5AV5D

Human nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
b'RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 38
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5D00
1P3PB 4XZQA 2PYOA 3W98C 1P3KD 1P3LC 5AV6A 5JA4B 2BYMA 1P3ID 3RELD 5FUGA 1P3LB 5B1MC 1KX4C 4QLCA 5KDMA 3UT9D 5B2IC 4WU9C 5B1MB 1KX4B 3LZ0C 5GT3C 1P3PD 5GT0C 4WU9B 5B33A 5F99C 5CP6C 5GT3B 3LZ0B 3X1SC 1ULYA 3X1TD 3O62C 5F99B 5CP6B 3AV2A 3X1SB 3W98D 1P3LD 3AZNA 5B32C 1BH8A 3WKJD 3X1UC 3O62B 2F8NB 5B32B 1KX4D 3X1UB 2L5AA 3AZED 5B2ID 4WU9D 4YM6D 3V9RA 3MVDD 5GT0D 5F99D 1BFMA 3X1SD 1M18D 3B6FC 3LELD 1BH9B 5AVCA 3AZHA 5AV8A 3W97D 3B6FB 2F8ND 5AV5A 5B32D 3X1UD 2AROD 4YS3C 1TZYC 4YS3B 5GXQA 4J8VC 3W96A 1P3BB 4H9RA 1F1EA 5GSUC 1TZYB 4J8VB 4G92C 4NE6A 5GSUB 4G92B 5B31C 5G49A 4Z66B 5AY8C 4ZUXA 5B31B 4KUDA 5AY8B 1TZYD 4X23A 1ZLAA 1U35B 2YFWB 4LD9A 2HIOC 4H9OB 5E5AA 4XUJA 4JJND 4WU8C 2HIOB 1HQ3A 1P3AA 1EQZC 4WU8B 3AN2A 3REJC 1EQZB 3LZ1C 1WWSA 3REJB 3W99D 1P3OA 3LZ1B 3AZLA 3KSYA 3WAAC 4H9QA 1B67A 1ID3C 2NQBC 4WU8D 5BNXB 1KX3D 2CV5A 5B24A 4XZQC 3TU4D 1ID3B 2PYOC 2NQBB 1Q9CA 3REJD 4XZQB 5AV6C 2RVQD 2PYOB 3LZ1D 4WV4B 4QLCC 5AV6B 2BYMB 3REKD 5FUGB 3B0CW 3AZGD 4QLCB 5KDMB 5BNVA 4UUZA 5B33C 3WAAD 1ID3D 5DNMA 3MGPA 1P3FD 5B33B 1M19A 1KX5D 2PYOD 3AV2C 3AZNC 5AV6D 1HTAA 5CPKD 4R8PD 3AV2B 3VH6A 3AZMA 3AZNB 1BH8B 5AVBA 3B0DC 5B0ZC 3B6GA 2FJ7A 3V9RB 3B0DB 3UTAD 5B0YA 3REHA 5BNXA 5AVCC 3AZHC 5AV8C 3AZJA 3AV2D 3KWQA 5AV5C 5C3IC 5DNND 3UTBA 5B1LA 5AVCB 5BO0A 5AV8B 3AZHB 3AZND 1AOIA 3VH6T 5C3IB 5AV5B 1P3GD 3C1CD 5JRGD 3AYWA 5GXQC 1B6WA 5AV9A 4J8UA 3W96C 4J8XA 3B0BA 1TAFA 5GXQB 3MGQD 5B0ZD 3W96B 4H9RB 1JFIA 3A6NA 3AZIA 4KHAA 5AVCD 5AV8D 4ZUXC 5AV5D 5G49B 4KUDC 4ZUXB 3B0CT 3KXBA 4X23C 1ZLAC 4KUDB 4LD9C 5B1MD 4NFTA 5E5AC 4X23B 4XUJC 1ZLAB 4LD9B 1HQ3C 1P3AC 5E5AB 4XUJB 3LZ0D 5GT3D 3AN2C 1H3OA 1HQ3B 5B40A 1P3AB 4ZUXD 5CP6D 3AN2B 2JSSA 4WZSB 4KUDD 3O62D 4HGAC 1P3OC 3AZLC 3LJAA 3C1BA 4X23D 4LD9D 4J8WA 4HGAB 1P3OB 3AZLB 5E5AD 4E44A 3WTPA 1P3BC 2CV5C 1HQ3D 5B2JA 5B24C 1P3KA 4H9QB 3KUYA 1WWIA 1P3AD 3AN2D 3RELA 4H9PA 5B24B 5CPJA 2CV5B 2NZDA 4Z66C 3B6FD 3UT9A 1P3OD 4H9SA 4NE3A 4YS3D 3WA9A 1U35C 3MGRA 1P3BD 5DNMC 5BNVB 4UUZB 3X1TA 3MGPC 4J8VD 3W98A 5B24D 1M19C 5GSUD 5DNMB 3WKJA 3MGPB 1M19B 4Z66D 3AZMC 5B31D 3AZEA 5B2IA 5AVBC 4YM6A 3MVDA 5AY8D 3AZMB 2BYKA 5GT0A 5AVBB 1U35D 3VH6W 1M18A 4NE5A 2FJ7C 3B6GC 3NQUA 5CHLB 4Z5TA 3LELA 4AWLC 5B0YC 3REHC 3B6GB 3W97A 4M6BA 4CAYA 2HIOD 2FJ7B 3AZJC 4AWLB 2AROA 5B0YB 3REHB 3UTBC 5B1LC 1AOIC 3AZJB 3KWQB 1EQZD 3UTBB 4WNNA 4EO5C 5B1LB 5BO0B 5AVBD 1AOIB 1F66A 5AV9C 4J8UC 4J8XC 3AV1A 1P3MA 4EO5B 3AYWB 1M1AA 3WTPE 5AV9B 4J8UB 4J8XB 1TAFB 3A6NC 3AZIC 1JFIB 3A6NB 3AZIB 2NQBD 3MGSA 4DRAA 4KHAB 1AOID 4XZQD 1KU5A 3KXBC 5BS7A 4H9NA 4J8XD 4JJNA 3KXBB 2IO5C 3R45A 4QLCD 2LY8A 3A6ND 1S32A 2IO5B 3X1VA 3MNNA 5B33D 5B40C 1H3OB 3W99A 5B40B 3LJAC 3C1BC 4KGCA 4J8WC 3LJAB 3C1BB 1KX3A 3TU4A 4J8WB 5B2JC 1P3KC 3WTPB 3KUYC 1N1JA 5B2JB 5CPJC 2NZDC 1P3KB 3KUYB 3REKA 4H9PB 3RELB 3UT9C 3AZGA 3AZHD 5CPJB 2NZDB 3UT9B 1P34A 4H9SC 3WAAA 4J8WD 3WA9C 3MGRC 5BT1C 3X1TC 1P3FA 3WA9B 5GXQD 1KX5A 5B2JD 3MGRB 3W96D 3KUYD 3X1TB 5CPIA 3WKJC 5CPKA 4R8PA 5CPJD 3W98B 2NZDD 2HUEC 3WKJB 3AZEC 3AZFA 3AZKA 3REIA 4YM6C 3MVDC 2HUEB 2F8NH 3AZEB 5B2IB 3WA9D 4YM6B 3MVDB 3MGRD 3UTAA 1M18C 5BT1D 4Z5TC 2BYKB 2YFVA 5GT0B 3AFAA 3LELC 1ZLAD 1M18B 3W97C 4CSRA 3NQUB 4Z5TB 3LELB 5DNNA 4XUJD 2AROC 4CAYB 3W97B 1P3GA 3C1CA 2AROB 5JRGA 4E45A 1P3IA 1F66C 4DRBA 4WNNB 2CWEA 3MGQA 3AV1C 1P3MC 5B0ZA 1F66B 1M1AC 3NQJA 3AV1B 1P3MB 4Z5TD 3AZLD 1M1AB 4ZBJC 1P3PA 4ZBJB 2F8NG 3MGSC 5B32G 5JA4A 1A7WA 2CV5D 1P3LA 3MGSB 1F66D 5BS7C 5B1MA 3AV1D 1P3MD 1KX4A 4JJNC 1M1AD 4WU9A 4H9NB 3LZ0A 4JJNB 5GT3A 1S32C 3R45B 3X1VC 3MNNC 5F99A 5CP6A 3X1SA 1S32B 5DNMD 3MGSD 3X1VB 3W99C 3MGPD 3O62A 3MNNB 1M19D 2F8NA 5B32A 3KWQC 3W99B 3X1UA 4KGCC 3VH5W 3AZMD 1KX3C 4KGCB 3TU4C 3AYWC 1S32D 1KX3B 5B31G 1BH9A 3TU4B 3X1VD 2RVQC 3MNND 3B6GD 2FJ7D 3B6FA 1N1JB 5B0YD 3REHD 3REKC 3AZGC 3AZJD 3KWQD 4YS3A 3REKB 3UTBD 1P34C 3AZGB 5B1LD 4KGCD 4Z2MH 1P3BA 1TZYA 1P34B 4J8VA 1P3FC 3WAAB 3AYWD 1KX5C 5AV9D 5GSUA 4J8UD 5CPIC 1P3FB 1KX5B 5CPKC 4R8PC 4Z66A 5B31A 5CPIB 5CPKB 4R8PB 3AZID 3AZFC 4G91C 3AZKC 5AY8A 3REIC 3VH5A 1P34D 3AZFB 4G91B 2YFWA 3AZKB 1U35A 3REIB 3UTAC 4H9OA 3AFAC 1R4VA 3KXBD 2HIOA 3UTAB 3AFAB 4WU8A 2YFVB 5DNNC 5CPID 3WTPC 1EQZA 4CSRB 4Z2MG 2F8NK 5DNNB 1P3GC 3C1CC 5JRGC 3REJA 3AZFD 3AZKD 1P3IC 3RELC 3LZ1A 3REID 5B40D 1P3GB 3C1CB 3VH5T 5JRGB 3MGQC 1P3IB 3MGQB 3AFAD 3LJAD 5B0ZB 3C1BD 1P3PC 3NQJB 1ID3A 2NQBA 3WTPD
chains in the Genus database with same CATH superfamily
1P3PB 4XZQA 2PYOA 3W98C 1P3KD 1P3LC 5AV6A 5JA4B 2BYMA 1P3ID 3RELD 5FUGA 1P3LB 5B1MC 1KX4C 4QLCA 5KDMA 3UT9D 5B2IC 4WU9C 5B1MB 1KX4B 3LZ0C 5GT3C 1P3PD 5GT0C 3H0RC 5B33A 4WU9B 5F99C 5CP6C 5GT3B 3LZ0B 3X1SC 1ULYA 3X1TD 3O62C 5F99B 5CP6B 3AV2A 3X1SB 3W98D 1P3LD 3AZNA 5B32C 1BH8A 3WKJD 3X1UC 3O62B 2F8NB 5B32B 1KX4D 3X1UB 2L5AA 3AZED 5B2ID 4WU9D 4YM6D 3V9RA 3MVDD 5GT0D 3H0MC 5F99D 1BFMA 3X1SD 1M18D 3B6FC 2Y2IA 3LELD 1BH9B 5AVCA 3AZHA 5AV8A 3W97D 3B6FB 2F8ND 5AV5A 3KFUG 5B32D 3X1UD 2AROD 4YS3C 1PZRA 1TZYC 5GXQA 4J8VC 4YS3B 3W96A 1P3BB 4H9RA 1F1EA 5GSUC 1TZYB 4J8VB 4G92C 4NE6A 5GSUB 4G92B 5B31C 5G49A 4Z66B 5AY8C 4ZUXA 5B31B 4KUDA 5AY8B 1TZYD 4X23A 1ZLAA 1U35B 2YFWB 4LD9A 2HIOC 4H9OB 5E5AA 4XUJA 4JJND 4WU8C 2HIOB 1HQ3A 1P3AA 1EQZC 4WU8B 3AN2A 3REJC 1EQZB 3LZ1C 1WWSA 3REJB 3W99D 1P3OA 3LZ1B 3AZLA 2Y2LA 3KSYA 3EPHA 3WAAC 4H9QA 1B67A 1ID3C 2NQBC 4WU8D 5BNXB 1KX3D 4UPKA 2CV5A 5B24A 4XZQC 2UWXA 3EPJA 3TU4D 1ID3B 2PYOC 2NQBB 2ZY4A 1Q9CA 3REJD 4XZQB 5AV6C 2RVQD 2PYOB 3LZ1D 4WV4B 4QLCC 5AV6B 2BYMB 3REKD 5FUGB 3B0CW 3AZGD 4QLCB 5KDMB 5BNVA 4UUZA 2DQNC 5B33C 3WAAD 1ID3D 2G5HC 5DNMA 3MGPA 1P3FD 5B33B 1M19A 1KX5D 2PYOD 3AV2C 3AZNC 5AV6D 1HTAA 5CPKD 4R8PD 2ZY5A 3AV2B 3VH6A 2Y2QA 3AZMA 3AZNB 1BH8B 2XD1A 5AVBA 3B0DC 5B0ZC 3B6GA 2FJ7A 3V9RB 3B0DB 3UTAD 5B0YA 3REHA 5BNXA 5AVCC 3AZHC 5AV8C 2F2AC 3AZJA 3AV2D 3KWQA 5AV5C 5C3IC 5DNND 3UTBA 5B1LA 5AVCB 5BO0A 5AV8B 3AZHB 3AZND 1AOIA 3VH6T 5C3IB 5AV5B 1P3GD 3C1CD 5JRGD 3AYWA 5GXQC 1B6WA 5AV9A 4J8UA 3W96C 4J8XA 3B0BA 1TAFA 5GXQB 3MGQD 5B0ZD 3W96B 4H9RB 1JFIA 3A6NA 3AZIA 4KHAA 5AVCD 5AV8D 4ZUXC 2DF4C 5AV5D 5G49B 4KUDC 4ZUXB 3B0CT 2Y2GA 3KXBA 4X23C 1ZLAC 4KUDB 4LD9C 5B1MD 4NFTA 5E5AC 4X23B 4XUJC 1ZLAB 4LD9B 1HQ3C 1P3AC 5E5AB 2RIQA 4XUJB 3LZ0D 5GT3D 3AN2C 1H3OA 3AL0C 1HQ3B 5B40A 1P3AB 4ZUXD 5CP6D 3AN2B 2JSSA 4WZSB 4KUDD 1T3UA 3O62D 4HGAC 1P3OC 4WJ3C 3AZLC 3LJAA 3C1BA 4X23D 4LD9D 4J8WA 4HGAB 1P3OB 2Y2HA 3AZLB 5E5AD 4E44A 3WTPA 1P3BC 2CV5C 1HQ3D 5B2JA 5B24C 1P3KA 4H9QB 3KUYA 1WWIA 1P3AD 3AN2D 2Y2PA 3RELA 4H9PA 5B24B 5CPJA 2CV5B 2NZDA 4Z66C 3B6FD 3UT9A 1P3OD 4H9SA 4NE3A 4YS3D 3WA9A 1U35C 3MGRA 1P3BD 5DNMC 5BNVB 4UUZB 3X1TA 3MGPC 4J8VD 3W98A 5B24D 1M19C 5GSUD 5DNMB 3WKJA 2J8PA 3MGPB 1M19B 4Z66D 3AZMC 5B31D 3AZEA 5B2IA 5AVBC 4YM6A 3MVDA 5AY8D 3AZMB 2JE5A 2BYKA 5GT0A 5AVBB 1U35D 3VH6W 1M18A 4NE5A 2FJ7C 3B6GC 3NQUA 5CHLB 4Z5TA 3LELA 4AWLC 5B0YC 3REHC 3B6GB 3W97A 4M6BA 4CAYA 2HIOD 2FJ7B 3AZJC 4AWLB 2AROA 5B0YB 3REHB 3UTBC 5B1LC 1AOIC 3AZJB 3KWQB 1EQZD 3UTBB 4WNNA 4EO5C 5B1LB 5BO0B 5AVBD 1AOIB 1F66A 5AV9C 4J8UC 2Y2JA 4J8XC 3AV1A 1P3MA 4EO5B 3AYWB 1M1AA 3WTPE 5AV9B 4J8UB 4J8XB 3FDDA 1TAFB 3A6NC 3AZIC 2G5IC 1JFIB 3A6NB 3AZIB 2NQBD 3MGSA 4DRAA 4KHAB 1AOID 4XZQD 1KU5A 3KXBC 5BS7A 3F6TA 3IP4C 4H9NA 4J8XD 4JJNA 3KXBB 2IO5C 3R45A 4QLCD 2LY8A 3A6ND 1S32A 2IO5B 3EPKA 2VQRA 3X1VA 1W2EA 3MNNA 5B33D 5B40C 3EG5B 1H3OB 3W99A 5B40B 3LJAC 3C1BC 4KGCA 4J8WC 3LJAB 2Y2MA 3C1BB 1KX3A 2NQBA 3TU4A 4J8WB 5B2JC 1P3KC 3WTPB 3KUYC 1N1JA 2JCHA 5B2JB 5CPJC 2NZDC 1P3KB 3KUYB 3REKA 4H9PB 3RELB 3UT9C 3AZGA 3AZHD 5CPJB 2NZDB 3UT9B 1P34A 4H9SC 3WAAA 4J8WD 3WA9C 3H0LC 3MGRC 5BT1C 3X1TC 1P3FA 3WA9B 5GXQD 1KX5A 5B2JD 3MGRB 3W96D 3KUYD 3X1TB 5CPIA 3WKJC 5CPKA 4R8PA 5CPJD 3W98B 2NZDD 1Z2CB 2HUEC 3WKJB 3AZEC 3AZFA 3AZKA 2ZM5A 3REIA 4YM6C 3MVDC 2HUEB 2F8NH 3AZEB 5B2IB 3WA9D 4YM6B 3MVDB 3MGRD 3UTAA 1M18C 5BT1D 4Z5TC 2BYKB 2YFVA 5GT0B 3AFAA 3LELC 1ZLAD 1M18B 3W97C 4CSRA 3NQUB 4Z5TB 3LELB 3A1IA 5DNNA 4XUJD 2AROC 4CAYB 3W97B 2ZY2A 1P3GA 3C1CA 2AROB 5JRGA 4E45A 1P3IA 1F66C 4DRBA 4WNNB 2CWEA 3MGQA 3AV1C 1P3MC 5B0ZA 1F66B 1M1AC 3NQJA 3AV1B 1P3MB 4Z5TD 3AZLD 1M1AB 4ZBJC 1P3PA 2XD5A 2Y2KA 4ZBJB 2F8NG 3MGSC 5B32G 5JA4A 1A7WA 2CV5D 1P3LA 3MGSB 1F66D 5BS7C 2Y2OA 5B1MA 3AV1D 1P3MD 1KX4A 4JJNC 1M1AD 4WU9A 4H9NB 3LZ0A 4JJNB 5GT3A 1S32C 3R45B 3X1VC 3MNNC 5F99A 5CP6A 3X1SA 1S32B 5DNMD 3MGSD 3X1VB 3W99C 3MGPD 3O62A 3MNNB 1M19D 2F8NA 5B32A 3KWQC 3W99B 3X1UA 4KGCC 3VH5W 3AZMD 1KX3C 4KGCB 3TU4C 3AYWC 1S32D 1KX3B 5B31G 1BH9A 3TU4B 3X1VD 2RVQC 3MNND 3B6GD 2FJ7D 3B6FA 1N1JB 5B0YD 3REHD 3REKC 3AZGC 3AZJD 3KWQD 4YS3A 3REKB 3UTBD 1P34C 3AZGB 5B1LD 4KGCD 4Z2MH 1P3BA 1TZYA 1P34B 4J8VA 1P3FC 3P5JB 3WAAB 3AYWD 1KX5C 5AV9D 5GSUA 4J8UD 5CPIC 1P3FB 1KX5B 5CPKC 4R8PC 4Z66A 2ZY3A 5B31A 5CPIB 5CPKB 4R8PB 3AZID 4DQYB 3AZFC 4G91C 3AZKC 5AY8A 3REIC 3VH5A 1P34D 3AZFB 4G91B 2YFWA 3AZKB 1U35A 3REIB 3UTAC 4H9OA 3A1KA 3AFAC 1R4VA 2Y2NA 3KXBD 2HIOA 3UTAB 2FFFB 3AFAB 4WU8A 2YFVB 5DNNC 5CPID 3WTPC 1EQZA 4CSRB 4Z2MG 2F8NK 5DNNB 1P3GC 3C1CC 5JRGC 3REJA 3AZFD 3AZKD 2W8SA 3RELC 1P3IC 3LZ1A 3REID 5B40D 1P3GB 3C1CB 3VH5T 5JRGB 3EPLA 3MGQC 1P3IB 3MGQB 3AFAD 3LJAD 5B0ZB 3C1BD 1P3PC 3NQJB 1ID3A 2BG1A 3WTPD
chains in the Genus database with same CATH topology
1P3PB 4XZQA 2PYOA 3W98C 1P3KD 1P3LC 5AV6A 5JA4B 2BYMA 1P3ID 3RELD 5FUGA 1P3LB 5B1MC 1KX4C 4QLCA 5KDMA 3UT9D 5B2IC 4WU9C 5B1MB 1KX4B 3LZ0C 5GT3C 1P3PD 5GT0C 3H0RC 5B33A 4WU9B 5F99C 5CP6C 5GT3B 3LZ0B 3X1SC 1ULYA 3X1TD 3O62C 5F99B 5CP6B 3AV2A 3X1SB 3W98D 1P3LD 3AZNA 5B32C 1BH8A 3WKJD 3X1UC 3O62B 2F8NB 5B32B 1KX4D 3X1UB 2L5AA 3AZED 5B2ID 4WU9D 4YM6D 3V9RA 3MVDD 5GT0D 3H0MC 5F99D 1BFMA 3X1SD 1M18D 3B6FC 2Y2IA 3LELD 1BH9B 5AVCA 3AZHA 5AV8A 3W97D 3B6FB 2F8ND 5AV5A 3KFUG 5B32D 3X1UD 2AROD 4YS3C 1PZRA 1TZYC 5GXQA 4J8VC 4YS3B 3W96A 1P3BB 4H9RA 1F1EA 5GSUC 1TZYB 4J8VB 4G92C 4NE6A 5GSUB 4G92B 5B31C 5G49A 4Z66B 5AY8C 4ZUXA 5B31B 4KUDA 5AY8B 1TZYD 4X23A 1ZLAA 1U35B 2YFWB 4LD9A 2HIOC 4H9OB 5E5AA 4XUJA 4JJND 4WU8C 2HIOB 1HQ3A 1P3AA 1EQZC 4WU8B 3AN2A 3REJC 1EQZB 3LZ1C 1WWSA 3REJB 3W99D 1P3OA 3LZ1B 3AZLA 2Y2LA 3KSYA 3EPHA 3WAAC 4H9QA 1B67A 1ID3C 2NQBC 4WU8D 5BNXB 1KX3D 4UPKA 2CV5A 5B24A 4XZQC 2UWXA 3EPJA 3TU4D 1ID3B 2PYOC 2NQBB 2ZY4A 1Q9CA 3REJD 4XZQB 5AV6C 2RVQD 2PYOB 3LZ1D 4WV4B 4QLCC 5AV6B 2BYMB 3REKD 5FUGB 3B0CW 3AZGD 4QLCB 5KDMB 5BNVA 4UUZA 2DQNC 5B33C 3WAAD 1ID3D 2G5HC 5DNMA 3MGPA 1P3FD 5B33B 1M19A 1KX5D 2PYOD 3AV2C 3AZNC 5AV6D 1HTAA 5CPKD 4R8PD 2ZY5A 3AV2B 3VH6A 2Y2QA 3AZMA 3AZNB 1BH8B 2XD1A 5AVBA 3B0DC 5B0ZC 3B6GA 2FJ7A 3V9RB 3B0DB 3UTAD 5B0YA 3REHA 5BNXA 5AVCC 3AZHC 5AV8C 2F2AC 3AZJA 3AV2D 3KWQA 5AV5C 5C3IC 5DNND 3UTBA 5B1LA 5AVCB 5BO0A 5AV8B 3AZHB 3AZND 1AOIA 3VH6T 5C3IB 5AV5B 1P3GD 3C1CD 5JRGD 3AYWA 5GXQC 1B6WA 5AV9A 4J8UA 3W96C 4J8XA 3B0BA 1TAFA 5GXQB 3MGQD 5B0ZD 3W96B 4H9RB 1JFIA 3A6NA 3AZIA 4KHAA 5AVCD 5AV8D 4ZUXC 2DF4C 5AV5D 5G49B 4KUDC 4ZUXB 3B0CT 2Y2GA 3KXBA 4X23C 1ZLAC 4KUDB 4LD9C 5B1MD 4NFTA 5E5AC 4X23B 4XUJC 1ZLAB 4LD9B 1HQ3C 1P3AC 5E5AB 2RIQA 4XUJB 3LZ0D 5GT3D 3AN2C 1H3OA 3AL0C 1HQ3B 5B40A 1P3AB 4ZUXD 5CP6D 3AN2B 2JSSA 4WZSB 4KUDD 1T3UA 3O62D 4HGAC 1P3OC 4WJ3C 3AZLC 3LJAA 3C1BA 4X23D 4LD9D 4J8WA 4HGAB 1P3OB 2Y2HA 3AZLB 5E5AD 4E44A 3WTPA 1P3BC 2CV5C 1HQ3D 5B2JA 5B24C 1P3KA 4H9QB 3KUYA 1WWIA 1P3AD 3AN2D 2Y2PA 3RELA 4H9PA 5B24B 5CPJA 2CV5B 2NZDA 4Z66C 3B6FD 3UT9A 1P3OD 4H9SA 4NE3A 4YS3D 3WA9A 1U35C 3MGRA 1P3BD 5DNMC 5BNVB 4UUZB 3X1TA 3MGPC 4J8VD 3W98A 5B24D 1M19C 5GSUD 5DNMB 3WKJA 2J8PA 3MGPB 1M19B 4Z66D 3AZMC 5B31D 3AZEA 5B2IA 5AVBC 4YM6A 3MVDA 5AY8D 3AZMB 2JE5A 2BYKA 5GT0A 5AVBB 1U35D 3VH6W 1M18A 4NE5A 2FJ7C 3B6GC 3NQUA 5CHLB 4Z5TA 3LELA 4AWLC 5B0YC 3REHC 3B6GB 3W97A 4M6BA 4CAYA 2HIOD 2FJ7B 3AZJC 4AWLB 2AROA 5B0YB 3REHB 3UTBC 5B1LC 1AOIC 3AZJB 3KWQB 1EQZD 3UTBB 4WNNA 4EO5C 5B1LB 5BO0B 5AVBD 1AOIB 1F66A 5AV9C 4J8UC 2Y2JA 4J8XC 3AV1A 1P3MA 4EO5B 3AYWB 1M1AA 3WTPE 5AV9B 4J8UB 4J8XB 3FDDA 1TAFB 3A6NC 3AZIC 2G5IC 1JFIB 3A6NB 3AZIB 2NQBD 3MGSA 4DRAA 4KHAB 1AOID 4XZQD 1KU5A 3KXBC 5BS7A 3F6TA 3IP4C 4H9NA 4J8XD 4JJNA 3KXBB 2IO5C 3R45A 4QLCD 2LY8A 3A6ND 1S32A 2IO5B 3EPKA 2VQRA 3X1VA 1W2EA 3MNNA 5B33D 5B40C 3EG5B 1H3OB 3W99A 5B40B 3LJAC 3C1BC 4KGCA 4J8WC 3LJAB 2Y2MA 3C1BB 1KX3A 2NQBA 3TU4A 4J8WB 5B2JC 1P3KC 3WTPB 3KUYC 1N1JA 2JCHA 5B2JB 5CPJC 2NZDC 1P3KB 3KUYB 3REKA 4H9PB 3RELB 3UT9C 3AZGA 3AZHD 5CPJB 2NZDB 3UT9B 1P34A 4H9SC 3WAAA 4J8WD 3WA9C 3H0LC 3MGRC 5BT1C 3X1TC 1P3FA 3WA9B 5GXQD 1KX5A 5B2JD 3MGRB 3W96D 3KUYD 3X1TB 5CPIA 3WKJC 5CPKA 4R8PA 5CPJD 3W98B 2NZDD 1Z2CB 2HUEC 3WKJB 3AZEC 3AZFA 3AZKA 2ZM5A 3REIA 4YM6C 3MVDC 2HUEB 2F8NH 3AZEB 5B2IB 3WA9D 4YM6B 3MVDB 3MGRD 3UTAA 1M18C 5BT1D 4Z5TC 2BYKB 2YFVA 5GT0B 3AFAA 3LELC 1ZLAD 1M18B 3W97C 4CSRA 3NQUB 4Z5TB 3LELB 3A1IA 5DNNA 4XUJD 2AROC 4CAYB 3W97B 2ZY2A 1P3GA 3C1CA 2AROB 5JRGA 4E45A 1P3IA 1F66C 4DRBA 4WNNB 2CWEA 3MGQA 3AV1C 1P3MC 5B0ZA 1F66B 1M1AC 3NQJA 3AV1B 1P3MB 4Z5TD 3AZLD 1M1AB 4ZBJC 1P3PA 2XD5A 2Y2KA 4ZBJB 2F8NG 3MGSC 5B32G 5JA4A 1A7WA 2CV5D 1P3LA 3MGSB 1F66D 5BS7C 2Y2OA 5B1MA 3AV1D 1P3MD 1KX4A 4JJNC 1M1AD 4WU9A 4H9NB 3LZ0A 4JJNB 5GT3A 1S32C 3R45B 3X1VC 3MNNC 5F99A 5CP6A 3X1SA 1S32B 5DNMD 3MGSD 3X1VB 3W99C 3MGPD 3O62A 3MNNB 1M19D 2F8NA 5B32A 3KWQC 3W99B 3X1UA 4KGCC 3VH5W 3AZMD 1KX3C 4KGCB 3TU4C 3AYWC 1S32D 1KX3B 5B31G 1BH9A 3TU4B 3X1VD 2RVQC 3MNND 3B6GD 2FJ7D 3B6FA 1N1JB 5B0YD 3REHD 3REKC 3AZGC 3AZJD 3KWQD 4YS3A 3REKB 3UTBD 1P34C 3AZGB 5B1LD 4KGCD 4Z2MH 1P3BA 1TZYA 1P34B 4J8VA 1P3FC 3P5JB 3WAAB 3AYWD 1KX5C 5AV9D 5GSUA 4J8UD 5CPIC 1P3FB 1KX5B 5CPKC 4R8PC 4Z66A 2ZY3A 5B31A 5CPIB 5CPKB 4R8PB 3AZID 4DQYB 3AZFC 4G91C 3AZKC 5AY8A 3REIC 3VH5A 1P34D 3AZFB 4G91B 2YFWA 3AZKB 1U35A 3REIB 3UTAC 4H9OA 3A1KA 3AFAC 1R4VA 2Y2NA 3KXBD 2HIOA 3UTAB 2FFFB 3AFAB 4WU8A 2YFVB 5DNNC 5CPID 3WTPC 1EQZA 4CSRB 4Z2MG 2F8NK 5DNNB 1P3GC 3C1CC 5JRGC 3REJA 3AZFD 3AZKD 2W8SA 3RELC 1P3IC 3LZ1A 3REID 5B40D 1P3GB 3C1CB 3VH5T 5JRGB 3EPLA 3MGQC 1P3IB 3MGQB 3AFAD 3LJAD 5B0ZB 3C1BD 1P3PC 3NQJB 1ID3A 2BG1A 3WTPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P B;  4XZQ A;  2PYO A;  3W98 C;  1P3K D;  1P3L C;  5AV6 A;  5JA4 B;  2BYM A;  1P3I D;  3REL D;  5FUG A;  1P3L B;  5B1M C;  1KX4 C;  4QLC A;  5KDM A;  3UT9 D;  5B2I C;  4WU9 C;  5B1M B;  1KX4 B;  3LZ0 C;  5GT3 C;  1P3P D;  5GT0 C;  4WU9 B;  5B33 A;  5F99 C;  5CP6 C;  5GT3 B;  3LZ0 B;  3X1S C;  1ULY A;  3X1T D;  3O62 C;  5F99 B;  5CP6 B;  3AV2 A;  3X1S B;  3W98 D;  1P3L D;  3AZN A;  5B32 C;  1BH8 A;  3WKJ D;  3X1U C;  3O62 B;  2F8N B;  5B32 B;  1KX4 D;  3X1U B;  2L5A A;  3AZE D;  5B2I D;  4WU9 D;  4YM6 D;  3V9R A;  3MVD D;  5GT0 D;  5F99 D;  1BFM A;  3X1S D;  1M18 D;  3B6F C;  3LEL D;  1BH9 B;  5AVC A;  3AZH A;  5AV8 A;  3W97 D;  3B6F B;  2F8N D;  5AV5 A;  5B32 D;  3X1U D;  2ARO D;  4YS3 C;  1TZY C;  4YS3 B;  5GXQ A;  4J8V C;  3W96 A;  1P3B B;  4H9R A;  1F1E A;  5GSU C;  1TZY B;  4J8V B;  4G92 C;  4NE6 A;  5GSU B;  4G92 B;  5B31 C;  5G49 A;  4Z66 B;  5AY8 C;  4ZUX A;  5B31 B;  4KUD A;  5AY8 B;  1TZY D;  4X23 A;  1ZLA A;  1U35 B;  2YFW B;  4LD9 A;  2HIO C;  4H9O B;  5E5A A;  4XUJ A;  4JJN D;  4WU8 C;  2HIO B;  1HQ3 A;  1P3A A;  1EQZ C;  4WU8 B;  3AN2 A;  3REJ C;  1EQZ B;  3LZ1 C;  1WWS A;  3REJ B;  3W99 D;  1P3O A;  3LZ1 B;  3AZL A;  3KSY A;  3WAA C;  4H9Q A;  1B67 A;  1ID3 C;  2NQB C;  4WU8 D;  5BNX B;  1KX3 D;  2CV5 A;  5B24 A;  4XZQ C;  3TU4 D;  1ID3 B;  2PYO C;  2NQB B;  1Q9C A;  3REJ D;  4XZQ B;  5AV6 C;  2RVQ D;  2PYO B;  3LZ1 D;  4WV4 B;  4QLC C;  5AV6 B;  2BYM B;  3REK D;  5FUG B;  3B0C W;  3AZG D;  4QLC B;  5KDM B;  5BNV A;  4UUZ A;  5B33 C;  3WAA D;  1ID3 D;  5DNM A;  3MGP A;  1P3F D;  5B33 B;  1M19 A;  1KX5 D;  2PYO D;  3AV2 C;  3AZN C;  5AV6 D;  1HTA A;  5CPK D;  4R8P D;  3AV2 B;  3VH6 A;  3AZM A;  3AZN B;  1BH8 B;  5AVB A;  3B0D C;  5B0Z C;  3B6G A;  2FJ7 A;  3V9R B;  3B0D B;  3UTA D;  5B0Y A;  3REH A;  5BNX A;  5AVC C;  3AZH C;  5AV8 C;  3AZJ A;  3AV2 D;  3KWQ A;  5AV5 C;  5C3I C;  5DNN D;  3UTB A;  5B1L A;  5AVC B;  5BO0 A;  5AV8 B;  3AZH B;  3AZN D;  1AOI A;  3VH6 T;  5C3I B;  5AV5 B;  1P3G D;  3C1C D;  5JRG D;  3AYW A;  5GXQ C;  1B6W A;  5AV9 A;  4J8U A;  3W96 C;  4J8X A;  3B0B A;  1TAF A;  5GXQ B;  3MGQ D;  5B0Z D;  3W96 B;  4H9R B;  1JFI A;  3A6N A;  3AZI A;  4KHA A;  5AVC D;  5AV8 D;  4ZUX C;  5AV5 D;  5G49 B;  4KUD C;  4ZUX B;  3B0C T;  3KXB A;  4X23 C;  1ZLA C;  4KUD B;  4LD9 C;  5B1M D;  4NFT A;  5E5A C;  4X23 B;  4XUJ C;  1ZLA B;  4LD9 B;  1HQ3 C;  1P3A C;  5E5A B;  4XUJ B;  3LZ0 D;  5GT3 D;  3AN2 C;  1H3O A;  1HQ3 B;  5B40 A;  1P3A B;  4ZUX D;  5CP6 D;  3AN2 B;  2JSS A;  4WZS B;  4KUD D;  3O62 D;  4HGA C;  1P3O C;  3AZL C;  3LJA A;  3C1B A;  4X23 D;  4LD9 D;  4J8W A;  4HGA B;  1P3O B;  3AZL B;  5E5A D;  4E44 A;  3WTP A;  1P3B C;  2CV5 C;  1HQ3 D;  5B2J A;  5B24 C;  1P3K A;  4H9Q B;  3KUY A;  1WWI A;  1P3A D;  3AN2 D;  3REL A;  4H9P A;  5B24 B;  5CPJ A;  2CV5 B;  2NZD A;  4Z66 C;  3B6F D;  3UT9 A;  1P3O D;  4H9S A;  4NE3 A;  4YS3 D;  3WA9 A;  1U35 C;  3MGR A;  1P3B D;  5DNM C;  5BNV B;  4UUZ B;  3X1T A;  3MGP C;  4J8V D;  3W98 A;  5B24 D;  1M19 C;  5GSU D;  5DNM B;  3WKJ A;  3MGP B;  1M19 B;  4Z66 D;  3AZM C;  5B31 D;  3AZE A;  5B2I A;  5AVB C;  4YM6 A;  3MVD A;  5AY8 D;  3AZM B;  2BYK A;  5GT0 A;  5AVB B;  1U35 D;  3VH6 W;  1M18 A;  4NE5 A;  2FJ7 C;  3B6G C;  3NQU A;  5CHL B;  4Z5T A;  3LEL A;  4AWL C;  5B0Y C;  3REH C;  3B6G B;  3W97 A;  4M6B A;  4CAY A;  2HIO D;  2FJ7 B;  3AZJ C;  4AWL B;  2ARO A;  5B0Y B;  3REH B;  3UTB C;  5B1L C;  1AOI C;  3AZJ B;  3KWQ B;  1EQZ D;  3UTB B;  4WNN A;  4EO5 C;  5B1L B;  5BO0 B;  5AVB D;  1AOI B;  1F66 A;  5AV9 C;  4J8U C;  4J8X C;  3AV1 A;  1P3M A;  4EO5 B;  3AYW B;  1M1A A;  3WTP E;  5AV9 B;  4J8U B;  4J8X B;  1TAF B;  3A6N C;  3AZI C;  1JFI B;  3A6N B;  3AZI B;  2NQB D;  3MGS A;  4DRA A;  4KHA B;  1AOI D;  4XZQ D;  1KU5 A;  3KXB C;  5BS7 A;  4H9N A;  4J8X D;  4JJN A;  3KXB B;  2IO5 C;  3R45 A;  4QLC D;  2LY8 A;  3A6N D;  1S32 A;  2IO5 B;  3X1V A;  3MNN A;  5B33 D;  5B40 C;  1H3O B;  3W99 A;  5B40 B;  3LJA C;  3C1B C;  4KGC A;  4J8W C;  3LJA B;  3C1B B;  1KX3 A;  3TU4 A;  4J8W B;  5B2J C;  1P3K C;  3WTP B;  3KUY C;  1N1J A;  5B2J B;  5CPJ C;  2NZD C;  1P3K B;  3KUY B;  3REK A;  4H9P B;  3REL B;  3UT9 C;  3AZG A;  3AZH D;  5CPJ B;  2NZD B;  3UT9 B;  1P34 A;  4H9S C;  3WAA A;  4J8W D;  3WA9 C;  3MGR C;  5BT1 C;  3X1T C;  1P3F A;  3WA9 B;  5GXQ D;  1KX5 A;  5B2J D;  3MGR B;  3W96 D;  3KUY D;  3X1T B;  5CPI A;  3WKJ C;  5CPK A;  4R8P A;  5CPJ D;  3W98 B;  2NZD D;  2HUE C;  3WKJ B;  3AZE C;  3AZF A;  3AZK A;  3REI A;  4YM6 C;  3MVD C;  2HUE B;  2F8N H;  3AZE B;  5B2I B;  3WA9 D;  4YM6 B;  3MVD B;  3MGR D;  3UTA A;  1M18 C;  5BT1 D;  4Z5T C;  2BYK B;  2YFV A;  5GT0 B;  3AFA A;  3LEL C;  1ZLA D;  1M18 B;  3W97 C;  4CSR A;  3NQU B;  4Z5T B;  3LEL B;  5DNN A;  4XUJ D;  2ARO C;  4CAY B;  3W97 B;  1P3G A;  3C1C A;  2ARO B;  5JRG A;  4E45 A;  1P3I A;  1F66 C;  4DRB A;  4WNN B;  2CWE A;  3MGQ A;  3AV1 C;  1P3M C;  5B0Z A;  1F66 B;  1M1A C;  3NQJ A;  3AV1 B;  1P3M B;  4Z5T D;  3AZL D;  1M1A B;  4ZBJ C;  1P3P A;  4ZBJ B;  2F8N G;  3MGS C;  5B32 G;  5JA4 A;  1A7W A;  2CV5 D;  1P3L A;  3MGS B;  1F66 D;  5BS7 C;  5B1M A;  3AV1 D;  1P3M D;  1KX4 A;  4JJN C;  1M1A D;  4WU9 A;  4H9N B;  3LZ0 A;  4JJN B;  5GT3 A;  1S32 C;  3R45 B;  3X1V C;  3MNN C;  5F99 A;  5CP6 A;  3X1S A;  1S32 B;  5DNM D;  3MGS D;  3X1V B;  3W99 C;  3MGP D;  3O62 A;  3MNN B;  1M19 D;  2F8N A;  5B32 A;  3KWQ C;  3W99 B;  3X1U A;  4KGC C;  3VH5 W;  3AZM D;  1KX3 C;  4KGC B;  3TU4 C;  3AYW C;  1S32 D;  1KX3 B;  5B31 G;  1BH9 A;  3TU4 B;  3X1V D;  2RVQ C;  3MNN D;  3B6G D;  2FJ7 D;  3B6F A;  1N1J B;  5B0Y D;  3REH D;  3REK C;  3AZG C;  3AZJ D;  3KWQ D;  4YS3 A;  3REK B;  3UTB D;  1P34 C;  3AZG B;  5B1L D;  4KGC D;  4Z2M H;  1P3B A;  1TZY A;  1P34 B;  4J8V A;  1P3F C;  3WAA B;  3AYW D;  1KX5 C;  5AV9 D;  5GSU A;  4J8U D;  5CPI C;  1P3F B;  1KX5 B;  5CPK C;  4R8P C;  4Z66 A;  5B31 A;  5CPI B;  5CPK B;  4R8P B;  3AZI D;  3AZF C;  4G91 C;  3AZK C;  5AY8 A;  3REI C;  3VH5 A;  1P34 D;  3AZF B;  4G91 B;  2YFW A;  3AZK B;  1U35 A;  3REI B;  3UTA C;  4H9O A;  3AFA C;  1R4V A;  3KXB D;  2HIO A;  3UTA B;  3AFA B;  4WU8 A;  2YFV B;  5DNN C;  5CPI D;  3WTP C;  1EQZ A;  4CSR B;  4Z2M G;  2F8N K;  5DNN B;  1P3G C;  3C1C C;  5JRG C;  3REJ A;  3AZF D;  3AZK D;  1P3I C;  3REL C;  3LZ1 A;  3REI D;  5B40 D;  1P3G B;  3C1C B;  3VH5 T;  5JRG B;  3MGQ C;  1P3I B;  3MGQ B;  3AFA D;  3LJA D;  5B0Z B;  3C1B D;  1P3P C;  3NQJ B;  1ID3 A;  2NQB A;  3WTP D; 
#chains in the Genus database with same CATH topology
 1P3P B;  4XZQ A;  2PYO A;  3W98 C;  1P3K D;  1P3L C;  5AV6 A;  5JA4 B;  2BYM A;  1P3I D;  3REL D;  5FUG A;  1P3L B;  5B1M C;  1KX4 C;  4QLC A;  5KDM A;  3UT9 D;  5B2I C;  4WU9 C;  5B1M B;  1KX4 B;  3LZ0 C;  5GT3 C;  1P3P D;  5GT0 C;  3H0R C;  5B33 A;  4WU9 B;  5F99 C;  5CP6 C;  5GT3 B;  3LZ0 B;  3X1S C;  1ULY A;  3X1T D;  3O62 C;  5F99 B;  5CP6 B;  3AV2 A;  3X1S B;  3W98 D;  1P3L D;  3AZN A;  5B32 C;  1BH8 A;  3WKJ D;  3X1U C;  3O62 B;  2F8N B;  5B32 B;  1KX4 D;  3X1U B;  2L5A A;  3AZE D;  5B2I D;  4WU9 D;  4YM6 D;  3V9R A;  3MVD D;  5GT0 D;  3H0M C;  5F99 D;  1BFM A;  3X1S D;  1M18 D;  3B6F C;  2Y2I A;  3LEL D;  1BH9 B;  5AVC A;  3AZH A;  5AV8 A;  3W97 D;  3B6F B;  2F8N D;  5AV5 A;  3KFU G;  5B32 D;  3X1U D;  2ARO D;  4YS3 C;  1PZR A;  1TZY C;  5GXQ A;  4J8V C;  4YS3 B;  3W96 A;  1P3B B;  4H9R A;  1F1E A;  5GSU C;  1TZY B;  4J8V B;  4G92 C;  4NE6 A;  5GSU B;  4G92 B;  5B31 C;  5G49 A;  4Z66 B;  5AY8 C;  4ZUX A;  5B31 B;  4KUD A;  5AY8 B;  1TZY D;  4X23 A;  1ZLA A;  1U35 B;  2YFW B;  4LD9 A;  2HIO C;  4H9O B;  5E5A A;  4XUJ A;  4JJN D;  4WU8 C;  2HIO B;  1HQ3 A;  1P3A A;  1EQZ C;  4WU8 B;  3AN2 A;  3REJ C;  1EQZ B;  3LZ1 C;  1WWS A;  3REJ B;  3W99 D;  1P3O A;  3LZ1 B;  3AZL A;  2Y2L A;  3KSY A;  3EPH A;  3WAA C;  4H9Q A;  1B67 A;  1ID3 C;  2NQB C;  4WU8 D;  5BNX B;  1KX3 D;  4UPK A;  2CV5 A;  5B24 A;  4XZQ C;  2UWX A;  3EPJ A;  3TU4 D;  1ID3 B;  2PYO C;  2NQB B;  2ZY4 A;  1Q9C A;  3REJ D;  4XZQ B;  5AV6 C;  2RVQ D;  2PYO B;  3LZ1 D;  4WV4 B;  4QLC C;  5AV6 B;  2BYM B;  3REK D;  5FUG B;  3B0C W;  3AZG D;  4QLC B;  5KDM B;  5BNV A;  4UUZ A;  2DQN C;  5B33 C;  3WAA D;  1ID3 D;  2G5H C;  5DNM A;  3MGP A;  1P3F D;  5B33 B;  1M19 A;  1KX5 D;  2PYO D;  3AV2 C;  3AZN C;  5AV6 D;  1HTA A;  5CPK D;  4R8P D;  2ZY5 A;  3AV2 B;  3VH6 A;  2Y2Q A;  3AZM A;  3AZN B;  1BH8 B;  2XD1 A;  5AVB A;  3B0D C;  5B0Z C;  3B6G A;  2FJ7 A;  3V9R B;  3B0D B;  3UTA D;  5B0Y A;  3REH A;  5BNX A;  5AVC C;  3AZH C;  5AV8 C;  2F2A C;  3AZJ A;  3AV2 D;  3KWQ A;  5AV5 C;  5C3I C;  5DNN D;  3UTB A;  5B1L A;  5AVC B;  5BO0 A;  5AV8 B;  3AZH B;  3AZN D;  1AOI A;  3VH6 T;  5C3I B;  5AV5 B;  1P3G D;  3C1C D;  5JRG D;  3AYW A;  5GXQ C;  1B6W A;  5AV9 A;  4J8U A;  3W96 C;  4J8X A;  3B0B A;  1TAF A;  5GXQ B;  3MGQ D;  5B0Z D;  3W96 B;  4H9R B;  1JFI A;  3A6N A;  3AZI A;  4KHA A;  5AVC D;  5AV8 D;  4ZUX C;  2DF4 C;  5AV5 D;  5G49 B;  4KUD C;  4ZUX B;  3B0C T;  2Y2G A;  3KXB A;  4X23 C;  1ZLA C;  4KUD B;  4LD9 C;  5B1M D;  4NFT A;  5E5A C;  4X23 B;  4XUJ C;  1ZLA B;  4LD9 B;  1HQ3 C;  1P3A C;  5E5A B;  2RIQ A;  4XUJ B;  3LZ0 D;  5GT3 D;  3AN2 C;  1H3O A;  3AL0 C;  1HQ3 B;  5B40 A;  1P3A B;  4ZUX D;  5CP6 D;  3AN2 B;  2JSS A;  4WZS B;  4KUD D;  1T3U A;  3O62 D;  4HGA C;  1P3O C;  4WJ3 C;  3AZL C;  3LJA A;  3C1B A;  4X23 D;  4LD9 D;  4J8W A;  4HGA B;  1P3O B;  2Y2H A;  3AZL B;  5E5A D;  4E44 A;  3WTP A;  1P3B C;  2CV5 C;  1HQ3 D;  5B2J A;  5B24 C;  1P3K A;  4H9Q B;  3KUY A;  1WWI A;  1P3A D;  3AN2 D;  2Y2P A;  3REL A;  4H9P A;  5B24 B;  5CPJ A;  2CV5 B;  2NZD A;  4Z66 C;  3B6F D;  3UT9 A;  1P3O D;  4H9S A;  4NE3 A;  4YS3 D;  3WA9 A;  1U35 C;  3MGR A;  1P3B D;  5DNM C;  5BNV B;  4UUZ B;  3X1T A;  3MGP C;  4J8V D;  3W98 A;  5B24 D;  1M19 C;  5GSU D;  5DNM B;  3WKJ A;  2J8P A;  3MGP B;  1M19 B;  4Z66 D;  3AZM C;  5B31 D;  3AZE A;  5B2I A;  5AVB C;  4YM6 A;  3MVD A;  5AY8 D;  3AZM B;  2JE5 A;  2BYK A;  5GT0 A;  5AVB B;  1U35 D;  3VH6 W;  1M18 A;  4NE5 A;  2FJ7 C;  3B6G C;  3NQU A;  5CHL B;  4Z5T A;  3LEL A;  4AWL C;  5B0Y C;  3REH C;  3B6G B;  3W97 A;  4M6B A;  4CAY A;  2HIO D;  2FJ7 B;  3AZJ C;  4AWL B;  2ARO A;  5B0Y B;  3REH B;  3UTB C;  5B1L C;  1AOI C;  3AZJ B;  3KWQ B;  1EQZ D;  3UTB B;  4WNN A;  4EO5 C;  5B1L B;  5BO0 B;  5AVB D;  1AOI B;  1F66 A;  5AV9 C;  4J8U C;  2Y2J A;  4J8X C;  3AV1 A;  1P3M A;  4EO5 B;  3AYW B;  1M1A A;  3WTP E;  5AV9 B;  4J8U B;  4J8X B;  3FDD A;  1TAF B;  3A6N C;  3AZI C;  2G5I C;  1JFI B;  3A6N B;  3AZI B;  2NQB D;  3MGS A;  4DRA A;  4KHA B;  1AOI D;  4XZQ D;  1KU5 A;  3KXB C;  5BS7 A;  3F6T A;  3IP4 C;  4H9N A;  4J8X D;  4JJN A;  3KXB B;  2IO5 C;  3R45 A;  4QLC D;  2LY8 A;  3A6N D;  1S32 A;  2IO5 B;  3EPK A;  2VQR A;  3X1V A;  1W2E A;  3MNN A;  5B33 D;  5B40 C;  3EG5 B;  1H3O B;  3W99 A;  5B40 B;  3LJA C;  3C1B C;  4KGC A;  4J8W C;  3LJA B;  2Y2M A;  3C1B B;  1KX3 A;  2NQB A;  3TU4 A;  4J8W B;  5B2J C;  1P3K C;  3WTP B;  3KUY C;  1N1J A;  2JCH A;  5B2J B;  5CPJ C;  2NZD C;  1P3K B;  3KUY B;  3REK A;  4H9P B;  3REL B;  3UT9 C;  3AZG A;  3AZH D;  5CPJ B;  2NZD B;  3UT9 B;  1P34 A;  4H9S C;  3WAA A;  4J8W D;  3WA9 C;  3H0L C;  3MGR C;  5BT1 C;  3X1T C;  1P3F A;  3WA9 B;  5GXQ D;  1KX5 A;  5B2J D;  3MGR B;  3W96 D;  3KUY D;  3X1T B;  5CPI A;  3WKJ C;  5CPK A;  4R8P A;  5CPJ D;  3W98 B;  2NZD D;  1Z2C B;  2HUE C;  3WKJ B;  3AZE C;  3AZF A;  3AZK A;  2ZM5 A;  3REI A;  4YM6 C;  3MVD C;  2HUE B;  2F8N H;  3AZE B;  5B2I B;  3WA9 D;  4YM6 B;  3MVD B;  3MGR D;  3UTA A;  1M18 C;  5BT1 D;  4Z5T C;  2BYK B;  2YFV A;  5GT0 B;  3AFA A;  3LEL C;  1ZLA D;  1M18 B;  3W97 C;  4CSR A;  3NQU B;  4Z5T B;  3LEL B;  3A1I A;  5DNN A;  4XUJ D;  2ARO C;  4CAY B;  3W97 B;  2ZY2 A;  1P3G A;  3C1C A;  2ARO B;  5JRG A;  4E45 A;  1P3I A;  1F66 C;  4DRB A;  4WNN B;  2CWE A;  3MGQ A;  3AV1 C;  1P3M C;  5B0Z A;  1F66 B;  1M1A C;  3NQJ A;  3AV1 B;  1P3M B;  4Z5T D;  3AZL D;  1M1A B;  4ZBJ C;  1P3P A;  2XD5 A;  2Y2K A;  4ZBJ B;  2F8N G;  3MGS C;  5B32 G;  5JA4 A;  1A7W A;  2CV5 D;  1P3L A;  3MGS B;  1F66 D;  5BS7 C;  2Y2O A;  5B1M A;  3AV1 D;  1P3M D;  1KX4 A;  4JJN C;  1M1A D;  4WU9 A;  4H9N B;  3LZ0 A;  4JJN B;  5GT3 A;  1S32 C;  3R45 B;  3X1V C;  3MNN C;  5F99 A;  5CP6 A;  3X1S A;  1S32 B;  5DNM D;  3MGS D;  3X1V B;  3W99 C;  3MGP D;  3O62 A;  3MNN B;  1M19 D;  2F8N A;  5B32 A;  3KWQ C;  3W99 B;  3X1U A;  4KGC C;  3VH5 W;  3AZM D;  1KX3 C;  4KGC B;  3TU4 C;  3AYW C;  1S32 D;  1KX3 B;  5B31 G;  1BH9 A;  3TU4 B;  3X1V D;  2RVQ C;  3MNN D;  3B6G D;  2FJ7 D;  3B6F A;  1N1J B;  5B0Y D;  3REH D;  3REK C;  3AZG C;  3AZJ D;  3KWQ D;  4YS3 A;  3REK B;  3UTB D;  1P34 C;  3AZG B;  5B1L D;  4KGC D;  4Z2M H;  1P3B A;  1TZY A;  1P34 B;  4J8V A;  1P3F C;  3P5J B;  3WAA B;  3AYW D;  1KX5 C;  5AV9 D;  5GSU A;  4J8U D;  5CPI C;  1P3F B;  1KX5 B;  5CPK C;  4R8P C;  4Z66 A;  2ZY3 A;  5B31 A;  5CPI B;  5CPK B;  4R8P B;  3AZI D;  4DQY B;  3AZF C;  4G91 C;  3AZK C;  5AY8 A;  3REI C;  3VH5 A;  1P34 D;  3AZF B;  4G91 B;  2YFW A;  3AZK B;  1U35 A;  3REI B;  3UTA C;  4H9O A;  3A1K A;  3AFA C;  1R4V A;  2Y2N A;  3KXB D;  2HIO A;  3UTA B;  2FFF B;  3AFA B;  4WU8 A;  2YFV B;  5DNN C;  5CPI D;  3WTP C;  1EQZ A;  4CSR B;  4Z2M G;  2F8N K;  5DNN B;  1P3G C;  3C1C C;  5JRG C;  3REJ A;  3AZF D;  3AZK D;  2W8S A;  3REL C;  1P3I C;  3LZ1 A;  3REI D;  5B40 D;  1P3G B;  3C1C B;  3VH5 T;  5JRG B;  3EPL A;  3MGQ C;  1P3I B;  3MGQ B;  3AFA D;  3LJA D;  5B0Z B;  3C1B D;  1P3P C;  3NQJ B;  1ID3 A;  2BG1 A;  3WTP D; 
#chains in the Genus database with same CATH homology
 1P3P B;  4XZQ A;  2PYO A;  3W98 C;  1P3K D;  1P3L C;  5AV6 A;  5JA4 B;  2BYM A;  1P3I D;  3REL D;  5FUG A;  1P3L B;  5B1M C;  1KX4 C;  4QLC A;  5KDM A;  3UT9 D;  5B2I C;  4WU9 C;  5B1M B;  1KX4 B;  3LZ0 C;  5GT3 C;  1P3P D;  5GT0 C;  3H0R C;  5B33 A;  4WU9 B;  5F99 C;  5CP6 C;  5GT3 B;  3LZ0 B;  3X1S C;  1ULY A;  3X1T D;  3O62 C;  5F99 B;  5CP6 B;  3AV2 A;  3X1S B;  3W98 D;  1P3L D;  3AZN A;  5B32 C;  1BH8 A;  3WKJ D;  3X1U C;  3O62 B;  2F8N B;  5B32 B;  1KX4 D;  3X1U B;  2L5A A;  3AZE D;  5B2I D;  4WU9 D;  4YM6 D;  3V9R A;  3MVD D;  5GT0 D;  3H0M C;  5F99 D;  1BFM A;  3X1S D;  1M18 D;  3B6F C;  2Y2I A;  3LEL D;  1BH9 B;  5AVC A;  3AZH A;  5AV8 A;  3W97 D;  3B6F B;  2F8N D;  5AV5 A;  3KFU G;  5B32 D;  3X1U D;  2ARO D;  4YS3 C;  1PZR A;  1TZY C;  5GXQ A;  4J8V C;  4YS3 B;  3W96 A;  1P3B B;  4H9R A;  1F1E A;  5GSU C;  1TZY B;  4J8V B;  4G92 C;  4NE6 A;  5GSU B;  4G92 B;  5B31 C;  5G49 A;  4Z66 B;  5AY8 C;  4ZUX A;  5B31 B;  4KUD A;  5AY8 B;  1TZY D;  4X23 A;  1ZLA A;  1U35 B;  2YFW B;  4LD9 A;  2HIO C;  4H9O B;  5E5A A;  4XUJ A;  4JJN D;  4WU8 C;  2HIO B;  1HQ3 A;  1P3A A;  1EQZ C;  4WU8 B;  3AN2 A;  3REJ C;  1EQZ B;  3LZ1 C;  1WWS A;  3REJ B;  3W99 D;  1P3O A;  3LZ1 B;  3AZL A;  2Y2L A;  3KSY A;  3EPH A;  3WAA C;  4H9Q A;  1B67 A;  1ID3 C;  2NQB C;  4WU8 D;  5BNX B;  1KX3 D;  4UPK A;  2CV5 A;  5B24 A;  4XZQ C;  2UWX A;  3EPJ A;  3TU4 D;  1ID3 B;  2PYO C;  2NQB B;  2ZY4 A;  1Q9C A;  3REJ D;  4XZQ B;  5AV6 C;  2RVQ D;  2PYO B;  3LZ1 D;  4WV4 B;  4QLC C;  5AV6 B;  2BYM B;  3REK D;  5FUG B;  3B0C W;  3AZG D;  4QLC B;  5KDM B;  5BNV A;  4UUZ A;  2DQN C;  5B33 C;  3WAA D;  1ID3 D;  2G5H C;  5DNM A;  3MGP A;  1P3F D;  5B33 B;  1M19 A;  1KX5 D;  2PYO D;  3AV2 C;  3AZN C;  5AV6 D;  1HTA A;  5CPK D;  4R8P D;  2ZY5 A;  3AV2 B;  3VH6 A;  2Y2Q A;  3AZM A;  3AZN B;  1BH8 B;  2XD1 A;  5AVB A;  3B0D C;  5B0Z C;  3B6G A;  2FJ7 A;  3V9R B;  3B0D B;  3UTA D;  5B0Y A;  3REH A;  5BNX A;  5AVC C;  3AZH C;  5AV8 C;  2F2A C;  3AZJ A;  3AV2 D;  3KWQ A;  5AV5 C;  5C3I C;  5DNN D;  3UTB A;  5B1L A;  5AVC B;  5BO0 A;  5AV8 B;  3AZH B;  3AZN D;  1AOI A;  3VH6 T;  5C3I B;  5AV5 B;  1P3G D;  3C1C D;  5JRG D;  3AYW A;  5GXQ C;  1B6W A;  5AV9 A;  4J8U A;  3W96 C;  4J8X A;  3B0B A;  1TAF A;  5GXQ B;  3MGQ D;  5B0Z D;  3W96 B;  4H9R B;  1JFI A;  3A6N A;  3AZI A;  4KHA A;  5AVC D;  5AV8 D;  4ZUX C;  2DF4 C;  5AV5 D;  5G49 B;  4KUD C;  4ZUX B;  3B0C T;  2Y2G A;  3KXB A;  4X23 C;  1ZLA C;  4KUD B;  4LD9 C;  5B1M D;  4NFT A;  5E5A C;  4X23 B;  4XUJ C;  1ZLA B;  4LD9 B;  1HQ3 C;  1P3A C;  5E5A B;  2RIQ A;  4XUJ B;  3LZ0 D;  5GT3 D;  3AN2 C;  1H3O A;  3AL0 C;  1HQ3 B;  5B40 A;  1P3A B;  4ZUX D;  5CP6 D;  3AN2 B;  2JSS A;  4WZS B;  4KUD D;  1T3U A;  3O62 D;  4HGA C;  1P3O C;  4WJ3 C;  3AZL C;  3LJA A;  3C1B A;  4X23 D;  4LD9 D;  4J8W A;  4HGA B;  1P3O B;  2Y2H A;  3AZL B;  5E5A D;  4E44 A;  3WTP A;  1P3B C;  2CV5 C;  1HQ3 D;  5B2J A;  5B24 C;  1P3K A;  4H9Q B;  3KUY A;  1WWI A;  1P3A D;  3AN2 D;  2Y2P A;  3REL A;  4H9P A;  5B24 B;  5CPJ A;  2CV5 B;  2NZD A;  4Z66 C;  3B6F D;  3UT9 A;  1P3O D;  4H9S A;  4NE3 A;  4YS3 D;  3WA9 A;  1U35 C;  3MGR A;  1P3B D;  5DNM C;  5BNV B;  4UUZ B;  3X1T A;  3MGP C;  4J8V D;  3W98 A;  5B24 D;  1M19 C;  5GSU D;  5DNM B;  3WKJ A;  2J8P A;  3MGP B;  1M19 B;  4Z66 D;  3AZM C;  5B31 D;  3AZE A;  5B2I A;  5AVB C;  4YM6 A;  3MVD A;  5AY8 D;  3AZM B;  2JE5 A;  2BYK A;  5GT0 A;  5AVB B;  1U35 D;  3VH6 W;  1M18 A;  4NE5 A;  2FJ7 C;  3B6G C;  3NQU A;  5CHL B;  4Z5T A;  3LEL A;  4AWL C;  5B0Y C;  3REH C;  3B6G B;  3W97 A;  4M6B A;  4CAY A;  2HIO D;  2FJ7 B;  3AZJ C;  4AWL B;  2ARO A;  5B0Y B;  3REH B;  3UTB C;  5B1L C;  1AOI C;  3AZJ B;  3KWQ B;  1EQZ D;  3UTB B;  4WNN A;  4EO5 C;  5B1L B;  5BO0 B;  5AVB D;  1AOI B;  1F66 A;  5AV9 C;  4J8U C;  2Y2J A;  4J8X C;  3AV1 A;  1P3M A;  4EO5 B;  3AYW B;  1M1A A;  3WTP E;  5AV9 B;  4J8U B;  4J8X B;  3FDD A;  1TAF B;  3A6N C;  3AZI C;  2G5I C;  1JFI B;  3A6N B;  3AZI B;  2NQB D;  3MGS A;  4DRA A;  4KHA B;  1AOI D;  4XZQ D;  1KU5 A;  3KXB C;  5BS7 A;  3F6T A;  3IP4 C;  4H9N A;  4J8X D;  4JJN A;  3KXB B;  2IO5 C;  3R45 A;  4QLC D;  2LY8 A;  3A6N D;  1S32 A;  2IO5 B;  3EPK A;  2VQR A;  3X1V A;  1W2E A;  3MNN A;  5B33 D;  5B40 C;  3EG5 B;  1H3O B;  3W99 A;  5B40 B;  3LJA C;  3C1B C;  4KGC A;  4J8W C;  3LJA B;  2Y2M A;  3C1B B;  1KX3 A;  2NQB A;  3TU4 A;  4J8W B;  5B2J C;  1P3K C;  3WTP B;  3KUY C;  1N1J A;  2JCH A;  5B2J B;  5CPJ C;  2NZD C;  1P3K B;  3KUY B;  3REK A;  4H9P B;  3REL B;  3UT9 C;  3AZG A;  3AZH D;  5CPJ B;  2NZD B;  3UT9 B;  1P34 A;  4H9S C;  3WAA A;  4J8W D;  3WA9 C;  3H0L C;  3MGR C;  5BT1 C;  3X1T C;  1P3F A;  3WA9 B;  5GXQ D;  1KX5 A;  5B2J D;  3MGR B;  3W96 D;  3KUY D;  3X1T B;  5CPI A;  3WKJ C;  5CPK A;  4R8P A;  5CPJ D;  3W98 B;  2NZD D;  1Z2C B;  2HUE C;  3WKJ B;  3AZE C;  3AZF A;  3AZK A;  2ZM5 A;  3REI A;  4YM6 C;  3MVD C;  2HUE B;  2F8N H;  3AZE B;  5B2I B;  3WA9 D;  4YM6 B;  3MVD B;  3MGR D;  3UTA A;  1M18 C;  5BT1 D;  4Z5T C;  2BYK B;  2YFV A;  5GT0 B;  3AFA A;  3LEL C;  1ZLA D;  1M18 B;  3W97 C;  4CSR A;  3NQU B;  4Z5T B;  3LEL B;  3A1I A;  5DNN A;  4XUJ D;  2ARO C;  4CAY B;  3W97 B;  2ZY2 A;  1P3G A;  3C1C A;  2ARO B;  5JRG A;  4E45 A;  1P3I A;  1F66 C;  4DRB A;  4WNN B;  2CWE A;  3MGQ A;  3AV1 C;  1P3M C;  5B0Z A;  1F66 B;  1M1A C;  3NQJ A;  3AV1 B;  1P3M B;  4Z5T D;  3AZL D;  1M1A B;  4ZBJ C;  1P3P A;  2XD5 A;  2Y2K A;  4ZBJ B;  2F8N G;  3MGS C;  5B32 G;  5JA4 A;  1A7W A;  2CV5 D;  1P3L A;  3MGS B;  1F66 D;  5BS7 C;  2Y2O A;  5B1M A;  3AV1 D;  1P3M D;  1KX4 A;  4JJN C;  1M1A D;  4WU9 A;  4H9N B;  3LZ0 A;  4JJN B;  5GT3 A;  1S32 C;  3R45 B;  3X1V C;  3MNN C;  5F99 A;  5CP6 A;  3X1S A;  1S32 B;  5DNM D;  3MGS D;  3X1V B;  3W99 C;  3MGP D;  3O62 A;  3MNN B;  1M19 D;  2F8N A;  5B32 A;  3KWQ C;  3W99 B;  3X1U A;  4KGC C;  3VH5 W;  3AZM D;  1KX3 C;  4KGC B;  3TU4 C;  3AYW C;  1S32 D;  1KX3 B;  5B31 G;  1BH9 A;  3TU4 B;  3X1V D;  2RVQ C;  3MNN D;  3B6G D;  2FJ7 D;  3B6F A;  1N1J B;  5B0Y D;  3REH D;  3REK C;  3AZG C;  3AZJ D;  3KWQ D;  4YS3 A;  3REK B;  3UTB D;  1P34 C;  3AZG B;  5B1L D;  4KGC D;  4Z2M H;  1P3B A;  1TZY A;  1P34 B;  4J8V A;  1P3F C;  3P5J B;  3WAA B;  3AYW D;  1KX5 C;  5AV9 D;  5GSU A;  4J8U D;  5CPI C;  1P3F B;  1KX5 B;  5CPK C;  4R8P C;  4Z66 A;  2ZY3 A;  5B31 A;  5CPI B;  5CPK B;  4R8P B;  3AZI D;  4DQY B;  3AZF C;  4G91 C;  3AZK C;  5AY8 A;  3REI C;  3VH5 A;  1P34 D;  3AZF B;  4G91 B;  2YFW A;  3AZK B;  1U35 A;  3REI B;  3UTA C;  4H9O A;  3A1K A;  3AFA C;  1R4V A;  2Y2N A;  3KXB D;  2HIO A;  3UTA B;  2FFF B;  3AFA B;  4WU8 A;  2YFV B;  5DNN C;  5CPI D;  3WTP C;  1EQZ A;  4CSR B;  4Z2M G;  2F8N K;  5DNN B;  1P3G C;  3C1C C;  5JRG C;  3REJ A;  3AZF D;  3AZK D;  2W8S A;  3REL C;  1P3I C;  3LZ1 A;  3REI D;  5B40 D;  1P3G B;  3C1C B;  3VH5 T;  5JRG B;  3EPL A;  3MGQ C;  1P3I B;  3MGQ B;  3AFA D;  3LJA D;  5B0Z B;  3C1B D;  1P3P C;  3NQJ B;  1ID3 A;  2BG1 A;  3WTP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...