5AV8B

Human nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8B00
3B6FC 5E5AB 3B0DC 4J8XA 3AFAA 1N1JB 1KX3A 2NQBA 2LY8A 3MGRA 2NQBB 3MGSD 5B32A 1TAFB 3WAAD 3AYWD 4J8WC 5CPJD 3MVDC 3AZIA 4WZSB 5B32B 3R45A 4Z5TD 1TZYC 4J8VD 3WKJC 1M1AC 3X1UC 3KWQA 5GT0D 4JJNC 5B24C 4WU9C 3MGSA 1KU5A 3WAAA 3AYWA 5AY8D 1F66C 5CPJA 5CP6D 3MGSB 4YM6C 4NFTA 3WAAB 3X1TD 3TU4C 5CPJB 4Z5TA 5DNMB 1ID3D 2PYOD 3LJAD 1EQZD 4J8VA 1M1AD 5B31D 4Z5TB 3B0CW 3B6FD 4HGAB 5BNXB 2F8ND 5GT0A 5CPIC 5CPKD 5GT0B 5BS7C 5AY8A 2HUEC 3B0BA 5CP6A 2YFVA 4XUJC 3LZ1C 5AY8B 3C1BC 4J8WD 1ID3A 3MVDD 2PYOA 3LJAA 1EQZA 3X1TB 1M1AA 5B31A 4X23B 3B6FA 1EQZB 3UTBC 2F8NA 1TZYD 4CAYA 3WKJD 1M1AB 5B31B 5CPKA 2CV5C 3B6FB 3X1UD 3B0DB 2F8NB 4JJND 5B24D 4WU9D 4WU8C 5BT1D 1F66D 4J8WA 3MVDA 1P3PC 1BH9A 3TU4D 5AVBC 4H9NA 3MVDB 1BH9B 1TZYA 3WKJA 3X1VC 4H9NB 2AROB 3X1UA 1AOIC 1A7WA 5AVCC 1TZYB 3WKJB 4JJNA 5CPID 5B24A 4WU9A 3X1UB 1F66A 4JJNB 3A6NC 5B24B 4XUJD 3LZ1D 4ZBJB 3C1BD 3TU4A 4XZQB 3AZNC 3VH6A 4YM6B 3MGRC 3UTBD 3AZFC 2CV5D 3AZIC 3REIC 5BS7A 5CPIB 4WU8D 3UTAB 4XUJA 3AZMD 3LZ1A 3C1BA 2HUEB 3W97C 3KWQC 1P3KA 4Z2MH 3LZ1B 4WV4B 5AV9C 1HQ3A 3C1BB 5AVBD 4KUDD 3UTBA 3X1VD 1P3FA 2CV5A 4R8PC 4UUZA 4G92C 1AOID 3UTBB 5AVCD 2YFWA 4WU8A 4UUZB 3AZMA 1Q9CA 5C3IC 3A6ND 5B2IB 4WU8B 3LZ0C 5B1LC 5AVBA 3AZND 1M19C 1P3PB 4YS3C 3AZJA 4KUDA 3NQUA 3MGPC 1HTAA 5AVBB 1H3OA 5CP6C 3X1VA 3VH5T 1AOIA 5AVCA 3NQUB 5B0YD 3AZFD 3X1VB 1H3OB 4AWLC 3AZID 5AVCB 3REID 3A6NA 1U35C 4DRAA 5B32G 3REKB 1P3OD 3A6NB 5CPKC 3W97D 3AZNA 3KWQD 4J8XB 3W96A 3AFAB 5AV9D 3O62C 1KX3B 3AZNB 5B0YA 3AZFA 3MGRB 1M18D 4R8PD 3REIA 2F8NH 3AZIB 3AZEC 1JFIA 5GSUA 3REIB 3REHC 3R45B 1P3OA 3W97A 1JFIB 3VH5A 1P3AC 3LZ0D 5B1LD 5AV9A 3W97B 3UT9A 3WA9C 3KWQB 1M19D 4YS3D 1P3GC 5BT1C 3MGPD 5AV9B 4NE3A 1M18A 4R8PA 3AYWB 4H9OA 5B33C 4R8PB 1KX4C 4G92B 3KXBC 5JRGC 1U35D 1KX5C 5C3IB 4J8VB 3LZ0A 5B1LA 2HIOC 1M19A 4YS3A 3LZ0B 5B1LB 5B31G 3MGPA 3AZLC 3O62D 1M19B 2F8NG 4YS3B 4H9RA 3MGPB 4EO5C 5CP6B 3RELC 2YFVB 1P3KC 5DNND 1HQ3C 1ID3B 4ZUXC 2PYOB 1U35A 3LJAB 3AZED 2L5AA 3MNNC 3AZHC 3REHD 1P3FC 3VH6T 5AV6C 1U35B 4CAYB 1P3AD 3AV1C 5CPKB 3O62A 5KDMA 3WA9D 3AZMC 1P3GD 1ZLAC 3O62B 4H9PA 5KDMB 5DNNA 3AZKC 4J8WB 4LD9C 5B33D 4H9PB 2BYMA 1KX4D 3AZEA 4KUDC 3AZJC 5JA4A 1P3IA 3KXBD 3KSYA 1BH8A 3REHA 5JRGD 2BYMB 3AZEB 1KX5D 1P3AA 2HIOD 3WA9A 3C1CC 1P3AB 1P3GA 3NQJA 3AZLD 4Z66A 5F99C 4WU9B 3WA9B 4E44A 5B40C 4H9QA 3AN2C 1F66B 1S32D 3NQJB 5B33A 3RELD 1P3KD 1KX4A 3W96C 4H9QB 3KXBA 3B6GD 1HQ3D 3TU4B 5B33B 4ZUXD 5JRGA 1KX4B 1KX5A 3MNND 5B0YC 3AZHD 5JRGB 1P3FD 2HIOA 5AV6D 1KX5B 5AV5C 4G91C 3AZLA 3AV1D 2HIOB 1P3BC 5GSUC 5E5AC 1P3MC 1S32A 3AZLB 1P3OC 1ZLAD 3RELA 4XUJB 2BYKA 3AZKD 3B6GA 4NE5A 4EO5B 4LD9D 4ZUXA 2RVQC 3UT9C 3RELB 1P3KB 2BYKB 3AZJD 3LELC 3MNNA 4KGCC 1HQ3B 3AZHA 1M18C 4ZUXB 5AV6A 3AZHB 3AV1A 2CV5B 1P3FB 5AV6B 3WTPC 3C1CD 1ZLAA 2YFWB 1R4VA 3AV1B 5F99D 3V9RA 3AZGC 3AZMB 5B40D 3AN2D 5BNVA 3AZKA 1ZLAB 4LD9A 3V9RB 5B1MC 3W96D 5BNVB 3VH5W 5B2JC 3AZKB 4LD9B 4KUDB 3AZJB 4CSRA 1B67A 5AV8C 1AOIB 3C1CA 4CSRB 5AV5D 5GT3A 4Z2MG 5F99A 1P3BD 4J8UC 5GSUD 5B40A 5E5AD 3AN2A 1P3MD 1B6WA 5B40B 5G49A 3AN2B 3UT9D 2RVQD 4NE6A 3LELD 3W96B 5GXQA 4KGCD 3MGQC 5DNNC 4H9SC 5B0YB 3AZFB 5AV5A 3WTPD 1P3IC 1P3BA 4X23C 2JSSA 5E5AA 1P3MA 5AV5B 4G91B 1P3BB 5GSUB 3AZGD 3W98C 1P3MB 1P3OB 5B1MD 3LELA 4KGCA 5B2JD 1TAFA 4Z66C 3UT9B 3LELB 4KGCB 5AV8D 3AV2C 1M18B 3WTPA 5DNMD 1P34C 4H9OB 3WTPB 4J8UD 3AZGA 2AROC 1F1EA 2CWEA 5B1MA 3AZGB 3REJC 5B2JA 5B1MB 1S32C 5AV8A 5B2JB 4DRBA 4ZBJC 3MGQD 4XZQC 5DNMA 1WWIA 4H9RB 5AV8B 5B0ZC 3B6GC 4E45A 4AWLB 1P3ID 4J8UA 3VH6W 4QLCC 4X23D 5BNXA 4J8UB 3W98D 3B0CT 3KUYC 3UTAC 4Z66D 3MGQA 4H9SA 3AV2D 3X1TA 3MGQB 2NZDC 5DNNB 1P34D 4X23A 2FJ7C 2IO5C 4KHAA 5JA4B 1P3IB 3W98A 2AROD 1BH8B 3REHB 5CHLB 4WNNA 3W99C 4KHAB 3W98B 3REJD 5GT3C 5FUGA 4WNNB 3X1SC 5B2IC 1P3GB 1P3LC 3AV2A 5FUGB 4Z66B 4XZQD 1P34A 5B0ZD 4YM6D 3AV2B 1P34B 5GXQC 4QLCD 2AROA 3KXBB 5BO0A 1WWSA 3REJA 5BO0B 1ULYA 3KUYD 3REJB 3UTAD 3REKC 4XZQA 5B0ZA 4YM6A 4J8XC 1S32B 3AFAC 2NZDD 1KX3C 2NQBC 4QLCA 5B0ZB 3B6GB 2FJ7D 3MNNB 4QLCB 4M6BA 5B32C 3W99D 3KUYA 5CPIA 3UTAA 5GT3D 3X1SD 3KUYB 5B2ID 1P3LD 2F8NK 2NZDA 1P3PD 2FJ7A 2NZDB 3MGSC 5GXQD 3WAAC 3AYWC 2FJ7B 1BFMA 2IO5B 5CPJC 5DNMC 3W99A 3X1SA 4Z5TC 3C1CB 3W99B 5B2IA 4HGAC 3REKA 5GT3B 1P3LA 4J8VC 5F99B 3REKD 3X1SB 4J8XD 5GT0C 1P3LB 1P3PA 3AFAD 1KX3D 2NQBD 5G49B 5AY8C 3MGRD 5GXQB 5B32D 3X1TC 1ID3C 3WTPE 2PYOC 3LJAC 1EQZC 1N1JA 5B31C
chains in the Genus database with same CATH superfamily
3B6FC 5E5AB 3B0DC 4J8XA 3AFAA 1N1JB 1KX3A 2NQBA 2LY8A 2G5IC 3MGRA 2NQBB 3MGSD 2Y2GA 5B32A 1TAFB 3WAAD 3AYWD 4J8WC 5CPJD 3MVDC 3AZIA 4WZSB 5B32B 3R45A 4Z5TD 2JE5A 1TZYC 4J8VD 3WKJC 2Y2LA 1M1AC 3X1UC 3KWQA 5GT0D 4JJNC 5B24C 4WU9C 3MGSA 1KU5A 3WAAA 3AYWA 5AY8D 1F66C 5CPJA 5CP6D 3MGSB 4YM6C 4NFTA 3WAAB 3X1TD 3TU4C 5CPJB 4Z5TA 5DNMB 1ID3D 2PYOD 3LJAD 1EQZD 4J8VA 1M1AD 5B31D 4Z5TB 3B0CW 3B6FD 4HGAB 5BNXB 3A1IA 2F8ND 5GT0A 5CPIC 1PZRA 5CPKD 5GT0B 5BS7C 5AY8A 2HUEC 3B0BA 5CP6A 2DQNC 2YFVA 4XUJC 3LZ1C 5AY8B 3C1BC 4J8WD 1ID3A 3MVDD 2PYOA 3LJAA 1EQZA 3X1TB 1M1AA 5B31A 4X23B 3B6FA 1EQZB 3UTBC 2F8NA 1TZYD 4CAYA 3WKJD 1M1AB 5B31B 5CPKA 2CV5C 3B6FB 3X1UD 3B0DB 2F8NB 4JJND 5B24D 4WU9D 4WU8C 5BT1D 1F66D 4J8WA 3MVDA 1P3PC 3AL0C 1BH9A 3TU4D 5AVBC 4H9NA 3MVDB 1BH9B 1TZYA 3WKJA 3X1VC 4H9NB 3EPKA 2AROB 3X1UA 1AOIC 1A7WA 5AVCC 1TZYB 3WKJB 4JJNA 5CPID 5B24A 4WU9A 3X1UB 1F66A 4JJNB 3A6NC 5B24B 4XUJD 3LZ1D 4ZBJB 3C1BD 3TU4A 4XZQB 3AZNC 3VH6A 4YM6B 3MGRC 3UTBD 2XD5A 3AZFC 2CV5D 3AZIC 4WJ3C 3H0RC 3REIC 5BS7A 5CPIB 4WU8D 3UTAB 4XUJA 1T3UA 3AZMD 3LZ1A 3C1BA 2HUEB 3W97C 3KWQC 3F6TA 1P3KA 4Z2MH 3LZ1B 4WV4B 5AV9C 1HQ3A 3C1BB 5AVBD 4KUDD 3UTBA 2ZY2A 3X1VD 1P3FA 2CV5A 4R8PC 4UUZA 4G92C 1AOID 3UTBB 5AVCD 2YFWA 4WU8A 4UUZB 3AZMA 1Q9CA 5C3IC 2JCHA 3A6ND 5B2IB 4WU8B 2W8SA 3LZ0C 5B1LC 5AVBA 3AZND 1M19C 1P3PB 2DF4C 4YS3C 3AZJA 4KUDA 3NQUA 3MGPC 1HTAA 5AVBB 1H3OA 5CP6C 3X1VA 3VH5T 1AOIA 5AVCA 3NQUB 5B0YD 3AZFD 3X1VB 1H3OB 4AWLC 3AZID 2Y2HA 5AVCB 3REID 3EPHA 3A6NA 1U35C 4DRAA 5B32G 3REKB 1P3OD 3A6NB 5CPKC 3W97D 3AZNA 3KWQD 2Y2NA 4J8XB 3W96A 3AFAB 5AV9D 3O62C 1KX3B 3AZNB 2F2AC 3KFUG 5B0YA 3AZFA 3MGRB 1M18D 4R8PD 3REIA 2F8NH 2Y2PA 3AZIB 3AZEC 1JFIA 5GSUA 3REIB 3REHC 3R45B 1P3OA 3W97A 1JFIB 3VH5A 1P3AC 3LZ0D 5B1LD 5AV9A 2VQRA 3W97B 3UT9A 3WA9C 3KWQB 1M19D 4YS3D 1P3GC 5BT1C 3MGPD 5AV9B 4NE3A 1M18A 4R8PA 3AYWB 4H9OA 5B33C 4R8PB 1KX4C 4G92B 3KXBC 2ZY5A 5JRGC 1Z2CB 1U35D 1KX5C 5C3IB 4J8VB 3LZ0A 5B1LA 2HIOC 1M19A 4YS3A 3LZ0B 5B1LB 5B31G 4UPKA 3MGPA 3AZLC 3O62D 1M19B 2F8NG 4YS3B 4H9RA 3MGPB 2BG1A 4EO5C 5CP6B 3RELC 2YFVB 1P3KC 5DNND 1HQ3C 1ID3B 4ZUXC 2PYOB 1U35A 3LJAB 3AZED 2L5AA 3MNNC 3AZHC 3REHD 1P3FC 3VH6T 5AV6C 3EG5B 1U35B 4CAYB 1P3AD 3AV1C 5CPKB 3O62A 5KDMA 3WA9D 3H0LC 3AZMC 1P3GD 1ZLAC 3O62B 4H9PA 5KDMB 5DNNA 3AZKC 4J8WB 3A1KA 4LD9C 5B33D 2BYMA 4H9PB 1KX4D 3AZEA 4KUDC 3AZJC 5JA4A 1P3IA 2ZY4A 3KXBD 3KSYA 1BH8A 3REHA 5JRGD 2BYMB 3AZEB 1KX5D 1P3AA 2HIOD 3WA9A 3C1CC 1P3AB 1P3GA 3NQJA 3AZLD 4Z66A 5F99C 4WU9B 3WA9B 4E44A 5B40C 4H9QA 3AN2C 1F66B 1S32D 3NQJB 5B33A 3RELD 1P3KD 1KX4A 3W96C 4H9QB 3KXBA 3B6GD 1HQ3D 3TU4B 5B33B 4ZUXD 5JRGA 1KX4B 1KX5A 3MNND 5B0YC 3AZHD 5JRGB 1P3FD 2HIOA 5AV6D 1KX5B 2Y2JA 5AV5C 4G91C 3AZLA 3AV1D 2HIOB 1P3BC 3IP4C 5GSUC 5E5AC 1P3MC 1S32A 3AZLB 1P3OC 1ZLAD 3RELA 4XUJB 2BYKA 3AZKD 3B6GA 4NE5A 4EO5B 4LD9D 4ZUXA 2RVQC 3UT9C 3RELB 1P3KB 2BYKB 3AZJD 3LELC 3MNNA 4KGCC 1HQ3B 3AZHA 1M18C 4ZUXB 5AV6A 3AZHB 3AV1A 2UWXA 2CV5B 5AV6B 3WTPC 1P3FB 3C1CD 1ZLAA 2YFWB 1R4VA 3AV1B 5F99D 3V9RA 3AZGC 3AZMB 5B40D 3AN2D 5BNVA 3AZKA 1ZLAB 4LD9A 3V9RB 5B1MC 3EPLA 3W96D 5BNVB 3VH5W 5B2JC 3AZKB 4LD9B 4KUDB 3AZJB 4CSRA 1B67A 5AV8C 2RIQA 1AOIB 3C1CA 4CSRB 5AV5D 5GT3A 4Z2MG 5F99A 1P3BD 4J8UC 5GSUD 5B40A 5E5AD 3AN2A 1P3MD 1B6WA 5B40B 5G49A 3AN2B 3UT9D 2RVQD 4NE6A 3LELD 3W96B 5GXQA 4KGCD 3MGQC 5DNNC 4H9SC 5B0YB 3AZFB 5AV5A 3WTPD 1P3IC 1P3BA 4X23C 2JSSA 5E5AA 1P3MA 5AV5B 4G91B 1P3BB 5GSUB 3AZGD 3W98C 2Y2IA 1P3MB 1P3OB 5B1MD 3LELA 4KGCA 5B2JD 1TAFA 4Z66C 3UT9B 3LELB 3EPJA 4KGCB 5AV8D 3AV2C 1M18B 3WTPA 5DNMD 1P34C 4H9OB 4DQYB 3WTPB 4J8UD 3AZGA 2AROC 1F1EA 2XD1A 2CWEA 5B1MA 3AZGB 3REJC 2Y2MA 5B2JA 5B1MB 1S32C 5AV8A 5B2JB 4DRBA 4ZBJC 3MGQD 4XZQC 5DNMA 1WWIA 4H9RB 5AV8B 5B0ZC 3B6GC 4E45A 2G5HC 4AWLB 1P3ID 4J8UA 3VH6W 4QLCC 4X23D 5BNXA 2Y2OA 4J8UB 3W98D 3B0CT 3KUYC 3H0MC 3UTAC 4Z66D 3MGQA 4H9SA 3AV2D 3X1TA 3MGQB 2NZDC 5DNNB 1P34D 4X23A 3FDDA 2FJ7C 2IO5C 4KHAA 5JA4B 1P3IB 3W98A 2AROD 1BH8B 3REHB 5CHLB 4WNNA 3W99C 4KHAB 3W98B 3REJD 5GT3C 5FUGA 4WNNB 3X1SC 5B2IC 1P3GB 1P3LC 3AV2A 5FUGB 4Z66B 4XZQD 1P34A 5B0ZD 4YM6D 3AV2B 2FFFB 1P34B 5GXQC 4QLCD 2AROA 3KXBB 5BO0A 2ZY3A 1WWSA 3REJA 5BO0B 1ULYA 3KUYD 3REJB 3UTAD 2Y2QA 3REKC 2ZM5A 4XZQA 5B0ZA 4YM6A 4J8XC 1S32B 3AFAC 2NZDD 1KX3C 2NQBC 4QLCA 5B0ZB 3B6GB 2FJ7D 3MNNB 4QLCB 4M6BA 5B32C 3W99D 3KUYA 5CPIA 3UTAA 1W2EA 5GT3D 3X1SD 3KUYB 5B2ID 1P3LD 2F8NK 2NZDA 1P3PD 2FJ7A 2NZDB 3MGSC 5GXQD 2J8PA 3WAAC 3AYWC 2FJ7B 1BFMA 2IO5B 5CPJC 5DNMC 3W99A 3P5JB 3X1SA 4Z5TC 3C1CB 3W99B 5B2IA 4HGAC 3REKA 5GT3B 1P3LA 4J8VC 5F99B 3REKD 3X1SB 4J8XD 5GT0C 1P3LB 1P3PA 3AFAD 2Y2KA 1KX3D 2NQBD 5G49B 5AY8C 3MGRD 5GXQB 5B32D 3X1TC 1ID3C 3WTPE 2PYOC 3LJAC 1EQZC 1N1JA 5B31C
chains in the Genus database with same CATH topology
3B6FC 5E5AB 3B0DC 4J8XA 3AFAA 1N1JB 1KX3A 2NQBA 2LY8A 2G5IC 3MGRA 2NQBB 3MGSD 2Y2GA 5B32A 1TAFB 3WAAD 3AYWD 4J8WC 5CPJD 3MVDC 3AZIA 4WZSB 5B32B 3R45A 4Z5TD 2JE5A 1TZYC 4J8VD 3WKJC 2Y2LA 1M1AC 3X1UC 3KWQA 5GT0D 4JJNC 5B24C 4WU9C 3MGSA 1KU5A 3WAAA 3AYWA 5AY8D 1F66C 5CPJA 5CP6D 3MGSB 4YM6C 4NFTA 3WAAB 3X1TD 3TU4C 5CPJB 4Z5TA 5DNMB 1ID3D 2PYOD 3LJAD 1EQZD 4J8VA 1M1AD 5B31D 4Z5TB 3B0CW 3B6FD 4HGAB 5BNXB 3A1IA 2F8ND 5GT0A 5CPIC 1PZRA 5CPKD 5GT0B 5BS7C 5AY8A 2HUEC 3B0BA 5CP6A 2DQNC 2YFVA 4XUJC 3LZ1C 5AY8B 3C1BC 4J8WD 1ID3A 3MVDD 2PYOA 3LJAA 1EQZA 3X1TB 1M1AA 5B31A 4X23B 3B6FA 1EQZB 3UTBC 2F8NA 1TZYD 4CAYA 3WKJD 1M1AB 5B31B 5CPKA 2CV5C 3B6FB 3X1UD 3B0DB 2F8NB 4JJND 5B24D 4WU9D 4WU8C 5BT1D 1F66D 4J8WA 3MVDA 1P3PC 3AL0C 1BH9A 3TU4D 5AVBC 4H9NA 3MVDB 1BH9B 1TZYA 3WKJA 3X1VC 4H9NB 3EPKA 2AROB 3X1UA 1AOIC 1A7WA 5AVCC 1TZYB 3WKJB 4JJNA 5CPID 5B24A 4WU9A 3X1UB 1F66A 4JJNB 3A6NC 5B24B 4XUJD 3LZ1D 4ZBJB 3C1BD 3TU4A 4XZQB 3AZNC 3VH6A 4YM6B 3MGRC 3UTBD 2XD5A 3AZFC 2CV5D 3AZIC 4WJ3C 3H0RC 3REIC 5BS7A 5CPIB 4WU8D 3UTAB 4XUJA 1T3UA 3AZMD 3LZ1A 3C1BA 2HUEB 3W97C 3KWQC 3F6TA 1P3KA 4Z2MH 3LZ1B 4WV4B 5AV9C 1HQ3A 3C1BB 5AVBD 4KUDD 3UTBA 2ZY2A 3X1VD 1P3FA 2CV5A 4R8PC 4UUZA 4G92C 1AOID 3UTBB 5AVCD 2YFWA 4WU8A 4UUZB 3AZMA 1Q9CA 5C3IC 2JCHA 3A6ND 5B2IB 4WU8B 2W8SA 3LZ0C 5B1LC 5AVBA 3AZND 1M19C 1P3PB 2DF4C 4YS3C 3AZJA 4KUDA 3NQUA 3MGPC 1HTAA 5AVBB 1H3OA 5CP6C 3X1VA 3VH5T 1AOIA 5AVCA 3NQUB 5B0YD 3AZFD 3X1VB 1H3OB 4AWLC 3AZID 2Y2HA 5AVCB 3REID 3EPHA 3A6NA 1U35C 4DRAA 5B32G 3REKB 1P3OD 3A6NB 5CPKC 3W97D 3AZNA 3KWQD 2Y2NA 4J8XB 3W96A 3AFAB 5AV9D 3O62C 1KX3B 3AZNB 2F2AC 3KFUG 5B0YA 3AZFA 3MGRB 1M18D 4R8PD 3REIA 2F8NH 2Y2PA 3AZIB 3AZEC 1JFIA 5GSUA 3REIB 3REHC 3R45B 1P3OA 3W97A 1JFIB 3VH5A 1P3AC 3LZ0D 5B1LD 5AV9A 2VQRA 3W97B 3UT9A 3WA9C 3KWQB 1M19D 4YS3D 1P3GC 5BT1C 3MGPD 5AV9B 4NE3A 1M18A 4R8PA 3AYWB 4H9OA 5B33C 4R8PB 1KX4C 4G92B 3KXBC 2ZY5A 5JRGC 1Z2CB 1U35D 1KX5C 5C3IB 4J8VB 3LZ0A 5B1LA 2HIOC 1M19A 4YS3A 3LZ0B 5B1LB 5B31G 4UPKA 3MGPA 3AZLC 3O62D 1M19B 2F8NG 4YS3B 4H9RA 3MGPB 2BG1A 4EO5C 5CP6B 3RELC 2YFVB 1P3KC 5DNND 1HQ3C 1ID3B 4ZUXC 2PYOB 1U35A 3LJAB 3AZED 2L5AA 3MNNC 3AZHC 3REHD 1P3FC 3VH6T 5AV6C 3EG5B 1U35B 4CAYB 1P3AD 3AV1C 5CPKB 3O62A 5KDMA 3WA9D 3H0LC 3AZMC 1P3GD 1ZLAC 3O62B 4H9PA 5KDMB 5DNNA 3AZKC 4J8WB 3A1KA 4LD9C 5B33D 2BYMA 4H9PB 1KX4D 3AZEA 4KUDC 3AZJC 5JA4A 1P3IA 2ZY4A 3KXBD 3KSYA 1BH8A 3REHA 5JRGD 2BYMB 3AZEB 1KX5D 1P3AA 2HIOD 3WA9A 3C1CC 1P3AB 1P3GA 3NQJA 3AZLD 4Z66A 5F99C 4WU9B 3WA9B 4E44A 5B40C 4H9QA 3AN2C 1F66B 1S32D 3NQJB 5B33A 3RELD 1P3KD 1KX4A 3W96C 4H9QB 3KXBA 3B6GD 1HQ3D 3TU4B 5B33B 4ZUXD 5JRGA 1KX4B 1KX5A 3MNND 5B0YC 3AZHD 5JRGB 1P3FD 2HIOA 5AV6D 1KX5B 2Y2JA 5AV5C 4G91C 3AZLA 3AV1D 2HIOB 1P3BC 3IP4C 5GSUC 5E5AC 1P3MC 1S32A 3AZLB 1P3OC 1ZLAD 3RELA 4XUJB 2BYKA 3AZKD 3B6GA 4NE5A 4EO5B 4LD9D 4ZUXA 2RVQC 3UT9C 3RELB 1P3KB 2BYKB 3AZJD 3LELC 3MNNA 4KGCC 1HQ3B 3AZHA 1M18C 4ZUXB 5AV6A 3AZHB 3AV1A 2UWXA 2CV5B 5AV6B 3WTPC 1P3FB 3C1CD 1ZLAA 2YFWB 1R4VA 3AV1B 5F99D 3V9RA 3AZGC 3AZMB 5B40D 3AN2D 5BNVA 3AZKA 1ZLAB 4LD9A 3V9RB 5B1MC 3EPLA 3W96D 5BNVB 3VH5W 5B2JC 3AZKB 4LD9B 4KUDB 3AZJB 4CSRA 1B67A 5AV8C 2RIQA 1AOIB 3C1CA 4CSRB 5AV5D 5GT3A 4Z2MG 5F99A 1P3BD 4J8UC 5GSUD 5B40A 5E5AD 3AN2A 1P3MD 1B6WA 5B40B 5G49A 3AN2B 3UT9D 2RVQD 4NE6A 3LELD 3W96B 5GXQA 4KGCD 3MGQC 5DNNC 4H9SC 5B0YB 3AZFB 5AV5A 3WTPD 1P3IC 1P3BA 4X23C 2JSSA 5E5AA 1P3MA 5AV5B 4G91B 1P3BB 5GSUB 3AZGD 3W98C 2Y2IA 1P3MB 1P3OB 5B1MD 3LELA 4KGCA 5B2JD 1TAFA 4Z66C 3UT9B 3LELB 3EPJA 4KGCB 5AV8D 3AV2C 1M18B 3WTPA 5DNMD 1P34C 4H9OB 4DQYB 3WTPB 4J8UD 3AZGA 2AROC 1F1EA 2XD1A 2CWEA 5B1MA 3AZGB 3REJC 2Y2MA 5B2JA 5B1MB 1S32C 5AV8A 5B2JB 4DRBA 4ZBJC 3MGQD 4XZQC 5DNMA 1WWIA 4H9RB 5AV8B 5B0ZC 3B6GC 4E45A 2G5HC 4AWLB 1P3ID 4J8UA 3VH6W 4QLCC 4X23D 5BNXA 2Y2OA 4J8UB 3W98D 3B0CT 3KUYC 3H0MC 3UTAC 4Z66D 3MGQA 4H9SA 3AV2D 3X1TA 3MGQB 2NZDC 5DNNB 1P34D 4X23A 3FDDA 2FJ7C 2IO5C 4KHAA 5JA4B 1P3IB 3W98A 2AROD 1BH8B 3REHB 5CHLB 4WNNA 3W99C 4KHAB 3W98B 3REJD 5GT3C 5FUGA 4WNNB 3X1SC 5B2IC 1P3GB 1P3LC 3AV2A 5FUGB 4Z66B 4XZQD 1P34A 5B0ZD 4YM6D 3AV2B 2FFFB 1P34B 5GXQC 4QLCD 2AROA 3KXBB 5BO0A 2ZY3A 1WWSA 3REJA 5BO0B 1ULYA 3KUYD 3REJB 3UTAD 2Y2QA 3REKC 2ZM5A 4XZQA 5B0ZA 4YM6A 4J8XC 1S32B 3AFAC 2NZDD 1KX3C 2NQBC 4QLCA 5B0ZB 3B6GB 2FJ7D 3MNNB 4QLCB 4M6BA 5B32C 3W99D 3KUYA 5CPIA 3UTAA 1W2EA 5GT3D 3X1SD 3KUYB 5B2ID 1P3LD 2F8NK 2NZDA 1P3PD 2FJ7A 2NZDB 3MGSC 5GXQD 2J8PA 3WAAC 3AYWC 2FJ7B 1BFMA 2IO5B 5CPJC 5DNMC 3W99A 3P5JB 3X1SA 4Z5TC 3C1CB 3W99B 5B2IA 4HGAC 3REKA 5GT3B 1P3LA 4J8VC 5F99B 3REKD 3X1SB 4J8XD 5GT0C 1P3LB 1P3PA 3AFAD 2Y2KA 1KX3D 2NQBD 5G49B 5AY8C 3MGRD 5GXQB 5B32D 3X1TC 1ID3C 3WTPE 2PYOC 3LJAC 1EQZC 1N1JA 5B31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6F C;  5E5A B;  3B0D C;  4J8X A;  3AFA A;  1N1J B;  1KX3 A;  2NQB A;  2LY8 A;  3MGR A;  2NQB B;  3MGS D;  5B32 A;  1TAF B;  3WAA D;  3AYW D;  4J8W C;  5CPJ D;  3MVD C;  3AZI A;  4WZS B;  5B32 B;  3R45 A;  4Z5T D;  1TZY C;  4J8V D;  3WKJ C;  1M1A C;  3X1U C;  3KWQ A;  5GT0 D;  4JJN C;  5B24 C;  4WU9 C;  3MGS A;  1KU5 A;  3WAA A;  3AYW A;  5AY8 D;  1F66 C;  5CPJ A;  5CP6 D;  3MGS B;  4YM6 C;  4NFT A;  3WAA B;  3X1T D;  3TU4 C;  5CPJ B;  4Z5T A;  5DNM B;  1ID3 D;  2PYO D;  3LJA D;  1EQZ D;  4J8V A;  1M1A D;  5B31 D;  4Z5T B;  3B0C W;  3B6F D;  4HGA B;  5BNX B;  2F8N D;  5GT0 A;  5CPI C;  5CPK D;  5GT0 B;  5BS7 C;  5AY8 A;  2HUE C;  3B0B A;  5CP6 A;  2YFV A;  4XUJ C;  3LZ1 C;  5AY8 B;  3C1B C;  4J8W D;  1ID3 A;  3MVD D;  2PYO A;  3LJA A;  1EQZ A;  3X1T B;  1M1A A;  5B31 A;  4X23 B;  3B6F A;  1EQZ B;  3UTB C;  2F8N A;  1TZY D;  4CAY A;  3WKJ D;  1M1A B;  5B31 B;  5CPK A;  2CV5 C;  3B6F B;  3X1U D;  3B0D B;  2F8N B;  4JJN D;  5B24 D;  4WU9 D;  4WU8 C;  5BT1 D;  1F66 D;  4J8W A;  3MVD A;  1P3P C;  1BH9 A;  3TU4 D;  5AVB C;  4H9N A;  3MVD B;  1BH9 B;  1TZY A;  3WKJ A;  3X1V C;  4H9N B;  2ARO B;  3X1U A;  1AOI C;  1A7W A;  5AVC C;  1TZY B;  3WKJ B;  4JJN A;  5CPI D;  5B24 A;  4WU9 A;  3X1U B;  1F66 A;  4JJN B;  3A6N C;  5B24 B;  4XUJ D;  3LZ1 D;  4ZBJ B;  3C1B D;  3TU4 A;  4XZQ B;  3AZN C;  3VH6 A;  4YM6 B;  3MGR C;  3UTB D;  3AZF C;  2CV5 D;  3AZI C;  3REI C;  5BS7 A;  5CPI B;  4WU8 D;  3UTA B;  4XUJ A;  3AZM D;  3LZ1 A;  3C1B A;  2HUE B;  3W97 C;  3KWQ C;  1P3K A;  4Z2M H;  3LZ1 B;  4WV4 B;  5AV9 C;  1HQ3 A;  3C1B B;  5AVB D;  4KUD D;  3UTB A;  3X1V D;  1P3F A;  2CV5 A;  4R8P C;  4UUZ A;  4G92 C;  1AOI D;  3UTB B;  5AVC D;  2YFW A;  4WU8 A;  4UUZ B;  3AZM A;  1Q9C A;  5C3I C;  3A6N D;  5B2I B;  4WU8 B;  3LZ0 C;  5B1L C;  5AVB A;  3AZN D;  1M19 C;  1P3P B;  4YS3 C;  3AZJ A;  4KUD A;  3NQU A;  3MGP C;  1HTA A;  5AVB B;  1H3O A;  5CP6 C;  3X1V A;  3VH5 T;  1AOI A;  5AVC A;  3NQU B;  5B0Y D;  3AZF D;  3X1V B;  1H3O B;  4AWL C;  3AZI D;  5AVC B;  3REI D;  3A6N A;  1U35 C;  4DRA A;  5B32 G;  3REK B;  1P3O D;  3A6N B;  5CPK C;  3W97 D;  3AZN A;  3KWQ D;  4J8X B;  3W96 A;  3AFA B;  5AV9 D;  3O62 C;  1KX3 B;  3AZN B;  5B0Y A;  3AZF A;  3MGR B;  1M18 D;  4R8P D;  3REI A;  2F8N H;  3AZI B;  3AZE C;  1JFI A;  5GSU A;  3REI B;  3REH C;  3R45 B;  1P3O A;  3W97 A;  1JFI B;  3VH5 A;  1P3A C;  3LZ0 D;  5B1L D;  5AV9 A;  3W97 B;  3UT9 A;  3WA9 C;  3KWQ B;  1M19 D;  4YS3 D;  1P3G C;  5BT1 C;  3MGP D;  5AV9 B;  4NE3 A;  1M18 A;  4R8P A;  3AYW B;  4H9O A;  5B33 C;  4R8P B;  1KX4 C;  4G92 B;  3KXB C;  5JRG C;  1U35 D;  1KX5 C;  5C3I B;  4J8V B;  3LZ0 A;  5B1L A;  2HIO C;  1M19 A;  4YS3 A;  3LZ0 B;  5B1L B;  5B31 G;  3MGP A;  3AZL C;  3O62 D;  1M19 B;  2F8N G;  4YS3 B;  4H9R A;  3MGP B;  4EO5 C;  5CP6 B;  3REL C;  2YFV B;  1P3K C;  5DNN D;  1HQ3 C;  1ID3 B;  4ZUX C;  2PYO B;  1U35 A;  3LJA B;  3AZE D;  2L5A A;  3MNN C;  3AZH C;  3REH D;  1P3F C;  3VH6 T;  5AV6 C;  1U35 B;  4CAY B;  1P3A D;  3AV1 C;  5CPK B;  3O62 A;  5KDM A;  3WA9 D;  3AZM C;  1P3G D;  1ZLA C;  3O62 B;  4H9P A;  5KDM B;  5DNN A;  3AZK C;  4J8W B;  4LD9 C;  5B33 D;  4H9P B;  2BYM A;  1KX4 D;  3AZE A;  4KUD C;  3AZJ C;  5JA4 A;  1P3I A;  3KXB D;  3KSY A;  1BH8 A;  3REH A;  5JRG D;  2BYM B;  3AZE B;  1KX5 D;  1P3A A;  2HIO D;  3WA9 A;  3C1C C;  1P3A B;  1P3G A;  3NQJ A;  3AZL D;  4Z66 A;  5F99 C;  4WU9 B;  3WA9 B;  4E44 A;  5B40 C;  4H9Q A;  3AN2 C;  1F66 B;  1S32 D;  3NQJ B;  5B33 A;  3REL D;  1P3K D;  1KX4 A;  3W96 C;  4H9Q B;  3KXB A;  3B6G D;  1HQ3 D;  3TU4 B;  5B33 B;  4ZUX D;  5JRG A;  1KX4 B;  1KX5 A;  3MNN D;  5B0Y C;  3AZH D;  5JRG B;  1P3F D;  2HIO A;  5AV6 D;  1KX5 B;  5AV5 C;  4G91 C;  3AZL A;  3AV1 D;  2HIO B;  1P3B C;  5GSU C;  5E5A C;  1P3M C;  1S32 A;  3AZL B;  1P3O C;  1ZLA D;  3REL A;  4XUJ B;  2BYK A;  3AZK D;  3B6G A;  4NE5 A;  4EO5 B;  4LD9 D;  4ZUX A;  2RVQ C;  3UT9 C;  3REL B;  1P3K B;  2BYK B;  3AZJ D;  3LEL C;  3MNN A;  4KGC C;  1HQ3 B;  3AZH A;  1M18 C;  4ZUX B;  5AV6 A;  3AZH B;  3AV1 A;  2CV5 B;  1P3F B;  5AV6 B;  3WTP C;  3C1C D;  1ZLA A;  2YFW B;  1R4V A;  3AV1 B;  5F99 D;  3V9R A;  3AZG C;  3AZM B;  5B40 D;  3AN2 D;  5BNV A;  3AZK A;  1ZLA B;  4LD9 A;  3V9R B;  5B1M C;  3W96 D;  5BNV B;  3VH5 W;  5B2J C;  3AZK B;  4LD9 B;  4KUD B;  3AZJ B;  4CSR A;  1B67 A;  5AV8 C;  1AOI B;  3C1C A;  4CSR B;  5AV5 D;  5GT3 A;  4Z2M G;  5F99 A;  1P3B D;  4J8U C;  5GSU D;  5B40 A;  5E5A D;  3AN2 A;  1P3M D;  1B6W A;  5B40 B;  5G49 A;  3AN2 B;  3UT9 D;  2RVQ D;  4NE6 A;  3LEL D;  3W96 B;  5GXQ A;  4KGC D;  3MGQ C;  5DNN C;  4H9S C;  5B0Y B;  3AZF B;  5AV5 A;  3WTP D;  1P3I C;  1P3B A;  4X23 C;  2JSS A;  5E5A A;  1P3M A;  5AV5 B;  4G91 B;  1P3B B;  5GSU B;  3AZG D;  3W98 C;  1P3M B;  1P3O B;  5B1M D;  3LEL A;  4KGC A;  5B2J D;  1TAF A;  4Z66 C;  3UT9 B;  3LEL B;  4KGC B;  5AV8 D;  3AV2 C;  1M18 B;  3WTP A;  5DNM D;  1P34 C;  4H9O B;  3WTP B;  4J8U D;  3AZG A;  2ARO C;  1F1E A;  2CWE A;  5B1M A;  3AZG B;  3REJ C;  5B2J A;  5B1M B;  1S32 C;  5AV8 A;  5B2J B;  4DRB A;  4ZBJ C;  3MGQ D;  4XZQ C;  5DNM A;  1WWI A;  4H9R B;  5AV8 B;  5B0Z C;  3B6G C;  4E45 A;  4AWL B;  1P3I D;  4J8U A;  3VH6 W;  4QLC C;  4X23 D;  5BNX A;  4J8U B;  3W98 D;  3B0C T;  3KUY C;  3UTA C;  4Z66 D;  3MGQ A;  4H9S A;  3AV2 D;  3X1T A;  3MGQ B;  2NZD C;  5DNN B;  1P34 D;  4X23 A;  2FJ7 C;  2IO5 C;  4KHA A;  5JA4 B;  1P3I B;  3W98 A;  2ARO D;  1BH8 B;  3REH B;  5CHL B;  4WNN A;  3W99 C;  4KHA B;  3W98 B;  3REJ D;  5GT3 C;  5FUG A;  4WNN B;  3X1S C;  5B2I C;  1P3G B;  1P3L C;  3AV2 A;  5FUG B;  4Z66 B;  4XZQ D;  1P34 A;  5B0Z D;  4YM6 D;  3AV2 B;  1P34 B;  5GXQ C;  4QLC D;  2ARO A;  3KXB B;  5BO0 A;  1WWS A;  3REJ A;  5BO0 B;  1ULY A;  3KUY D;  3REJ B;  3UTA D;  3REK C;  4XZQ A;  5B0Z A;  4YM6 A;  4J8X C;  1S32 B;  3AFA C;  2NZD D;  1KX3 C;  2NQB C;  4QLC A;  5B0Z B;  3B6G B;  2FJ7 D;  3MNN B;  4QLC B;  4M6B A;  5B32 C;  3W99 D;  3KUY A;  5CPI A;  3UTA A;  5GT3 D;  3X1S D;  3KUY B;  5B2I D;  1P3L D;  2F8N K;  2NZD A;  1P3P D;  2FJ7 A;  2NZD B;  3MGS C;  5GXQ D;  3WAA C;  3AYW C;  2FJ7 B;  1BFM A;  2IO5 B;  5CPJ C;  5DNM C;  3W99 A;  3X1S A;  4Z5T C;  3C1C B;  3W99 B;  5B2I A;  4HGA C;  3REK A;  5GT3 B;  1P3L A;  4J8V C;  5F99 B;  3REK D;  3X1S B;  4J8X D;  5GT0 C;  1P3L B;  1P3P A;  3AFA D;  1KX3 D;  2NQB D;  5G49 B;  5AY8 C;  3MGR D;  5GXQ B;  5B32 D;  3X1T C;  1ID3 C;  3WTP E;  2PYO C;  3LJA C;  1EQZ C;  1N1J A;  5B31 C; 
#chains in the Genus database with same CATH topology
 3B6F C;  5E5A B;  3B0D C;  4J8X A;  3AFA A;  1N1J B;  1KX3 A;  2NQB A;  2LY8 A;  2G5I C;  3MGR A;  2NQB B;  3MGS D;  2Y2G A;  5B32 A;  1TAF B;  3WAA D;  3AYW D;  4J8W C;  5CPJ D;  3MVD C;  3AZI A;  4WZS B;  5B32 B;  3R45 A;  4Z5T D;  2JE5 A;  1TZY C;  4J8V D;  3WKJ C;  2Y2L A;  1M1A C;  3X1U C;  3KWQ A;  5GT0 D;  4JJN C;  5B24 C;  4WU9 C;  3MGS A;  1KU5 A;  3WAA A;  3AYW A;  5AY8 D;  1F66 C;  5CPJ A;  5CP6 D;  3MGS B;  4YM6 C;  4NFT A;  3WAA B;  3X1T D;  3TU4 C;  5CPJ B;  4Z5T A;  5DNM B;  1ID3 D;  2PYO D;  3LJA D;  1EQZ D;  4J8V A;  1M1A D;  5B31 D;  4Z5T B;  3B0C W;  3B6F D;  4HGA B;  5BNX B;  3A1I A;  2F8N D;  5GT0 A;  5CPI C;  1PZR A;  5CPK D;  5GT0 B;  5BS7 C;  5AY8 A;  2HUE C;  3B0B A;  5CP6 A;  2DQN C;  2YFV A;  4XUJ C;  3LZ1 C;  5AY8 B;  3C1B C;  4J8W D;  1ID3 A;  3MVD D;  2PYO A;  3LJA A;  1EQZ A;  3X1T B;  1M1A A;  5B31 A;  4X23 B;  3B6F A;  1EQZ B;  3UTB C;  2F8N A;  1TZY D;  4CAY A;  3WKJ D;  1M1A B;  5B31 B;  5CPK A;  2CV5 C;  3B6F B;  3X1U D;  3B0D B;  2F8N B;  4JJN D;  5B24 D;  4WU9 D;  4WU8 C;  5BT1 D;  1F66 D;  4J8W A;  3MVD A;  1P3P C;  3AL0 C;  1BH9 A;  3TU4 D;  5AVB C;  4H9N A;  3MVD B;  1BH9 B;  1TZY A;  3WKJ A;  3X1V C;  4H9N B;  3EPK A;  2ARO B;  3X1U A;  1AOI C;  1A7W A;  5AVC C;  1TZY B;  3WKJ B;  4JJN A;  5CPI D;  5B24 A;  4WU9 A;  3X1U B;  1F66 A;  4JJN B;  3A6N C;  5B24 B;  4XUJ D;  3LZ1 D;  4ZBJ B;  3C1B D;  3TU4 A;  4XZQ B;  3AZN C;  3VH6 A;  4YM6 B;  3MGR C;  3UTB D;  2XD5 A;  3AZF C;  2CV5 D;  3AZI C;  4WJ3 C;  3H0R C;  3REI C;  5BS7 A;  5CPI B;  4WU8 D;  3UTA B;  4XUJ A;  1T3U A;  3AZM D;  3LZ1 A;  3C1B A;  2HUE B;  3W97 C;  3KWQ C;  3F6T A;  1P3K A;  4Z2M H;  3LZ1 B;  4WV4 B;  5AV9 C;  1HQ3 A;  3C1B B;  5AVB D;  4KUD D;  3UTB A;  2ZY2 A;  3X1V D;  1P3F A;  2CV5 A;  4R8P C;  4UUZ A;  4G92 C;  1AOI D;  3UTB B;  5AVC D;  2YFW A;  4WU8 A;  4UUZ B;  3AZM A;  1Q9C A;  5C3I C;  2JCH A;  3A6N D;  5B2I B;  4WU8 B;  2W8S A;  3LZ0 C;  5B1L C;  5AVB A;  3AZN D;  1M19 C;  1P3P B;  2DF4 C;  4YS3 C;  3AZJ A;  4KUD A;  3NQU A;  3MGP C;  1HTA A;  5AVB B;  1H3O A;  5CP6 C;  3X1V A;  3VH5 T;  1AOI A;  5AVC A;  3NQU B;  5B0Y D;  3AZF D;  3X1V B;  1H3O B;  4AWL C;  3AZI D;  2Y2H A;  5AVC B;  3REI D;  3EPH A;  3A6N A;  1U35 C;  4DRA A;  5B32 G;  3REK B;  1P3O D;  3A6N B;  5CPK C;  3W97 D;  3AZN A;  3KWQ D;  2Y2N A;  4J8X B;  3W96 A;  3AFA B;  5AV9 D;  3O62 C;  1KX3 B;  3AZN B;  2F2A C;  3KFU G;  5B0Y A;  3AZF A;  3MGR B;  1M18 D;  4R8P D;  3REI A;  2F8N H;  2Y2P A;  3AZI B;  3AZE C;  1JFI A;  5GSU A;  3REI B;  3REH C;  3R45 B;  1P3O A;  3W97 A;  1JFI B;  3VH5 A;  1P3A C;  3LZ0 D;  5B1L D;  5AV9 A;  2VQR A;  3W97 B;  3UT9 A;  3WA9 C;  3KWQ B;  1M19 D;  4YS3 D;  1P3G C;  5BT1 C;  3MGP D;  5AV9 B;  4NE3 A;  1M18 A;  4R8P A;  3AYW B;  4H9O A;  5B33 C;  4R8P B;  1KX4 C;  4G92 B;  3KXB C;  2ZY5 A;  5JRG C;  1Z2C B;  1U35 D;  1KX5 C;  5C3I B;  4J8V B;  3LZ0 A;  5B1L A;  2HIO C;  1M19 A;  4YS3 A;  3LZ0 B;  5B1L B;  5B31 G;  4UPK A;  3MGP A;  3AZL C;  3O62 D;  1M19 B;  2F8N G;  4YS3 B;  4H9R A;  3MGP B;  2BG1 A;  4EO5 C;  5CP6 B;  3REL C;  2YFV B;  1P3K C;  5DNN D;  1HQ3 C;  1ID3 B;  4ZUX C;  2PYO B;  1U35 A;  3LJA B;  3AZE D;  2L5A A;  3MNN C;  3AZH C;  3REH D;  1P3F C;  3VH6 T;  5AV6 C;  3EG5 B;  1U35 B;  4CAY B;  1P3A D;  3AV1 C;  5CPK B;  3O62 A;  5KDM A;  3WA9 D;  3H0L C;  3AZM C;  1P3G D;  1ZLA C;  3O62 B;  4H9P A;  5KDM B;  5DNN A;  3AZK C;  4J8W B;  3A1K A;  4LD9 C;  5B33 D;  2BYM A;  4H9P B;  1KX4 D;  3AZE A;  4KUD C;  3AZJ C;  5JA4 A;  1P3I A;  2ZY4 A;  3KXB D;  3KSY A;  1BH8 A;  3REH A;  5JRG D;  2BYM B;  3AZE B;  1KX5 D;  1P3A A;  2HIO D;  3WA9 A;  3C1C C;  1P3A B;  1P3G A;  3NQJ A;  3AZL D;  4Z66 A;  5F99 C;  4WU9 B;  3WA9 B;  4E44 A;  5B40 C;  4H9Q A;  3AN2 C;  1F66 B;  1S32 D;  3NQJ B;  5B33 A;  3REL D;  1P3K D;  1KX4 A;  3W96 C;  4H9Q B;  3KXB A;  3B6G D;  1HQ3 D;  3TU4 B;  5B33 B;  4ZUX D;  5JRG A;  1KX4 B;  1KX5 A;  3MNN D;  5B0Y C;  3AZH D;  5JRG B;  1P3F D;  2HIO A;  5AV6 D;  1KX5 B;  2Y2J A;  5AV5 C;  4G91 C;  3AZL A;  3AV1 D;  2HIO B;  1P3B C;  3IP4 C;  5GSU C;  5E5A C;  1P3M C;  1S32 A;  3AZL B;  1P3O C;  1ZLA D;  3REL A;  4XUJ B;  2BYK A;  3AZK D;  3B6G A;  4NE5 A;  4EO5 B;  4LD9 D;  4ZUX A;  2RVQ C;  3UT9 C;  3REL B;  1P3K B;  2BYK B;  3AZJ D;  3LEL C;  3MNN A;  4KGC C;  1HQ3 B;  3AZH A;  1M18 C;  4ZUX B;  5AV6 A;  3AZH B;  3AV1 A;  2UWX A;  2CV5 B;  5AV6 B;  3WTP C;  1P3F B;  3C1C D;  1ZLA A;  2YFW B;  1R4V A;  3AV1 B;  5F99 D;  3V9R A;  3AZG C;  3AZM B;  5B40 D;  3AN2 D;  5BNV A;  3AZK A;  1ZLA B;  4LD9 A;  3V9R B;  5B1M C;  3EPL A;  3W96 D;  5BNV B;  3VH5 W;  5B2J C;  3AZK B;  4LD9 B;  4KUD B;  3AZJ B;  4CSR A;  1B67 A;  5AV8 C;  2RIQ A;  1AOI B;  3C1C A;  4CSR B;  5AV5 D;  5GT3 A;  4Z2M G;  5F99 A;  1P3B D;  4J8U C;  5GSU D;  5B40 A;  5E5A D;  3AN2 A;  1P3M D;  1B6W A;  5B40 B;  5G49 A;  3AN2 B;  3UT9 D;  2RVQ D;  4NE6 A;  3LEL D;  3W96 B;  5GXQ A;  4KGC D;  3MGQ C;  5DNN C;  4H9S C;  5B0Y B;  3AZF B;  5AV5 A;  3WTP D;  1P3I C;  1P3B A;  4X23 C;  2JSS A;  5E5A A;  1P3M A;  5AV5 B;  4G91 B;  1P3B B;  5GSU B;  3AZG D;  3W98 C;  2Y2I A;  1P3M B;  1P3O B;  5B1M D;  3LEL A;  4KGC A;  5B2J D;  1TAF A;  4Z66 C;  3UT9 B;  3LEL B;  3EPJ A;  4KGC B;  5AV8 D;  3AV2 C;  1M18 B;  3WTP A;  5DNM D;  1P34 C;  4H9O B;  4DQY B;  3WTP B;  4J8U D;  3AZG A;  2ARO C;  1F1E A;  2XD1 A;  2CWE A;  5B1M A;  3AZG B;  3REJ C;  2Y2M A;  5B2J A;  5B1M B;  1S32 C;  5AV8 A;  5B2J B;  4DRB A;  4ZBJ C;  3MGQ D;  4XZQ C;  5DNM A;  1WWI A;  4H9R B;  5AV8 B;  5B0Z C;  3B6G C;  4E45 A;  2G5H C;  4AWL B;  1P3I D;  4J8U A;  3VH6 W;  4QLC C;  4X23 D;  5BNX A;  2Y2O A;  4J8U B;  3W98 D;  3B0C T;  3KUY C;  3H0M C;  3UTA C;  4Z66 D;  3MGQ A;  4H9S A;  3AV2 D;  3X1T A;  3MGQ B;  2NZD C;  5DNN B;  1P34 D;  4X23 A;  3FDD A;  2FJ7 C;  2IO5 C;  4KHA A;  5JA4 B;  1P3I B;  3W98 A;  2ARO D;  1BH8 B;  3REH B;  5CHL B;  4WNN A;  3W99 C;  4KHA B;  3W98 B;  3REJ D;  5GT3 C;  5FUG A;  4WNN B;  3X1S C;  5B2I C;  1P3G B;  1P3L C;  3AV2 A;  5FUG B;  4Z66 B;  4XZQ D;  1P34 A;  5B0Z D;  4YM6 D;  3AV2 B;  2FFF B;  1P34 B;  5GXQ C;  4QLC D;  2ARO A;  3KXB B;  5BO0 A;  2ZY3 A;  1WWS A;  3REJ A;  5BO0 B;  1ULY A;  3KUY D;  3REJ B;  3UTA D;  2Y2Q A;  3REK C;  2ZM5 A;  4XZQ A;  5B0Z A;  4YM6 A;  4J8X C;  1S32 B;  3AFA C;  2NZD D;  1KX3 C;  2NQB C;  4QLC A;  5B0Z B;  3B6G B;  2FJ7 D;  3MNN B;  4QLC B;  4M6B A;  5B32 C;  3W99 D;  3KUY A;  5CPI A;  3UTA A;  1W2E A;  5GT3 D;  3X1S D;  3KUY B;  5B2I D;  1P3L D;  2F8N K;  2NZD A;  1P3P D;  2FJ7 A;  2NZD B;  3MGS C;  5GXQ D;  2J8P A;  3WAA C;  3AYW C;  2FJ7 B;  1BFM A;  2IO5 B;  5CPJ C;  5DNM C;  3W99 A;  3P5J B;  3X1S A;  4Z5T C;  3C1C B;  3W99 B;  5B2I A;  4HGA C;  3REK A;  5GT3 B;  1P3L A;  4J8V C;  5F99 B;  3REK D;  3X1S B;  4J8X D;  5GT0 C;  1P3L B;  1P3P A;  3AFA D;  2Y2K A;  1KX3 D;  2NQB D;  5G49 B;  5AY8 C;  3MGR D;  5GXQ B;  5B32 D;  3X1T C;  1ID3 C;  3WTP E;  2PYO C;  3LJA C;  1EQZ C;  1N1J A;  5B31 C; 
#chains in the Genus database with same CATH homology
 3B6F C;  5E5A B;  3B0D C;  4J8X A;  3AFA A;  1N1J B;  1KX3 A;  2NQB A;  2LY8 A;  2G5I C;  3MGR A;  2NQB B;  3MGS D;  2Y2G A;  5B32 A;  1TAF B;  3WAA D;  3AYW D;  4J8W C;  5CPJ D;  3MVD C;  3AZI A;  4WZS B;  5B32 B;  3R45 A;  4Z5T D;  2JE5 A;  1TZY C;  4J8V D;  3WKJ C;  2Y2L A;  1M1A C;  3X1U C;  3KWQ A;  5GT0 D;  4JJN C;  5B24 C;  4WU9 C;  3MGS A;  1KU5 A;  3WAA A;  3AYW A;  5AY8 D;  1F66 C;  5CPJ A;  5CP6 D;  3MGS B;  4YM6 C;  4NFT A;  3WAA B;  3X1T D;  3TU4 C;  5CPJ B;  4Z5T A;  5DNM B;  1ID3 D;  2PYO D;  3LJA D;  1EQZ D;  4J8V A;  1M1A D;  5B31 D;  4Z5T B;  3B0C W;  3B6F D;  4HGA B;  5BNX B;  3A1I A;  2F8N D;  5GT0 A;  5CPI C;  1PZR A;  5CPK D;  5GT0 B;  5BS7 C;  5AY8 A;  2HUE C;  3B0B A;  5CP6 A;  2DQN C;  2YFV A;  4XUJ C;  3LZ1 C;  5AY8 B;  3C1B C;  4J8W D;  1ID3 A;  3MVD D;  2PYO A;  3LJA A;  1EQZ A;  3X1T B;  1M1A A;  5B31 A;  4X23 B;  3B6F A;  1EQZ B;  3UTB C;  2F8N A;  1TZY D;  4CAY A;  3WKJ D;  1M1A B;  5B31 B;  5CPK A;  2CV5 C;  3B6F B;  3X1U D;  3B0D B;  2F8N B;  4JJN D;  5B24 D;  4WU9 D;  4WU8 C;  5BT1 D;  1F66 D;  4J8W A;  3MVD A;  1P3P C;  3AL0 C;  1BH9 A;  3TU4 D;  5AVB C;  4H9N A;  3MVD B;  1BH9 B;  1TZY A;  3WKJ A;  3X1V C;  4H9N B;  3EPK A;  2ARO B;  3X1U A;  1AOI C;  1A7W A;  5AVC C;  1TZY B;  3WKJ B;  4JJN A;  5CPI D;  5B24 A;  4WU9 A;  3X1U B;  1F66 A;  4JJN B;  3A6N C;  5B24 B;  4XUJ D;  3LZ1 D;  4ZBJ B;  3C1B D;  3TU4 A;  4XZQ B;  3AZN C;  3VH6 A;  4YM6 B;  3MGR C;  3UTB D;  2XD5 A;  3AZF C;  2CV5 D;  3AZI C;  4WJ3 C;  3H0R C;  3REI C;  5BS7 A;  5CPI B;  4WU8 D;  3UTA B;  4XUJ A;  1T3U A;  3AZM D;  3LZ1 A;  3C1B A;  2HUE B;  3W97 C;  3KWQ C;  3F6T A;  1P3K A;  4Z2M H;  3LZ1 B;  4WV4 B;  5AV9 C;  1HQ3 A;  3C1B B;  5AVB D;  4KUD D;  3UTB A;  2ZY2 A;  3X1V D;  1P3F A;  2CV5 A;  4R8P C;  4UUZ A;  4G92 C;  1AOI D;  3UTB B;  5AVC D;  2YFW A;  4WU8 A;  4UUZ B;  3AZM A;  1Q9C A;  5C3I C;  2JCH A;  3A6N D;  5B2I B;  4WU8 B;  2W8S A;  3LZ0 C;  5B1L C;  5AVB A;  3AZN D;  1M19 C;  1P3P B;  2DF4 C;  4YS3 C;  3AZJ A;  4KUD A;  3NQU A;  3MGP C;  1HTA A;  5AVB B;  1H3O A;  5CP6 C;  3X1V A;  3VH5 T;  1AOI A;  5AVC A;  3NQU B;  5B0Y D;  3AZF D;  3X1V B;  1H3O B;  4AWL C;  3AZI D;  2Y2H A;  5AVC B;  3REI D;  3EPH A;  3A6N A;  1U35 C;  4DRA A;  5B32 G;  3REK B;  1P3O D;  3A6N B;  5CPK C;  3W97 D;  3AZN A;  3KWQ D;  2Y2N A;  4J8X B;  3W96 A;  3AFA B;  5AV9 D;  3O62 C;  1KX3 B;  3AZN B;  2F2A C;  3KFU G;  5B0Y A;  3AZF A;  3MGR B;  1M18 D;  4R8P D;  3REI A;  2F8N H;  2Y2P A;  3AZI B;  3AZE C;  1JFI A;  5GSU A;  3REI B;  3REH C;  3R45 B;  1P3O A;  3W97 A;  1JFI B;  3VH5 A;  1P3A C;  3LZ0 D;  5B1L D;  5AV9 A;  2VQR A;  3W97 B;  3UT9 A;  3WA9 C;  3KWQ B;  1M19 D;  4YS3 D;  1P3G C;  5BT1 C;  3MGP D;  5AV9 B;  4NE3 A;  1M18 A;  4R8P A;  3AYW B;  4H9O A;  5B33 C;  4R8P B;  1KX4 C;  4G92 B;  3KXB C;  2ZY5 A;  5JRG C;  1Z2C B;  1U35 D;  1KX5 C;  5C3I B;  4J8V B;  3LZ0 A;  5B1L A;  2HIO C;  1M19 A;  4YS3 A;  3LZ0 B;  5B1L B;  5B31 G;  4UPK A;  3MGP A;  3AZL C;  3O62 D;  1M19 B;  2F8N G;  4YS3 B;  4H9R A;  3MGP B;  2BG1 A;  4EO5 C;  5CP6 B;  3REL C;  2YFV B;  1P3K C;  5DNN D;  1HQ3 C;  1ID3 B;  4ZUX C;  2PYO B;  1U35 A;  3LJA B;  3AZE D;  2L5A A;  3MNN C;  3AZH C;  3REH D;  1P3F C;  3VH6 T;  5AV6 C;  3EG5 B;  1U35 B;  4CAY B;  1P3A D;  3AV1 C;  5CPK B;  3O62 A;  5KDM A;  3WA9 D;  3H0L C;  3AZM C;  1P3G D;  1ZLA C;  3O62 B;  4H9P A;  5KDM B;  5DNN A;  3AZK C;  4J8W B;  3A1K A;  4LD9 C;  5B33 D;  2BYM A;  4H9P B;  1KX4 D;  3AZE A;  4KUD C;  3AZJ C;  5JA4 A;  1P3I A;  2ZY4 A;  3KXB D;  3KSY A;  1BH8 A;  3REH A;  5JRG D;  2BYM B;  3AZE B;  1KX5 D;  1P3A A;  2HIO D;  3WA9 A;  3C1C C;  1P3A B;  1P3G A;  3NQJ A;  3AZL D;  4Z66 A;  5F99 C;  4WU9 B;  3WA9 B;  4E44 A;  5B40 C;  4H9Q A;  3AN2 C;  1F66 B;  1S32 D;  3NQJ B;  5B33 A;  3REL D;  1P3K D;  1KX4 A;  3W96 C;  4H9Q B;  3KXB A;  3B6G D;  1HQ3 D;  3TU4 B;  5B33 B;  4ZUX D;  5JRG A;  1KX4 B;  1KX5 A;  3MNN D;  5B0Y C;  3AZH D;  5JRG B;  1P3F D;  2HIO A;  5AV6 D;  1KX5 B;  2Y2J A;  5AV5 C;  4G91 C;  3AZL A;  3AV1 D;  2HIO B;  1P3B C;  3IP4 C;  5GSU C;  5E5A C;  1P3M C;  1S32 A;  3AZL B;  1P3O C;  1ZLA D;  3REL A;  4XUJ B;  2BYK A;  3AZK D;  3B6G A;  4NE5 A;  4EO5 B;  4LD9 D;  4ZUX A;  2RVQ C;  3UT9 C;  3REL B;  1P3K B;  2BYK B;  3AZJ D;  3LEL C;  3MNN A;  4KGC C;  1HQ3 B;  3AZH A;  1M18 C;  4ZUX B;  5AV6 A;  3AZH B;  3AV1 A;  2UWX A;  2CV5 B;  5AV6 B;  3WTP C;  1P3F B;  3C1C D;  1ZLA A;  2YFW B;  1R4V A;  3AV1 B;  5F99 D;  3V9R A;  3AZG C;  3AZM B;  5B40 D;  3AN2 D;  5BNV A;  3AZK A;  1ZLA B;  4LD9 A;  3V9R B;  5B1M C;  3EPL A;  3W96 D;  5BNV B;  3VH5 W;  5B2J C;  3AZK B;  4LD9 B;  4KUD B;  3AZJ B;  4CSR A;  1B67 A;  5AV8 C;  2RIQ A;  1AOI B;  3C1C A;  4CSR B;  5AV5 D;  5GT3 A;  4Z2M G;  5F99 A;  1P3B D;  4J8U C;  5GSU D;  5B40 A;  5E5A D;  3AN2 A;  1P3M D;  1B6W A;  5B40 B;  5G49 A;  3AN2 B;  3UT9 D;  2RVQ D;  4NE6 A;  3LEL D;  3W96 B;  5GXQ A;  4KGC D;  3MGQ C;  5DNN C;  4H9S C;  5B0Y B;  3AZF B;  5AV5 A;  3WTP D;  1P3I C;  1P3B A;  4X23 C;  2JSS A;  5E5A A;  1P3M A;  5AV5 B;  4G91 B;  1P3B B;  5GSU B;  3AZG D;  3W98 C;  2Y2I A;  1P3M B;  1P3O B;  5B1M D;  3LEL A;  4KGC A;  5B2J D;  1TAF A;  4Z66 C;  3UT9 B;  3LEL B;  3EPJ A;  4KGC B;  5AV8 D;  3AV2 C;  1M18 B;  3WTP A;  5DNM D;  1P34 C;  4H9O B;  4DQY B;  3WTP B;  4J8U D;  3AZG A;  2ARO C;  1F1E A;  2XD1 A;  2CWE A;  5B1M A;  3AZG B;  3REJ C;  2Y2M A;  5B2J A;  5B1M B;  1S32 C;  5AV8 A;  5B2J B;  4DRB A;  4ZBJ C;  3MGQ D;  4XZQ C;  5DNM A;  1WWI A;  4H9R B;  5AV8 B;  5B0Z C;  3B6G C;  4E45 A;  2G5H C;  4AWL B;  1P3I D;  4J8U A;  3VH6 W;  4QLC C;  4X23 D;  5BNX A;  2Y2O A;  4J8U B;  3W98 D;  3B0C T;  3KUY C;  3H0M C;  3UTA C;  4Z66 D;  3MGQ A;  4H9S A;  3AV2 D;  3X1T A;  3MGQ B;  2NZD C;  5DNN B;  1P34 D;  4X23 A;  3FDD A;  2FJ7 C;  2IO5 C;  4KHA A;  5JA4 B;  1P3I B;  3W98 A;  2ARO D;  1BH8 B;  3REH B;  5CHL B;  4WNN A;  3W99 C;  4KHA B;  3W98 B;  3REJ D;  5GT3 C;  5FUG A;  4WNN B;  3X1S C;  5B2I C;  1P3G B;  1P3L C;  3AV2 A;  5FUG B;  4Z66 B;  4XZQ D;  1P34 A;  5B0Z D;  4YM6 D;  3AV2 B;  2FFF B;  1P34 B;  5GXQ C;  4QLC D;  2ARO A;  3KXB B;  5BO0 A;  2ZY3 A;  1WWS A;  3REJ A;  5BO0 B;  1ULY A;  3KUY D;  3REJ B;  3UTA D;  2Y2Q A;  3REK C;  2ZM5 A;  4XZQ A;  5B0Z A;  4YM6 A;  4J8X C;  1S32 B;  3AFA C;  2NZD D;  1KX3 C;  2NQB C;  4QLC A;  5B0Z B;  3B6G B;  2FJ7 D;  3MNN B;  4QLC B;  4M6B A;  5B32 C;  3W99 D;  3KUY A;  5CPI A;  3UTA A;  1W2E A;  5GT3 D;  3X1S D;  3KUY B;  5B2I D;  1P3L D;  2F8N K;  2NZD A;  1P3P D;  2FJ7 A;  2NZD B;  3MGS C;  5GXQ D;  2J8P A;  3WAA C;  3AYW C;  2FJ7 B;  1BFM A;  2IO5 B;  5CPJ C;  5DNM C;  3W99 A;  3P5J B;  3X1S A;  4Z5T C;  3C1C B;  3W99 B;  5B2I A;  4HGA C;  3REK A;  5GT3 B;  1P3L A;  4J8V C;  5F99 B;  3REK D;  3X1S B;  4J8X D;  5GT0 C;  1P3L B;  1P3P A;  3AFA D;  2Y2K A;  1KX3 D;  2NQB D;  5G49 B;  5AY8 C;  3MGR D;  5GXQ B;  5B32 D;  3X1T C;  1ID3 C;  3WTP E;  2PYO C;  3LJA C;  1EQZ C;  1N1J A;  5B31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...