5AV8B

Human nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8B00
1AOIB 5AV6A 1P3FD 5AV5A 5AV8B 2NZDB 5GXQB 1KX3B 1P3BC 4KGCC 3MGPB 3LZ1A 3V9RB 4J8VC 5FUGB 5B32D 4Z2MG 4ZUXB 2L5AA 4Z2MH 3LZ0B 4J8UC 3X1SC 5AVCA 4E44A 3MGSB 3AYWC 3C1CB 3MGSD 3REHB 2FJ7B 3KXBD 3VH5A 5BO0B 4QLCA 1P3GD 4X23D 1M18B 1TZYA 2NQBB 2AROA 2CV5B 1P3BD 4KGCD 4J8VD 4NE5A 3WAAA 3UTAB 2IO5B 5CPKC 2F8NK 3TU4A 4H9SA 4J8UB 3AZNB 2YFVB 4XUJC 4J8UD 3X1SD 1P3IC 5B1MB 3AYWD 4YM6C 3REKB 3AZHB 3AV2B 3AZEA 3KWQB 3LJAB 4WU9B 1U35C 5GSUC 5AVBB 4E45A 5BS7A 4WU8B 1P3MC 1BH8A 1S32B 3AZKA 2F8ND 1KU5A 3A6NA 3C1BC 4UUZB 5CPKD 2PYOB 4XUJB 1ID3C 4XUJD 4J8WC 1P3ID 3LELA 5CPJB 2HIOA 4G92B 3AN2B 1ULYA 4YM6D 5B33B 1P3PC 5GT0A 4H9PA 1U35D 5CHLB 5GSUD 1P3MD 5AY8B 5B2JB 3C1BB 4DRBA 4R8PC 1TAFB 3MNNB 1M1AB 3C1BD 3AZGC 3REIC 3VH6A 2YFWA 3UTBB 4YS3B 4J8WB 1EQZC 1ID3D 4J8WD 4H9OA 3AZIC 1P3PB 4KUDA 5B40A 5JA4B 1P3AA 1P3PD 5B2IB 1JFIB 5AV9B 1KX5C 4R8PD 5B31C 3AZGD 3REID 3AFAA 5DNMB 4H9RB 1EQZD 5B1LC 3AZID 5BNVA 3W99B 3KUYB 4Z66A 1P3OA 3W98B 3B0CT 5C3IB 3AZFB 3B6GC 3X1VB 1P3FA 1P34B 1KX5D 5B31D 5B24D 4NE3A 4J8XC 1P3KC 5B32A 4NFTA 3REJB 3AZJC 3AZLC 1Q9CA 5B1LD 3KXBA 2JSSA 3WA9C 3X1UB 1N1JA 1P3GA 1P3LA 3B0DB 4X23A 1AOIC 3MVDB 5AV8C 3MGQB 2NZDC 5GXQC 3R45B 1KX3C 3O62C 3B6FC 3B6GD 3MGPC 3RELB 1P3BA 1BH9B 4KGCA 4J8VA 2BYMA 1F1EA 3NQUA 1KX4B 4J8XD 1P3KD 4ZUXC 5B0YA 3LZ0C 3MGRB 3AZJD 5CPIC 3WTPC 3AZLD 3X1SA 3C1CC 3REHC 2FJ7C 5G49B 2F8NH 3AYWA 4WNNB 3UT9B 1M19C 1M18C 3WA9D 2NQBC 1AOID 3O62B 3B6FB 2CV5C 3W97B 5AV8D 2NZDD 5GXQD 1KX3D 1H3OB 3MGPD 3UTAC 5KDMA 2IO5C 2F8NA 3NQJB 5E5AB 5CPKA 4CSRA 3AZNC 4ZUXD 5GT3B 3LZ0D 3WKJB 3WTPB 5CPIB 1HQ3B 5B1MC 3WTPD 5CPID 4EO5B 3C1CD 1P3IA 3REHD 3REKC 3AZHC 3AV2C 5DNNB 1M19B 2FJ7D 3KWQC 3LJAC 4WU9C 2CWEA 4YM6A 3AV1A 1HTAA 1M19D 1M18D 5AVBC 2LY8A 5B0ZA 4WU8C 1U35A 5GSUA 2NQBD 4H9NB 4H9QB 1P3MA 2CV5D 3W96C 1S32C 3UTAD 2PYOC 4G91B 4Z5TB 3AZND 5CPJC 1ID3A 5B1MD 5F99B 4G92C 3AN2C 3REKD 3AZMB 3AZHD 3AV2D 5B33C 4WU9D 3KWQD 3LJAD 5AV5C 5AVBD 4WU8D 3W96B 5AY8C 5B2JC 5CP6B 1S32D 3VH5W 4XZQB 3W96D 3MNNC 4LD9B 1M1AC 1F66B 5JRGB 4R8PA 3X1TB 2PYOD 3UTBC 4YS3C 3REIA 3AZGA 3B0BA 1EQZA 5CPJD 4JJNB 3AN2D 1B67A 5AV6B 5AV5B 3AZIA 5B33D 5AV5D 5B2IC 3LZ1B 2BYKA 5AY8D 5B2JD 5AV9C 3MNND 1M1AD 5AVCB 5DNMC 1KX5A 5B31A 5B24A 4YS3D 3UTBD 4QLCB 1TZYB 3W99C 2AROB 3KUYC 5B1LA 1ZLAA 4KHAA 3W98C 5B2ID 3WAAB 5C3IC 4AWLB 3AZFC 3X1VC 3TU4B 1P34C 4WZSB 3B6GA 5AV9D 5DNMD 4J8XA 3REJC 1P3KA 3AZEB 4CAYA 5BNXA 5B32G 3AZJA 3AZLA 3VH6W 3W99D 3X1UC 3KUYD 1BH8B 3B0DC 5BT1C 3WA9A 3MVDC 3AZKB 4ZBJB 3W98D 3MGQC 3A6NB 1AOIA 3WTPE 3AZFD 3RELC 5AV8A 3X1VD 1P34D 5GXQA 2NZDA 1KX3A 3MGPA 3V9RA 1KX4C 5FUGA 3LELB 2HIOB 3MGRC 1WWSA 3REJD 4DRAA 4ZUXA 3LZ0A 5GT0B 4H9PB 3MGSA 3C1CA 3UT9C 3REHA 2FJ7A 3X1UD 5BO0A 1M18A 1M19A 5BT1D 3MVDD 3W97C 3MGQD 2NQBA 2YFWB 3RELD 2CV5A 3UTAA 5E5AC 1BFMA 1KX4D 4H9OB 5GT3C 3WKJC 4J8UA 1HQ3C 3MGRD 5B40B 3AZNA 2F8NG 2YFVA 4KUDB 1P3AB 4EO5C 5DNNC 5B1MA 3UT9D 3REKA 3AZHA 3AV2A 3KWQA 3LJAA 4WU9A 5AVBA 4WU8A 3O62D 3B6FD 3W97D 3AFAB 1S32A 4G91C 5E5AD 4HGAB 4UUZA 2PYOA 4Z5TC 5GT3D 4XUJA 5BNVB 3WKJD 1HQ3D 5F99C 4Z66B 3AZMC 1P3LC 5CPJA 5DNND 1P3OB 3AN2A 1P3FB 5B33A 2HUEB 2RVQC 5CP6C 4XZQC 5B32B 4LD9C 5AY8A 5B2JA 1F66C 3C1BA 5B0YC 5JRGC 1TAFA 3MNNA 3X1TC 1M1AA 4Z5TD 3UTBA 4YS3A 3KXBB 4J8WA 1N1JB 1P3GB 1P3LB 4X23B 5F99D 4JJNC 5AV6C 3AZMD 1P3LD 1P3PA 3LZ1C 5JA4A 1P3BB 4KGCB 4J8VB 2BYMB 3NQUB 5B2IA 1JFIA 2RVQD 5CP6D 4XZQD 5B0YB 4LD9D 5AVCC 1F66D 5AV9A 5B0YD 5JRGD 3X1TD 3X1SB 5DNMA 4H9RA 4QLCC 3AYWB 1TZYC 3AV1C 5B31G 4JJND 5B0ZC 2AROC 5AV6D 3W99A 3KUYA 3LZ1D 3WAAC 3VH5T 4AWLC 5KDMB 2F8NB 3W98A 3TU4C 1A7WA 4H9SC 3AZFA 5CPKB 4CSRB 3X1VA 1P34A 5AVCD 3KSYA 1P3IB 3AZEC 4QLCD 3REJA 4YM6B 3AV1B 5B0ZB 5BS7C 1TZYD 3AV1D 1U35B 5GSUB 5B0ZD 1P3MB 2AROD 3AZKC 3X1UA 4ZBJC 3WAAD 3A6NC 3MVDA 1R4VA 3MGQA 3TU4D 3R45A 3RELA 1BH9A 3LELC 1ID3B 2HIOC 1KX4A 3AZED 5GT0C 3MGRA 4M6BA 5G49A 4WNNA 3UT9A 3AZKD 1B6WA 3A6ND 3B0CW 3O62A 3W97A 4R8PB 3B6FA 3AZGB 3REIB 1H3OA 5B24C 1EQZB 3LELD 3NQJA 2HIOD 5E5AA 4KUDC 5B40C 3VH6T 5GT3A 3AZIB 1P3AC 3WTPA 5GT0D 5CPIA 1HQ3A 3WKJA 1ZLAC 5DNNA 2BYKB 3AFAC 4H9NA 4H9QA 1KX5B 4WV4B 5B31B 5B24B 1WWIA 4HGAC 4KUDD 4Z5TA 5B40D 5B1LB 1P3AD 1ZLAB 4Z66C 4KHAB 1P3OC 1ZLAD 5F99A 3AZMA 1P3FC 3B6GB 2HUEC 4NE6A 3AFAD 3W96A 5B32C 4J8XB 5CP6A 1P3KB 4XZQA 4LD9A 1F66A 4CAYB 5BNXB 5JRGA 3AZLB 3AZJB 3X1TA 3MGSC 3KXBC 1P3GC 4X23C 3WA9B 4Z66D 1P3OD 4JJNA
chains in the Genus database with same CATH superfamily
1AOIB 5AV6A 1P3FD 5AV5A 5AV8B 2NZDB 5GXQB 1KX3B 1P3BC 4KGCC 3MGPB 3LZ1A 3V9RB 4J8VC 2VQRA 5FUGB 5B32D 4Z2MG 4ZUXB 2L5AA 4Z2MH 3LZ0B 4J8UC 3X1SC 3EPHA 5AVCA 4E44A 3MGSB 3AYWC 3C1CB 3MGSD 3REHB 2FJ7B 3KXBD 3VH5A 5BO0B 4QLCA 1P3GD 4X23D 1M18B 1TZYA 2NQBB 2AROA 2CV5B 1P3BD 4KGCD 4J8VD 4NE5A 3WAAA 3UTAB 2IO5B 5CPKC 2F8NK 3TU4A 4H9SA 4J8UB 3AZNB 2YFVB 4XUJC 3A1KA 4J8UD 3X1SD 1P3IC 5B1MB 3AYWD 4YM6C 3REKB 3AZHB 3AV2B 3AZEA 3KWQB 3LJAB 4WU9B 1U35C 5GSUC 5AVBB 4E45A 5BS7A 4WU8B 1P3MC 2Y2LA 1BH8A 1S32B 3AZKA 2F8ND 1KU5A 3A6NA 3C1BC 4UUZB 5CPKD 2PYOB 4XUJB 1ID3C 4XUJD 4J8WC 1P3ID 3LELA 5CPJB 2HIOA 4G92B 3AN2B 1ULYA 4YM6D 5B33B 1P3PC 5GT0A 4H9PA 1U35D 5CHLB 5GSUD 2ZM5A 1P3MD 1T3UA 5AY8B 5B2JB 3C1BB 4DRBA 4R8PC 1TAFB 3MNNB 1M1AB 3C1BD 3AZGC 3REIC 3VH6A 2YFWA 3UTBB 4YS3B 4J8WB 1EQZC 1ID3D 4J8WD 2XD1A 4H9OA 4WJ3C 3AZIC 1P3PB 4KUDA 5B40A 2RIQA 5JA4B 1P3AA 1P3PD 5B2IB 1JFIB 2Y2HA 5AV9B 1KX5C 4R8PD 5B31C 3AZGD 3REID 3AFAA 5DNMB 4H9RB 1EQZD 5B1LC 3AZID 5BNVA 3W99B 3KUYB 2Y2KA 4Z66A 1P3OA 3W98B 3B0CT 1W2EA 5C3IB 3AZFB 3B6GC 3X1VB 1P3FA 1P34B 3EG5B 1KX5D 5B31D 4NE3A 5B24D 4J8XC 1P3KC 5B32A 4NFTA 3REJB 3AZJC 3AZLC 1Q9CA 5B1LD 3KXBA 2JSSA 3WA9C 3X1UB 1N1JA 1P3GA 1P3LA 3B0DB 4X23A 1AOIC 3MVDB 5AV8C 3MGQB 2NZDC 5GXQC 3R45B 1KX3C 3O62C 3B6FC 3B6GD 3MGPC 3RELB 1P3BA 1BH9B 4KGCA 4J8VA 2BYMA 1F1EA 3NQUA 1KX4B 4J8XD 1P3KD 4ZUXC 5B0YA 3LZ0C 3MGRB 3AZJD 5CPIC 3WTPC 3AZLD 3X1SA 3C1CC 3REHC 2FJ7C 5G49B 2F8NH 3AYWA 4WNNB 3UT9B 1M19C 1M18C 3WA9D 2NQBC 1AOID 3O62B 3B6FB 2CV5C 3W97B 5AV8D 2NZDD 5GXQD 1KX3D 1H3OB 3MGPD 3UTAC 5KDMA 2IO5C 2F8NA 3NQJB 5E5AB 5CPKA 4CSRA 3AZNC 4ZUXD 5GT3B 3LZ0D 3WKJB 3WTPB 5CPIB 2JE5A 1HQ3B 5B1MC 3WTPD 5CPID 4EO5B 3C1CD 1P3IA 3REHD 1Z2CB 3REKC 3AZHC 5DNNB 3AV2C 1M19B 2FJ7D 3KWQC 3LJAC 4WU9C 2CWEA 4YM6A 3AV1A 1HTAA 1M19D 1M18D 5AVBC 2LY8A 5B0ZA 4WU8C 1U35A 2Y2QA 5GSUA 2NQBD 4H9NB 4H9QB 1P3MA 2CV5D 3W96C 1S32C 2Y2PA 3UTAD 2PYOC 4G91B 4Z5TB 3AZND 5CPJC 1ID3A 5B1MD 5F99B 4G92C 3AN2C 3REKD 3AZMB 3AZHD 3AV2D 5B33C 4WU9D 3KWQD 3LJAD 5AV5C 5AVBD 4WU8D 3W96B 5AY8C 5B2JC 5CP6B 1S32D 3VH5W 4XZQB 3H0RC 3W96D 3MNNC 4LD9B 1M1AC 1F66B 5JRGB 4R8PA 3X1TB 2PYOD 2Y2IA 4YS3C 3REIA 3UTBC 3AZGA 2DQNC 2ZY4A 3H0LC 3B0BA 1EQZA 5CPJD 4JJNB 3AN2D 5AV6B 1B67A 3FDDA 5AV5B 3AZIA 3KFUG 5B33D 5AV5D 5B2IC 3LZ1B 2BYKA 5AY8D 5B2JD 5AV9C 3MNND 1M1AD 5AVCB 5DNMC 1KX5A 5B31A 2UWXA 5B24A 4YS3D 2Y2MA 2FFFB 2ZY2A 3UTBD 4QLCB 2G5HC 1TZYB 3W99C 2AROB 3KUYC 4DQYB 5B1LA 1ZLAA 4KHAA 3W98C 5B2ID 3WAAB 5C3IC 4AWLB 3AZFC 3X1VC 3TU4B 1P34C 4WZSB 3B6GA 3EPKA 5AV9D 5DNMD 4J8XA 3REJC 1P3KA 3AZEB 4CAYA 5BNXA 5B32G 3EPLA 3AZJA 3AZLA 3VH6W 3W99D 3X1UC 3KUYD 1BH8B 3B0DC 5BT1C 3WA9A 3MVDC 3AZKB 4ZBJB 3W98D 3MGQC 3A6NB 1AOIA 3WTPE 3AZFD 3RELC 5AV8A 3X1VD 1P34D 5GXQA 2NZDA 1KX3A 3MGPA 3V9RA 1KX4C 5FUGA 3LELB 2HIOB 3MGRC 1WWSA 2JCHA 1PZRA 4DRAA 4ZUXA 3REJD 3LZ0A 5GT0B 4H9PB 3MGSA 3C1CA 3UT9C 3REHA 2FJ7A 3X1UD 5BO0A 1M18A 1M19A 5BT1D 3MVDD 3W97C 2G5IC 3MGQD 2NQBA 2YFWB 3RELD 2CV5A 2Y2OA 3UTAA 5E5AC 1BFMA 1KX4D 4H9OB 3F6TA 5GT3C 3WKJC 4J8UA 1HQ3C 3MGRD 5B40B 3AZNA 2F8NG 2YFVA 4KUDB 1P3AB 4EO5C 5DNNC 5B1MA 3UT9D 3REKA 3AZHA 3AV2A 3KWQA 3LJAA 4WU9A 5AVBA 4WU8A 3O62D 3B6FD 3W97D 3AFAB 1S32A 4G91C 5E5AD 3A1IA 4HGAB 4UUZA 2PYOA 4Z5TC 5GT3D 4XUJA 5BNVB 3WKJD 1HQ3D 2DF4C 5F99C 4Z66B 3AZMC 1P3LC 5CPJA 5DNND 1P3OB 3AN2A 1P3FB 5B33A 2HUEB 2RVQC 5CP6C 4XZQC 5B32B 4LD9C 5AY8A 5B2JA 1F66C 3C1BA 5B0YC 5JRGC 1TAFA 3MNNA 3X1TC 1M1AA 4Z5TD 3UTBA 4YS3A 3KXBB 4J8WA 1N1JB 1P3GB 1P3LB 4X23B 5F99D 4JJNC 5AV6C 3AZMD 1P3LD 1P3PA 3LZ1C 5JA4A 1P3BB 4KGCB 4J8VB 2BYMB 3NQUB 5B2IA 1JFIA 2RVQD 5CP6D 4XZQD 5B0YB 4LD9D 5AVCC 1F66D 5AV9A 5B0YD 5JRGD 3X1TD 3X1SB 5DNMA 4H9RA 4QLCC 3AYWB 1TZYC 3AV1C 5B31G 4JJND 5B0ZC 2ZY5A 2AROC 5AV6D 2BG1A 3KUYA 3W99A 3LZ1D 3WAAC 3VH5T 4AWLC 5KDMB 2F8NB 3W98A 3TU4C 1A7WA 4H9SC 3AZFA 5CPKB 4CSRB 3X1VA 1P34A 5AVCD 3KSYA 3P5JB 1P3IB 3AZEC 4QLCD 3REJA 4YM6B 3AV1B 2J8PA 5B0ZB 5BS7C 1TZYD 3AV1D 1U35B 5GSUB 5B0ZD 1P3MB 2AROD 3AZKC 3X1UA 4ZBJC 3WAAD 3A6NC 3MVDA 3IP4C 1R4VA 3MGQA 3TU4D 3R45A 3RELA 1BH9A 3LELC 1ID3B 2HIOC 1KX4A 3AZED 5GT0C 3MGRA 4M6BA 5G49A 4WNNA 3EPJA 3UT9A 3AL0C 3AZKD 1B6WA 3A6ND 3B0CW 3O62A 3W97A 4R8PB 3B6FA 3AZGB 3REIB 1H3OA 5B24C 1EQZB 3LELD 3NQJA 2HIOD 5E5AA 2Y2NA 5B40C 4KUDC 3VH6T 5GT3A 3AZIB 1P3AC 3WTPA 5GT0D 5CPIA 1HQ3A 3WKJA 1ZLAC 2W8SA 5DNNA 2BYKB 3AFAC 4H9NA 4H9QA 1KX5B 4WV4B 5B31B 5B24B 1WWIA 2F2AC 4HGAC 2Y2JA 3H0MC 4KUDD 4Z5TA 5B40D 5B1LB 1P3AD 4UPKA 4Z66C 1ZLAB 2Y2GA 2ZY3A 4KHAB 1P3OC 1ZLAD 5F99A 3AZMA 1P3FC 3B6GB 2HUEC 4NE6A 3AFAD 3W96A 5B32C 4J8XB 5CP6A 1P3KB 4XZQA 4LD9A 1F66A 4CAYB 5BNXB 5JRGA 3AZLB 3AZJB 3X1TA 3MGSC 3KXBC 1P3GC 4X23C 2XD5A 3WA9B 4Z66D 1P3OD 4JJNA
chains in the Genus database with same CATH topology
1AOIB 5AV6A 1P3FD 5AV5A 5AV8B 2NZDB 5GXQB 1KX3B 1P3BC 4KGCC 3MGPB 3LZ1A 3V9RB 4J8VC 2VQRA 5FUGB 5B32D 4Z2MG 4ZUXB 2L5AA 4Z2MH 3LZ0B 4J8UC 3X1SC 3EPHA 5AVCA 4E44A 3MGSB 3AYWC 3C1CB 3MGSD 3REHB 2FJ7B 3KXBD 3VH5A 5BO0B 4QLCA 1P3GD 4X23D 1M18B 1TZYA 2NQBB 2AROA 2CV5B 1P3BD 4KGCD 4J8VD 4NE5A 3WAAA 3UTAB 2IO5B 5CPKC 2F8NK 3TU4A 4H9SA 4J8UB 3AZNB 2YFVB 4XUJC 3A1KA 4J8UD 3X1SD 1P3IC 5B1MB 3AYWD 4YM6C 3REKB 3AZHB 3AV2B 3AZEA 3KWQB 3LJAB 4WU9B 1U35C 5GSUC 5AVBB 4E45A 5BS7A 4WU8B 1P3MC 2Y2LA 1BH8A 1S32B 3AZKA 2F8ND 1KU5A 3A6NA 3C1BC 4UUZB 5CPKD 2PYOB 4XUJB 1ID3C 4XUJD 4J8WC 1P3ID 3LELA 5CPJB 2HIOA 4G92B 3AN2B 1ULYA 4YM6D 5B33B 1P3PC 5GT0A 4H9PA 1U35D 5CHLB 5GSUD 2ZM5A 1P3MD 1T3UA 5AY8B 5B2JB 3C1BB 4DRBA 4R8PC 1TAFB 3MNNB 1M1AB 3C1BD 3AZGC 3REIC 3VH6A 2YFWA 3UTBB 4YS3B 4J8WB 1EQZC 1ID3D 4J8WD 2XD1A 4H9OA 4WJ3C 3AZIC 1P3PB 4KUDA 5B40A 2RIQA 5JA4B 1P3AA 1P3PD 5B2IB 1JFIB 2Y2HA 5AV9B 1KX5C 4R8PD 5B31C 3AZGD 3REID 3AFAA 5DNMB 4H9RB 1EQZD 5B1LC 3AZID 5BNVA 3W99B 3KUYB 2Y2KA 4Z66A 1P3OA 3W98B 3B0CT 1W2EA 5C3IB 3AZFB 3B6GC 3X1VB 1P3FA 1P34B 3EG5B 1KX5D 5B31D 4NE3A 5B24D 4J8XC 1P3KC 5B32A 4NFTA 3REJB 3AZJC 3AZLC 1Q9CA 5B1LD 3KXBA 2JSSA 3WA9C 3X1UB 1N1JA 1P3GA 1P3LA 3B0DB 4X23A 1AOIC 3MVDB 5AV8C 3MGQB 2NZDC 5GXQC 3R45B 1KX3C 3O62C 3B6FC 3B6GD 3MGPC 3RELB 1P3BA 1BH9B 4KGCA 4J8VA 2BYMA 1F1EA 3NQUA 1KX4B 4J8XD 1P3KD 4ZUXC 5B0YA 3LZ0C 3MGRB 3AZJD 5CPIC 3WTPC 3AZLD 3X1SA 3C1CC 3REHC 2FJ7C 5G49B 2F8NH 3AYWA 4WNNB 3UT9B 1M19C 1M18C 3WA9D 2NQBC 1AOID 3O62B 3B6FB 2CV5C 3W97B 5AV8D 2NZDD 5GXQD 1KX3D 1H3OB 3MGPD 3UTAC 5KDMA 2IO5C 2F8NA 3NQJB 5E5AB 5CPKA 4CSRA 3AZNC 4ZUXD 5GT3B 3LZ0D 3WKJB 3WTPB 5CPIB 2JE5A 1HQ3B 5B1MC 3WTPD 5CPID 4EO5B 3C1CD 1P3IA 3REHD 1Z2CB 3REKC 3AZHC 5DNNB 3AV2C 1M19B 2FJ7D 3KWQC 3LJAC 4WU9C 2CWEA 4YM6A 3AV1A 1HTAA 1M19D 1M18D 5AVBC 2LY8A 5B0ZA 4WU8C 1U35A 2Y2QA 5GSUA 2NQBD 4H9NB 4H9QB 1P3MA 2CV5D 3W96C 1S32C 2Y2PA 3UTAD 2PYOC 4G91B 4Z5TB 3AZND 5CPJC 1ID3A 5B1MD 5F99B 4G92C 3AN2C 3REKD 3AZMB 3AZHD 3AV2D 5B33C 4WU9D 3KWQD 3LJAD 5AV5C 5AVBD 4WU8D 3W96B 5AY8C 5B2JC 5CP6B 1S32D 3VH5W 4XZQB 3H0RC 3W96D 3MNNC 4LD9B 1M1AC 1F66B 5JRGB 4R8PA 3X1TB 2PYOD 2Y2IA 4YS3C 3REIA 3UTBC 3AZGA 2DQNC 2ZY4A 3H0LC 3B0BA 1EQZA 5CPJD 4JJNB 3AN2D 5AV6B 1B67A 3FDDA 5AV5B 3AZIA 3KFUG 5B33D 5AV5D 5B2IC 3LZ1B 2BYKA 5AY8D 5B2JD 5AV9C 3MNND 1M1AD 5AVCB 5DNMC 1KX5A 5B31A 2UWXA 5B24A 4YS3D 2Y2MA 2FFFB 2ZY2A 3UTBD 4QLCB 2G5HC 1TZYB 3W99C 2AROB 3KUYC 4DQYB 5B1LA 1ZLAA 4KHAA 3W98C 5B2ID 3WAAB 5C3IC 4AWLB 3AZFC 3X1VC 3TU4B 1P34C 4WZSB 3B6GA 3EPKA 5AV9D 5DNMD 4J8XA 3REJC 1P3KA 3AZEB 4CAYA 5BNXA 5B32G 3EPLA 3AZJA 3AZLA 3VH6W 3W99D 3X1UC 3KUYD 1BH8B 3B0DC 5BT1C 3WA9A 3MVDC 3AZKB 4ZBJB 3W98D 3MGQC 3A6NB 1AOIA 3WTPE 3AZFD 3RELC 5AV8A 3X1VD 1P34D 5GXQA 2NZDA 1KX3A 3MGPA 3V9RA 1KX4C 5FUGA 3LELB 2HIOB 3MGRC 1WWSA 2JCHA 1PZRA 4DRAA 4ZUXA 3REJD 3LZ0A 5GT0B 4H9PB 3MGSA 3C1CA 3UT9C 3REHA 2FJ7A 3X1UD 5BO0A 1M18A 1M19A 5BT1D 3MVDD 3W97C 2G5IC 3MGQD 2NQBA 2YFWB 3RELD 2CV5A 2Y2OA 3UTAA 5E5AC 1BFMA 1KX4D 4H9OB 3F6TA 5GT3C 3WKJC 4J8UA 1HQ3C 3MGRD 5B40B 3AZNA 2F8NG 2YFVA 4KUDB 1P3AB 4EO5C 5DNNC 5B1MA 3UT9D 3REKA 3AZHA 3AV2A 3KWQA 3LJAA 4WU9A 5AVBA 4WU8A 3O62D 3B6FD 3W97D 3AFAB 1S32A 4G91C 5E5AD 3A1IA 4HGAB 4UUZA 2PYOA 4Z5TC 5GT3D 4XUJA 5BNVB 3WKJD 1HQ3D 2DF4C 5F99C 4Z66B 3AZMC 1P3LC 5CPJA 5DNND 1P3OB 3AN2A 1P3FB 5B33A 2HUEB 2RVQC 5CP6C 4XZQC 5B32B 4LD9C 5AY8A 5B2JA 1F66C 3C1BA 5B0YC 5JRGC 1TAFA 3MNNA 3X1TC 1M1AA 4Z5TD 3UTBA 4YS3A 3KXBB 4J8WA 1N1JB 1P3GB 1P3LB 4X23B 5F99D 4JJNC 5AV6C 3AZMD 1P3LD 1P3PA 3LZ1C 5JA4A 1P3BB 4KGCB 4J8VB 2BYMB 3NQUB 5B2IA 1JFIA 2RVQD 5CP6D 4XZQD 5B0YB 4LD9D 5AVCC 1F66D 5AV9A 5B0YD 5JRGD 3X1TD 3X1SB 5DNMA 4H9RA 4QLCC 3AYWB 1TZYC 3AV1C 5B31G 4JJND 5B0ZC 2ZY5A 2AROC 5AV6D 2BG1A 3KUYA 3W99A 3LZ1D 3WAAC 3VH5T 4AWLC 5KDMB 2F8NB 3W98A 3TU4C 1A7WA 4H9SC 3AZFA 5CPKB 4CSRB 3X1VA 1P34A 5AVCD 3KSYA 3P5JB 1P3IB 3AZEC 4QLCD 3REJA 4YM6B 3AV1B 2J8PA 5B0ZB 5BS7C 1TZYD 3AV1D 1U35B 5GSUB 5B0ZD 1P3MB 2AROD 3AZKC 3X1UA 4ZBJC 3WAAD 3A6NC 3MVDA 3IP4C 1R4VA 3MGQA 3TU4D 3R45A 3RELA 1BH9A 3LELC 1ID3B 2HIOC 1KX4A 3AZED 5GT0C 3MGRA 4M6BA 5G49A 4WNNA 3EPJA 3UT9A 3AL0C 3AZKD 1B6WA 3A6ND 3B0CW 3O62A 3W97A 4R8PB 3B6FA 3AZGB 3REIB 1H3OA 5B24C 1EQZB 3LELD 3NQJA 2HIOD 5E5AA 2Y2NA 5B40C 4KUDC 3VH6T 5GT3A 3AZIB 1P3AC 3WTPA 5GT0D 5CPIA 1HQ3A 3WKJA 1ZLAC 2W8SA 5DNNA 2BYKB 3AFAC 4H9NA 4H9QA 1KX5B 4WV4B 5B31B 5B24B 1WWIA 2F2AC 4HGAC 2Y2JA 3H0MC 4KUDD 4Z5TA 5B40D 5B1LB 1P3AD 4UPKA 4Z66C 1ZLAB 2Y2GA 2ZY3A 4KHAB 1P3OC 1ZLAD 5F99A 3AZMA 1P3FC 3B6GB 2HUEC 4NE6A 3AFAD 3W96A 5B32C 4J8XB 5CP6A 1P3KB 4XZQA 4LD9A 1F66A 4CAYB 5BNXB 5JRGA 3AZLB 3AZJB 3X1TA 3MGSC 3KXBC 1P3GC 4X23C 2XD5A 3WA9B 4Z66D 1P3OD 4JJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI B;  5AV6 A;  1P3F D;  5AV5 A;  5AV8 B;  2NZD B;  5GXQ B;  1KX3 B;  1P3B C;  4KGC C;  3MGP B;  3LZ1 A;  3V9R B;  4J8V C;  5FUG B;  5B32 D;  4Z2M G;  4ZUX B;  2L5A A;  4Z2M H;  3LZ0 B;  4J8U C;  3X1S C;  5AVC A;  4E44 A;  3MGS B;  3AYW C;  3C1C B;  3MGS D;  3REH B;  2FJ7 B;  3KXB D;  3VH5 A;  5BO0 B;  4QLC A;  1P3G D;  4X23 D;  1M18 B;  1TZY A;  2NQB B;  2ARO A;  2CV5 B;  1P3B D;  4KGC D;  4J8V D;  4NE5 A;  3WAA A;  3UTA B;  2IO5 B;  5CPK C;  2F8N K;  3TU4 A;  4H9S A;  4J8U B;  3AZN B;  2YFV B;  4XUJ C;  4J8U D;  3X1S D;  1P3I C;  5B1M B;  3AYW D;  4YM6 C;  3REK B;  3AZH B;  3AV2 B;  3AZE A;  3KWQ B;  3LJA B;  4WU9 B;  1U35 C;  5GSU C;  5AVB B;  4E45 A;  5BS7 A;  4WU8 B;  1P3M C;  1BH8 A;  1S32 B;  3AZK A;  2F8N D;  1KU5 A;  3A6N A;  3C1B C;  4UUZ B;  5CPK D;  2PYO B;  4XUJ B;  1ID3 C;  4XUJ D;  4J8W C;  1P3I D;  3LEL A;  5CPJ B;  2HIO A;  4G92 B;  3AN2 B;  1ULY A;  4YM6 D;  5B33 B;  1P3P C;  5GT0 A;  4H9P A;  1U35 D;  5CHL B;  5GSU D;  1P3M D;  5AY8 B;  5B2J B;  3C1B B;  4DRB A;  4R8P C;  1TAF B;  3MNN B;  1M1A B;  3C1B D;  3AZG C;  3REI C;  3VH6 A;  2YFW A;  3UTB B;  4YS3 B;  4J8W B;  1EQZ C;  1ID3 D;  4J8W D;  4H9O A;  3AZI C;  1P3P B;  4KUD A;  5B40 A;  5JA4 B;  1P3A A;  1P3P D;  5B2I B;  1JFI B;  5AV9 B;  1KX5 C;  4R8P D;  5B31 C;  3AZG D;  3REI D;  3AFA A;  5DNM B;  4H9R B;  1EQZ D;  5B1L C;  3AZI D;  5BNV A;  3W99 B;  3KUY B;  4Z66 A;  1P3O A;  3W98 B;  3B0C T;  5C3I B;  3AZF B;  3B6G C;  3X1V B;  1P3F A;  1P34 B;  1KX5 D;  5B31 D;  5B24 D;  4NE3 A;  4J8X C;  1P3K C;  5B32 A;  4NFT A;  3REJ B;  3AZJ C;  3AZL C;  1Q9C A;  5B1L D;  3KXB A;  2JSS A;  3WA9 C;  3X1U B;  1N1J A;  1P3G A;  1P3L A;  3B0D B;  4X23 A;  1AOI C;  3MVD B;  5AV8 C;  3MGQ B;  2NZD C;  5GXQ C;  3R45 B;  1KX3 C;  3O62 C;  3B6F C;  3B6G D;  3MGP C;  3REL B;  1P3B A;  1BH9 B;  4KGC A;  4J8V A;  2BYM A;  1F1E A;  3NQU A;  1KX4 B;  4J8X D;  1P3K D;  4ZUX C;  5B0Y A;  3LZ0 C;  3MGR B;  3AZJ D;  5CPI C;  3WTP C;  3AZL D;  3X1S A;  3C1C C;  3REH C;  2FJ7 C;  5G49 B;  2F8N H;  3AYW A;  4WNN B;  3UT9 B;  1M19 C;  1M18 C;  3WA9 D;  2NQB C;  1AOI D;  3O62 B;  3B6F B;  2CV5 C;  3W97 B;  5AV8 D;  2NZD D;  5GXQ D;  1KX3 D;  1H3O B;  3MGP D;  3UTA C;  5KDM A;  2IO5 C;  2F8N A;  3NQJ B;  5E5A B;  5CPK A;  4CSR A;  3AZN C;  4ZUX D;  5GT3 B;  3LZ0 D;  3WKJ B;  3WTP B;  5CPI B;  1HQ3 B;  5B1M C;  3WTP D;  5CPI D;  4EO5 B;  3C1C D;  1P3I A;  3REH D;  3REK C;  3AZH C;  3AV2 C;  5DNN B;  1M19 B;  2FJ7 D;  3KWQ C;  3LJA C;  4WU9 C;  2CWE A;  4YM6 A;  3AV1 A;  1HTA A;  1M19 D;  1M18 D;  5AVB C;  2LY8 A;  5B0Z A;  4WU8 C;  1U35 A;  5GSU A;  2NQB D;  4H9N B;  4H9Q B;  1P3M A;  2CV5 D;  3W96 C;  1S32 C;  3UTA D;  2PYO C;  4G91 B;  4Z5T B;  3AZN D;  5CPJ C;  1ID3 A;  5B1M D;  5F99 B;  4G92 C;  3AN2 C;  3REK D;  3AZM B;  3AZH D;  3AV2 D;  5B33 C;  4WU9 D;  3KWQ D;  3LJA D;  5AV5 C;  5AVB D;  4WU8 D;  3W96 B;  5AY8 C;  5B2J C;  5CP6 B;  1S32 D;  3VH5 W;  4XZQ B;  3W96 D;  3MNN C;  4LD9 B;  1M1A C;  1F66 B;  5JRG B;  4R8P A;  3X1T B;  2PYO D;  3UTB C;  4YS3 C;  3REI A;  3AZG A;  3B0B A;  1EQZ A;  5CPJ D;  4JJN B;  3AN2 D;  1B67 A;  5AV6 B;  5AV5 B;  3AZI A;  5B33 D;  5AV5 D;  5B2I C;  3LZ1 B;  2BYK A;  5AY8 D;  5B2J D;  5AV9 C;  3MNN D;  1M1A D;  5AVC B;  5DNM C;  1KX5 A;  5B31 A;  5B24 A;  4YS3 D;  3UTB D;  4QLC B;  1TZY B;  3W99 C;  2ARO B;  3KUY C;  5B1L A;  1ZLA A;  4KHA A;  3W98 C;  5B2I D;  3WAA B;  5C3I C;  4AWL B;  3AZF C;  3X1V C;  3TU4 B;  1P34 C;  4WZS B;  3B6G A;  5AV9 D;  5DNM D;  4J8X A;  3REJ C;  1P3K A;  3AZE B;  4CAY A;  5BNX A;  5B32 G;  3AZJ A;  3AZL A;  3VH6 W;  3W99 D;  3X1U C;  3KUY D;  1BH8 B;  3B0D C;  5BT1 C;  3WA9 A;  3MVD C;  3AZK B;  4ZBJ B;  3W98 D;  3MGQ C;  3A6N B;  1AOI A;  3WTP E;  3AZF D;  3REL C;  5AV8 A;  3X1V D;  1P34 D;  5GXQ A;  2NZD A;  1KX3 A;  3MGP A;  3V9R A;  1KX4 C;  5FUG A;  3LEL B;  2HIO B;  3MGR C;  1WWS A;  3REJ D;  4DRA A;  4ZUX A;  3LZ0 A;  5GT0 B;  4H9P B;  3MGS A;  3C1C A;  3UT9 C;  3REH A;  2FJ7 A;  3X1U D;  5BO0 A;  1M18 A;  1M19 A;  5BT1 D;  3MVD D;  3W97 C;  3MGQ D;  2NQB A;  2YFW B;  3REL D;  2CV5 A;  3UTA A;  5E5A C;  1BFM A;  1KX4 D;  4H9O B;  5GT3 C;  3WKJ C;  4J8U A;  1HQ3 C;  3MGR D;  5B40 B;  3AZN A;  2F8N G;  2YFV A;  4KUD B;  1P3A B;  4EO5 C;  5DNN C;  5B1M A;  3UT9 D;  3REK A;  3AZH A;  3AV2 A;  3KWQ A;  3LJA A;  4WU9 A;  5AVB A;  4WU8 A;  3O62 D;  3B6F D;  3W97 D;  3AFA B;  1S32 A;  4G91 C;  5E5A D;  4HGA B;  4UUZ A;  2PYO A;  4Z5T C;  5GT3 D;  4XUJ A;  5BNV B;  3WKJ D;  1HQ3 D;  5F99 C;  4Z66 B;  3AZM C;  1P3L C;  5CPJ A;  5DNN D;  1P3O B;  3AN2 A;  1P3F B;  5B33 A;  2HUE B;  2RVQ C;  5CP6 C;  4XZQ C;  5B32 B;  4LD9 C;  5AY8 A;  5B2J A;  1F66 C;  3C1B A;  5B0Y C;  5JRG C;  1TAF A;  3MNN A;  3X1T C;  1M1A A;  4Z5T D;  3UTB A;  4YS3 A;  3KXB B;  4J8W A;  1N1J B;  1P3G B;  1P3L B;  4X23 B;  5F99 D;  4JJN C;  5AV6 C;  3AZM D;  1P3L D;  1P3P A;  3LZ1 C;  5JA4 A;  1P3B B;  4KGC B;  4J8V B;  2BYM B;  3NQU B;  5B2I A;  1JFI A;  2RVQ D;  5CP6 D;  4XZQ D;  5B0Y B;  4LD9 D;  5AVC C;  1F66 D;  5AV9 A;  5B0Y D;  5JRG D;  3X1T D;  3X1S B;  5DNM A;  4H9R A;  4QLC C;  3AYW B;  1TZY C;  3AV1 C;  5B31 G;  4JJN D;  5B0Z C;  2ARO C;  5AV6 D;  3W99 A;  3KUY A;  3LZ1 D;  3WAA C;  3VH5 T;  4AWL C;  5KDM B;  2F8N B;  3W98 A;  3TU4 C;  1A7W A;  4H9S C;  3AZF A;  5CPK B;  4CSR B;  3X1V A;  1P34 A;  5AVC D;  3KSY A;  1P3I B;  3AZE C;  4QLC D;  3REJ A;  4YM6 B;  3AV1 B;  5B0Z B;  5BS7 C;  1TZY D;  3AV1 D;  1U35 B;  5GSU B;  5B0Z D;  1P3M B;  2ARO D;  3AZK C;  3X1U A;  4ZBJ C;  3WAA D;  3A6N C;  3MVD A;  1R4V A;  3MGQ A;  3TU4 D;  3R45 A;  3REL A;  1BH9 A;  3LEL C;  1ID3 B;  2HIO C;  1KX4 A;  3AZE D;  5GT0 C;  3MGR A;  4M6B A;  5G49 A;  4WNN A;  3UT9 A;  3AZK D;  1B6W A;  3A6N D;  3B0C W;  3O62 A;  3W97 A;  4R8P B;  3B6F A;  3AZG B;  3REI B;  1H3O A;  5B24 C;  1EQZ B;  3LEL D;  3NQJ A;  2HIO D;  5E5A A;  4KUD C;  5B40 C;  3VH6 T;  5GT3 A;  3AZI B;  1P3A C;  3WTP A;  5GT0 D;  5CPI A;  1HQ3 A;  3WKJ A;  1ZLA C;  5DNN A;  2BYK B;  3AFA C;  4H9N A;  4H9Q A;  1KX5 B;  4WV4 B;  5B31 B;  5B24 B;  1WWI A;  4HGA C;  4KUD D;  4Z5T A;  5B40 D;  5B1L B;  1P3A D;  1ZLA B;  4Z66 C;  4KHA B;  1P3O C;  1ZLA D;  5F99 A;  3AZM A;  1P3F C;  3B6G B;  2HUE C;  4NE6 A;  3AFA D;  3W96 A;  5B32 C;  4J8X B;  5CP6 A;  1P3K B;  4XZQ A;  4LD9 A;  1F66 A;  4CAY B;  5BNX B;  5JRG A;  3AZL B;  3AZJ B;  3X1T A;  3MGS C;  3KXB C;  1P3G C;  4X23 C;  3WA9 B;  4Z66 D;  1P3O D;  4JJN A; 
#chains in the Genus database with same CATH topology
 1AOI B;  5AV6 A;  1P3F D;  5AV5 A;  5AV8 B;  2NZD B;  5GXQ B;  1KX3 B;  1P3B C;  4KGC C;  3MGP B;  3LZ1 A;  3V9R B;  4J8V C;  2VQR A;  5FUG B;  5B32 D;  4Z2M G;  4ZUX B;  2L5A A;  4Z2M H;  3LZ0 B;  4J8U C;  3X1S C;  3EPH A;  5AVC A;  4E44 A;  3MGS B;  3AYW C;  3C1C B;  3MGS D;  3REH B;  2FJ7 B;  3KXB D;  3VH5 A;  5BO0 B;  4QLC A;  1P3G D;  4X23 D;  1M18 B;  1TZY A;  2NQB B;  2ARO A;  2CV5 B;  1P3B D;  4KGC D;  4J8V D;  4NE5 A;  3WAA A;  3UTA B;  2IO5 B;  5CPK C;  2F8N K;  3TU4 A;  4H9S A;  4J8U B;  3AZN B;  2YFV B;  4XUJ C;  3A1K A;  4J8U D;  3X1S D;  1P3I C;  5B1M B;  3AYW D;  4YM6 C;  3REK B;  3AZH B;  3AV2 B;  3AZE A;  3KWQ B;  3LJA B;  4WU9 B;  1U35 C;  5GSU C;  5AVB B;  4E45 A;  5BS7 A;  4WU8 B;  1P3M C;  2Y2L A;  1BH8 A;  1S32 B;  3AZK A;  2F8N D;  1KU5 A;  3A6N A;  3C1B C;  4UUZ B;  5CPK D;  2PYO B;  4XUJ B;  1ID3 C;  4XUJ D;  4J8W C;  1P3I D;  3LEL A;  5CPJ B;  2HIO A;  4G92 B;  3AN2 B;  1ULY A;  4YM6 D;  5B33 B;  1P3P C;  5GT0 A;  4H9P A;  1U35 D;  5CHL B;  5GSU D;  2ZM5 A;  1P3M D;  1T3U A;  5AY8 B;  5B2J B;  3C1B B;  4DRB A;  4R8P C;  1TAF B;  3MNN B;  1M1A B;  3C1B D;  3AZG C;  3REI C;  3VH6 A;  2YFW A;  3UTB B;  4YS3 B;  4J8W B;  1EQZ C;  1ID3 D;  4J8W D;  2XD1 A;  4H9O A;  4WJ3 C;  3AZI C;  1P3P B;  4KUD A;  5B40 A;  2RIQ A;  5JA4 B;  1P3A A;  1P3P D;  5B2I B;  1JFI B;  2Y2H A;  5AV9 B;  1KX5 C;  4R8P D;  5B31 C;  3AZG D;  3REI D;  3AFA A;  5DNM B;  4H9R B;  1EQZ D;  5B1L C;  3AZI D;  5BNV A;  3W99 B;  3KUY B;  2Y2K A;  4Z66 A;  1P3O A;  3W98 B;  3B0C T;  1W2E A;  5C3I B;  3AZF B;  3B6G C;  3X1V B;  1P3F A;  1P34 B;  3EG5 B;  1KX5 D;  5B31 D;  4NE3 A;  5B24 D;  4J8X C;  1P3K C;  5B32 A;  4NFT A;  3REJ B;  3AZJ C;  3AZL C;  1Q9C A;  5B1L D;  3KXB A;  2JSS A;  3WA9 C;  3X1U B;  1N1J A;  1P3G A;  1P3L A;  3B0D B;  4X23 A;  1AOI C;  3MVD B;  5AV8 C;  3MGQ B;  2NZD C;  5GXQ C;  3R45 B;  1KX3 C;  3O62 C;  3B6F C;  3B6G D;  3MGP C;  3REL B;  1P3B A;  1BH9 B;  4KGC A;  4J8V A;  2BYM A;  1F1E A;  3NQU A;  1KX4 B;  4J8X D;  1P3K D;  4ZUX C;  5B0Y A;  3LZ0 C;  3MGR B;  3AZJ D;  5CPI C;  3WTP C;  3AZL D;  3X1S A;  3C1C C;  3REH C;  2FJ7 C;  5G49 B;  2F8N H;  3AYW A;  4WNN B;  3UT9 B;  1M19 C;  1M18 C;  3WA9 D;  2NQB C;  1AOI D;  3O62 B;  3B6F B;  2CV5 C;  3W97 B;  5AV8 D;  2NZD D;  5GXQ D;  1KX3 D;  1H3O B;  3MGP D;  3UTA C;  5KDM A;  2IO5 C;  2F8N A;  3NQJ B;  5E5A B;  5CPK A;  4CSR A;  3AZN C;  4ZUX D;  5GT3 B;  3LZ0 D;  3WKJ B;  3WTP B;  5CPI B;  2JE5 A;  1HQ3 B;  5B1M C;  3WTP D;  5CPI D;  4EO5 B;  3C1C D;  1P3I A;  3REH D;  1Z2C B;  3REK C;  3AZH C;  5DNN B;  3AV2 C;  1M19 B;  2FJ7 D;  3KWQ C;  3LJA C;  4WU9 C;  2CWE A;  4YM6 A;  3AV1 A;  1HTA A;  1M19 D;  1M18 D;  5AVB C;  2LY8 A;  5B0Z A;  4WU8 C;  1U35 A;  2Y2Q A;  5GSU A;  2NQB D;  4H9N B;  4H9Q B;  1P3M A;  2CV5 D;  3W96 C;  1S32 C;  2Y2P A;  3UTA D;  2PYO C;  4G91 B;  4Z5T B;  3AZN D;  5CPJ C;  1ID3 A;  5B1M D;  5F99 B;  4G92 C;  3AN2 C;  3REK D;  3AZM B;  3AZH D;  3AV2 D;  5B33 C;  4WU9 D;  3KWQ D;  3LJA D;  5AV5 C;  5AVB D;  4WU8 D;  3W96 B;  5AY8 C;  5B2J C;  5CP6 B;  1S32 D;  3VH5 W;  4XZQ B;  3H0R C;  3W96 D;  3MNN C;  4LD9 B;  1M1A C;  1F66 B;  5JRG B;  4R8P A;  3X1T B;  2PYO D;  2Y2I A;  4YS3 C;  3REI A;  3UTB C;  3AZG A;  2DQN C;  2ZY4 A;  3H0L C;  3B0B A;  1EQZ A;  5CPJ D;  4JJN B;  3AN2 D;  5AV6 B;  1B67 A;  3FDD A;  5AV5 B;  3AZI A;  3KFU G;  5B33 D;  5AV5 D;  5B2I C;  3LZ1 B;  2BYK A;  5AY8 D;  5B2J D;  5AV9 C;  3MNN D;  1M1A D;  5AVC B;  5DNM C;  1KX5 A;  5B31 A;  2UWX A;  5B24 A;  4YS3 D;  2Y2M A;  2FFF B;  2ZY2 A;  3UTB D;  4QLC B;  2G5H C;  1TZY B;  3W99 C;  2ARO B;  3KUY C;  4DQY B;  5B1L A;  1ZLA A;  4KHA A;  3W98 C;  5B2I D;  3WAA B;  5C3I C;  4AWL B;  3AZF C;  3X1V C;  3TU4 B;  1P34 C;  4WZS B;  3B6G A;  3EPK A;  5AV9 D;  5DNM D;  4J8X A;  3REJ C;  1P3K A;  3AZE B;  4CAY A;  5BNX A;  5B32 G;  3EPL A;  3AZJ A;  3AZL A;  3VH6 W;  3W99 D;  3X1U C;  3KUY D;  1BH8 B;  3B0D C;  5BT1 C;  3WA9 A;  3MVD C;  3AZK B;  4ZBJ B;  3W98 D;  3MGQ C;  3A6N B;  1AOI A;  3WTP E;  3AZF D;  3REL C;  5AV8 A;  3X1V D;  1P34 D;  5GXQ A;  2NZD A;  1KX3 A;  3MGP A;  3V9R A;  1KX4 C;  5FUG A;  3LEL B;  2HIO B;  3MGR C;  1WWS A;  2JCH A;  1PZR A;  4DRA A;  4ZUX A;  3REJ D;  3LZ0 A;  5GT0 B;  4H9P B;  3MGS A;  3C1C A;  3UT9 C;  3REH A;  2FJ7 A;  3X1U D;  5BO0 A;  1M18 A;  1M19 A;  5BT1 D;  3MVD D;  3W97 C;  2G5I C;  3MGQ D;  2NQB A;  2YFW B;  3REL D;  2CV5 A;  2Y2O A;  3UTA A;  5E5A C;  1BFM A;  1KX4 D;  4H9O B;  3F6T A;  5GT3 C;  3WKJ C;  4J8U A;  1HQ3 C;  3MGR D;  5B40 B;  3AZN A;  2F8N G;  2YFV A;  4KUD B;  1P3A B;  4EO5 C;  5DNN C;  5B1M A;  3UT9 D;  3REK A;  3AZH A;  3AV2 A;  3KWQ A;  3LJA A;  4WU9 A;  5AVB A;  4WU8 A;  3O62 D;  3B6F D;  3W97 D;  3AFA B;  1S32 A;  4G91 C;  5E5A D;  3A1I A;  4HGA B;  4UUZ A;  2PYO A;  4Z5T C;  5GT3 D;  4XUJ A;  5BNV B;  3WKJ D;  1HQ3 D;  2DF4 C;  5F99 C;  4Z66 B;  3AZM C;  1P3L C;  5CPJ A;  5DNN D;  1P3O B;  3AN2 A;  1P3F B;  5B33 A;  2HUE B;  2RVQ C;  5CP6 C;  4XZQ C;  5B32 B;  4LD9 C;  5AY8 A;  5B2J A;  1F66 C;  3C1B A;  5B0Y C;  5JRG C;  1TAF A;  3MNN A;  3X1T C;  1M1A A;  4Z5T D;  3UTB A;  4YS3 A;  3KXB B;  4J8W A;  1N1J B;  1P3G B;  1P3L B;  4X23 B;  5F99 D;  4JJN C;  5AV6 C;  3AZM D;  1P3L D;  1P3P A;  3LZ1 C;  5JA4 A;  1P3B B;  4KGC B;  4J8V B;  2BYM B;  3NQU B;  5B2I A;  1JFI A;  2RVQ D;  5CP6 D;  4XZQ D;  5B0Y B;  4LD9 D;  5AVC C;  1F66 D;  5AV9 A;  5B0Y D;  5JRG D;  3X1T D;  3X1S B;  5DNM A;  4H9R A;  4QLC C;  3AYW B;  1TZY C;  3AV1 C;  5B31 G;  4JJN D;  5B0Z C;  2ZY5 A;  2ARO C;  5AV6 D;  2BG1 A;  3KUY A;  3W99 A;  3LZ1 D;  3WAA C;  3VH5 T;  4AWL C;  5KDM B;  2F8N B;  3W98 A;  3TU4 C;  1A7W A;  4H9S C;  3AZF A;  5CPK B;  4CSR B;  3X1V A;  1P34 A;  5AVC D;  3KSY A;  3P5J B;  1P3I B;  3AZE C;  4QLC D;  3REJ A;  4YM6 B;  3AV1 B;  2J8P A;  5B0Z B;  5BS7 C;  1TZY D;  3AV1 D;  1U35 B;  5GSU B;  5B0Z D;  1P3M B;  2ARO D;  3AZK C;  3X1U A;  4ZBJ C;  3WAA D;  3A6N C;  3MVD A;  3IP4 C;  1R4V A;  3MGQ A;  3TU4 D;  3R45 A;  3REL A;  1BH9 A;  3LEL C;  1ID3 B;  2HIO C;  1KX4 A;  3AZE D;  5GT0 C;  3MGR A;  4M6B A;  5G49 A;  4WNN A;  3EPJ A;  3UT9 A;  3AL0 C;  3AZK D;  1B6W A;  3A6N D;  3B0C W;  3O62 A;  3W97 A;  4R8P B;  3B6F A;  3AZG B;  3REI B;  1H3O A;  5B24 C;  1EQZ B;  3LEL D;  3NQJ A;  2HIO D;  5E5A A;  2Y2N A;  5B40 C;  4KUD C;  3VH6 T;  5GT3 A;  3AZI B;  1P3A C;  3WTP A;  5GT0 D;  5CPI A;  1HQ3 A;  3WKJ A;  1ZLA C;  2W8S A;  5DNN A;  2BYK B;  3AFA C;  4H9N A;  4H9Q A;  1KX5 B;  4WV4 B;  5B31 B;  5B24 B;  1WWI A;  2F2A C;  4HGA C;  2Y2J A;  3H0M C;  4KUD D;  4Z5T A;  5B40 D;  5B1L B;  1P3A D;  4UPK A;  4Z66 C;  1ZLA B;  2Y2G A;  2ZY3 A;  4KHA B;  1P3O C;  1ZLA D;  5F99 A;  3AZM A;  1P3F C;  3B6G B;  2HUE C;  4NE6 A;  3AFA D;  3W96 A;  5B32 C;  4J8X B;  5CP6 A;  1P3K B;  4XZQ A;  4LD9 A;  1F66 A;  4CAY B;  5BNX B;  5JRG A;  3AZL B;  3AZJ B;  3X1T A;  3MGS C;  3KXB C;  1P3G C;  4X23 C;  2XD5 A;  3WA9 B;  4Z66 D;  1P3O D;  4JJN A; 
#chains in the Genus database with same CATH homology
 1AOI B;  5AV6 A;  1P3F D;  5AV5 A;  5AV8 B;  2NZD B;  5GXQ B;  1KX3 B;  1P3B C;  4KGC C;  3MGP B;  3LZ1 A;  3V9R B;  4J8V C;  2VQR A;  5FUG B;  5B32 D;  4Z2M G;  4ZUX B;  2L5A A;  4Z2M H;  3LZ0 B;  4J8U C;  3X1S C;  3EPH A;  5AVC A;  4E44 A;  3MGS B;  3AYW C;  3C1C B;  3MGS D;  3REH B;  2FJ7 B;  3KXB D;  3VH5 A;  5BO0 B;  4QLC A;  1P3G D;  4X23 D;  1M18 B;  1TZY A;  2NQB B;  2ARO A;  2CV5 B;  1P3B D;  4KGC D;  4J8V D;  4NE5 A;  3WAA A;  3UTA B;  2IO5 B;  5CPK C;  2F8N K;  3TU4 A;  4H9S A;  4J8U B;  3AZN B;  2YFV B;  4XUJ C;  3A1K A;  4J8U D;  3X1S D;  1P3I C;  5B1M B;  3AYW D;  4YM6 C;  3REK B;  3AZH B;  3AV2 B;  3AZE A;  3KWQ B;  3LJA B;  4WU9 B;  1U35 C;  5GSU C;  5AVB B;  4E45 A;  5BS7 A;  4WU8 B;  1P3M C;  2Y2L A;  1BH8 A;  1S32 B;  3AZK A;  2F8N D;  1KU5 A;  3A6N A;  3C1B C;  4UUZ B;  5CPK D;  2PYO B;  4XUJ B;  1ID3 C;  4XUJ D;  4J8W C;  1P3I D;  3LEL A;  5CPJ B;  2HIO A;  4G92 B;  3AN2 B;  1ULY A;  4YM6 D;  5B33 B;  1P3P C;  5GT0 A;  4H9P A;  1U35 D;  5CHL B;  5GSU D;  2ZM5 A;  1P3M D;  1T3U A;  5AY8 B;  5B2J B;  3C1B B;  4DRB A;  4R8P C;  1TAF B;  3MNN B;  1M1A B;  3C1B D;  3AZG C;  3REI C;  3VH6 A;  2YFW A;  3UTB B;  4YS3 B;  4J8W B;  1EQZ C;  1ID3 D;  4J8W D;  2XD1 A;  4H9O A;  4WJ3 C;  3AZI C;  1P3P B;  4KUD A;  5B40 A;  2RIQ A;  5JA4 B;  1P3A A;  1P3P D;  5B2I B;  1JFI B;  2Y2H A;  5AV9 B;  1KX5 C;  4R8P D;  5B31 C;  3AZG D;  3REI D;  3AFA A;  5DNM B;  4H9R B;  1EQZ D;  5B1L C;  3AZI D;  5BNV A;  3W99 B;  3KUY B;  2Y2K A;  4Z66 A;  1P3O A;  3W98 B;  3B0C T;  1W2E A;  5C3I B;  3AZF B;  3B6G C;  3X1V B;  1P3F A;  1P34 B;  3EG5 B;  1KX5 D;  5B31 D;  4NE3 A;  5B24 D;  4J8X C;  1P3K C;  5B32 A;  4NFT A;  3REJ B;  3AZJ C;  3AZL C;  1Q9C A;  5B1L D;  3KXB A;  2JSS A;  3WA9 C;  3X1U B;  1N1J A;  1P3G A;  1P3L A;  3B0D B;  4X23 A;  1AOI C;  3MVD B;  5AV8 C;  3MGQ B;  2NZD C;  5GXQ C;  3R45 B;  1KX3 C;  3O62 C;  3B6F C;  3B6G D;  3MGP C;  3REL B;  1P3B A;  1BH9 B;  4KGC A;  4J8V A;  2BYM A;  1F1E A;  3NQU A;  1KX4 B;  4J8X D;  1P3K D;  4ZUX C;  5B0Y A;  3LZ0 C;  3MGR B;  3AZJ D;  5CPI C;  3WTP C;  3AZL D;  3X1S A;  3C1C C;  3REH C;  2FJ7 C;  5G49 B;  2F8N H;  3AYW A;  4WNN B;  3UT9 B;  1M19 C;  1M18 C;  3WA9 D;  2NQB C;  1AOI D;  3O62 B;  3B6F B;  2CV5 C;  3W97 B;  5AV8 D;  2NZD D;  5GXQ D;  1KX3 D;  1H3O B;  3MGP D;  3UTA C;  5KDM A;  2IO5 C;  2F8N A;  3NQJ B;  5E5A B;  5CPK A;  4CSR A;  3AZN C;  4ZUX D;  5GT3 B;  3LZ0 D;  3WKJ B;  3WTP B;  5CPI B;  2JE5 A;  1HQ3 B;  5B1M C;  3WTP D;  5CPI D;  4EO5 B;  3C1C D;  1P3I A;  3REH D;  1Z2C B;  3REK C;  3AZH C;  5DNN B;  3AV2 C;  1M19 B;  2FJ7 D;  3KWQ C;  3LJA C;  4WU9 C;  2CWE A;  4YM6 A;  3AV1 A;  1HTA A;  1M19 D;  1M18 D;  5AVB C;  2LY8 A;  5B0Z A;  4WU8 C;  1U35 A;  2Y2Q A;  5GSU A;  2NQB D;  4H9N B;  4H9Q B;  1P3M A;  2CV5 D;  3W96 C;  1S32 C;  2Y2P A;  3UTA D;  2PYO C;  4G91 B;  4Z5T B;  3AZN D;  5CPJ C;  1ID3 A;  5B1M D;  5F99 B;  4G92 C;  3AN2 C;  3REK D;  3AZM B;  3AZH D;  3AV2 D;  5B33 C;  4WU9 D;  3KWQ D;  3LJA D;  5AV5 C;  5AVB D;  4WU8 D;  3W96 B;  5AY8 C;  5B2J C;  5CP6 B;  1S32 D;  3VH5 W;  4XZQ B;  3H0R C;  3W96 D;  3MNN C;  4LD9 B;  1M1A C;  1F66 B;  5JRG B;  4R8P A;  3X1T B;  2PYO D;  2Y2I A;  4YS3 C;  3REI A;  3UTB C;  3AZG A;  2DQN C;  2ZY4 A;  3H0L C;  3B0B A;  1EQZ A;  5CPJ D;  4JJN B;  3AN2 D;  5AV6 B;  1B67 A;  3FDD A;  5AV5 B;  3AZI A;  3KFU G;  5B33 D;  5AV5 D;  5B2I C;  3LZ1 B;  2BYK A;  5AY8 D;  5B2J D;  5AV9 C;  3MNN D;  1M1A D;  5AVC B;  5DNM C;  1KX5 A;  5B31 A;  2UWX A;  5B24 A;  4YS3 D;  2Y2M A;  2FFF B;  2ZY2 A;  3UTB D;  4QLC B;  2G5H C;  1TZY B;  3W99 C;  2ARO B;  3KUY C;  4DQY B;  5B1L A;  1ZLA A;  4KHA A;  3W98 C;  5B2I D;  3WAA B;  5C3I C;  4AWL B;  3AZF C;  3X1V C;  3TU4 B;  1P34 C;  4WZS B;  3B6G A;  3EPK A;  5AV9 D;  5DNM D;  4J8X A;  3REJ C;  1P3K A;  3AZE B;  4CAY A;  5BNX A;  5B32 G;  3EPL A;  3AZJ A;  3AZL A;  3VH6 W;  3W99 D;  3X1U C;  3KUY D;  1BH8 B;  3B0D C;  5BT1 C;  3WA9 A;  3MVD C;  3AZK B;  4ZBJ B;  3W98 D;  3MGQ C;  3A6N B;  1AOI A;  3WTP E;  3AZF D;  3REL C;  5AV8 A;  3X1V D;  1P34 D;  5GXQ A;  2NZD A;  1KX3 A;  3MGP A;  3V9R A;  1KX4 C;  5FUG A;  3LEL B;  2HIO B;  3MGR C;  1WWS A;  2JCH A;  1PZR A;  4DRA A;  4ZUX A;  3REJ D;  3LZ0 A;  5GT0 B;  4H9P B;  3MGS A;  3C1C A;  3UT9 C;  3REH A;  2FJ7 A;  3X1U D;  5BO0 A;  1M18 A;  1M19 A;  5BT1 D;  3MVD D;  3W97 C;  2G5I C;  3MGQ D;  2NQB A;  2YFW B;  3REL D;  2CV5 A;  2Y2O A;  3UTA A;  5E5A C;  1BFM A;  1KX4 D;  4H9O B;  3F6T A;  5GT3 C;  3WKJ C;  4J8U A;  1HQ3 C;  3MGR D;  5B40 B;  3AZN A;  2F8N G;  2YFV A;  4KUD B;  1P3A B;  4EO5 C;  5DNN C;  5B1M A;  3UT9 D;  3REK A;  3AZH A;  3AV2 A;  3KWQ A;  3LJA A;  4WU9 A;  5AVB A;  4WU8 A;  3O62 D;  3B6F D;  3W97 D;  3AFA B;  1S32 A;  4G91 C;  5E5A D;  3A1I A;  4HGA B;  4UUZ A;  2PYO A;  4Z5T C;  5GT3 D;  4XUJ A;  5BNV B;  3WKJ D;  1HQ3 D;  2DF4 C;  5F99 C;  4Z66 B;  3AZM C;  1P3L C;  5CPJ A;  5DNN D;  1P3O B;  3AN2 A;  1P3F B;  5B33 A;  2HUE B;  2RVQ C;  5CP6 C;  4XZQ C;  5B32 B;  4LD9 C;  5AY8 A;  5B2J A;  1F66 C;  3C1B A;  5B0Y C;  5JRG C;  1TAF A;  3MNN A;  3X1T C;  1M1A A;  4Z5T D;  3UTB A;  4YS3 A;  3KXB B;  4J8W A;  1N1J B;  1P3G B;  1P3L B;  4X23 B;  5F99 D;  4JJN C;  5AV6 C;  3AZM D;  1P3L D;  1P3P A;  3LZ1 C;  5JA4 A;  1P3B B;  4KGC B;  4J8V B;  2BYM B;  3NQU B;  5B2I A;  1JFI A;  2RVQ D;  5CP6 D;  4XZQ D;  5B0Y B;  4LD9 D;  5AVC C;  1F66 D;  5AV9 A;  5B0Y D;  5JRG D;  3X1T D;  3X1S B;  5DNM A;  4H9R A;  4QLC C;  3AYW B;  1TZY C;  3AV1 C;  5B31 G;  4JJN D;  5B0Z C;  2ZY5 A;  2ARO C;  5AV6 D;  2BG1 A;  3KUY A;  3W99 A;  3LZ1 D;  3WAA C;  3VH5 T;  4AWL C;  5KDM B;  2F8N B;  3W98 A;  3TU4 C;  1A7W A;  4H9S C;  3AZF A;  5CPK B;  4CSR B;  3X1V A;  1P34 A;  5AVC D;  3KSY A;  3P5J B;  1P3I B;  3AZE C;  4QLC D;  3REJ A;  4YM6 B;  3AV1 B;  2J8P A;  5B0Z B;  5BS7 C;  1TZY D;  3AV1 D;  1U35 B;  5GSU B;  5B0Z D;  1P3M B;  2ARO D;  3AZK C;  3X1U A;  4ZBJ C;  3WAA D;  3A6N C;  3MVD A;  3IP4 C;  1R4V A;  3MGQ A;  3TU4 D;  3R45 A;  3REL A;  1BH9 A;  3LEL C;  1ID3 B;  2HIO C;  1KX4 A;  3AZE D;  5GT0 C;  3MGR A;  4M6B A;  5G49 A;  4WNN A;  3EPJ A;  3UT9 A;  3AL0 C;  3AZK D;  1B6W A;  3A6N D;  3B0C W;  3O62 A;  3W97 A;  4R8P B;  3B6F A;  3AZG B;  3REI B;  1H3O A;  5B24 C;  1EQZ B;  3LEL D;  3NQJ A;  2HIO D;  5E5A A;  2Y2N A;  5B40 C;  4KUD C;  3VH6 T;  5GT3 A;  3AZI B;  1P3A C;  3WTP A;  5GT0 D;  5CPI A;  1HQ3 A;  3WKJ A;  1ZLA C;  2W8S A;  5DNN A;  2BYK B;  3AFA C;  4H9N A;  4H9Q A;  1KX5 B;  4WV4 B;  5B31 B;  5B24 B;  1WWI A;  2F2A C;  4HGA C;  2Y2J A;  3H0M C;  4KUD D;  4Z5T A;  5B40 D;  5B1L B;  1P3A D;  4UPK A;  4Z66 C;  1ZLA B;  2Y2G A;  2ZY3 A;  4KHA B;  1P3O C;  1ZLA D;  5F99 A;  3AZM A;  1P3F C;  3B6G B;  2HUE C;  4NE6 A;  3AFA D;  3W96 A;  5B32 C;  4J8X B;  5CP6 A;  1P3K B;  4XZQ A;  4LD9 A;  1F66 A;  4CAY B;  5BNX B;  5JRG A;  3AZL B;  3AZJ B;  3X1T A;  3MGS C;  3KXB C;  1P3G C;  4X23 C;  2XD5 A;  3WA9 B;  4Z66 D;  1P3O D;  4JJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...