5AVDA

The 0.86 angstrom structure of elastase crystallized in high-strength agarose hydrogel
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Growth of protein crystals in hydrogels prevents osmotic shock
pubmed doi rcsb
source organism Sus scrofa
molecule tags Isomerase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5avdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5avdA01
5FAHA 1F0RA 5DJ7A 1GPZA 2CMYA 6LPRA 4CRGA 2ODYB 3QO6A 1IQNA 1OPHB 3MH7A 1ELFA 4Y11E 1SHYA 1F2SE 3UNSA 3P8OA 2HPQH 2C8ZB 3B8JA 4AG2A 4ISIH 3OYPA 2F9VA 2FI5E 2JETC 2FXRA 4FUJA 3RXCA 2DE8A 2P93A 2Z6BD 1SMFE 3K65B 3K6YA 3RUOA 2A4GA 3NZIA 1CQQA 5DO4H 1XKBC 4B75A 2EA3A 1GHBF 5AF9H 2Q6FA 4OS2A 1YPLH 4B71A 4XBCA 1LDTT 2FI4E 2VB0A 1TPPA 1GCTB 1Z8RA 4WXIA 1LQEA 1ORFA 1TAWA 4HTCH 2TPIZ 1YM0A 1BCUH 1UTKA 3NCLA 4A92A 4CRFA 1FJSA 1FIWA 3BTDE 5CHAC 2NU0E 4GCHG 1KSNA 4GSOA 3SU6A 5DP6A 3FFGA 2ZU4A 1A5IA 1TIOA 1WOFA 2ZCLP 1EOLA 4TWWA 3EDXB 3LJJA 5A8XA 3MFJA 1CGJE 1MUEB 1VITG 1TRNA 2ANYA 2VH6A 3MH6A 2AH4X 1AZ8A 1G3EA 1GDUA 3QTVH 4X2XA 1GHVH 3M5OA 2A7CA 1LHCH 3CS7A 2SNVA 1RTLA 3GY5A 4IMQA 1A0HB 5C3NA 3MU1A 1G3BA 1K22H 2GMTB 1GBAA 1O3EA 3MNCA 3SV2H 5FCRA 4AFQA 5GWZA 1GI1A 1OS8A 2GV7A 4K5ZA 3SN8A 2QXJA 2BD4A 1KXBA 4X6NA 2V3OH 1G37A 4GVUA 3F9GA 5LH8A 4FUFA 1GBDA 3GY7A 2C3SA 1GWAA 4IN1A 4ZAEA 1CU1A 4X1QU 1D6WA 1JMOH 3ZVCA 1EZQA 3P17H 3MNBA 2ZEBA 1AE8H 1HFDA 5GDSH 1SFQB 2JKHA 2OTVA 1NRRH 3GCNA 1YF4A 3UREA 1EKBB 2FS8A 1FUJA 3UNRA 1LTOA 1NRNH 2OC7A 1UVOA 2VH0A 2VGCC 2CHAB 2XW9A 2WINI 1C2EA 4ABIA 1P2OA 4O3TA 4IGDA 4ZROA 1O2KA 1XUHA 1HDTH 1ZTJA 1HV7A 3V0XA 3SNEA 4NIYA 2BYAX 4O03A 2IN2A 1W14U 2Z3EA 3DT0H 1D3PB 2BD7A 5JPMH 1C2HA 2A4OA 1K9OE 1F0UA 1JWTA 1CT0E 1DLEA 4ZXXH 1LVMA 2ZCHP 3F1SB 1QFKH 1A0LA 3SHAH 1GDNA 1GJAB 4MQAA 3I77A 2A32A 1FIZA 2W7UA 1MTWA 2G4UA 5CE1A 5FBEA 1W0YH 3SNBA 6GCHF 5LGOA 1THRH 4WJG2 1ANCA 4MNVA 1AB9B 1T8MA 1GBLA 3JZ2B 3SHCH 4BOHA 3SU1A 1UVUH 2HPPH 5T6DA 2O8WA 4A7IB 1HBTH 2VINA 1PQ5A 5GIBA 3KQDA 4AB8A 1XXFA 3KGPA 4YTAA 3BG4B 1LKBA 3V3MA 1T8NA 1TPAE 3KCGH 3DFLA 4CRAA 3RXSA 3QN7A 3UPEA 5JB8S 4OS5A 4PROA 3R0FA 1YCPK 2CGAA 2F9BH 2Z9LA 5SGAE 7LPRA 4U30A 1HJ9A 1QBOA 3TPIZ 1Z6EA 1HAVB 2EI6A 1LVOA 1Y5UT 2GVFA 1O2OA 1SGEE 2F9NA 2GDDA 3F6UH 3SOSA 2VNTA 1MD8A 1TNGA 3QGNB 2FOEA 2ZU5A 2ZDNA 5TJXA 2ZHDA 4NWKA 4AOQA 1P05A 1EQ9A 3LH3A 2RDLA 1CHOF 1O5AB 3A7YA 1RJXB 1C9PA 4H6TA 1S84A 1PJPA 2WV4A 2FODA 4X8SH 3ZZDA 2AMQA 2BLOA 4ABJA 1WAYB 3LH1A 1ZMJA 4AFUA 4AN7A 3H7OA 1DOJA 3TJOA 1LQDB 3P70B 1LHFH 1KIGH 1BTYA 1V2JT 5A8ZA 1QL7A 4DIHH 1WTGH 1O2IA 1TGSZ 2A5IA 3ITIA 1C2LA 3K2UA 5ESTE 1GJBB 3RC4A 1ID5H 1QURH 1NY22 1K1MA 3MWIU 4NG9H 3VB7A 1GHAG 1N1LA 4K60A 1G32B 1TMBH 1F5KU 4THNH 1YP9A 1BTXA 3MU0A 1S6FA 2ZTZA 1F5RA 1LHEH 1VCPA 2PFEA 3AAUA 2ZPRA 2ULLA 2GT7A 3M7UA 1NFXA 1W12U 5E0HA 2J2UA 1ZHRA 1AN1E 1LVBA 4CRCA 2TGPZ 1V3XA 1EP6A 1K1IA 1P2NA 5EGMA 1G36A 3ATMA 2M5TA 2FOBA 5EQRA 5E0JA 4D8NA 3S9CA 2WPMS 4I32A 3NKKA 3VB3A 1P10A 1T31A 3RMMH 3ENSB 3GDUA 3GY3A 2FOHA 3STJA 2J9NA 2RG3A 3A86A 3GY8A 3LGVA 3LGYA 1C2MA 3VXFH 3NK8A 3PTNA 2V3HH 2A4QA 3FVFB 1S83A 3LGUA 1SGDE 1ZTKA 1M9UA 1OYQA 3LDXH 2P3UB 5I25A 3A83A 1Z8JB 4INHA 2BDCA 1TABE 4YOGA 1GCDA 1OWEA 3A88A 3PB1E 6CHAB 1QY6A 4O3UA 4D9QA 1BMLA 1PPZA 1SB1H 1C4Y2 1UTOA 5JYIA 3A81A 3UNQA 3I29A 1O3FA 1SGPE 3UWIA 2FZZA 3A84A 1L0ZA 1C5MD 1WCZA 2PWXA 4Q2KA 3FAOA 1MH0A 1O30A 5I46H 2PTNA 4UFGH 4AZ2B 1JXPA 1O3IA 2VWOA 1C5LH 1UCYK 1HGTH 1IHTH 4OGYA 4OS6A 4UONA 1QHRB 2XBWA 1DWCH 1SGYE 1V2PT 1ANEA 4ZKOU 3OTJE 3ZZ6A 1XVMA 3V13A 4D9RA 1EP5A 2ZGBH 2YOLA 2PTCE 3ZVBA 3QTOH 3URCA 4YT7H 3UIRA 1TNJA 2XNIA 2OC1A 2A0QB 1GI8B 5C1YA 1IQKA 1GMHF 1PPGE 4KELA 1K21H 1HIAA 3SJIA 4AFZA 3PWBA 1BRUP 1C1RA 5H4IB 1D3DB 2FOMB 1Z8GA 1QB6A 2ZGJA 1BTPA 2ZG0H 4ABFA 4BAHB 2G4TA 3A7WA 4K8BA 2RA0A 5DGJA 1GJ6A 1KLIH 1SBWA 4B74A 2EC9H 1SC8U 4E7NA 2BDAA 1PQ8A 2VWLA 5LPRA 4JYTA 4Z6AH 4VGCC 4DOQA 1W8BH 1TRYA 1QQUA 1DITH 7KMEH 4I7YH 3TNSA 1FV9A 5A0BA 1C5VA 3A7XA 4WMDA 3B23B 4CBNA 1FQ3A 2SGQE 4JZEH 3S9AA 1K1PA 1V2MT 1C1OA 1MAYA 2A2QH 3F9EA 1YC0A 1OX1A 1ZHPA 1UHBA 2AERH 1EASA 4NFEA 5JBBS 4UFFH 1YBWA 2F9OA 5PTPA 5A09A 1BQYA 2XXLA 1MTNC 3SI3H 2Y5FA 2OCVB 3RXBA 6ESTA 1ZGIA 1KLTA 1C5WB 3CS0A 4GHTA 3M36A 1RIWB 1ETTH 2BHGA 2H5CA 2Z9JA 3BTFE 1EZUC 1Z1IA 4IW4E 4FVBA 1OOKB 1THSH 1DE7H 1KXAA 2HALA 1GJ9B 4CR5A 1GJ4H 1SGFG 2XRCA 1DUAA 3E6PH 3VEQB 1LMWB 1U6QA 2UUJB 3ZVDA 1FLEE 3E8LA 1TBZH 3W94A 5K0HA 1G3DA 4BTTB 1QBNA 4ABEA 2KAIA 1PPEE 2ZGCA 2BZ6H 3RXPA 1TA2A 3RXTA 2ZU1A 3PLKA 3LONA 1GCTC 1VR1H 1OP8A 4WH8A 5AFZH 3MTYA 1NT1A 2BY7X 8GCHG 5BPEA 1MBQA 1AE5A 1EAIA 9ESTA 3PYHA 3GY4A 3MHWU 5EW2H 2OXSA 1W0ZU 2DUCA 4X6PA 2BTCE 1BBRK 4AG1A 3LGWA 1O5EH 1TNLA 2H9HA 3FP7E 2NU3E 3G01A 1ZPCA 2BD8A 3URDA 2WPHS 4NA7A 1K1NA 1YKTA 1K28D 3SV6A 2FPZA 1OWKA 1TGBA 2QXGA 1BMNH 4JK5A 1JIMA 4KGAA 2PW8H 3P92A 1Q2WA 4Q7XA 3GDSA 3M3SA 4KTCA 3S0NA 2I6QA 2ALPA 1NS3A 2GMTC 1KXDA 1NC6A 1PPBH 1VJAU 5GXPA 3RMLH 3GCHB 1QCPA 5T6GA 4FUIA 1YPGH 2TGDA 2EEKA 4GCHF 2PUQH 3N7OA 1EXFA 1O2QA 1P0SH 1MKXH 4WMEA 2NU1E 1C1QA 3MYWA 2WPLS 3EGKH 3RXHA 3SNDA 4ZMAH 1O2SA 2V35A 2YNAA 1C1UH 4HZHA 5FX5A 2GKVE 1ARCA 1JRTA 3HGNA 1S5SA 1RD3B 3O8BA 1VITF 3MU4A 3Q76A 1O32A 1ZR0A 2CHAC 1YPMH 2AMDA 5EW1H 4U01A 3U1IB 1JRSA 3D62A 2STBE 1CBWB 4MVNA 1QQ4A 3P6ZB 1ZRBA 3U8RH 1HAOH 1C5RA 1GGDB 1V2OT 3ATIA 1AKSA 1UK4A 3E91A 2B8OH 4X8VH 1ACBE 1HAYB 5JBTA 4Y71A 2BLQA 5F8XA 1TNHA 2VIWA 1AUJA 1ANDA 1FY3A 1O3DA 3ZVGA 4BXWA 2HLCA 1OSSA 1GMDG 5EQSA 9LPRA 4TY7A 4ABGA 2BVRH 1NROH 1FONA 4NZLA 1GVKB 1QA0A 4ISHH 2F9PA 2ZDMA 1AB9C 1G30B 8KME2 1GVZA 5DG6A 2Z9GA 5DKMA 2NU4E 3K9XB 2O9QA 3A7ZA 2OC8A 3Q3KA 1HAXB 4MPWA 3S9BA 3BG4C 3MOCA 5A0AE 3PV4A 2J95A 1GMCG 1C5QA 1O3MA 5C5OA 1T7CA 5E2OA 3ODDA 2VVCA 1GVLA 1DWDH 1K2I1 2J4IA 3PM3A 3T2NA 4ZHAA 3TGIE 2IPHA 1EPTA 5EPNA 1NU9A 1NFUA 4D7FA 3EA9A 1O2ZA 1MCVA 4GAWA 2ZWLH 5AFYH 2BM2A 3BTTE 4CR9A 5FHTA 1PPHE 2ZFTA 1LVYA 1TOCB 4CH8B 1O36A 5FPSA 3E0PB 2ZDKA 3ZVFA 1VGCB 4OGXA 3UOPA 1O2YA 1LHGH 1Y5AT 3MNXA 2GZ9A 4Y79A 4RKJB 2FWWA 2O8MA 3T29A 1Y5BT 5T6FA 1C5PA 3RXAA 1VITH 2AIPA 1FAXA 1WTHD 1QL8A 1CO7E 2P59A 2A2XH 2HNTC 4I8GA 1W7XH 2WUBA 1CGHA 1OWJA 1Y3WA 4I8JA 4H6SB 4CRBA 1ZYOA 4FUEA 1O3LA 3VFEA 1P11E 1UCYE 4ZKNU 3UY9A 2XC0A 3HK3B 3IG6B 3ATLA 4ZKSU 1QR3E 1IHSH 1AD8H 2OP9A 3RM0H 3TK5A 2BDIA 2P94A 2HWLB 3GCOA 3O8CA 1O2JA 1C1WH 4IC6A 2Y82A 2ZPSA 4MLFB 1XXDA 3CP7A 4R8TB 2GV6A 4TY6A 3RLWH 1ZZZA 1DWBH 2UUFB 2TGAA 3LU9B 4ISOA 4LK4A 2TRMA 4BTUB 1CVWH 4CHAB 1NRSH 1QJ7B 1UTJA 2QN5T 4A1TA 2G5NA 4MPXA 1EB1H 4CRDA 3TJNA 1HIAB 3Q00A 1A7SA 1EAXA 2QCYA 1UO6A 1S81A 1VJ9U 4XBBA 1O3GA 1NRQH 1P57B 4JYUH 4ABBA 4HGCA 3IWMA 2NU2E 2FESH 1PPCE 2H2ZA 1TMUH 2A45B 3TITA 4DCDA 4WH6A 3A89A 1GI2A 1IAUA 3AW0A 2WYJA 1GBCA 1E0FD 1GDQA 1GJ7B 2K1QA 4LZ4B 1QJ1B 1MZAA 2PGBB 2SGAA 1H8DH 1OWDA 6CHAC 1FXYA 1TALA 2VIQA 5LPEA 1P3CA 1J8AA 1KTSB 1C5NH 2Z9IA 3A8CA 3MH5A 3RDZA 2BOHB 2VIPA 2R3YA 1S6HA 5DP9A 2ASUB 4ZHMU 1B0FA 3QK1A 1UHBB 3E3TA 4NIVA 1ETRH 1G2LA 1W3CA 2SFAA 2ZU2A 1YCPM 1B5GH 3SUEA 3MU5A 5FXLA 1GJ5H 3RXRA 3RXEA 3A8DA 1TMTH 1QNJA 4MG3A 1PFXC 5C1UA 7ESTE 4OS1A 1OP0A 1HAHH 1F92A 1IQEA 3ZV8A 1SGRE 2R0KA 1VCQA 4XOJA 3SW2B 2FOFA 2CJIA 2AYWA 2Q1JA 1ZRKA 3IITA 1BTHH 1HNEE 1PYTD 1XUFA 2A5KA 3KNXA 3ZZ4A 2BB4A 4MTBA 4SGAE 5GPIB 1MTSA 1O2GH 2OD3B 2W26A 2C90B 1DX5M 1QIXB 2WUCA 1TGTA 2KAIB 2FLRH 1F5LA 1V2UT 1BRCE 4WVPE 5EU8A 1O2NA 4ABHA 1H9IE 3KQCA 1L1JA 2J94A 4DW2U 1HRTH 2OUAA 4CREA 3TH4H 2FIRH 4Z0KA 1WSSH 1MD7A 2XTTB 3O8DA 1SFIA 2P3FH 1LCYA 1XUJA 4JCNA 1C4U2 4NA8A 5EPYA 4LXBH 1XVOA 1D6RA 1Y3YA 4Y7AA 3A85A 1V2LT 1BBRE 2O8UA 1QJ6B 3EYDA 3PO1B 1FPCH 1HJAB 3Q77A 3BN9A 1ELCA 2ANKH 4YM9A 1UVTH 2G5VA 1O3CA 1QL9A 4IBLH 1YGCH 2BZAA 2OQUA 3F68H 4R0IA 4TPYA 4DGJA 2ESTE 5DP5A 1O2UA 3BV9B 2AS9A 2ZDVH 4JZDH 4RKOB 8ESTE 3QX5H 1B0EA 1T32A 3EAJA 1UTPA 3E0NB 1BMMH 2AEIH 5GJ4B 2H9TH 1P2MA 3DUXH 3HKIB 1MU8B 5J4QA 1T4VH 1EZSC 3BTWE 2XWBI 3U8TH 4BTIB 3GYLB 5C67A 2B5TB 4KP0A 4UE7H 1C5ZB 1RIWC 1RXPA 3ZVEA 2C4FH 4DIIH 3UQVA 4KTUA 1ETSH 1EATA 1W2KH 1FNIA 2PLXA 1TE0A 4BAMB 3E1XB 1RRKA 1RGQA 2OC0A 3FANA 1O2TA 1SLVB 3QDZB 1O3BA 3UR6A 1QRZA 4WMFA 2JH0D 1OXGA 3OSYA 2HNTE 5TCAA 1CA0B 2XC5A 3RU4D 2BOKA 3SUGA 3DA9B 2B7DH 3RXMA 3SNCA 3UFAA 4NCYA 3TGKE 4ASHA 3O8RA 3RXDA 5EQQA 2W5EA 1Z1JA 4MNWA 3RXLA 2R2WU 3BEUA 1GHXH 1AKSB 1DXWA 5HM2A 2VIVA 1GI0A 2THFB 1AWHB 1ZSLA 3M7TA 5HXFA 3NWUA 1XUKA 4I33A 3FP8E 1GHWH 1T4UH 1IQGA 1BHXF 2ZDAH 1DDJA 1VCWA 1TNKA 4U2WA 3TK6A 1H9LB 2BQ7B 1EX3A 7GCHG 1MQ5A 1GHZA 2C93B 1W11U 2PUXB 5DPAA 2SGEE 3ZZCA 3UOUA 2XWAA 1TLDA 1O2PA 3QGJA 3L6PA 2C8YB 1O5FH 1WU1A 2CF8H 2LNCA 4ABDA 1WQVH 1GI9B 4M7GA 1AVXA 1ARBA 8GCHF 1ZTLA 3GCHC 1ELVA 1OWHA 4X1NU 3AVZA 1KYNA 3HK6B 4X1SU 1N6XA 3BTEE 1N8OB 3QWCH 3RXQA 2GZ7A 1V2TT 1FY1A 4FU7A 3KEEA 4ABAA 3GCTG 1YYY1 2GCTB 1A0JA 3SUFA 1Y8TA 3U9AH 1EPTB 5E8EH 4ZUHA 3PMBB 1T8LA 3D49H 3F9HA 2ZO3H 3M61U 2QXIA 5ABWA 1XMNB 1GBJA 4H42U 1FZZA 2Z7FE 5A0CA 1MZDA 4K3JA 5C1XA 1HPGA 1MAXA 3P8FA 1CBWC 1T8OA 1TA6A 1RTKA 1AFQB 1GGDC 3LPRA 1SI5H 1YLDA 1GHYH 3TJUA 4ISNA 1SGIB 1GI7B 1CGIE 2CN0H 2FTMA 1AI8H 1C5XB 1D3QB 1IOEA 2EI8A 4E7RG 5HYOA 3U1JB 5DP3A 2ANMH 1NTPA 4X8TH 3S7HB 4WF8A 1NRPH 2Q6DA 3E90B 1TOMH 4GLYA 4K8YA 1BRBE 2OBQA 1P02A 2V0BA 4X2YA 3QLPH 2ZHQH 4H4FA 3VB5A 2O8TA 1BTZA 3M5LA 1BTUA 2ZIQH 4X6MA 1GL1A 2VVUA 4X1RU 1ELEE 1J9CH 4GHQA 1NFYA 1CA8B 2FP7B 1EJAA 3T5FH 3MO3A 1P09A 1O2MA 2G55A 4B1TA 4FUBA 2PKSB 1Y3XA 2R2MB 1GBTA 2NWNA 2O8LA 1C1MA 2STAE 2JH5D 3LC5A 2UWOA 2J34A 2G00A 3A8BA 4I8LA 5JB9S 2ANWA 1C1TA 1V2VT 1L4DA 5DP8A 3SQHE 2Z9KA 5F8ZA 1ZPBA 3SBKA 1LKAA 1HXFH 1DSUA 1GMDF 3SORA 3ZZ3A 1A5HA 1DPOA 2CV3A 4FUGA 2A5AA 2AGEX 1TGCA 1P12E 1O3PB 2VWNA 4U32A 1DWEH 2BD5A 2FS9A 2BX4A 3T28A 3ZV9A 2LPRA 1TPOA 3ATWA 5ESBA 1ZPZA 1A3BH 1FAKH 1MQ6A 3HKJB 1GMHG 3ZYDA 1IQHA 3VB6A 2FTLE 2PKAA 2BDGA 2FX4A 3STIA 4AYVB 1VGCC 2FMJA 4NA9H 2H6MA 4YZUA 1BOQA 1QGFA 2GCHG 5T3HA 4F4OC 1W13U 1GI3A 4YLUA 3T27A 4XSKU 1UVSH 1AGJA 2Y5GA 4X8UH 3RXUA 1GMCF 2PSXA 1UTMA 3A82A 1O5CB 2AIQA 1P3EA 1S0QA 1HAZB 4Y8YA 5L2YH 1O5DH 1GBBA 2GGVB 1SG8B 1PQ7A 4Y6DA 2BD3A 4CH2B 4AFSA 3ATKA 4AB9A 2W3IA 4NSYA 1P01A 2Z94A 3RC5A 4AGJA 1SGCA 4XFQA 4K2YA 3UQOA 1IQLA 1C4V2 2SGPE 1RS0A 3SGBE 2SGDE 4MNYA 3S69A 2ZFRH 2BVSH 2PHBA 1TPSA 4FVDA 1ABJH 1HAIH 1Y3UA 1GBKA 3FZDA 3RU4E 3BF6H 1LPKB 4TPIZ 1E38B 1JOUB 1MTVA 3PMJA 4ZH8A 1O34A 3MO6A 1L1NA 1OKXA 3VGCB 1A61H 3UR9A 3ZZBA 2P95A 1BTWA 1SSXA 1UK3A 1ZSKA 3OU0A 3S7KB 2BDBA 3SGQE 3OY5U 4FUCA 4O97A 3LIWA 2ZHWH 4CHAC 2FYRA 2BLWA 5G4BA 1GI6A 2FOGA 3LGTA 4YT6H 2OINA 4TWYA 4ZKRU 3U98H 1NN6A 1V2QT 3SU2A 2Y81A 1HXEH 2ZFPH 3VPKA 3SJ8A 1FN6A 2VIOA 4RSPA 3GYMA 1Z6JH 2ZDLA 3H5CB 2ZFQH 3R3GB 5BRRE 1O5BB 2UWPA 3M3TA 1SLXB 4IC5A 3AASA 4MNXA 8LPRA 1AMHA 1AVGH 1AVWA 1AFEH 4JZ1A 3ZZ8A 3SU5A 2UUYA 2ZA5A 5GCHG 3D65E 1O39A 4B2AA 3SGAE 5FCKA 1P03A 1KTTB 2G51A 1P9SA 3SV9A 3QUMP 3Q3XA 1SQAA 2QF3A 1DUEA 1D4PB 1A4WH 1UJ1A 4AGKA 1FN8A 1HJ8A 2FYQA 4K1SA 3UTUH 1CT4E 1O35A 2A31A 2QV1A 4KTSA 1NFWA 3U8OH 1J15A 2ZU3A 3GDVA 2BLVA 1FY8E 1AO5A 1W10U 5EXNA 2ZF0H 3SNAA 5B6OA 3M7QA 1NO9H 1GG6B 4I31A 4AX9H 4YOJA 1SHHB 2P8OB 1F7ZA 1MKWH 1YCPH 2ZGXH 4JZIA 4YOIA 4HFPB 1FY5A 1QB9A 2PV9B 3MH4A 1IQJA 2QA9E 4WWYA 1O38A 4ZHLU 1C5UA 1EAWA 2IJOB 3M37A 1BT7A 4DURA 1KDQA 1C5SA 1ABIH 2ZHFH 2FM2A 3RM2H 1IQMA 3SV7A 2ZGHA 3HATH 1LHDH 4AYYB 2ZTYA 5F03A 4X6OA 5L30H 1FMGA 3BTGE 1H1BA 3DHKH 1YPJH 2R0LA 4Y76A 1WV7H 1WQSA 1D3TB 4QT8C 1QBVH 2ZNKH 3LC3A 2R3UA 4Y8XA 3KL6A 3PO1C 1HB0B 1HJAC 1SGQE 1DSTA 2HVXA 3GISB 1H4WA 2F91A 1XUGA 3Q3YA 5K7RA 1HCGA 2ZC9H 5IDKA 3HPTB 3MU8A 1O33A 1MKXK 3GOVB 1O31A 1YLCA 1MCTA 1MBMA 3SU4A 1O3JA 1TQ0B 3ZZ9A 1O3HA 3BEFB 1TBQH 1O2XA 4WY3A 3BTME 3LGIA 2VIDA 4RN6A 1Q3XA 2WYGA 1C5TA 1P2KA 3NUMA 3PROA 1EOJA 3PMAB 4B2CA 3DD2H 3U69H 1E35B 2A4RA 1SQOA 2SNWA 3DFJA 1TNIA 3RXGA 1L1GA 2OBOA 1NM6A 2BD9A 2FLBH 3RU4T 4UD9H 3AW1A 2H5DA 1P2QA 2Z3CA 3GY2A 1P2IA 3ZVAA 1S0RA 1DY9A 1UVPA 3OY6U 1O37A 1GHBG 4D7GA 1GHAF 3TH3H 1W7GH 3TU7H 2VWMA 1P8VC 1GJCB 1CA0C 2Y7ZA 1A5GH 1SR5C 1UTQA 3LOXA 1BB0B 1ELBA 4UDWH 1C5YB 1AIXH 1YPHC 3GICB 4Q7ZA 1BRAA 4BNRA 4JYVH 1KY9A 1DY8A 1O3NA 1NZQH 3RXJA 2B9LA 4KKDA 4FXGH 3TIUA 3FZZA 4K1EA 1J16A 5IYTA 2ALVA 1Z71A 1QB1A 1O0DH 2B0FA 2QAAA 5F6MA 1AU8A 1F0TA 2JETB 1SGNE 1UK2A 1TB6H 1FPHH 1OYTH 3GY6A 1ZGVA 1L4ZA 1SVPA 1Q31A 2ZQ2A 4DG4A 3I78A 1TBRH 2GDEH 2G81E 2R9PA 1EJNA 2BD2A 1ZMLA 5HMAA 2FOCA 2ZCKP 3A87A 1XX9A 2D1JA 1L2EA 5EOKA 1D9IA 1UCYH 4NIWA 1BDAA 2FEQH 1PPFE 1DXPA 4GPGA 3LT3A 4BANB 3VXEH 5C2ZA 1ELTA 1WYKA 2F9UA 3BG8A 1CT2E 1MKWK 2FO9A 4IMZA 1SGTA 3MI4A 5CHAB 4OS7A 4MPUA 5FBIA 1C1VH 3E16B 3SUDA 2OQ5A 1V2ST 3LKWA 1PYTC 3BEIB 5LPFA 4ZXYH 1QRXA 2BVXH 2QYIA 1A3EH 1EB2A 3AAVA 2WPJS 3M35A 1N8OC 3TJVA 4GUXA 4I8KA 1C9TA 2W7SA 1BA8B 2GCTC 3BTQE 4I8HA 5E0GA 2BY9X 1SL3A 1C2JA 5C5NA 5E2PA 1EPTC 1UTNA 2D26C 1AZZA 7GCHF 2ILNA 3A80A 1GI5A 4E05H 2Y7XA 3SJOA 2GX4A 1OWIA 1DICA 5HM9A 1ZSJA 3LJOA 4BAQB 1LPZB 2D2DA 4INLA 2PKAB 4DT7B 4NIXA 2C8XB 3MMGA 1GJDB 5DP4A 3TGJE 1GJ8B 1AFQC 1NU7B 2H9EH 1YPKH 2BDYA 1FDPA 1HYLA 1TFXA 4ESTE 1Y3VA 1TRMA 3T26A 4HI3A 1SQTA 1V2WT 3V7TA 2BY5X 4Q80A 1EZXC 6GCHG 1ZJDA 3QZRA 2XYAA 1O2HA 1ELAA 1IQIA 1TONA 1K1JA 3GCTF 2ZQ1A 2VGCB 1HAGE 2G52A 2ZZUH 3A7VA 2WPIS 1O3AA 1XKAC 2HNTF 5AVDA 1KLJH 1ZHMA 2XC4A 3B9FH 4A6LA 1INCA 1BHXB 2QIQA 4BAKB 1A1RA 3PWCA 1SLWB 3H7TA 2XBVA 2ZHEH 2PKSC 3PLPA 1CHGA 3NPSA 3ESTA 1ESTA 5C20A 2CF9H 1MU6B 2GTBA 1A46H 1P2JA 1E37B 3F9FA 1OP2A 1Z8IB 1C2IA 3KF2A 1SOTA 1MMJN 4B76A 1O3OA 3KIDU 2HGTH 4X0WU 3MNSA 5A8YA 2RCEA 3WY8A 1LO6A 1CHOG 2J92A 4YO9A 5EXLA 4Y0YE 1ZMNA 4K1TA 1HAPH 2RA3A 3A8AA 3RMNH 4NSVA 2P16A 3UWJH 4B2BA 2I6SA 1H8IH 4Q7YA 2BXTH 1BBRH 3PLBA 1IQFA 1DANH 3SZNA 3RP2A 3T62A 3VB4A 1NESE 2XCFA 1ZOMA 1VZQH 1Z7KA 2QXHA 1MTUA 4MPVA 3BTHE 5HGGA 2FI3E 3ZYEA 1ELGA 1C1PA 1KXFA 2ZI2H 3BIVH 1S85A 1C2DA 3P95A 4DVAU 4A1VA 4NFFA 2F3CE 2Y6TA 1YPHE 1P06A 1AUTC 1E36B 5TCCA 3UUZA 3RLYH 5EG4A 1WUNH 1TQ7B 1THPB 1XM1A 1ZJKA 3W95A 3OX7U 4DJZB 3SI4H 1BITA 4NWLA 5FPTA 4J2YB 3V12A 2CXVA 2OLGA 2YNBA 2AGIX 4SGBE 2SGFE 2H1UA 4CBOA 3RXIA 3A7TA 4Y0ZE 1K1LA 2A7JA 1GBHA 1G2MA 3PMHB 1PQAA 3T25A 5FX6A 4X2VA 3VGCC 2GCHF 1O3KA 1TYNA 1CSOE 3BSQA 2VVVA 5JBAS 1E34B 4UEHH 2ZKSA 3TH2H 1TX7A 1X7AC 2HOBA 1ESBA 1C2KA 3ELAH 1V6DA 2W3KA 1DS2E 1KDQB 2XBXA 4JMYA 4J1YA 3ODFA 2VJ1A 3TVJB 1G9IE 3RXKA 3EE0B 2ZP0H 3L3TA 1ESAA 5A2MH 3RXOA 4LOYH 3RXVA 4UFDH 4A1XA 3BTKE 4B73A 5F8TA 2JH6D 1ELDE 2GP9B 1DT2A 1UTLM 3QZQA 5AHGH 1V2NT 4Y10E 3SU3A 3CENA 5JBCS 1BIOA 1EUFA 2J38A 2Z3DA 2BMGB 1GBMA 4MDSA 4NGAH 1TX8A 3KQEA 1GI4A 4NZQA 2TGTA 1BZXE 4AORA 1HAVA 5EODA 2ODPA 1QTFA 1AWFH 4TYDA 4A5TS 2GT8A 4YESB 2F83A 4XDEA 4ISLA 3NXPA 4DY7B 1QA7A 2QY0B 2TBSA 3KHVA 4UFEH 1DVAH 3FP6E 1K1OA 4INKA 3TNTA 2ZFSA 2ZPQA 1KXCA 2ZECA 2PR3A 1WBGB 2PSYA 2G8TA 2BDHA 3K6ZA 2WPKS 2D8WA 2QC2A 5EXMA 1GG6C 3ZZ5A 2P8OC 1YPEH 5L2ZH 1B7XB 1SPJA 2UUKB 3P8GA 1BJUA 1G3CA 1TX6A 3RXFA 1LPGB 1O2VA 5GCHF 3SJKA 3TK9A 1NPMA 2A7HA 1EAUA 2HRVA 5ETXA 4BAOB 3TLOA 1O5GH 2ZFFH 2BY6X 1ANBA 1SLUB 3KQBA 2UWLA 1FI8A 4FUHA 2AMPA 2FOAA 4XBDA 2XCNA 3M3VA 1FY4A 3RMOH 1A2CH 4X1PU 2Y5HA 1S82A 3L33A 1SOZA 2AFQB 3D23A 1C5OH 2Q6GA 1GL0E 3SV8A 2WV5A 1RTFB 2V6NA 3EA8A 5DK1A 4XE4A 4JZFH 1TWXB 4YLQH 1ZLRA 1AY6H 2VU8E 2Y80A 2QGRA 3SU0A 1AHTH 1F0SA 4IN2A 1HUTH 1UMAH 2C8WB 1GBIA 1TGNA 1C1NA 3BIUH 2GZ8A 1J14A 4F49A 1HLTH 2IOTA 3ZZ7A 1DFPA 1DLKB 4X2WA 1QRWA 5CMXH 1RFNA 1O2RA 1GBEA 5L6NH 2QF0A 3EA7A 3MO9A 4IS5A 3SJ9A 4FUDA 4Y8ZA 1H9HE 1C2FA 1SGFA 2A1DB 4D76A 4BXSA 1V2KT 2ODQA 1V2RT 2AGGX 4WXVA 1JBUH 3SQEE 2BQ6B 2DE9A 4K69A 1P9UA 4LZ1H 3M5NA 2BX3A 1EJMA 1BUIA 1N6YA 1O2LA 4O9VA 2TIOA 2BQWB 2PGQB 1C1SA 4VGCB 3C1KA 1XUIA 3HGPA 5DP7A 1C2GA 1KXEA 1BMAA 2EI7A 3PTBA 4E06H 3ZZAA 3C27B 2GD4B 1JIRA 2ZTXA 3EQ0H 4FU9A 1GBFA 1O2WA 2FDAA 4Y7BA 5J4SA 5JDUB 1CE5A 3SO3A 2XBYA 3P8NA 1DM4B 3KN2A 1J17T 1BJVA 1P04A 5FPYA 4JK6A 3RC6A 3JZ1B 4OS4A 1Y59T 2FX6A 2BXUH 4FU8A 1MTNB 1AQ7A 2P3TB 2BY8X 3M5MA
chains in the Genus database with same CATH superfamily
5FAHA 1F0RA 5DJ7A 1GPZA 2CMYA 6LPRA 4CRGA 2ODYB 3QO6A 3SYJA 1IQNA 1OPHB 3MH7A 1ELFA 4Y11E 1SHYA 1F2SE 3UNSA 3P8OA 2HPQH 2C8ZB 3B8JA 4AG2A 4ISIH 3OYPA 2F9VA 2FI5E 2JETC 2FXRA 4FUJA 3RXCA 2DE8A 2P93A 2Z6BD 1SMFE 3K65B 3K6YA 3RUOA 2A4GA 3F3BA 3NZIA 1CQQA 5DO4H 1XKBC 4B75A 2EA3A 1GHBF 5AF9H 2Q6FA 4OS2A 1YPLH 4B71A 3PV5A 4XBCA 1LDTT 2FI4E 2VB0A 1TPPA 1GCTB 1Z8RA 4WXIA 1LQEA 1ORFA 1TAWA 4HTCH 2TPIZ 1YM0A 1BCUH 1UTKA 3NCLA 2QF5A 4A92A 4CRFA 1FJSA 1FIWA 3BTDE 5CHAC 4M9FA 2NU0E 4GCHG 1KSNA 4GSOA 3SU6A 5DP6A 3FFGA 2ZU4A 1A5IA 1TIOA 1WOFA 2ZCLP 1EOLA 4TWWA 3EDXB 3LJJA 5A8XA 3MFJA 1CGJE 1MUEB 1VITG 3CNRA 1TRNA 2ANYA 2VH6A 3MH6A 2AH4X 1AZ8A 1G3EA 1GDUA 3QTVH 4X2XA 1GHVH 3M5OA 2A7CA 1LHCH 3CS7A 2SNVA 1RTLA 3GY5A 4IMQA 1A0HB 5C3NA 3MU1A 1G3BA 4RT0A 2J98B 2F4LA 1K22H 2GMTB 1GBAA 1O3EA 3MNCA 3SV2H 5FCRA 4AFQA 5GWZA 1GI1A 1OS8A 2GV7A 4K5ZA 3SN8A 2QXJA 2BD4A 1KXBA 4X6NA 2V3OH 1G37A 4GVUA 3F9GA 5LH8A 4FUFA 1EFRD 1GBDA 3GY7A 2C3SA 1GWAA 4IN1A 4ZAEA 1CU1A 4X1QU 1D6WA 1JMOH 3ZVCA 1EZQA 3P17H 3MNBA 2ZEBA 1AE8H 1HFDA 5GDSH 1SFQB 2JKHA 2OTVA 1NRRH 3GCNA 1YF4A 3UREA 1EKBB 2FS8A 1FUJA 3UNRA 1LTOA 1NRNH 2OC7A 1UVOA 2VH0A 5EIYA 2VGCC 2CHAB 2XW9A 1VKYA 4P00A 2WINI 1C2EA 5EJZA 4ABIA 1P2OA 5FL7D 4O3TA 4IGDA 4ZROA 1O2KA 1XUHA 1E1QD 1HDTH 1ZTJA 1HV7A 3V0XA 3SNEA 4NIYA 2BYAX 4O03A 2IN2A 1W14U 2Z3EA 3DT0H 1D3PB 2BD7A 5JPMH 1C2HA 2A4OA 1K9OE 1F0UA 1JWTA 1CT0E 1DLEA 4ZXXH 1LVMA 2ZCHP 3F1SB 1QFKH 1A0LA 3SHAH 1GDNA 1GJAB 4MQAA 3I77A 2A32A 1FIZA 2W7UA 1MTWA 2G4UA 5CE1A 5FBEA 1W0YH 3SNBA 6GCHF 5LGOA 1THRH 4WJG2 1ANCA 1E1RD 4MNVA 1AB9B 1T8MA 1GBLA 3JZ2B 3SHCH 4BOHA 3SU1A 1UVUH 2HPPH 5T6DA 2O8WA 4A7IB 1HBTH 2VINA 1PQ5A 5GIBA 3KQDA 4AB8A 1XXFA 3KGPA 4YTAA 3BG4B 1LKBA 3V3MA 1T8NA 1TPAE 1K0HA 3KCGH 3DFLA 4CRAA 3RXSA 3QN7A 3UPEA 5JB8S 4OS5A 4PROA 3R0FA 1YCPK 2CGAA 2F9BH 2Z9LA 5SGAE 7LPRA 4U30A 2AHME 1HJ9A 1QBOA 3TPIZ 1Z6EA 1HAVB 2EI6A 1LVOA 1Y5UT 2GVFA 1O2OA 1SGEE 2F9NA 2GDDA 3F6UH 3SOSA 2VNTA 1MD8A 1TNGA 3QGNB 2FOEA 2ZU5A 2ZDNA 5TJXA 2ZHDA 4NWKA 4AOQA 1P05A 1EQ9A 3LH3A 4XD7D 2RDLA 1CHOF 1O5AB 3A7YA 1RJXB 1C9PA 3PV2A 1S84A 4H6TA 1PJPA 2WV4A 2FODA 4X8SH 3ZZDA 2AMQA 2BLOA 4ABJA 1WAYB 3LH1A 1ZMJA 4AFUA 4AN7A 3H7OA 1DOJA 3TJOA 1LQDB 2YMSB 3P70B 1LHFH 1KIGH 1BTYA 1V2JT 5A8ZA 1QL7A 4DIHH 1WTGH 2A5IA 1O2IA 1TGSZ 3ITIA 1C2LA 3K2UA 2LP6A 5ESTE 1GJBB 3RC4A 1ID5H 1QURH 2KR7A 1NY22 1K1MA 3MWIU 4NG9H 3VB7A 1GHAG 1N1LA 3PRDA 4K60A 1G32B 1TMBH 1F5KU 4THNH 1YP9A 1BTXA 3MU0A 1S6FA 2ZTZA 1F5RA 1LHEH 1VCPA 2PFEA 3AAUA 2ZPRA 2ULLA 2GT7A 3M7UA 1NFXA 1W12U 5E0HA 2J2UA 1ZHRA 1AN1E 1LVBA 4CRCA 2TGPZ 1V3XA 1EP6A 3AK5A 1K1IA 1P2NA 5EGMA 1G36A 2V3MA 3ATMA 2M5TA 2FOBA 5EQRA 5E0JA 4D8NA 3S9CA 2WPMS 4I32A 3NKKA 3VB3A 3N99A 1P10A 1T31A 3RMMH 3ENSB 3GDUA 3GY3A 2FOHA 3STJA 2J9NA 2RG3A 3A86A 3GY8A 2XNDD 3LGVA 3LGYA 1YLNA 1C2MA 3VXFH 3NK8A 3PTNA 2V3HH 2A4QA 3FVFB 1S83A 3LGUA 1SGDE 1ZTKA 1M9UA 1OYQA 3LDXH 3DSGA 2P3UB 5I25A 3A83A 1Z8JB 4INHA 2BDCA 1TABE 4YOGA 1GCDA 1OWEA 1YY3A 3A88A 3PB1E 6CHAB 1QY6A 4O3UA 4D9QA 1BMLA 1PPZA 1SB1H 1C4Y2 1UTOA 3UAIC 5JYIA 3A81A 3UNQA 3I29A 3NRLA 1O3FA 1SGPE 3UWIA 2FZZA 3A84A 1L0ZA 1C5MD 1WCZA 2PWXA 4Q2KA 3FAOA 1MH0A 1O30A 5I46H 2PTNA 4UFGH 2WPDD 4AZ2B 1JXPA 1O3IA 2VWOA 1C5LH 1UCYK 4XRNA 1HGTH 1IHTH 4OGYA 4OS6A 4Q4LA 4UONA 1QHRB 2XBWA 1DWCH 1SGYE 1V2PT 1ANEA 4ZKOU 3OTJE 3ZZ6A 1XVMA 3FKSD 3V13A 4D9RA 1EP5A 2ZGBH 2YOLA 2PTCE 3ZVBA 3QTOH 3URCA 4YT7H 3UIRA 1TNJA 3F0OA 2XNIA 2OC1A 2A0QB 1GI8B 5C1YA 1IQKA 1GMHF 1PPGE 4KELA 1K21H 1HIAA 3SJIA 4AFZA 3PWBA 1BRUP 1C1RA 5H4IB 1D3DB 2FOMB 1Z8GA 1QB6A 2ZGJA 1BTPA 2ZG0H 4ABFA 4BAHB 2G4TA 3A7WA 4K8BA 2RA0A 5DGJA 1GJ6A 1KLIH 1SBWA 4B74A 2EC9H 1SC8U 4E7NA 2BDAA 1PQ8A 2VWLA 5LPRA 4JYTA 4Z6AH 4VGCC 4DOQA 1W8BH 1TRYA 1QQUA 1DITH 7KMEH 4I7YH 3TNSA 1FV9A 1W0JD 5A0BA 1C5VA 3A7XA 4WMDA 3B23B 4CBNA 1FQ3A 2SGQE 4JZEH 3S9AA 1K1PA 1V2MT 1C1OA 1MAYA 2A2QH 3W1EA 3F9EA 1YC0A 1OX1A 1ZHPA 1UHBA 1H8ED 2AERH 1EASA 1E79D 4NFEA 5JBBS 4UFFH 1YBWA 2F9OA 5PTPA 5A09A 1BQYA 2XXLA 1MTNC 3SI3H 2Y5FA 2OCVB 3RXBA 6ESTA 1ZGIA 1KLTA 1C5WB 3CS0A 4GHTA 3M36A 1RIWB 1ETTH 2BHGA 2H5CA 2Z9JA 3BTFE 3N7DA 1EZUC 1Z1IA 4IW4E 4FVBA 1OOKB 1THSH 1DE7H 1KXAA 2HALA 1GJ9B 4CR5A 1GJ4H 1SGFG 2XRCA 1DUAA 3E6PH 3VEQB 2GJGA 1LMWB 1U6QA 2UUJB 3ZVDA 1FLEE 3E8LA 1TBZH 3W94A 5K0HA 1G3DA 3OEED 1QBNA 4BTTB 4ABEA 2KAIA 1PPEE 2ZGCA 2BZ6H 3RXPA 1TA2A 3RXTA 2ZU1A 3PLKA 3LONA 1GCTC 1VR1H 1OP8A 4WH8A 5AFZH 3MTYA 1NT1A 2BY7X 8GCHG 5BPEA 1MBQA 1AE5A 1EAIA 9ESTA 3PYHA 3GY4A 3MHWU 5EW2H 2OXSA 1W0ZU 2DUCA 4X6PA 2HLDD 2BTCE 1BBRK 4AG1A 3LGWA 1O5EH 1TNLA 2H9HA 3FP7E 2NU3E 3G01A 5C17A 1ZPCA 2BD8A 3URDA 2WPHS 1SKYE 4NA7A 1K1NA 1YKTA 1K28D 3SV6A 2FPZA 1OWKA 1TGBA 2QXGA 1BMNH 4JK5A 1JIMA 4KGAA 2PW8H 3P92A 1Q2WA 4Q7XA 3GDSA 3M3SA 4KTCA 3S0NA 2I6QA 2ALPA 1NS3A 2GMTC 1KXDA 1NC6A 1PPBH 1VJAU 5GXPA 1UW7A 3RMLH 3GCHB 1QCPA 2WV9A 5T6GA 5HIYA 4FUIA 1YPGH 2TGDA 2EEKA 4GCHF 2PUQH 3N7OA 1EXFA 1O2QA 1P0SH 1MKXH 4F55A 4WMEA 2NU1E 1C1QA 3MYWA 2WPLS 3EGKH 3RXHA 3SNDA 4ZMAH 1O2SA 2V35A 2YNAA 1C1UH 4HZHA 5FX5A 5B6LA 2GKVE 1ARCA 1JRTA 3HGNA 1S5SA 1RD3B 3O8BA 1VITF 3MU4A 3Q76A 1O32A 1ZR0A 2CHAC 1YPMH 2AMDA 5EW1H 4U01A 3U1IB 1JRSA 3D62A 2STBE 5T1VA 2PP6A 1CBWB 4MVNA 1QQ4A 3P6ZB 1ZRBA 3U8RH 1HAOH 3ZIAD 1C5RA 1GGDB 1V2OT 3ATIA 1AKSA 1UK4A 3E91A 2B8OH 3SZEA 4X8VH 1ACBE 1HAYB 5JBTA 4RI0A 2BLQA 4Y71A 5F8XA 1TNHA 2VIWA 1AUJA 1ANDA 1FY3A 1O3DA 3ZVGA 4YXWD 4BXWA 2HLCA 1OSSA 1GMDG 5EQSA 9LPRA 4TY7A 4ABGA 2BVRH 1NROH 1FONA 4NZLA 1GVKB 1QA0A 4ISHH 2F9PA 2ZDMA 1AB9C 1G30B 8KME2 1GVZA 5DG6A 2Z9GA 5DKMA 2NU4E 3K9XB 2O9QA 3A7ZA 5KGOA 2OC8A 3Q3KA 1HAXB 4MPWA 3S9BA 3BG4C 3MOCA 5A0AE 3PV4A 2J95A 1GMCG 1C5QA 1O3MA 5C5OA 3PRBA 1T7CA 5E2OA 3ODDA 2VVCA 1GVLA 1DWDH 1K2I1 2J4IA 3PM3A 3T2NA 4ZHAA 3TGIE 2IPHA 1EPTA 5EPNA 1NU9A 1NFUA 4D7FA 3EA9A 1O2ZA 1MCVA 4GAWA 2ZWLH 5AFYH 2BM2A 3BTTE 4CR9A 5FHTA 1PPHE 2ZFTA 1LVYA 1TOCB 2YMSD 4CH8B 1O36A 5FPSA 3E0PB 2ZDKA 3ZVFA 1VGCB 4OGXA 3UOPA 1O2YA 1LHGH 1Y5AT 3MNXA 2GZ9A 4Y79A 4RKJB 2FWWA 2O8MA 3T29A 1Y5BT 5T6FA 1QZ8A 1C5PA 3RXAA 1VITH 2YMSC 2AIPA 1FAXA 1WTHD 1QL8A 1CO7E 2P59A 2A2XH 2HNTC 2L6OA 1W7XH 4I8GA 2WUBA 1CGHA 1OWJA 1Y3WA 4I8JA 4H6SB 4CRBA 1ZYOA 4FUEA 1O3LA 3VFEA 1P11E 1UCYE 4ZKNU 3UY9A 2XC0A 3HK3B 3IG6B 3ATLA 4Q63A 4ZKSU 1QR3E 1IHSH 1AD8H 2OP9A 3RM0H 3TK5A 2BDIA 2P94A 2HWLB 3GCOA 3O8CA 1O2JA 1C1WH 4IC6A 3N7EA 2Y82A 4ZCNA 2ZPSA 4MLFB 1XXDA 3CP7A 3F0PA 4R8TB 2GV6A 4TY6A 3RLWH 1ZZZA 1NBMD 1DWBH 2UUFB 2TGAA 3LU9B 4F48B 4ISOA 4LK4A 2TRMA 4BTUB 1CVWH 4CHAB 1NRSH 1QJ7B 1UTJA 2QN5T 4A1TA 2G5NA 4MPXA 1EB1H 4CRDA 3TJNA 1HIAB 3Q00A 1A7SA 1EAXA 2QCYA 1UO6A 1S81A 1VJ9U 2VBCA 4XBBA 1O3GA 1NRQH 2IJD1 1P57B 4JYUH 4ABBA 4HGCA 3IWMA 2NU2E 2FESH 1PPCE 2H2ZA 1TMUH 2A45B 3TITA 4DCDA 4WH6A 3A89A 1GI2A 1IAUA 3AW0A 2WYJA 4FOUC 1GBCA 1E0FD 1GDQA 1GJ7B 2K1QA 4LZ4B 1QJ1B 1MZAA 2PGBB 2SGAA 1H8DH 1OWDA 6CHAC 1FXYA 1TALA 2VIQA 5LPEA 1P3CA 1J8AA 1KTSB 1C5NH 5HKKD 2Z9IA 3A8CA 3MH5A 3RDZA 2BOHB 2VIPA 2R3YA 1S6HA 5CHBA 5DP9A 2ASUB 4ZHMU 1B0FA 3QK1A 1UHBB 3E3TA 4NIVA 1ETRH 1G2LA 1W3CA 2SFAA 2ZU2A 1YCPM 1B5GH 3SUEA 3MU5A 5FXLA 1GJ5H 1H8HD 3RXRA 3RXEA 3A8DA 1TMTH 1QNJA 4MG3A 1PFXC 2M2AA 4P02A 5C1UA 7ESTE 4OS1A 1OP0A 1HAHH 1F92A 1IQEA 3ZV8A 1SGRE 2R0KA 1VCQA 4XOJA 3SW2B 2FOFA 2CJIA 2AYWA 2Q1JA 1ZRKA 3IITA 1BTHH 1HNEE 1PYTD 1XUFA 2A5KA 3KNXA 3ZZ4A 2BB4A 4MTBA 4SGAE 5GPIB 1MTSA 1O2GH 2KFWA 2OD3B 2W26A 2C90B 1DX5M 1QIXB 2WUCA 1TGTA 2KAIB 2FLRH 1F5LA 1V2UT 1BRCE 4WVPE 5EU8A 1O2NA 4ABHA 1H9IE 3KQCA 1L1JA 2J94A 4HG6A 4DW2U 1HRTH 2OUAA 4CREA 3TH4H 2FIRH 4Z0KA 1WSSH 1MD7A 2XTTB 3O8DA 1SFIA 2P3FH 1LCYA 1XUJA 4JCNA 1BMFD 1C4U2 4NA8A 5EPYA 4LXBH 1XVOA 1D6RA 1Y3YA 4Y7AA 2HVYB 3A85A 1V2LT 1BBRE 2O8UA 1QJ6B 3EYDA 3PO1B 1FPCH 1HJAB 3Q77A 3BN9A 1ELCA 2ANKH 4YM9A 2KCOA 1UVTH 2G5VA 3OFND 1O3CA 1QL9A 4IBLH 1YGCH 2BZAA 2OQUA 3F68H 4R0IA 4TPYA 4DGJA 2ESTE 5DP5A 1O2UA 3BV9B 2AS9A 2ZDVH 4JZDH 4RKOB 8ESTE 3QX5H 1B0EA 1T32A 3VG8A 3EAJA 1UTPA 3E0NB 1BMMH 2AEIH 5GJ4B 2H9TH 3WWFA 1P2MA 3DUXH 3HKIB 1MU8B 5J4QA 1T4VH 1EZSC 3BTWE 2XWBI 3U8TH 4BTIB 3GYLB 5C67A 2B5TB 4KP0A 4UE7H 1C5ZB 1RIWC 1RXPA 3ZVEA 2C4FH 4DIIH 3UQVA 3OAAD 4KTUA 1ETSH 1EATA 1W2KH 4ACBA 1FNIA 2PLXA 1TE0A 4BAMB 3E1XB 1RRKA 1RGQA 2OC0A 3FANA 1O2TA 1SLVB 2JJ1D 1O3BA 3QDZB 1QRZA 3UR6A 4WMFA 2JH0D 1OXGA 3OSYA 2HNTE 5TCAA 1CA0B 2XC5A 3RU4D 2BOKA 5DN6D 3SUGA 3DA9B 2B7DH 3RXMA 3SNCA 3UFAA 2J5UA 4NCYA 3TGKE 4ASHA 3O8RA 3RXDA 5EQQA 4TT3D 2W5EA 1Z1JA 4MNWA 3RXLA 2R2WU 3BEUA 3DSOA 1GHXH 1AKSB 1DXWA 5HM2A 2VIVA 1GI0A 2THFB 1AWHB 1ZSLA 3M7TA 5HXFA 3NWUA 1XUKA 4I33A 3FP8E 1GHWH 1T4UH 1IQGA 1BHXF 2ZDAH 1DDJA 1VCWA 1TNKA 4U2WA 3TK6A 2F43B 2KCYA 1H9LB 2BQ7B 1EX3A 7GCHG 1MQ5A 1GHZA 2C93B 1W11U 2PUXB 1NBME 5DPAA 2SGEE 3ZZCA 3UOUA 2XWAA 1TLDA 1O2PA 3QGJA 3L6PA 2C8YB 1O5FH 1WU1A 2CF8H 2LNCA 4ABDA 1WQVH 1GI9B 4M7GA 1AVXA 1ARBA 8GCHF 1ZTLA 3GCHC 5F53A 1ELVA 1OWHA 4X1NU 3AVZA 1KYNA 3HK6B 4X1SU 5EJLA 1N6XA 3BTEE 1N8OB 3QWCH 3RXQA 2GZ7A 1V2TT 1FY1A 4FU7A 3KEEA 4ABAA 3GCTG 1YYY1 2GCTB 1A0JA 3SUFA 1Y8TA 3U9AH 1EPTB 5E8EH 4ZUHA 3PMBB 1T8LA 3D49H 3F9HA 4B6EA 2ZO3H 3M61U 2QXIA 5ABWA 1XMNB 1GBJA 4H42U 1FZZA 2Z7FE 5A0CA 1MZDA 4K3JA 5C1XA 1HPGA 1MAXA 3P8FA 1CBWC 5C0UA 1T8OA 1TA6A 1RTKA 1AFQB 1GGDC 2KZ4A 3LPRA 1SI5H 1YLDA 1GHYH 3TJUA 4ISNA 1SGIB 1GI7B 1CGIE 2CN0H 2FTMA 1AI8H 1C5XB 1D3QB 1IOEA 2EI8A 4E7RG 5HYOA 2IPQX 3U1JB 5DP3A 2ANMH 1NTPA 4X8TH 3S7HB 4WF8A 1NRPH 2Q6DA 3E90B 1TOMH 4GLYA 4K8YA 1BRBE 2OBQA 1P02A 2V0BA 4X2YA 3QLPH 2ZHQH 4H4FA 3VB5A 2O8TA 1BTZA 3M5LA 1BTUA 2ZIQH 4X6MA 1GL1A 2VVUA 4X1RU 1ELEE 1J9CH 4GHQA 1NFYA 1CA8B 2FP7B 1EJAA 3T5FH 2KM0A 3MO3A 1P09A 1O2MA 2G55A 4Z1MD 4B1TA 4FUBA 2PKSB 1Y3XA 2R2MB 1GBTA 2NWNA 2O8LA 1C1MA 2STAE 2JH5D 3LC5A 2UWOA 2J34A 2G00A 3A8BA 4I8LA 5JB9S 2ANWA 1C1TA 1V2VT 1L4DA 5DP8A 3SQHE 3OE7D 2Z9KA 5F8ZA 1ZPBA 3SBKA 4DT4A 1LKAA 1HXFH 1DSUA 1GMDF 3SORA 3ZZ3A 1A5HA 1DPOA 2CV3A 4FUGA 2A5AA 2AGEX 1TGCA 1P12E 1O3PB 2VWNA 4U32A 1DWEH 2BD5A 2FS9A 2BX4A 3T28A 3ZV9A 2LPRA 1TPOA 3ATWA 5ESBA 1ZPZA 1A3BH 1FAKH 1MQ6A 3WWBA 3HKJB 1GMHG 3ZYDA 1IQHA 3VB6A 2FTLE 2PKAA 2BDGA 2FX4A 3STIA 4AYVB 1VGCC 2FMJA 4NA9H 2H6MA 4YZUA 1BOQA 1QGFA 2GCHG 5T3HA 4F4OC 1W13U 1GI3A 4YLUA 3T27A 4XSKU 1UVSH 1AGJA 2Y5GA 4X8UH 3RXUA 1GMCF 2PSXA 1UTMA 3A82A 1O5CB 2AIQA 1P3EA 1S0QA 1HAZB 4Y8YA 5L2YH 2KCAA 1O5DH 1GBBA 2GGVB 1SG8B 1PQ7A 4Y6DA 1MABB 2BD3A 4CH2B 4AFSA 3ATKA 2WZQA 2W3IA 4AB9A 4NSYA 1P01A 2Z94A 3RC5A 4AGJA 1COWD 1SGCA 4XFQA 4K2YA 3UQOA 1IQLA 1C4V2 2SGPE 1RS0A 3SGBE 2EQNA 2SGDE 4MNYA 3S69A 2ZFRH 2BVSH 2PHBA 1TPSA 4FVDA 1ABJH 1HAIH 1SQRA 1Y3UA 1GBKA 3FZDA 3RU4E 3BF6H 5C94A 1LPKB 4TPIZ 1E38B 1JOUB 1MTVA 3PMJA 4ZH8A 1O34A 3WW7A 3MO6A 1L1NA 1OKXA 3VGCB 1A61H 3UR9A 5DSFA 3ZZBA 2P95A 1BTWA 1SSXA 1UK3A 1ZSKA 3OU0A 3S7KB 2BDBA 3SGQE 2WHXA 3OY5U 4FUCA 4O97A 3LIWA 2ZHWH 4CHAC 2FYRA 2BLWA 5G4BA 1GI6A 2FOGA 3LGTA 4YT6H 1YWUA 2OINA 4TWYA 4ZKRU 3U98H 1NN6A 1V2QT 3SU2A 2Y81A 1HXEH 2W6ID 2ZFPH 3VPKA 3SJ8A 3KYGA 1FN6A 2VIOA 4RSPA 3GYMA 1Z6JH 2ZDLA 3H5CB 2ZFQH 3FOAA 3R3GB 5BRRE 1O5BB 2UWPA 3M3TA 1SLXB 4IC5A 3AASA 4MNXA 8LPRA 1AMHA 1AVGH 1AVWA 1AFEH 3F2GA 4JZ1A 3ZZ8A 3SU5A 2UUYA 2ZA5A 5GCHG 3D65E 5KEDA 1O39A 4B2AA 3SGAE 4RT1A 5FCKA 1P03A 1KTTB 2G51A 1P9SA 3SV9A 3QUMP 3Q3XA 1SQAA 2QF3A 1DUEA 1D4PB 1A4WH 1UJ1A 4AGKA 1FN8A 1HJ8A 2FYQA 4K1SA 3UTUH 1CT4E 1O35A 2A31A 2QV1A 4KTSA 1NFWA 3U8OH 1J15A 2ZU3A 3GDVA 2BLVA 1FY8E 3KQ5A 1AO5A 1W10U 5EXNA 2ZF0H 3SNAA 5B6OA 3M7QA 1NO9H 1GG6B 4I31A 4AX9H 4YOJA 1SHHB 1F7ZA 1YCPH 1MKWH 2P8OB 2ZGXH 4JZIA 1W0KD 4YOIA 4HFPB 1FY5A 1QB9A 2PV9B 3MH4A 1IQJA 2QA9E 4WWYA 1O38A 4ZHLU 1C5UA 1EAWA 2IJOB 3M37A 1BT7A 4DURA 1KDQA 1C5SA 1ABIH 2ZHFH 2FM2A 3RM2H 1IQMA 3SV7A 2ZGHA 4B6FA 3HATH 1LHDH 4AYYB 2ZTYA 5F03A 4X6OA 5L30H 1FMGA 3BTGE 1H1BA 3DHKH 1YPJH 2R0LA 4Y76A 1WV7H 1WQSA 1D3TB 4QT8C 1QBVH 2ZNKH 3LC3A 2R3UA 4Y8XA 3KL6A 3PO1C 1HB0B 1HJAC 1SGQE 1DSTA 2HVXA 3GISB 1H4WA 2F91A 1XUGA 3Q3YA 5K7RA 1HCGA 2ZC9H 5IDKA 3HPTB 3MU8A 1O33A 1MKXK 3GOVB 1O31A 1YLCA 5CDFE 1MCTA 1MBMA 3SU4A 2EY4C 1O3JA 1TQ0B 3ZZ9A 1O3HA 3BEFB 1TBQH 1O2XA 4WY3A 3BTME 3LGIA 2VIDA 4RN6A 1Q3XA 2WYGA 1C5TA 1P2KA 3NUMA 3PROA 1EOJA 3PMAB 4B2CA 3DD2H 3U69H 1E35B 2A4RA 1SQOA 2SNWA 3DFJA 1TNIA 3RXGA 1L1GA 2OBOA 1NM6A 2BD9A 2CK3D 2FLBH 3RU4T 2JIZD 4UD9H 3AW1A 2H5DA 1P2QA 1WDIA 2Z3CA 3GY2A 1P2IA 3ZVAA 1S0RA 1DY9A 1UVPA 3OY6U 1O37A 1GHBG 4D7GA 1GHAF 3TH3H 2RDEA 1W7GH 3TU7H 5C0TA 2VWMA 1P8VC 1GJCB 1CA0C 2Y7ZA 1A5GH 1SR5C 1UTQA 3LOXA 1BB0B 1ELBA 4UDWH 1C5YB 1AIXH 1YPHC 3GICB 4Q7ZA 1BRAA 4BNRA 4JYVH 1KY9A 1DY8A 1O3NA 3FO8D 1NZQH 3RXJA 2B9LA 4KKDA 4FXGH 3TIUA 3FZZA 4K1EA 1J16A 5IYTA 2ALVA 1Z71A 1QB1A 1O0DH 2B0FA 2QAAA 2WSSD 5F6MA 1AU8A 1F0TA 2JETB 1SGNE 1UK2A 1TB6H 1FPHH 1OYTH 3GY6A 1ZGVA 1L4ZA 1SVPA 3F2HA 1Q31A 2ZQ2A 4DG4A 3I78A 1TBRH 2GDEH 2G81E 2R9PA 1EJNA 2BD2A 1ZMLA 5HMAA 2FOCA 2ZCKP 3A87A 1XX9A 2D1JA 1L2EA 5EOKA 1D9IA 1UCYH 4NIWA 1BDAA 2FEQH 1PPFE 1DXPA 4GPGA 3LT3A 4BANB 2W6JD 3VXEH 5C2ZA 1ELTA 1WYKA 2F9UA 3BG8A 1CT2E 1MKWK 2FO9A 2LELA 4IMZA 1SGTA 3MI4A 5CHAB 4OS7A 4MPUA 5FBIA 1C1VH 3E16B 3SUDA 2OQ5A 1V2ST 3LKWA 1PYTC 3BEIB 5LPFA 4ZXYH 1QRXA 2BVXH 2QYIA 1A3EH 1EB2A 3AAVA 2WPJS 3M35A 1N8OC 3TJVA 4GUXA 4I8KA 4TSFD 1C9TA 2W7SA 1BA8B 2GCTC 2XOKD 3EE7A 3BTQE 4I8HA 5E0GA 2BY9X 1SL3A 1C2JA 5C5NA 5E2PA 1EPTC 1UTNA 2KCPA 1KMHB 2D26C 1AZZA 7GCHF 4OM9A 2ILNA 3A80A 1GI5A 4E05H 2Y7XA 3SJOA 2GX4A 1OWIA 1DICA 5HM9A 1ZSJA 3LJOA 4BAQB 1LPZB 2D2DA 4INLA 2PKAB 4DT7B 4NIXA 2C8XB 3MMGA 1GJDB 5DP4A 3TGJE 1GJ8B 1AFQC 1NU7B 2H9EH 1YPKH 2BDYA 1FDPA 1HYLA 1TFXA 2K0QA 4ESTE 1Y3VA 1TRMA 3T26A 4HI3A 1SQTA 1V2WT 3V7TA 2BY5X 4Q80A 1EZXC 6GCHG 1ZJDA 3QZRA 2XYAA 1O2HA 1ELAA 1IQIA 1TONA 1K1JA 3GCTF 5EJ1A 2ZQ1A 2VGCB 1HAGE 2G52A 2ZZUH 3A7VA 2WPIS 1O3AA 3FN8A 1XKAC 2HNTF 5AVDA 1KLJH 1ZHMA 2XC4A 3B9FH 4A6LA 3DSPA 1INCA 1BHXB 2QIQA 4BAKB 1A1RA 3PWCA 1SLWB 3H7TA 2XBVA 2ZHEH 2OK5A 2PKSC 3PLPA 1CHGA 3NPSA 3ESTA 1ESTA 5C20A 2CF9H 1MU6B 2GTBA 1A46H 1P2JA 1E37B 3F9FA 1OP2A 1Z8IB 1C2IA 3KF2A 1SOTA 1MMJN 4B76A 1O3OA 3KIDU 2HGTH 4I86A 4X0WU 3MNSA 5A8YA 2RCEA 3WY8A 1LO6A 1CHOG 2J92A 4YO9A 5EXLA 4Y0YE 1ZMNA 4K1TA 1HAPH 2J97A 2RA3A 3A8AA 2J98A 2L74A 3RMNH 4NSVA 2P16A 3UWJH 4B2BA 2I6SA 1H8IH 4Q7YA 2BXTH 1BBRH 3PLBA 1IQFA 1DANH 3SZNA 3RP2A 3T62A 3VB4A 1NESE 2XCFA 1ZOMA 1VZQH 1Z7KA 2QXHA 4ASUD 1MTUA 4MPVA 3BTHE 5HGGA 2FI3E 3ZYEA 1ELGA 1C1PA 1KXFA 2ZI2H 3BIVH 1S85A 1C2DA 3P95A 4DVAU 4A1VA 4NFFA 2KX4A 2F3CE 2Y6TA 1YPHE 4ACAA 1P06A 1AUTC 1E36B 5TCCA 3UUZA 3RLYH 5EG4A 1WUNH 1TQ7B 1THPB 3F2FA 1XM1A 1ZJKA 2K8IA 3W95A 3OX7U 4DJZB 3SI4H 1BITA 4NWLA 5FPTA 1FX0B 4J2YB 3V12A 2CXVA 2OLGA 2YNBA 2AGIX 4SGBE 2SGFE 2H1UA 4CBOA 3RXIA 3A7TA 4Y0ZE 1K1LA 2A7JA 1GBHA 1G2MA 3PMHB 1PQAA 3T25A 5FX6A 2JJ2D 4X2VA 3VGCC 2GCHF 1O3KA 1TYNA 1CSOE 3BSQA 2VVVA 5JBAS 1E34B 4UEHH 2ZKSA 5GNDA 3TH2H 1TX7A 1X7AC 2HOBA 1ESBA 1C2KA 3ELAH 5KECA 1V6DA 2W3KA 1DS2E 1KDQB 2XBXA 4JMYA 4J1YA 3ODFA 2VJ1A 2V7QD 3TVJB 1G9IE 3RXKA 3EE0B 2ZP0H 3L3TA 1ESAA 5A2MH 3RXOA 4LOYH 3RXVA 4UFDH 4A1XA 3BTKE 4B73A 5F8TA 2JH6D 1ELDE 2GP9B 3U28C 1DT2A 1UTLM 3QZQA 5AHGH 1V2NT 4Y10E 3SU3A 3CENA 5JBCS 1BIOA 1EUFA 2J38A 2Z3DA 2BMGB 1GBMA 4MDSA 4NGAH 1TX8A 3KQEA 1GI4A 4NZQA 2TGTA 1BZXE 4AORA 2JDID 1HAVA 5EODA 2ODPA 3UB0A 1QTFA 1AWFH 4TYDA 4A5TS 2GT8A 4YESB 2F83A 4XDEA 4ISLA 3NXPA 4DY7B 1QA7A 2QY0B 2TBSA 3KHVA 1WXRA 4UFEH 1DVAH 4FETA 3FP6E 1K1OA 4INKA 3TNTA 2ZFSA 2ZPQA 1KXCA 2RFKC 2ZECA 2PR3A 1WBGB 2PSYA 2G8TA 2BDHA 3K6ZA 2WPKS 2D8WA 2QC2A 5EXMA 1GG6C 3ZZ5A 2P8OC 1YPEH 5L2ZH 1B7XB 1SPJA 2UUKB 3P8GA 2QE7D 1BJUA 1G3CA 1TX6A 3RXFA 1LPGB 1O2VA 5GCHF 3SJKA 3TK9A 1NPMA 2A7HA 1EAUA 2HRVA 5ETXA 4BAOB 3TLOA 1O5GH 2ZFFH 2BY6X 1ANBA 1SLUB 3KQBA 2UWLA 1FI8A 4FUHA 2AMPA 2FOAA 4XBDA 2XCNA 3M3VA 1FY4A 3RMOH 1A2CH 4X1PU 2Y5HA 5IK2D 1S82A 3L33A 1SOZA 2AFQB 3D23A 1C5OH 2Q6GA 1GL0E 3SV8A 3GS9A 2WV5A 1RTFB 2V6NA 3EA8A 5DK1A 4XE4A 4JZFH 1TWXB 4YLQH 1ZLRA 3DCLA 1AY6H 2VU8E 2Y80A 2QGRA 3SU0A 1AHTH 3KYFA 1F0SA 4IN2A 1HUTH 1UMAH 2C8WB 1GBIA 3MQKC 1TGNA 1C1NA 1OHHD 3BIUH 2GZ8A 1J14A 4F49A 1HLTH 2IOTA 3ZZ7A 1DFPA 1DLKB 4X2WA 1QRWA 5CMXH 1RFNA 1O2RA 1GBEA 5L6NH 2QF0A 3EA7A 3MO9A 4IS5A 3SJ9A 4FUDA 2QF4A 4Y8ZA 1H9HE 1C2FA 4AC9A 1SGFA 2A1DB 4D76A 4BXSA 1V2KT 2ODQA 1V2RT 3OEHD 2AGGX 4WXVA 1JBUH 3SQEE 2BQ6B 2DE9A 4K69A 1P9UA 4LZ1H 3M5NA 2BX3A 1EJMA 1BUIA 1N6YA 1O2LA 4O9VA 2TIOA 2BQWB 5HIZA 2PGQB 1C1SA 4VGCB 3C1KA 1XUIA 3HGPA 5DP7A 1C2GA 1KXEA 1BMAA 2EI7A 3PTBA 4E06H 3H09A 3ZZAA 3C27B 2GD4B 1JIRA 3OTPA 2ZTXA 3EQ0H 4FU9A 1GBFA 1O2WA 2FDAA 4Y7BA 5J4SA 5JDUB 1CE5A 3SO3A 2XBYA 3P8NA 1DM4B 3KN2A 1S6LA 1J17T 1BJVA 1P04A 5FPYA 4JK6A 3RC6A 3JZ1B 4OS4A 1Y59T 2FX6A 2BXUH 4FU8A 1MTNB 1AQ7A 2P3TB 2BY8X 3M5MA
chains in the Genus database with same CATH topology
5FAHA 1F0RA 5DJ7A 1GPZA 2CMYA 6LPRA 4CRGA 2ODYB 3QO6A 1IQNA 1OPHB 3MH7A 1ELFA 4Y11E 1SHYA 1F2SE 3UNSA 3P8OA 2HPQH 2C8ZB 3B8JA 4AG2A 4ISIH 3OYPA 2F9VA 2FI5E 2JETC 2FXRA 4FUJA 3RXCA 2DE8A 2P93A 2Z6BD 1SMFE 3K65B 3K6YA 3RUOA 2A4GA 3NZIA 1CQQA 5DO4H 1XKBC 4B75A 2EA3A 1GHBF 5AF9H 2Q6FA 4OS2A 1YPLH 4B71A 4XBCA 1LDTT 2FI4E 2VB0A 1TPPA 1GCTB 1Z8RA 4WXIA 1LQEA 1ORFA 1TAWA 4HTCH 2TPIZ 1YM0A 1BCUH 1UTKA 3NCLA 4A92A 4CRFA 1FJSA 1FIWA 3BTDE 5CHAC 2NU0E 4GCHG 1KSNA 4GSOA 3SU6A 5DP6A 3FFGA 2ZU4A 1A5IA 1TIOA 1WOFA 2ZCLP 1EOLA 4TWWA 3EDXB 3LJJA 5A8XA 3MFJA 1CGJE 1MUEB 1VITG 1TRNA 2ANYA 2VH6A 3MH6A 2AH4X 1AZ8A 1G3EA 1GDUA 3QTVH 4X2XA 1GHVH 3M5OA 2A7CA 1LHCH 3CS7A 2SNVA 1RTLA 3GY5A 4IMQA 1A0HB 5C3NA 3MU1A 1G3BA 1K22H 2GMTB 1GBAA 1O3EA 3MNCA 3SV2H 5FCRA 4AFQA 5GWZA 1GI1A 1OS8A 2GV7A 4K5ZA 3SN8A 2QXJA 2BD4A 1KXBA 4X6NA 2V3OH 1G37A 4GVUA 3F9GA 5LH8A 4FUFA 1GBDA 3GY7A 2C3SA 1GWAA 4IN1A 4ZAEA 1CU1A 4X1QU 1D6WA 1JMOH 3ZVCA 1EZQA 3P17H 3MNBA 2ZEBA 1AE8H 1HFDA 5GDSH 1SFQB 2JKHA 2OTVA 1NRRH 3GCNA 1YF4A 3UREA 1EKBB 2FS8A 1FUJA 3UNRA 1LTOA 1NRNH 2OC7A 1UVOA 2VH0A 2VGCC 2CHAB 2XW9A 2WINI 1C2EA 4ABIA 1P2OA 4O3TA 4IGDA 4ZROA 1O2KA 1XUHA 1HDTH 1ZTJA 1HV7A 3V0XA 3SNEA 4NIYA 2BYAX 4O03A 2IN2A 1W14U 2Z3EA 3DT0H 1D3PB 2BD7A 5JPMH 1C2HA 2A4OA 1K9OE 1F0UA 1JWTA 1CT0E 1DLEA 4ZXXH 1LVMA 2ZCHP 3F1SB 1QFKH 1A0LA 3SHAH 1GDNA 1GJAB 4MQAA 3I77A 2A32A 1FIZA 2W7UA 1MTWA 2G4UA 5CE1A 5FBEA 1W0YH 3SNBA 6GCHF 5LGOA 1THRH 4WJG2 1ANCA 4MNVA 1AB9B 1T8MA 1GBLA 3JZ2B 3SHCH 4BOHA 3SU1A 1UVUH 2HPPH 5T6DA 2O8WA 4A7IB 1HBTH 2VINA 1PQ5A 5GIBA 3KQDA 4AB8A 1XXFA 3KGPA 4YTAA 3BG4B 1LKBA 3V3MA 1T8NA 1TPAE 3KCGH 3DFLA 4CRAA 3RXSA 3QN7A 3UPEA 5JB8S 4OS5A 4PROA 3R0FA 1YCPK 2CGAA 2F9BH 2Z9LA 5SGAE 7LPRA 4U30A 1HJ9A 1QBOA 3TPIZ 1Z6EA 1HAVB 2EI6A 1LVOA 1Y5UT 2GVFA 1O2OA 1SGEE 2F9NA 2GDDA 3F6UH 3SOSA 2VNTA 1MD8A 1TNGA 3QGNB 2FOEA 2ZU5A 2ZDNA 5TJXA 2ZHDA 4NWKA 4AOQA 1P05A 1EQ9A 3LH3A 2RDLA 1CHOF 1O5AB 3A7YA 1RJXB 1C9PA 4H6TA 1S84A 1PJPA 2WV4A 2FODA 4X8SH 3ZZDA 2AMQA 2BLOA 4ABJA 1WAYB 3LH1A 1ZMJA 4AFUA 4AN7A 3H7OA 1DOJA 3TJOA 1LQDB 3P70B 1LHFH 1KIGH 1BTYA 1V2JT 5A8ZA 1QL7A 4DIHH 1WTGH 1O2IA 1TGSZ 2A5IA 3ITIA 1C2LA 3K2UA 5ESTE 1GJBB 3RC4A 1ID5H 1QURH 1NY22 1K1MA 3MWIU 4NG9H 3VB7A 1GHAG 1N1LA 4K60A 1G32B 1TMBH 1F5KU 4THNH 1YP9A 1BTXA 3MU0A 1S6FA 2ZTZA 1F5RA 1LHEH 1VCPA 2PFEA 3AAUA 2ZPRA 2ULLA 2GT7A 3M7UA 1NFXA 1W12U 5E0HA 2J2UA 1ZHRA 1AN1E 1LVBA 4CRCA 2TGPZ 1V3XA 1EP6A 1K1IA 1P2NA 5EGMA 1G36A 3ATMA 2M5TA 2FOBA 5EQRA 5E0JA 4D8NA 3S9CA 2WPMS 4I32A 3NKKA 3VB3A 1P10A 1T31A 3RMMH 3ENSB 3GDUA 3GY3A 2FOHA 3STJA 2J9NA 2RG3A 3A86A 3GY8A 3LGVA 3LGYA 1C2MA 3VXFH 3NK8A 3PTNA 2V3HH 2A4QA 3FVFB 1S83A 3LGUA 1SGDE 1ZTKA 1M9UA 1OYQA 3LDXH 2P3UB 5I25A 3A83A 1Z8JB 4INHA 2BDCA 1TABE 4YOGA 1GCDA 1OWEA 3A88A 3PB1E 6CHAB 1QY6A 4O3UA 4D9QA 1BMLA 1PPZA 1SB1H 1C4Y2 1UTOA 5JYIA 3A81A 3UNQA 3I29A 1O3FA 1SGPE 3UWIA 2FZZA 3A84A 1L0ZA 1C5MD 1WCZA 2PWXA 4Q2KA 3FAOA 1MH0A 1O30A 5I46H 2PTNA 4UFGH 4AZ2B 1JXPA 1O3IA 2VWOA 1C5LH 1UCYK 1HGTH 1IHTH 4OGYA 4OS6A 4UONA 1QHRB 2XBWA 1DWCH 1SGYE 1V2PT 1ANEA 4ZKOU 3OTJE 3ZZ6A 1XVMA 3V13A 4D9RA 1EP5A 2ZGBH 2YOLA 2PTCE 3ZVBA 3QTOH 3URCA 4YT7H 3UIRA 1TNJA 2XNIA 2OC1A 2A0QB 1GI8B 5C1YA 1IQKA 1GMHF 1PPGE 4KELA 1K21H 1HIAA 3SJIA 4AFZA 3PWBA 1BRUP 1C1RA 5H4IB 1D3DB 2FOMB 1Z8GA 1QB6A 2ZGJA 1BTPA 2ZG0H 4ABFA 4BAHB 2G4TA 3A7WA 4K8BA 2RA0A 5DGJA 1GJ6A 1KLIH 1SBWA 4B74A 2EC9H 1SC8U 4E7NA 2BDAA 1PQ8A 2VWLA 5LPRA 4JYTA 4Z6AH 4VGCC 4DOQA 1W8BH 1TRYA 1QQUA 1DITH 7KMEH 4I7YH 3TNSA 1FV9A 5A0BA 1C5VA 3A7XA 4WMDA 3B23B 4CBNA 1FQ3A 2SGQE 4JZEH 3S9AA 1K1PA 1V2MT 1C1OA 1MAYA 2A2QH 3F9EA 1YC0A 1OX1A 1ZHPA 1UHBA 2AERH 1EASA 4NFEA 5JBBS 4UFFH 1YBWA 2F9OA 5PTPA 5A09A 1BQYA 2XXLA 1MTNC 3SI3H 2Y5FA 2OCVB 3RXBA 6ESTA 1ZGIA 1KLTA 1C5WB 3CS0A 4GHTA 3M36A 1RIWB 1ETTH 2BHGA 2H5CA 2Z9JA 3BTFE 1EZUC 1Z1IA 4IW4E 4FVBA 1OOKB 1THSH 1DE7H 1KXAA 2HALA 1GJ9B 4CR5A 1GJ4H 1SGFG 2XRCA 1DUAA 3E6PH 3VEQB 1LMWB 1U6QA 2UUJB 3ZVDA 1FLEE 3E8LA 1TBZH 3W94A 5K0HA 1G3DA 4BTTB 1QBNA 4ABEA 2KAIA 1PPEE 2ZGCA 2BZ6H 3RXPA 1TA2A 3RXTA 2ZU1A 3PLKA 3LONA 1GCTC 1VR1H 1OP8A 4WH8A 5AFZH 3MTYA 1NT1A 2BY7X 8GCHG 5BPEA 1MBQA 1AE5A 1EAIA 9ESTA 3PYHA 3GY4A 3MHWU 5EW2H 2OXSA 1W0ZU 2DUCA 4X6PA 2BTCE 1BBRK 4AG1A 3LGWA 1O5EH 1TNLA 2H9HA 3FP7E 2NU3E 3G01A 1ZPCA 2BD8A 3URDA 2WPHS 4NA7A 1K1NA 1YKTA 1K28D 3SV6A 2FPZA 1OWKA 1TGBA 2QXGA 1BMNH 4JK5A 1JIMA 4KGAA 2PW8H 3P92A 1Q2WA 4Q7XA 3GDSA 3M3SA 4KTCA 3S0NA 2I6QA 2ALPA 1NS3A 2GMTC 1KXDA 1NC6A 1PPBH 1VJAU 5GXPA 3RMLH 3GCHB 1QCPA 5T6GA 4FUIA 1YPGH 2TGDA 2EEKA 4GCHF 2PUQH 3N7OA 1EXFA 1O2QA 1P0SH 1MKXH 4WMEA 2NU1E 1C1QA 3MYWA 2WPLS 3EGKH 3RXHA 3SNDA 4ZMAH 1O2SA 2V35A 2YNAA 1C1UH 4HZHA 5FX5A 2GKVE 1ARCA 1JRTA 3HGNA 1S5SA 1RD3B 3O8BA 1VITF 3MU4A 3Q76A 1O32A 1ZR0A 2CHAC 1YPMH 2AMDA 5EW1H 4U01A 3U1IB 1JRSA 3D62A 2STBE 1CBWB 4MVNA 1QQ4A 3P6ZB 1ZRBA 3U8RH 1HAOH 1C5RA 1GGDB 1V2OT 3ATIA 1AKSA 1UK4A 3E91A 2B8OH 4X8VH 1ACBE 1HAYB 5JBTA 4Y71A 2BLQA 5F8XA 1TNHA 2VIWA 1AUJA 1ANDA 1FY3A 1O3DA 3ZVGA 4BXWA 2HLCA 1OSSA 1GMDG 5EQSA 9LPRA 4TY7A 4ABGA 2BVRH 1NROH 1FONA 4NZLA 1GVKB 1QA0A 4ISHH 2F9PA 2ZDMA 1AB9C 1G30B 8KME2 1GVZA 5DG6A 2Z9GA 5DKMA 2NU4E 3K9XB 2O9QA 3A7ZA 2OC8A 3Q3KA 1HAXB 4MPWA 3S9BA 3BG4C 3MOCA 5A0AE 3PV4A 2J95A 1GMCG 1C5QA 1O3MA 5C5OA 1T7CA 5E2OA 3ODDA 2VVCA 1GVLA 1DWDH 1K2I1 2J4IA 3PM3A 3T2NA 4ZHAA 3TGIE 2IPHA 1EPTA 5EPNA 1NU9A 1NFUA 4D7FA 3EA9A 1O2ZA 1MCVA 4GAWA 2ZWLH 5AFYH 2BM2A 3BTTE 4CR9A 5FHTA 1PPHE 2ZFTA 1LVYA 1TOCB 4CH8B 1O36A 5FPSA 3E0PB 2ZDKA 3ZVFA 1VGCB 4OGXA 3UOPA 1O2YA 1LHGH 1Y5AT 3MNXA 2GZ9A 4Y79A 4RKJB 2FWWA 2O8MA 3T29A 1Y5BT 5T6FA 1C5PA 3RXAA 1VITH 2AIPA 1FAXA 1WTHD 1QL8A 1CO7E 2P59A 2A2XH 2HNTC 4I8GA 1W7XH 2WUBA 1CGHA 1OWJA 1Y3WA 4I8JA 4H6SB 4CRBA 1ZYOA 4FUEA 1O3LA 3VFEA 1P11E 1UCYE 4ZKNU 3UY9A 2XC0A 3HK3B 3IG6B 3ATLA 4ZKSU 1QR3E 1IHSH 1AD8H 2OP9A 3RM0H 3TK5A 2BDIA 2P94A 2HWLB 3GCOA 3O8CA 1O2JA 1C1WH 4IC6A 2Y82A 2ZPSA 4MLFB 1XXDA 3CP7A 4R8TB 2GV6A 4TY6A 3RLWH 1ZZZA 1DWBH 2UUFB 2TGAA 3LU9B 4ISOA 4LK4A 2TRMA 4BTUB 1CVWH 4CHAB 1NRSH 1QJ7B 1UTJA 2QN5T 4A1TA 2G5NA 4MPXA 1EB1H 4CRDA 3TJNA 1HIAB 3Q00A 1A7SA 1EAXA 2QCYA 1UO6A 1S81A 1VJ9U 4XBBA 1O3GA 1NRQH 1P57B 4JYUH 4ABBA 4HGCA 3IWMA 2NU2E 2FESH 1PPCE 2H2ZA 1TMUH 2A45B 3TITA 4DCDA 4WH6A 3A89A 1GI2A 1IAUA 3AW0A 2WYJA 1GBCA 1E0FD 1GDQA 1GJ7B 2K1QA 4LZ4B 1QJ1B 1MZAA 2PGBB 2SGAA 1H8DH 1OWDA 6CHAC 1FXYA 1TALA 2VIQA 5LPEA 1P3CA 1J8AA 1KTSB 1C5NH 2Z9IA 3A8CA 3MH5A 3RDZA 2BOHB 2VIPA 2R3YA 1S6HA 5DP9A 2ASUB 4ZHMU 1B0FA 3QK1A 1UHBB 3E3TA 4NIVA 1ETRH 1G2LA 1W3CA 2SFAA 2ZU2A 1YCPM 1B5GH 3SUEA 3MU5A 5FXLA 1GJ5H 3RXRA 3RXEA 3A8DA 1TMTH 1QNJA 4MG3A 1PFXC 5C1UA 7ESTE 4OS1A 1OP0A 1HAHH 1F92A 1IQEA 3ZV8A 1SGRE 2R0KA 1VCQA 4XOJA 3SW2B 2FOFA 2CJIA 2AYWA 2Q1JA 1ZRKA 3IITA 1BTHH 1HNEE 1PYTD 1XUFA 2A5KA 3KNXA 3ZZ4A 2BB4A 4MTBA 4SGAE 5GPIB 1MTSA 1O2GH 2OD3B 2W26A 2C90B 1DX5M 1QIXB 2WUCA 1TGTA 2KAIB 2FLRH 1F5LA 1V2UT 1BRCE 4WVPE 5EU8A 1O2NA 4ABHA 1H9IE 3KQCA 1L1JA 2J94A 4DW2U 1HRTH 2OUAA 4CREA 3TH4H 2FIRH 4Z0KA 1WSSH 1MD7A 2XTTB 3O8DA 1SFIA 2P3FH 1LCYA 1XUJA 4JCNA 1C4U2 4NA8A 5EPYA 4LXBH 1XVOA 1D6RA 1Y3YA 4Y7AA 3A85A 1V2LT 1BBRE 2O8UA 1QJ6B 3EYDA 3PO1B 1FPCH 1HJAB 3Q77A 3BN9A 1ELCA 2ANKH 4YM9A 1UVTH 2G5VA 1O3CA 1QL9A 4IBLH 1YGCH 2BZAA 2OQUA 3F68H 4R0IA 4TPYA 4DGJA 2ESTE 5DP5A 1O2UA 3BV9B 2AS9A 2ZDVH 4JZDH 4RKOB 8ESTE 3QX5H 1B0EA 1T32A 3EAJA 1UTPA 3E0NB 1BMMH 2AEIH 5GJ4B 2H9TH 1P2MA 3DUXH 3HKIB 1MU8B 5J4QA 1T4VH 1EZSC 3BTWE 2XWBI 3U8TH 4BTIB 3GYLB 5C67A 2B5TB 4KP0A 4UE7H 1C5ZB 1RIWC 1RXPA 3ZVEA 2C4FH 4DIIH 3UQVA 4KTUA 1ETSH 1EATA 1W2KH 1FNIA 2PLXA 1TE0A 4BAMB 3E1XB 1RRKA 1RGQA 2OC0A 3FANA 1O2TA 1SLVB 3QDZB 1O3BA 3UR6A 1QRZA 4WMFA 2JH0D 1OXGA 3OSYA 2HNTE 5TCAA 1CA0B 2XC5A 3RU4D 2BOKA 3SUGA 3DA9B 2B7DH 3RXMA 3SNCA 3UFAA 4NCYA 3TGKE 4ASHA 3O8RA 3RXDA 5EQQA 2W5EA 1Z1JA 4MNWA 3RXLA 2R2WU 3BEUA 1GHXH 1AKSB 1DXWA 5HM2A 2VIVA