A;  4H9S C;  5E5A C;  5B31 D;  5CP6 C;  1ULY A;  4WV4 B;  2JSS A;  5JA4 B;  4Z66 A;  3B6G C;  2NZD C;  3AZH D;  4EO5 B;  1BH9 A;  4WNN A;  4WU8 B;  5CPK D;  5B0Y B;  3WKJ B;  3AZF A;  5B33 C;  2BYK B;  3AZJ B;  5DNM C;  1EQZ D;  3REK D;  3X1S D;  5AVB C;  1TAF B;  4Z5T A;  5E5A D;  5JRG D;  5B40 D;  1ID3 D;  5CPI C;  3W99 A;  4XZQ D;  1ZLA D;  3AZL D;  2YFV B;  5AVC B;  1KX5 B;  3MGR A;  4YM6 A;  5B33 B;  3A6N D;  4ZUX A;  3O62 A;  3AZJ C;  3AZK A;  2ARO A;  3MNN B;  3AZM A;  2BYK A;  1M1A D;  4XUJ C;  3MGP B;  1TZY A;  2HIO C;  5G49 A;  3REK C;  3V9R B;  4J8U D;  2FJ7 A;  5F99 A;  4DRB A;  2F8N G;  1P3K D;  3MVD B;  2F8N H;  3B0C W;  3W96 A;  5B1L B;  4JJN C;  3AZL A;  5B1M B;  3W96 C;  5C3I C;  5GSU A;  5BNV B;  5B31 G;  1H3O B;  3UTA B;  1P3P D;  5GT0 B;  3WA9 C;  3X1V C;  4UUZ B;  1M19 B;  1KX4 A;  1U35 B;  4H9P B;  5CPI A;  5B32 A;  3AZE D;  3KUY B;  2YFW A;  5GXQ A;  1N1J B;  3WA9 D;  3UTB C;  1ID3 C;  3AZL C;  3KSY A;  3R45 B;  1P3A B;  5AVB D;  2F8N A;  5B32 C;  2BYM A;  1AOI C;  1WWI A;  4HGA B;  5AV5 A;  5DNM B;  4J8X C;  1M19 C;  3REL C;  3VH5 A;  1P3F A;  4LD9 C;  4M6B A;  4LD9 D;  1F66 B;  3WAA B;  3AZH C;  4J8X A;  4AWL C;  3LJA A;  2NZD B;  5B0Z D;  3C1C A;  2LY8 A;  3MGS C;  3AYW C;  5CPJ A;  1BH8 B;  3LZ1 D;  3NQU B;  4KHA A;  3AFA D;  5KDM B;  3AZI B;  3REI D;  4KGC C;  1N1J A;  1JFI A;  5AV8 A;  4H9Q B;  3C1B B;  1S32 C;  3REK A;  3MGP C;  3WAA C;  4XUJ B;  4H9O B;  1P3L D;  2PYO A;  1P3G B;  1S32 D;  3MGS B;  1P3M D;  4WZS B;  4KGC B;  3B6F B;  3KWQ D;  4CSR B;  1P3O C;  2ARO D;  3REJ D;  3UT9 A;  4QLC D;  3AZF D;  1P34 B;  1P3O A;  5GSU B;  1P3I D;  1P3K C;  3X1V B;  5E5A A;  1M18 D;  5B2J C;  4XZQ A;  3AZN B;  3MVD A; 
#chains in the Genus database with same CATH topology
 3H0M C;  2JE5 A;  5BS7 C;  3UTB B;  2HUE C;  5AY8 D;  4Z66 B;  3KXB D;  5AV9 D;  1P3A C;  2FJ7 C;  3A1K A;  3W97 D;  3B6G B;  3MGP A;  5BO0 B;  2Y2O A;  2CV5 B;  3AZM D;  3UTA C;  1M1A A;  4ZUX B;  4H9R B;  3O62 B;  4E45 A;  5B33 A;  1KX4 D;  5DNN A;  5CPI D;  5JRG C;  5B40 C;  3WTP B;  5GXQ D;  3WKJ A;  3AZG D;  3REI C;  5DNN C;  5GT3 A;  5B2I C;  4J8W D;  3MNN C;  3WTP E;  3X1S C;  3B0C T;  3W96 D;  3UT9 C;  1Q9C A;  4Z5T B;  1TAF A;  3X1U D;  3AZI C;  3WAA A;  2BG1 A;  5AV5 C;  5CPK C;  1P34 C;  2XD1 A;  4NE3 A;  3X1S A;  3V9R A;  5E5A B;  5GT3 C;  5B0Y A;  2HIO D;  5B31 A;  5BS7 A;  5DNM A;  5AV5 B;  4CAY A;  3KWQ C;  4J8X D;  3B0D C;  1KU5 A;  5B31 C;  3KFU G;  3LEL B;  3C1C D;  3MGR B;  3A6N A;  3AZK D;  3B0D B;  4DQY B;  5GT3 B;  4KGC A;  1HQ3 C;  2Y2Q A;  2F8N D;  3AZE C;  1M19 A;  3X1T B;  1EQZ A;  3NQJ A;  3REH B;  3AN2 A;  5FUG B;  1EQZ C;  2Y2H A;  5B40 A;  5JRG A;  5B24 D;  4YS3 D;  3X1T C;  1JFI B;  5C3I B;  2Y2J A;  1HQ3 B;  4KUD C;  2HUE B;  4JJN D;  4WU8 D;  3FDD A;  3LJA B;  3AV2 C;  3AV2 D;  3LZ0 B;  4CSR A;  3REL D;  1P3B B;  3AV1 D;  5GSU C;  4WU9 D;  5B2I D;  4J8W C;  1TZY D;  5CP6 B;  3WTP A;  3AYW B;  4X23 B;  1KX3 D;  3H0L C;  2PYO D;  4KUD B;  5FUG A;  5F99 D;  2BYM B;  4YM6 B;  4YS3 C;  1KX4 C;  3A1I A;  1P3A A;  1AOI B;  1KX5 D;  3AZM C;  3W98 C;  3W98 D;  3MGS A;  5CPJ C;  3W99 B;  4KHA B;  3MGQ D;  1U35 C;  2Y2L A;  3TU4 D;  5B2J D;  5B0Z B;  4KUD A;  3WKJ D;  4DRA A;  3B6G A;  3LEL C;  3AL0 C;  1P3K B;  3MVD D;  3X1S B;  1BH8 A;  3WA9 A;  3KXB A;  3UT9 B;  3LZ0 A;  3C1B D;  3REI A;  3EG5 B;  3X1U A;  4XZQ B;  1ZLA B;  5AVB A;  4J8V B;  4WU8 C;  5B0Y D;  3REH C;  1P34 A;  1BFM A;  4E44 A;  1P3F D;  1U35 D;  3MNN D;  1M1A B;  1R4V A;  3B6F A;  3KWQ A;  3NQJ B;  3LZ1 A;  3VH5 W;  1KX5 C;  5B32 B;  4R8P B;  3AFA C;  1P3I B;  3LZ1 C;  3A6N B;  3UTB A;  3EPH A;  5B0Y C;  3LEL A;  2F2A C;  3UTA A;  3AZH B;  5AV8 B;  1T3U A;  4UPK A;  4Z66 C;  5AY8 B;  5AV6 D;  4CAY B;  1F66 C;  5CP6 A;  1S32 A;  2FJ7 B;  2NQB D;  3NQU A;  5AY8 A;  2NZD D;  5GT0 D;  5AV9 A;  4WNN B;  4WU8 A;  3MVD C;  1P3I C;  2ZY4 A;  3AZM B;  3X1U C;  3AZI D;  3REI B;  2J8P A;  3AV2 A;  3TU4 C;  3LJA C;  5JA4 A;  5G49 B;  5BNX A;  4WU9 A;  1P3O D;  3WTP D;  3AN2 D;  4NE6 A;  5CPK B;  4H9P A;  3H0R C;  5B1M C;  4J8W A;  3R45 A;  4YS3 A;  1EQZ B;  3REK B;  2F8N K;  1KX5 A;  1P3P C;  3KUY D;  5BNV A;  2YFV A;  5AVC A;  2CWE A;  4G91 C;  3WAA D;  1ID3 B;  3MGP D;  3W98 A;  4XZQ C;  5B1M A;  1ZLA C;  5CPJ B;  2L5A A;  3MGR C;  1P3F C;  4J8U B;  5AVB B;  4J8V A;  1TZY C;  2HIO A;  2Y2M A;  4J8X B;  4Z2M H;  3AV1 A;  5DNM D;  5B33 D;  5B0Z C;  2ZM5 A;  1P3B A;  4X23 C;  4EO5 C;  5GT3 D;  1F66 D;  4QLC C;  1P3B C;  3REJ C;  3W97 B;  1P3G D;  4NFT A;  5B24 C;  3X1T D;  1M19 D;  3A6N C;  3AZJ D;  2CV5 D;  2UWX A;  4R8P C;  2G5H C;  3AFA B;  5B1L D;  3AZG C;  5JRG B;  5B40 B;  1U35 A;  2Y2I A;  2ARO B;  3MNN A;  5BT1 D;  5B24 A;  5BT1 C;  1HQ3 D;  5DNN B;  4QLC B;  3REH A;  1B6W A;  3WTP C;  4WJ3 C;  5B1L C;  4JJN B;  4J8W B;  2Y2N A;  1P3P B;  1H3O A;  4Z2M G;  5CPK A;  3X1V D;  3VH6 T;  4H9Q A;  3LZ0 D;  3EPK A;  3C1B A;  1WWS A;  5F99 C;  1M18 B;  4KGC D;  4H9N A;  3AZE B;  5BNX B;  4WU9 B;  1P3G C;  3REL A;  2RVQ D;  3AYW D;  4LD9 B;  4X23 D;  4J8V C;  3AV1 C;  4AWL B;  5F99 B;  1M18 C;  2HIO B;  1KX3 A;  3AZF B;  1P34 D;  3C1B C;  2NQB A;  5B31 B;  1F1E A;  4ZBJ B;  5AVC C;  3MGR D;  3AZH A;  3AZK B;  4JJN A;  1A7W A;  4XUJ D;  2F8N B;  3VH5 T;  1P3L B;  4R8P A;  3AZN C;  3TU4 A;  4ZBJ C;  3LZ1 B;  5B2I A;  1P3M B;  2IO5 C;  1P3L C;  2DF4 C;  3KWQ B;  4YM6 C;  4H9O A;  4YS3 B;  3EPJ A;  1KX4 B;  3AZK C;  2PYO C;  3AZL B;  5AV9 C;  3AZN A;  1B67 A;  5GT0 A;  3REJ B;  3W97 C;  1P3A D;  5BO0 A;  5AVC D;  5GSU D;  5KDM A;  3AZI A;  1S32 B;  1ZLA A;  3MGS D;  4Z5T C;  3AV2 B;  1W2E A;  3C1C B;  3AV1 B;  5GT0 C;  3MGQ A;  2RVQ C;  4Z66 D;  3KXB B;  5AV9 B;  2NQB C;  5B2J A;  2ARO C;  4KUD D;  3B6G D;  1P3K A;  4ZUX C;  3O62 C;  2ZY2 A;  1AOI D;  1P3G A;  2Y2K A;  5B24 B;  4HGA C;  5B1M D;  2JCH A;  3UTB D;  4H9S A;  5AV8 C;  5GXQ B;  4G92 C;  3AZG B;  5AV6 B;  3AN2 C;  3UTA D;  2IO5 B;  5B2J B;  3LJA D;  3REH D;  3VH6 A;  2NZD A;  1P3B D;  3X1U B;  3B6F D;  3X1V A;  1F66 A;  4ZUX D;  3O62 D;  3WA9 B;  1P3O B;  5CHL B;  5AV6 C;  5AV5 D;  3W96 B;  4J8U A;  1HTA A;  3LZ0 C;  3LEL D;  4Z5T D;  1P3F B;  3W99 D;  1ID3 A;  5AV6 A;  5B2I B;  1P3M A;  1TZY B;  5CP6 D;  1M1A C;  5B0Z A;  3P5J B;  3KUY A;  2PYO B;  5CPJ D;  4YM6 D;  4XUJ A;  4UUZ A;  3VH6 W;  4QLC A;  4NE5 A;  4R8P D;  2CV5 C;  2YFW B;  2Y2G A;  3C1C C;  3AYW A;  5CPI B;  1KX3 C;  5AY8 C;  1P3L A;  5B32 G;  3KXB C;  2FJ7 D;  3MGQ B;  2NQB B;  3W99 C;  4WU9 C;  3W97 A;  3REL B;  3AZF C;  4J8U C;  1BH9 B;  3WKJ C;  3REJ A;  3UT9 D;  5B1L A;  1KX3 B;  1P3P A;  4J8V D;  5DNN D;  3MGQ C;  5GXQ C;  4G92 B;  3AN2 B;  1P3I A;  4LD9 A;  3B6F C;  1HQ3 A;  3KUY C;  3AZG A;  4H9N B;  5B32 D;  3AZE A;  1M18 A;  3B0B A;  1P3M C;  3W98 B;  1AOI A;  3AZN D;  2XD5 A;  3AFA A;  4G91 B;  5AV8 D;  4H9R A;  3X1T A;  3TU4 B;  4X23 A;  3AZJ A;  1PZR A;  3IP4 C;  2CV5 A;  4H9S C;  5E5A C;  5B31 D;  5CP6 C;  1ULY A;  4WV4 B;  2JSS A;  5JA4 B;  4Z66 A;  3B6G C;  2NZD C;  3EPL A;  3AZH D;  4EO5 B;  1BH9 A;  4WNN A;  4WU8 B;  2G5I C;  5CPK D;  5B0Y B;  3WKJ B;  3AZF A;  5B33 C;  2BYK B;  2VQR A;  3AZJ B;  5DNM C;  1EQZ D;  3REK D;  2ZY3 A;  3X1S D;  5AVB C;  1TAF B;  4Z5T A;  5E5A D;  5JRG D;  5B40 D;  1ID3 D;  5CPI C;  3W99 A;  4XZQ D;  1ZLA D;  3AZL D;  2YFV B;  5AVC B;  1KX5 B;  3MGR A;  4YM6 A;  5B33 B;  3A6N D;  4ZUX A;  3O62 A;  3AZJ C;  3AZK A;  2ARO A;  3MNN B;  3AZM A;  2BYK A;  2Y2P A;  1M1A D;  4XUJ C;  3MGP B;  1TZY A;  2HIO C;  5G49 A;  3REK C;  3V9R B;  4J8U D;  2FJ7 A;  5F99 A;  4DRB A;  2F8N G;  1P3K D;  3MVD B;  2F8N H;  3B0C W;  3W96 A;  5B1L B;  4JJN C;  3AZL A;  2RIQ A;  5B1M B;  3W96 C;  5C3I C;  5GSU A;  5BNV B;  5B31 G;  1H3O B;  3UTA B;  1P3P D;  5GT0 B;  3WA9 C;  1Z2C B;  3X1V C;  4UUZ B;  1M19 B;  1KX4 A;  2W8S A;  1U35 B;  4H9P B;  5CPI A;  5B32 A;  3AZE D;  3KUY B;  2YFW A;  5GXQ A;  1N1J B;  3WA9 D;  3UTB C;  1ID3 C;  3AZL C;  3KSY A;  3R45 B;  1P3A B;  5AVB D;  2F8N A;  5B32 C;  2BYM A;  1AOI C;  1WWI A;  4HGA B;  5AV5 A;  5DNM B;  4J8X C;  1M19 C;  3REL C;  3VH5 A;  1P3F A;  4LD9 C;  4M6B A;  4LD9 D;  1F66 B;  3WAA B;  3AZH C;  4J8X A;  4AWL C;  3LJA A;  2NZD B;  5B0Z D;  3C1C A;  2LY8 A;  3MGS C;  3AYW C;  5CPJ A;  1BH8 B;  3LZ1 D;  3NQU B;  4KHA A;  3AFA D;  5KDM B;  3AZI B;  3REI D;  4KGC C;  1N1J A;  1JFI A;  5AV8 A;  4H9Q B;  3C1B B;  1S32 C;  3REK A;  3MGP C;  3WAA C;  4XUJ B;  4H9O B;  1P3L D;  2PYO A;  1P3G B;  1S32 D;  3MGS B;  1P3M D;  4WZS B;  4KGC B;  3B6F B;  3KWQ D;  4CSR B;  1P3O C;  2ARO D;  2FFF B;  2DQN C;  3REJ D;  3UT9 A;  4QLC D;  3F6T A;  3AZF D;  1P34 B;  1P3O A;  5GSU B;  1P3I D;  1P3K C;  3X1V B;  5E5A A;  1M18 D;  5B2J C;  4XZQ A;  2ZY5 A;  3AZN B;  3MVD A; 
#chains in the Genus database with same CATH homology
 3H0M C;  2JE5 A;  5BS7 C;  3UTB B;  2HUE C;  5AY8 D;  4Z66 B;  3KXB D;  5AV9 D;  1P3A C;  2FJ7 C;  3A1K A;  3W97 D;  3B6G B;  3MGP A;  5BO0 B;  2Y2O A;  2CV5 B;  3AZM D;  3UTA C;  1M1A A;  4ZUX B;  4H9R B;  3O62 B;  4E45 A;  5B33 A;  1KX4 D;  5DNN A;  5CPI D;  5JRG C;  5B40 C;  3WTP B;  5GXQ D;  3WKJ A;  3AZG D;  3REI C;  5DNN C;  5GT3 A;  5B2I C;  4J8W D;  3MNN C;  3WTP E;  3X1S C;  3B0C T;  3W96 D;  3UT9 C;  1Q9C A;  4Z5T B;  1TAF A;  3X1U D;  3AZI C;  3WAA A;  2BG1 A;  5AV5 C;  5CPK C;  1P34 C;  2XD1 A;  4NE3 A;  3X1S A;  3V9R A;  5E5A B;  5GT3 C;  5B0Y A;  2HIO D;  5B31 A;  5BS7 A;  5DNM A;  5AV5 B;  4CAY A;  3KWQ C;  4J8X D;  3B0D C;  1KU5 A;  5B31 C;  3KFU G;  3LEL B;  3C1C D;  3MGR B;  3A6N A;  3AZK D;  3B0D B;  4DQY B;  5GT3 B;  4KGC A;  1HQ3 C;  2Y2Q A;  2F8N D;  3AZE C;  1M19 A;  3X1T B;  1EQZ A;  3NQJ A;  3REH B;  3AN2 A;  5FUG B;  1EQZ C;  2Y2H A;  5B40 A;  5JRG A;  5B24 D;  4YS3 D;  3X1T C;  1JFI B;  5C3I B;  2Y2J A;  1HQ3 B;  4KUD C;  2HUE B;  4JJN D;  4WU8 D;  3FDD A;  3LJA B;  3AV2 C;  3AV2 D;  3LZ0 B;  4CSR A;  3REL D;  1P3B B;  3AV1 D;  5GSU C;  4WU9 D;  5B2I D;  4J8W C;  1TZY D;  5CP6 B;  3WTP A;  3AYW B;  4X23 B;  1KX3 D;  3H0L C;  2PYO D;  4KUD B;  5FUG A;  5F99 D;  2BYM B;  4YM6 B;  4YS3 C;  1KX4 C;  3A1I A;  1P3A A;  1AOI B;  1KX5 D;  3AZM C;  3W98 C;  3W98 D;  3MGS A;  5CPJ C;  3W99 B;  4KHA B;  3MGQ D;  1U35 C;  2Y2L A;  3TU4 D;  5B2J D;  5B0Z B;  4KUD A;  3WKJ D;  4DRA A;  3B6G A;  3LEL C;  3AL0 C;  1P3K B;  3MVD D;  3X1S B;  1BH8 A;  3WA9 A;  3KXB A;  3UT9 B;  3LZ0 A;  3C1B D;  3REI A;  3EG5 B;  3X1U A;  4XZQ B;  1ZLA B;  5AVB A;  4J8V B;  4WU8 C;  5B0Y D;  3REH C;  1P34 A;  1BFM A;  4E44 A;  1P3F D;  1U35 D;  3MNN D;  1M1A B;  1R4V A;  3B6F A;  3KWQ A;  3NQJ B;  3LZ1 A;  3VH5 W;  1KX5 C;  5B32 B;  4R8P B;  3AFA C;  1P3I B;  3LZ1 C;  3A6N B;  3UTB A;  3EPH A;  5B0Y C;  3LEL A;  2F2A C;  3UTA A;  3AZH B;  5AV8 B;  1T3U A;  4UPK A;  4Z66 C;  5AY8 B;  5AV6 D;  4CAY B;  1F66 C;  5CP6 A;  1S32 A;  2FJ7 B;  2NQB D;  3NQU A;  5AY8 A;  2NZD D;  5GT0 D;  5AV9 A;  4WNN B;  4WU8 A;  3MVD C;  1P3I C;  2ZY4 A;  3AZM B;  3X1U C;  3AZI D;  3REI B;  2J8P A;  3AV2 A;  3TU4 C;  3LJA C;  5JA4 A;  5G49 B;  5BNX A;  4WU9 A;  1P3O D;  3WTP D;  3AN2 D;  4NE6 A;  5CPK B;  4H9P A;  3H0R C;  5B1M C;  4J8W A;  3R45 A;  4YS3 A;  1EQZ B;  3REK B;  2F8N K;  1KX5 A;  1P3P C;  3KUY D;  5BNV A;  2YFV A;  5AVC A;  2CWE A;  4G91 C;  3WAA D;  1ID3 B;  3MGP D;  3W98 A;  4XZQ C;  5B1M A;  1ZLA C;  5CPJ B;  2L5A A;  3MGR C;  1P3F C;  4J8U B;  5AVB B;  4J8V A;  1TZY C;  2HIO A;  2Y2M A;  4J8X B;  4Z2M H;  3AV1 A;  5DNM D;  5B33 D;  5B0Z C;  2ZM5 A;  1P3B A;  4X23 C;  4EO5 C;  5GT3 D;  1F66 D;  4QLC C;  1P3B C;  3REJ C;  3W97 B;  1P3G D;  4NFT A;  5B24 C;  3X1T D;  1M19 D;  3A6N C;  3AZJ D;  2CV5 D;  2UWX A;  4R8P C;  2G5H C;  3AFA B;  5B1L D;  3AZG C;  5JRG B;  5B40 B;  1U35 A;  2Y2I A;  2ARO B;  3MNN A;  5BT1 D;  5B24 A;  5BT1 C;  1HQ3 D;  5DNN B;  4QLC B;  3REH A;  1B6W A;  3WTP C;  4WJ3 C;  5B1L C;  4JJN B;  4J8W B;  2Y2N A;  1P3P B;  1H3O A;  4Z2M G;  5CPK A;  3X1V D;  3VH6 T;  4H9Q A;  3LZ0 D;  3EPK A;  3C1B A;  1WWS A;  5F99 C;  1M18 B;  4KGC D;  4H9N A;  3AZE B;  5BNX B;  4WU9 B;  1P3G C;  3REL A;  2RVQ D;  3AYW D;  4LD9 B;  4X23 D;  4J8V C;  3AV1 C;  4AWL B;  5F99 B;  1M18 C;  2HIO B;  1KX3 A;  3AZF B;  1P34 D;  3C1B C;  2NQB A;  5B31 B;  1F1E A;  4ZBJ B;  5AVC C;  3MGR D;  3AZH A;  3AZK B;  4JJN A;  1A7W A;  4XUJ D;  2F8N B;  3VH5 T;  1P3L B;  4R8P A;  3AZN C;  3TU4 A;  4ZBJ C;  3LZ1 B;  5B2I A;  1P3M B;  2IO5 C;  1P3L C;  2DF4 C;  3KWQ B;  4YM6 C;  4H9O A;  4YS3 B;  3EPJ A;  1KX4 B;  3AZK C;  2PYO C;  3AZL B;  5AV9 C;  3AZN A;  1B67 A;  5GT0 A;  3REJ B;  3W97 C;  1P3A D;  5BO0 A;  5AVC D;  5GSU D;  5KDM A;  3AZI A;  1S32 B;  1ZLA A;  3MGS D;  4Z5T C;  3AV2 B;  1W2E A;  3C1C B;  3AV1 B;  5GT0 C;  3MGQ A;  2RVQ C;  4Z66 D;  3KXB B;  5AV9 B;  2NQB C;  5B2J A;  2ARO C;  4KUD D;  3B6G D;  1P3K A;  4ZUX C;  3O62 C;  2ZY2 A;  1AOI D;  1P3G A;  2Y2K A;  5B24 B;  4HGA C;  5B1M D;  2JCH A;  3UTB D;  4H9S A;  5AV8 C;  5GXQ B;  4G92 C;  3AZG B;  5AV6 B;  3AN2 C;  3UTA D;  2IO5 B;  5B2J B;  3LJA D;  3REH D;  3VH6 A;  2NZD A;  1P3B D;  3X1U B;  3B6F D;  3X1V A;  1F66 A;  4ZUX D;  3O62 D;  3WA9 B;  1P3O B;  5CHL B;  5AV6 C;  5AV5 D;  3W96 B;  4J8U A;  1HTA A;  3LZ0 C;  3LEL D;  4Z5T D;  1P3F B;  3W99 D;  1ID3 A;  5AV6 A;  5B2I B;  1P3M A;  1TZY B;  5CP6 D;  1M1A C;  5B0Z A;  3P5J B;  3KUY A;  2PYO B;  5CPJ D;  4YM6 D;  4XUJ A;  4UUZ A;  3VH6 W;  4QLC A;  4NE5 A;  4R8P D;  2CV5 C;  2YFW B;  2Y2G A;  3C1C C;  3AYW A;  5CPI B;  1KX3 C;  5AY8 C;  1P3L A;  5B32 G;  3KXB C;  2FJ7 D;  3MGQ B;  2NQB B;  3W99 C;  4WU9 C;  3W97 A;  3REL B;  3AZF C;  4J8U C;  1BH9 B;  3WKJ C;  3REJ A;  3UT9 D;  5B1L A;  1KX3 B;  1P3P A;  4J8V D;  5DNN D;  3MGQ C;  5GXQ C;  4G92 B;  3AN2 B;  1P3I A;  4LD9 A;  3B6F C;  1HQ3 A;  3KUY C;  3AZG A;  4H9N B;  5B32 D;  3AZE A;  1M18 A;  3B0B A;  1P3M C;  3W98 B;  1AOI A;  3AZN D;  2XD5 A;  3AFA A;  4G91 B;  5AV8 D;  4H9R A;  3X1T A;  3TU4 B;  4X23 A;  3AZJ A;  1PZR A;  3IP4 C;  2CV5 A;  4H9S C;  5E5A C;  5B31 D;  5CP6 C;  1ULY A;  4WV4 B;  2JSS A;  5JA4 B;  4Z66 A;  3B6G C;  2NZD C;  3EPL A;  3AZH D;  4EO5 B;  1BH9 A;  4WNN A;  4WU8 B;  2G5I C;  5CPK D;  5B0Y B;  3WKJ B;  3AZF A;  5B33 C;  2BYK B;  2VQR A;  3AZJ B;  5DNM C;  1EQZ D;  3REK D;  2ZY3 A;  3X1S D;  5AVB C;  1TAF B;  4Z5T A;  5E5A D;  5JRG D;  5B40 D;  1ID3 D;  5CPI C;  3W99 A;  4XZQ D;  1ZLA D;  3AZL D;  2YFV B;  5AVC B;  1KX5 B;  3MGR A;  4YM6 A;  5B33 B;  3A6N D;  4ZUX A;  3O62 A;  3AZJ C;  3AZK A;  2ARO A;  3MNN B;  3AZM A;  2BYK A;  2Y2P A;  1M1A D;  4XUJ C;  3MGP B;  1TZY A;  2HIO C;  5G49 A;  3REK C;  3V9R B;  4J8U D;  2FJ7 A;  5F99 A;  4DRB A;  2F8N G;  1P3K D;  3MVD B;  2F8N H;  3B0C W;  3W96 A;  5B1L B;  4JJN C;  3AZL A;  2RIQ A;  5B1M B;  3W96 C;  5C3I C;  5GSU A;  5BNV B;  5B31 G;  1H3O B;  3UTA B;  1P3P D;  5GT0 B;  3WA9 C;  1Z2C B;  3X1V C;  4UUZ B;  1M19 B;  1KX4 A;  2W8S A;  1U35 B;  4H9P B;  5CPI A;  5B32 A;  3AZE D;  3KUY B;  2YFW A;  5GXQ A;  1N1J B;  3WA9 D;  3UTB C;  1ID3 C;  3AZL C;  3KSY A;  3R45 B;  1P3A B;  5AVB D;  2F8N A;  5B32 C;  2BYM A;  1AOI C;  1WWI A;  4HGA B;  5AV5 A;  5DNM B;  4J8X C;  1M19 C;  3REL C;  3VH5 A;  1P3F A;  4LD9 C;  4M6B A;  4LD9 D;  1F66 B;  3WAA B;  3AZH C;  4J8X A;  4AWL C;  3LJA A;  2NZD B;  5B0Z D;  3C1C A;  2LY8 A;  3MGS C;  3AYW C;  5CPJ A;  1BH8 B;  3LZ1 D;  3NQU B;  4KHA A;  3AFA D;  5KDM B;  3AZI B;  3REI D;  4KGC C;  1N1J A;  1JFI A;  5AV8 A;  4H9Q B;  3C1B B;  1S32 C;  3REK A;  3MGP C;  3WAA C;  4XUJ B;  4H9O B;  1P3L D;  2PYO A;  1P3G B;  1S32 D;  3MGS B;  1P3M D;  4WZS B;  4KGC B;  3B6F B;  3KWQ D;  4CSR B;  1P3O C;  2ARO D;  2FFF B;  2DQN C;  3REJ D;  3UT9 A;  4QLC D;  3F6T A;  3AZF D;  1P34 B;  1P3O A;  5GSU B;  1P3I D;  1P3K C;  3X1V B;  5E5A A;  1M18 D;  5B2J C;  4XZQ A;  2ZY5 A;  3AZN B;  3MVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...