5AVTB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avtB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avtB02
3HTKA 2R3CA 3HE4A 1A02J 3HE4B 3HE5A 1GD2E 3TNUA 3LIDA 3HE5B 3P8MC 1HUCA 1CSBA 3P7KA 3TNUB 1H89A 1GZLA 1CI6A 1MUUA 1CZQA 2N9BA 2R5DA 2WTYA 1JUNA 5APVA 1CI6B 4LC1A 2Q5UA 1OXZA 1MFZA 5APTA 2WT7A 5CMZA 3NFQA 2Q7CA 5AW8B 1NAFA 2WT7B 3L36A 4HYTB 3VN0A 5AW4B 3V5BA 3KQGA 2ZXEB 4I6MC 3IR9A 2E43A 3L37A 5AVVB 3VMYA 4I2LC 5AW5B 2VRSA 2WWWA 3TK1A 3NMDA 3MGNA 3M0AA 3M9HA 5AVUB 1GU5A 5APQA 1YYCA 4GKGA 3VMZA 3A7OA 5AW2B 4B86A 3SWFA 1GK6A 3V4QA 1KQLA 3VTPC 5AVXB 4AYCA 2P67A 4XE5B 3V4WA 1A02F 3NXSA 1MV8A 1J2JB 2XV5A 1HBWA 2Z5IA 3M0DA 2WPSA 1HWTC 2P7JA 2KP8A 5AW3B 4KHXA 3OAKA 4JYCA 5AVQB 3T97A 2C9LY 2H7HA 2JJLA 5AVYB 1HJBA 3L35A 1H8AA 4C46A 1T2KD 1JNMA 4JYBA 5AVSB 1G2CB 3A2AA 1OWAA 2W27A 3A5TA 2R5BA 2C9NY 4EOTA 4RETB 3M9BA 3VMXA 3VYIA 5AW7B 2Z5HA 2P2UA 4DZOA 2WPQA 3UIAA 1H88A 4GT1A 5AVRB 1FAVA 1IO4A 4AQRD 2E42A 5AVTB 2YNYA 2XZRA 2XU6A 2QM7A 3NTNA 2R32A 1GTWA 3I5CA 2YO3A 2Q3IA 4C7NA 2YO2A 2ZFCA 1SLQA 5APYA 1S9KD 1T2KC 5AW6B 4C7NB 1X8YA 5APWA 5AW1B 2IPPA 3WGUB 2W6AA 3O8ZA 3LIEA 1SP4A 5APUA 2BASA 3A3YB 5AVWB 4AUWA 4RESB 5AW0B 1FOSF 1S9KE 1GK4A 3M91A 1DH3A 3TYYA 2WPRA 3KDPB 3B8EB 3MD0A 3M06A 3P32A 5APSA 5APXA 5AVZB 2QM8A 1NWQA 1FOSE 5AW9B 1GU4A 4M3LA 3WGVB
chains in the Genus database with same CATH superfamily
1J10A 4UM9D 4HHAB 5DJXB 3B5NA 3TIDA 4JLRA 4X4ME 5C2UB 2NZ9D 2V2XB 3BQVA 5JQ6L 2WWKT 3IDIB 1BD2A 2C1OA 4LKXA 3MGTA 3AU1A 2ZOKA 5DC2A 4CJ1A 3MLWH 4ES9A 1ESOA 3LV3B 5E6ZA 3DI3B 1NSNH 1QSZA 1AR2A 2R23B 1HZLA 3QJTB 1VQ7P 4KFMA 4N5ED 1NLBL 3C2AL 4Q6KA 4RGMC 5HHOD 4AL8L 2ZNWA 4HK3N 2WB7A 1ZXGA 2HFFB 5CM1A 3NCYP 4G9DB 5CHNB 4NBXB 5FA3A 1T5WA 2E74D 3BQUA 2HTKC 5JO5B 4M7JL 3MGAA 5C0AD 4JPWH 4F1ZA 2J5LB 2QLYA 2VMJA 4GINA 3PHLA 4Q56A 5E4EB 1EZLA 3UJJL 3NFNA 4B9KC 4F9LA 1OOAA 5KG9A 1WC7B 1QX8A 2E46A 3H1IJ 4DGVL 5BV7H 5I5IA 2WYHA 1HJBC 4UNIA 4LMQE 5DK0A 1A02N 1GW6A 2QJDA 4JLRB 5FKPA 4DP2X 4JVWA 1J8HB 2Y0CA 1FYTA 3E1F1 5AKRA 1DZBA 4ISVA 2V37A 1Z32X 3OG6B 3WI9A 2Z8WC 3NK3A 1C12A 2DQFB 4MAUH 5FUCE 5KS9A 4IL6H 5T1MA 3ZTEA 2XSKA 4G71B 3SDXA 1MVUA 4FADA 5I73B 1HH0A 1D5MB 1FNGA 4GAGL 4JFVA 5CP7B 1IKOP 2RCSH 1I7ZA 2HYNA 4U1JB 3CCUP 1FZKB 2DQDL 2PXYC 1R24B 4XAWH 4BXSV 4ONHA 5IB5B 1DJSA 3K81A 4P2OD 1QSFE 3VA6A 1NHLA 1OGAA 1ZDSA 3HUJF 3BAKA 3MNMA 4UOW1 4JYBA 4HD9A 4N4YB 4ZUUA 5KVFH 2AAVA 2VDPH 4L9LC 1EVTC 4FQQB 1M1XB 4KRNA 3NUKA 2D3LA 5I74B 4IDJL 1URIA 2FYYA 3R0NA 4OJDH 4PD4I 1LT1A 1MCIA 1KB5L 1XR9A 2C4FT 3UIAA 2D7PA 3HE7A 4JFPB 1IAIH 2Q7NA 4Y2NA 5T1MB 2KPWA 5BV7C 1SJXA 1SEQH 3MU3A 4PJHA 3WDHA 1UA6H 5EBWB 3VWKA 1IKNA 3LZFL 3H7BA 4XXCA 4O2CA 4L75A 1IVTA 2JCCA 2Z9TA 3FQNB 2VXSL 3U30B 5EO9A 2JTYA 1PIXA 1N2DC 2WVRA 3KPNB 1LWUC 1FL5A 1HAWA 3ARYA 1BXXA 3H0TB 2NUPA 4EOWH 4MRBA 2D2CD 5EBMA 4HXAL 5AVWB 1NCWH 3E9UA 4X9HA 2AQ2A 4FKEA 5F7YC 2XFGB 1KYOK 1ZHNA 2J8UE 4MD4B 1QEXA 4K7PL 3IE9A 2HH0H 2VLRA 4UQIM 2YBRB 3A0BE 5IB1B 1W6LA 5I0DA 5TE7L 1AJYA 3VWKB 2OR7A 2XVBA 3WEBA 1P84E 1TJIL 3H7BB 4EIUA 5DQJB 1S3KH 2IDFA 4R90L 2NY5L 1LTXA 5LXGL 1NAMB 4P5KA 2PW1B 1MIML 2V2WB 1OE2A 1RE4A 4LC1A 1DSFH 3QPXL 5EBMB 4TPRL 1T1WA 2BHZA 1DLHB 2R27A 4TVPH 4XO9A 2FYNC 2FT7A 2FT6A 3EHBD 3ILEA 1CLOH 1ADQH 1PY4A 2AABL 2A73A 1IARB 2VZ3A 5TDOA 5HXMA 2X4NB 5I16B 4CAGA 1L9TA 1GW3A 2AQ1A 4ZMAT 2JLLA 1R3KA 2OMXB 3RA7H 2AW2A 4HJTA 4ZXBA 2HTLD 2WK2A 1KGYE 3GMOB 2QADD 1RF1C 1PL3A 3RIFK 5LWYH 2P45B 1B0GA 4LHUA 5HJBA 5I2IB 2P5WB 4Q14A 5FWQA 4UTAL 4N8CL 3RVXD 3CBKB 4AE1A 1VL2A 4MAYC 4I5BA 2ZIDA 3E80A 3I3BA 2UVFA 1DN2A 1VZIA 2RMZA 1ZT7A 4ODTH 5JW3L 3P4MA 2KI7B 2YD8A 3IFNL 4LQFL 3SQBB 1YPZA 3KDMB 1BVLA 4BA0A 1EZVI 4HH9A 4OCSL 1TZIA 3GI9H 4XI5C 2X0WA 2AK4D 4X7FC 3GRWL 4XNYH 2R0KH 3RKDC 1RZ8A 3QFJB 3RUGA 1OY3B 1KN4L 4P8QA 1Z5LB 5KVMC 3VRJB 2QIWA 3SQRA 4B27A 4PM1A 2X38A 2BOBA 3L8QA 2V5MA 4PPTA 1QFUH 3RZCD 4DPAX 1OCOB 1VFBA 2P4AB 3EFOA 4IRZA 4XN9A 4A63A 1OAYH 2CU9A 2Y24A 2QELA 1NCOA 2Z3FA 4I48A 4PRBA 4HHGA 5GGTL 4I5BB 3I55P 2M83A 2B1OA 3AY4A 3Q1SL 5F70A 5HGDA 4DQAA 4JQVC 5EDSA 1N26A 2OR9L 1IKFL 4U1KA 1EDLA 2L0DA 1SQPD 1BVLB 1OGTA 5CN1A 1RURL 2YPLB 3F7VA 4DT2A 4KHTH 2QGCA 2IPPA 5IK3B 4PREB 4ONFH 5IJKC 2Y5EA 5FHBL 1PGPA 4WK0B 2Z8RA 2BSSA 3JZ7A 5LJYH 2BCKB 5HD8D 3UEQA 1AQKL 1Q94B 4NYLA 4DO6A 1VGKB 2RB8A 4KY2A 5IEHA 4RLDA 1JZ8A 1N59B 4P23A 1KTRL 1F4YH 2HKHL 3PV6A 3L70G 4MZ2A 4POZD 4HIJA 1VFBB 3HFMH 1J48A 3HE4A 3D6YA 4PRBB 1NANH 1NDMA 1E4XL 4KJQC 1B90A 4R97C 3W0WA 4J6IA 3L74J 2IX7C 1DBAH 1N8ZA 1YJ9P 5GJTL 2MPAH 1A8ZA 2AJSH 1HHIB 4WI2A 1Q0XL 3CVCA 1XMWA 4NO0B 5LCVL 4OVNF 2WTYA 2R0LH 2Q3AA 3VGHA 2JKSA 3K1DA 2KPNA 5IY5B 4PMEA 3KNBA 4M93B 1L9OA 5E99H 2J6WA 1P6WA 1SQQD 2LR2A 3GSWA 4XGZA 3G5ZA 1H0DA 1TVBA 5BZXA 3H3BC 2GCYB 4TOYH 2WMPB 2TSBA 2Y0DA 3UCRA 1INDH 2AQPA 5ISZE 2J3SA 4JM0A 2OQJB 3HZKA 3Q01A 3LKPA 4PJ7B 5E7BA 3ASOB 4OZFA 4F93B 5IEHB 1XAKA 5HJ3A 4TNGA 1HEJC 4QJ3B 4KAQH 5K59E 5JIQA 1NDGA 3ZTJG 1O7VA 2NY7H 1RQUA 1WA0X 2YD1A 4ILDA 2CCVA 1YNTB 4JZNB 3VG9B 5EF3A 3HI6H 1SYSA 4ODWA 3GT6A 1NDMB 4XI5D 3CFQA 1OAQL 3CHQA 1F1DA 2HUHA 3FQUA 4N8PA 3RKDD 4E5XB 1R33A 1WV7T 4FN0A 3V10A 2EDJA 1V7MH 1BM7A 2W0FB 2Z6FA 3C60A 4QMEA 1MCWM 3DMMA 4LVEA 4JQ0D 2J1KA 4W6YB 5D1ZI 4B9FA 1XF3A 3GSWB 3G5ZB 4L0YA 1P7BA 5DHEA 3ZY7A 1B9ZA 3TBSB 5HYJB 4H0LB 4KI5E 1CUOA 4TLUA 1MXDA 3ORJA 1XH3A 2FGWH 4XMXA 3SPIA 3L71E 3OX8B 4G9FD 1MJ7H 3U36B 3AUWB 5DZJA 2L8AA 5FYLL 2B2XL 3GRBA 4LVOC 2CHDA 1JNJA 2ZAHA 3V9EA 1NDGB 2KI6A 1DDTA 1BX2A 1OCZB 3MRIA 4H26A 3QCUL 5HYIA 2P8PA 2VAAB 1KELH 2R29A 4EOTA 2J73A 5CCHD 4X5QA 3SIKA 1RUPH 3SCMA 2I9LA 1JWMA 3WE1A 6CGTA 3FOMB 4ZNCD 1PKOA 2P5EE 2P5PA 4NUGH 4YGVB 1V8HA 2KS1A 4AXWB 1WS7A 3NA9H 4KJYB 1SLVA 4JPZB 3TU6A 5IFJA 1RZJL 5F7EL 5B5EE 2DQTH 4UT6L 3RG1C 1HESA 2XTSA 4MJ4A 4H88H 1JTTA 2I85A 3OKDA 3MXWL 4KJQD 4OCWL 3ROOA 1XH3B 4L4VA 4AKPA 3AE4C 5DS8B 3GUTB 5KJ7E 5E2WH 2VC2L 3BKCH 5B1JA 4DAGH 3LKSB 4CPGA 2CXGA 3VG0H 4Q6IA 1P7QD 4GKOA 4HKJA 3MOBL 1ITCA 1DH3A 3ESOA 3ILQC 4AEHL 5HTSA 4N3YB 1L4AA 4Y2LA 4WW2C 4MNQA 4AUYA 5APXA 1PY9A 3L13A 5KSBA 4WJ5B 1JWMB 2MOQA 1A3RL 5A2BA 2EC8A 3GSNB 3B7YA 4YVNA 4JFEA 2G3XA 4Z7UB 1U8KA 4YOKA 4IRSA 1L0LD 4ZO9A 1B6DA 4GAJL 3FUIA 3CZFA 2DF3A 2Z31A 3TGUE 1KPVB 3NG5A 3OKDB 2NY4B 3L1EA 4L5FH 1KFMA 2KDYA 3SKNB 1FNEA 5JLZA 2XFXA 5F7MC 3DURA 4FYSA 1FVDA 5EWIL 4QXUL 4XXWC 5JA8B 4GRLB 2D7TH 2XV3A 3RQ3A 5D7JA 4NO2B 1GKOA 2DD8L 5FGCB 5EZLA 1S7TA 5IZ7A 3BWSA 1RUKH 1UFGA 2APXA 1V3LA 1TDQA 5CF3A 2MTPA 3E3QE 3HUSA 1IC5L 5T3XH 3TK1A 1E4KC 5KSBB 1KBGL 3BPOB 2F58L 2NW2A 3CPLB 2UWEA 5D70L 2QVIA 1SQBK 5E5LA 4K7FB 1AR1D 1LQSR 1T80A 1YJNP 1JGVL 3KL3A 2NR6C 1LTBC 1MI5E 3GYRA 4N2EA 3UPAA 3GXNA 4PJ0H 2HG0A 1D7BA 3IAGC 1EK3A 2WLIB 3FMGL 4HIQA 3D85A 4KOBA 1LTAC 1AZZC 1LO2H 2VQUA 4EN2A 3GKZA 4UB0H 3E2HC 3AQDA 3KPTA 3B9DA 1K5NB 2WINB 5CZKA 4RMWA 1XIWC 5TDPB 5T8IA 2Y36H 2H0PA 2VDML 1S7TB 1KILD 1R75A 2IPTL 2DTMH 4HLZG 4GT0A 3RX7A 4U6VH 2WN3A 3ZKXC 3TEYA 1FI8C 3CXHD 2NW2B 3GZKA 4JRYE 3VI3E 2OMUA 4FMVA 1HK6A 5C07D 4QMAA 1AGFB 1CGYA 5HDBB 4R4FL 5F97E 1HXYA 4CVXB 2QV4A 3S3CB 4KWUA 3LDBC 3TC9A 2VDNH 3NH7L 3ILQD 4HX1A 1NIBA 3MNVA 3SJVD 3AAZB 4Y5VC 4GMTH 5CGBA 3QW9A 1A66A 5KTBA 2FB4L 1E90A 5D7LB 3ZT7A 3B1TA 1QO3B 1LP1B 4PJ9B 3MUDA 1I7RB 2ROYA 2WQXA 1G1KA 3FUJA 3QQ9D 1U21A 1X7QA 3R4RA 1E7UA 3E6HB 5DJ2A 3T3PE 4RZCA 4PJAB 4K3HA 3CAFA 1Z7JA 4L4TE 1U7MA 2H3NA 3ZW3A 3FBKA 2BSEA 3H9SA 4KJWC 4PS4L 4K5LA 5ICXA 4ZMNA 5BZDB 1FOSF 1KSRA 1GS8A 2VR5A 4OGAC 4TSAH 3J8F7 5DO2D 3WFZA 1A9VA 3FQ2A 2CK0H 4NQXB 4JDVA 3KH3A 2FFDC 4U4IA 4POYA 5AVZB 1JYXA 4RFEB 2FYUE 1OTSC 3OLEA 4HZLA 4HX1B 4QNPF 3S35L 4ABVA 4PGEB 3VMNA 1U8HB 1IC2A 1FZOA 2CALA 1AO7D 5T1DH 3GHPA 2Y5TB 2F7IA 3IYLW 4FZ8H 4P9HH 2MTAA 3DKHA 4YHYC 4R4LA 4WF7A 3EKCA 4RGND 2Q8BL 1D5XA 5IM7A 3NCEB 1YEJL 2NR6D 2YXRB 1XXDC 1RFDH 4IK6A 1UZ8B 4KMTL 4NUQA 4Y4FA 3TNNB 4LE8A 1G7PA 4Y4HC 2I9TA 3HS0C 1L0NG 4PVBA 2X1PA 1INQB 1OF0A 2VITA 3HMXH 3RJQB 3H9SB 4F2FA 3J07A 1E3FA 1IEBA 3KYQA 1IEAA 2NNAB 1XGUB 2QQKL 4UT7H 5DJDA 4C4BA 4DFIA 3VD0A 3HZYA 3I2CL 1XIWD 1CXKA 3ZMNA 3CFNA 1UH2A 5EB9A 3H1KE 4RKUJ 3KD4A 3TXAA 3M45A 5JHDA 3LEXB 3TESA 4BZYA 4ODSH 5I82A 3KLKA 4HVBA 5EZIH 2B39A 2IGFL 4DESA 5FR3A 1WF5A 1VRSA 3LXCA 3HG1D 1BZ9B 2EC9T 1KQLA 3L2NA 3O3BA 4Z7WB 5DUMH 4MRCA 5DEGB 4K3EH 3U2SB 3CN3A 2VDRL 3CBJB 4Y4FB 2VXQL 1NCBL 3UAJA 2I9TB 2F9BT 1RZ7H 1WSST 3A22A 3SOTA 2CE6A 5SWSA 1RMFL 2DS4A 5I1IL 4J4PA 4X6DA 3LCYA 2F74A 1CR9L 1S9VA 1X5AA 2I60L 1FVCB 4IGBA 4XBPB 3VE0A 1WAPA 1IAIM 3TF4A 5K9OB 1MFTA 2XY1A 1T2QH 1UURA 2LAGB 3H3PL 3QBTB 3LOWA 3QIUC 5FFLA 3ARDA 3EF4A 4F7EB 4E2OA 3SFEC 2VLKD 2LFGA 4HLJA 4PYGA 5ITBH 2G60L 3IFPA 3SYCA 4BXVA 4H8QA 1EO8L 2DH2A 5F0LB 5D2LB 5IIEB 1T8ZA 4I7ZB 3R06B 4OGAD 4PEEA 1MCSA 2W60B 3EADA 3HPLA 2GJ6B 3PWUB 43C9B 2P47B 4OF0A 5BO0D 1OP4A 2I1JA 1W8OA 1AH1A 3RL0C 5LDUA 1JP5A 3CVHB 4AJVA 1LDPL 4LSTL 3RK2C 2H9GB 4R0LC 1JZ4A 2W5PA 3I02A 2Q9OA 2YEVB 5T33L 1JTHA 1SJEA 5KAIE 3ZDXF 4OZGA 3OAUL 4XVUC 2GSIB 2ESVD 4K3DH 1AGDB 1U8MA 5HHXL 4C83B 2DQCL 2EZ0C 5TDNA 4JL1A 4YGAB 2AZAA 3NIFB 4NKIL 1EXUB 5C08E 2O1KA 1YY8B 2FQDA 3Q5SA 1U8PA 2XKUA 5CCJA 5FM5M 5HHPA 4FQXA 3C9NA 4HAFA 4CW1A 1YEEH 5CN3A 5ILTH 1OAZL 3BMVA 4WVRA 5FX3A 1JBJA 1I7TA 4HKXB 4AM0Q 3A6CL 1NSNL 1FRGH 1QQDA 4ZO8A 4WEUD 4URKA 3NEEA 4Y99B 5EU5A 5C0EA 3VXOA 1XB3A 2KK7A 3H1LE 5EZJA 3KXFD 1E9OB 4QJ4B 1PY0A 4NRXB 3MJ8A 2EIZA 4F5CE 2KLUA 3TEUA 1JTHB 3U4EB 3AMKA 1U8MB 4XP9H 1G1CA 2UXVA 5TDNB 5I1DB 3L36A 4LEBA 4JO4H 3EYVB 1RIHH 1PG7X 3OD3A 1MJ8H 1NFDE 1QVOA 4RFOL 3VMYA 3EOYG 4WTZG 3OKLA 4CADA 2POHA 3VGFA 2KNCA 5F96L 5ABDE 4HWBA 4NRZA 4JFDD 5DZPA 2H1XA 1XBDA 3BWUC 3MOAH 4G6ML 5FO7A 3U2JA 5EZJB 2GFBA 3GFUA 4K07A 3HAEA 4K0OA 3MJ8B 4EUPG 1HEZA 4CC0A 2OZNA 4WUUE 3ARBB 3AUVA 2FK9A 3AT9A 2BCMA 4G6AC 3SKOA 4NJ9H 5DD6A 1A9BA 4OQTH 1FBMA 4GDOA 2KERA 3MZTA 3GGWB 1QFPA 1FZAA 3FAWA 5ITFA 3VJ6A 1WRGA 4MB4A 1DSWA 3RL0D 3L3GA 2Y7OA 5KVFL 1DEEB 1QVOB 3MNWB 4OIIH 5CSZA 2LABA 3OAZH 1OCRB 4MXQC 3VXMD 1EWHA 4AMKL 4EF3A 4TTGA 3KLDA 5GRUH 4HXBH 4MCYA 2X7LB 4XVUD 4F8PA 1YI2P 1IAIL 5IV2A 5FGSA 1SEQL 3GHBH 2EO1A 2EZ0D 1P4BL 3HRZB 3M7FB 1UA6L 1ET8A 2XQYG 1HZKA 1EJ8A 1KLGA 2MKWA 2YA0A 1CW5A 4C54A 4Y1AB 1A6ZA 3SGEI 2E42A 1ZRUA 1NU1E 1KJ2B 2XN0A 2J4WH 2IZ1A 1JPGA 2FXMA 4EOWL 5EULV 3DO3A 5AZEH 3D6GA 5AB0A 3JVGA 4BQCA 2WSCJ 4BRVA 4ZW7A 5APWA 3BLKA 4UOQA 3NP4A 1EAPA 1S4XA 4H4NA 5KSAC 1GXEA 3F01A 4XXDA 3BP7A 1HHGB 4D9LL 1YMMA 3WKYA 3ZE0F 5JQHC 1TZ8A 1KB9I 2NT1A 1HL8A 2FHBA 1EAJA 1UB6B 5FA4A 2EIEA 3MTUE 4RISH 2W0PA 43CAA 1N7SD 5EZOL 5F9WB 3N40F 2APFA 1V7NH 2D0GA 2EEDA 5DQDH 2ATKB 4OFKA 3L81A 4HFWA 5JUEH 3HNSH 2CO3A 4XT1C 1MZ9A 4X7TA 5T1KD 4JZOA 1ZLWK 2IBZI 1AZUA 1UKTA 1T04B 1QZNA 3F04A 4LLWB 1TZGH 4BZ1H 4DUXA 1LE9A 2AEPH 4YHLH 3AACA 3IEAA 3NPSB 1CLOL 1ADQL 4Y19E 3SBPA 4FNPA 3BP7B 4OZIF 2QTVA 2X70A 4U6YB 3MJ9H 1QI3A 4GAYB 1O9ZA 4AH2A 4LVHC 3OQ3B 2G3MA 3QIBC 2JP3A 1JZ7A 3DO4A 3DPBB 2VRSA 4HJJL 4PR5A 5LWYL 1XVSA 3EDDA 3L73E 1R5WB 2EILB 4OIAA 2X4PA 4PJGB 1PZ5B 2CNYA 2F19H 2FO4A 4DCQB 3A0HE 1DLFH 1MRCH 2GSMB 2IXQB 4BEIA 2K0RA 4POUB 1JWSB 4N90E 2KKQA 5DK2A 1E28B 4OCXH 4JE0A 5T5FH 1OAXL 1QPPA 1ZR2A 1YRKA 2A6KB 2R59A 2XIBA 3KPRE 4ODTL 4DEPB 3H42L 1VFOA 2WSPA 1F13A 5ID1A 3DARA 5EOTA 4ZT1A 3MV01 5FK9B 1UD8A 5IVXA 2DQ6A 2X70B 3N85H 3HHSB 3AE6C 4XNYL 4G1MA 2EUZA 2BP5M 3ARZA 4KJPD 2PAJA 2A06G 1F4HA 1KYDA 1GGCH 2AZUA 2FJUB 2HVJA 4NGHL 3CWBG 4BFBD 3MA9H 1BQRA 1ZLLA 3MRHA 1QEWB 4N87A 3RB5A 3VQ2C 2X4PB 1HE7A 4DKDC 3HUJE 4D94A 2FO4B 5KSAD 1OAYL 2DDQH 2IBGA 2IV9A 1WHPA 3II3A 5H35A 3FT2A 4EZLA 5CEZL 2XTJB 3OKOA 3S0PA 3USSA 2ITEA 1UEMA 1XTGB 4QRQA 1VQ4P 2FJFB 3UO8B 2OMWB 5IEKA 4PJEA 1OB1B 1TQBB 4KHTL 1JV2A 3U4AA 4MD5A 4MCMA 2R44A 3AVEA 5I76A 4WNJA 1EEUA 1USZA 3DROB 1YEWA 1S9XB 3U59A 2DY2A 3PWPD 5KBLA 4LEEA 1NTKD 3O9WB 4MHHG 3S8WA 3BZ4A 2W6AA 1FBIH 2DAVA 1F4YL 2R69H 3RVWD 4JVUA 5F9JA 3FO1A 3HFML 2VN7A 3QIWD 1MNNA 5KVGE 1HCVA 3CMAP 2IGTA 4ZTPL 3NZUA 5FO8A 2B4CH 1F5WA 2I07A 4YHML 1OX3A 3EGXB 1S7RA 2YRBA 3DK0A 1DBAL 1N3NA 4K9JA 3FXDA 4LHQB 3WUWB 1AS7A 2QA4P 1CGSH 3FO9B 1JV2B 4X2UA 1M7IA 2BOLA 3GJEA 1UJ3B 4Q9QL 4PV1C 1K72A 1QR4A 2R4SL 2IYPA 2OCJA 4Z7OF 2HFGH 4PRNA 4GP4B 5CLWA 2YMXH 1INDL 4P05A 4QRTA 2QPUA 3BZ4B 4QHNB 4U7KA 3L1OL 4ODXA 4U2YA 3LVTA 4G8GD 4KAQL 3SZ6A 1SQPK 4HLZH 4JHWH 2FWLB 3FO1B 3HMWL 3MX0B 2DMHA 3S97C 1IK9A 4E9SA 4WVZA 3DHJA 5FO8B 4W4NA 4IOFC 4AZUA 4I2LC 2EIBA 1S7RB 4LLHA 3F05A 1N3NB 3HOGA 1RAMA 2PMZA 2EEFA 5CFHA 1MH5B 1V7ML 1EDJA 2R51A 3K72A 4GAFB 5TK2A 5IQMA 1WD9A 3DDFA 3VXUE 2OM5A 2QKIB 5MERB 3B7UX 4AC4A 5IOKA 4ZFOA 4D9RE 2IFGA 4D8OA 2O5YH 3BH8A 3OKNA 4JDTH 4P07A 2FGWL 4GFTB 3VCLB 3IFLH 2A38A 3H85A 1UA7A 4B5EA 4UMSA 1I8IB 1HSBA 5EEVA 3L3OB 4ZK8A 1VERA 2Y72A 3KJ4C 5I30L 2J2ZB 1Y1DA 4ZI8A 1SQQK 3PTZA 5DVPA 1CTMA 4MXWH 1LE5B 4BDVB 4P4KD 3UACA 4B6ZA 2Y22A 4KDWA 1BE3G 3EYUH 4P06A 4OGQC 5DZ9A 1OW6A 1N0XH 4PRIB 1Y6KR 2IAMC 4Y5YA 1I8KB 4NUGL 2WXGA 4R8WH 3O6FB 3M1OA 3ZVVA 2DYPA 3REWA 5F2FA 2I5YH 5BUGA 4H88L 5H94A 3U7AA 4QPEA 3BH8B 4AX3A 1KT2A 4GOSA 4QLWA 3E1IA 1EDYA 1I8UA 3BKCL 4Z3HA 1PZSA 2FIKA 2XWJB 1YNKH 4PWEA 1C5CL 4F37K 4GI8A 2HG5B 1CL7L 4YSEA 4NQTA 4Y2OA 1X5ZA 3MRKB 2AITA 5DVKA 1JG9A 5SX4I 3ILPA 2VOTA 1YN6A 3TTYA 4XX5A 2FWOA 1B4LA 3CCMP 1V55B 2YEQA 3K1KC 3E1RA 1GK4A 4DP0X 2XJLA 3RPIB 4OGXH 3N42B 4NQVA 1CXEA 2A9NH 1FDMA 2I69A 3LMJH 2GTQA 2QM8A 4KKLC 1A0QH 3QJQB 4HIEA 4HKZB 1LEKA 4MD0A 3O2DA 4ENZA 3I84A 3CMOH 4W9ZA 3H6JA 4L5FL 3MV8E 2XV6B 1N73A 3C5JA 4AQAA 1KCWA 4LHUG 2YJLA 3B9KD 3F58H 4XCYA 3E8VA 3MRNA 5D4IA 5C0FA 1NZRA 3ZSSA 1TSRA 4QRRB 5IWLC 3QEQA 5APVA 1RUKL 5EU6A 3V6OE 4CBZA 4PS8A 2Q7CA 5T3XL 1KULA 1NGYB 2FWOB 3RFZA 1MEXL 1GC1H 2F5AH 3U25A 4ZMWA 3W2DL 3WXVH 2C7FA 3X11B 3SDAC 5E1GA 3VFVB 2K3RA 2HP4A 5E5MA 3FRUB 2X0UA 4HIEB 3UPCA 4H8WH 1OW0A 4PGZA 4WENB 3GM8A 5E2TH 1LEGB 1TOXA 3NAAL 1BAWA 5K39A 2JLPA 3HG3A 4B3VA 5DXWA 1GK6A 2A1WH 1ZGLA 2VH5L 3ROLA 2IAMD 1L0LK 4XE5B 3P3SA 3Q7JA 5DR5H 4D6TJ 2YZ1A 1C5BL 1F3RB 4Z7AA 4U6VL 2MCPH 2D3VA 4FXLA 5L4IA 2VN6A 1NBYA 4I18C 1AKJB 1T7ZA 2MQGA 1BIHA 4RMQA 2ARJB 2MQ3A 2QVMA 3UYOD 4ZFZA 4BWUA 3FTGB 1XGTB 3CX5D 4M6AA 4FQHA 2C1PA 4CA4A 1J5DA 3VOPA 4TV3A 4L76A 4U3SA 5DJ0B 5C0CE 2QVAA 3EZJB 2UXGA 2PWEA 1PX8A 5J4MA 1ROCA 4YC2B 2EUVA 1S72P 1H5BC 1QPKA 1TF4A 1HIMH 2NY3C 4LGRB 1NICA 3S2CA 3VACA 2V9QA 1W0WA 2VZVA 1A7PH 3CLEH 3MNZB 2AJVH 3NSYA 3QWRA 3WFDL 4E5XG 3H3KA 3B2XA 1C08B 4EI5D 3R18A 1OVRA 2G9HA 3W39B 2WYTA 2WLZA 3C09C 4W1TA 4UDTB 5GGVL 4IKNA 1IK7A 1NBYB 2PYED 5AENA 3P4LA 3R1GH 2K1MA 4MJIE 4CMMA 4N22A 3KW8A 4LVNC 3UTTA 4C4KT 3QZWB 3WIFA 1I9RH 4TUOB 2CK0L 1VQKP 3VGAC 2QJPC 3ZDZB 4L23A 3VRIA 5I0WA 2VIRA 1V54B 2C1PB 3GLAA 4OZFG 5I1JH 4YHPB 3CXHK 1NTME 3K4ZA 5IUCA 1H3PL 3DXAE 3BMWA 5IROA 2YGNA 3HPJA 2IANA 1WWAX 4FZ8L 4P9HL 2ZYRA 3LVEA 2PN5A 5B7MA 3O4LE 4LMQI 4YHIB 3SDYH 1T0MA 2CG9X 1OF2A 5CCGE 4WSKA 3QJXA 5GRJH 1FGNL 2ZG1A 3FF8A 3PL6D 1LP9F 3GI8L 4EUPH 1G1YA 5CILL 3ZHNA 2WSEH 1UWGL 1S5LX 1N18A 1WFIA 3HFFA 3LXAA 3NCMA 1JHKL 3NRQA 4KKQA 2FSEA 4A7VA 2GTZA 3RBZA 2E7DA 4KC3B 4ODHH 3FDWA 4XCCH 1HL4A 5F6IB 3VFOA 2FR4B 3MRDA 3WIFB 2GITA 6FABH 2EKSB 1GOFA 1AQDA 4J23A 5ETUA 3VFSA 1UM4H 5I75B 2CKBB 2VIRB 4LLAA 2YKQA 1EAQA 4JPVL 2HPTA 2PYFA 3KPPA 5DUPL 1FHGA 4RNRA 1UCTA 2NCMA 1JY3P 4YSRA 3IR9A 5EZIL 1MWAH 1PL5A 2JSFA 5HHVL 5JZ7C 3CZEA 1M57B 1AGCB 2HN7A 4HIPA 4UTBH 4YDJA 4M7ZB 3NFPA 2YN3A 1B3IA 4BKLA 1IZKA 4GKGA 5KYWA 3J27A 3TBWB 3PJSK 5FYLD 4LSSL 2CO1A 3DX8A 4TQ8A 2BS71 1RZ7L 3L75G 4NX0A 2DB8A 2FNBA 5GHWL 1I9EA 3N9GH 1KXTA 1CD1A 2NXYD 3OMIB 3IRPX 2H26A 5GRZA 3MRDB 5LAXA 1J2JB 5KSVB 4TUJB 2JKVA 2XT1B 2Q9IA 3GIZL 4GIFA 1SQVE 2K4WA 3KYOB 3NIGB 4W9JC 4W9IC 5K9QG 2Q76A 4CNIA 2CRYA 2PYFB 3ABGA 5FGBA 2AFNA 2OTWB 1ET7A 1RZGB 1NTZK 3CFCL 5ITBL 1DQDH 3CZLA 4NZRL 3IJ8A 2GAZA 4YDJB 3LNDA 5ANME 1D7DA 4OJEH 1BDCA 1FZJA 4FLOA 1I1FA 1RZFH 3MUUA 1R3IH 1AHWA 2KUBA 1JGUH 2MEJB 2QEJA 3P3TA 5AB9A 5KYWB 4KPHH 1PP9G 3QP3A 4F91B 3QDJA 1ZOXA 3ZDYB 1I75A 1KXTB 5EUOB 5LAXB 4XCFH 3SPVA 3ABLB 4TUKH 3BKYL 3N6YA 5F9AC 5GSVA 1QFWM 3T0BA 2C0XA 4YSAA 4Z23A 4E36A 1KCSH 4FNUA 4P2CG 3G6DH 5C0CD 4LRNH 1RE3A 2R1XB 5FKAB 2VXVH 3A67H 1WT5C 4ZMDA 2E56A 3D39E 4BD4A 3MLVL 4JFOB 4LLVB 1YEEL 5D96B 5ILTL 4K71B 1AHWB 4C58B 4KQ4H 4JJ5B 1G9HA 5I1CH 3QJHB 3O2VL 5IG7A 5TQ0H 3KLHC 1KNOB 4PY8J 5IB2A 5IQ9A 2GIYA 1FOSE 3KPLA 2E27L 3OB8A 1YHPA 3JWDL 4MQ7B 5JZ7D 4PWKA 1FL6A 5L8LB 3GXMA 4Y0GA 1FLRH 5SWZB 4ZYKA 3T8XB 4L3EE 3HKZA 4OJYA 4QNPE 2OMBA 3WHE0 4F2MB 5KAFH 5E79E 5F7AA 4L1SA 1A5FH 1DDHA 1L2PA 3MRJA 3WJLA 1TCRA 1HINH 5J1AA 1F8TL 4Z95H 5EBGA 1R5VB 4ICXA 3AREB 5F93C 1ES0A 2DI8A 1QRNE 3QDGA 1MJ8L 5CCGD 2GK0B 3UIZA 4JPSA 2PPFA 5D1ZA 5GISH 2Z34A 3T0EA 1JPTL 2Y6TE 4X6CA 1SY6H 2G0KA 3QSKB 5J13B 4TXVB 1KFGA 3FO0L 4IKJA 1KGXA 3N1GC 3PFUA 5E1AB 2LTQB 3LD8B 4PCTA 4KNSA 1JZEA 5IB2B 3MOAL 1XR8B 1CU4L 2XQ0A 3NMDA 3BAWA 3OAYK 4HUWA 2ZKWA 4X5WB 5I8OH 1B4JH 3VQLA 4K5MA 3U82B 1YEIH 4G42A 1I9JH 4ADJA 4KX7A 4IW4C 3M7OA 3SWYA 1QPXA 2Q3EA 1A7NH 4XMUA 2ZUTA 3TBVA 4JAMB 2F8XC 1KXVC 4HJGA 1J7VR 3FFCE 3QJUB 1GIGH 2ID5A 4WO4B 1IAMA 4A66A 3F12A 1ES0B 3EH2A 1XGRA 3OSVA 3B43A 4K9EC 3FCTA 3Q6GH 4KY1L 3MRLB 4M1GL 4OIIL 3RX5A 1UADC 1U42A 2DM3A 4WU7B 4ADIA 3HC0B 3ATAA 1DO5A 3H1JJ 2GY5A 3BHBB 4HXBL 4OFPA 1H3UA 1BJMA 1HN1A 1MNUH 2XVLA 1E5YA 5FV2A 4DQOH 5DS2A 3X1BA 2ZG2A 4I3SH 3RTQA 1SVCP 3GHBL 2YUZA 5GZOC 1T66D 4G82A 4ETQB 1F6AB 4M9OA 4ODBD 1XF2B 2WNKA 3MV7B 4KX9A 5FS5A 2WWOA 3Q06A 2RQ8A 5EH1A 4B9CA 3HE6A 4RH4A 5EUKB 3TBVB 2YQ3A 2DLFH 1XEUA 4LO9A 4BHUA 3STLB 2VT0A 4JM2A 2FQFA 2IH8A 3TBTB 1T3JA 5ALBH 3KLHD 2G2RA 4AM0A 1ACXA 1G7MA 5AZEL 1X5YA 4BE6A 4NB7A 4YXKL 5JHLA 2DPKA 3NMEA 4GEIA 2OBGA 3B5NC 4QOKD 4MCZA 4H13B 3H1IG 1DJZA 3FTYA 4G7QB 4X9IA 1E5BA 2YO3A 2CR3A 2UY6B 3DX7A 1BVKB 4K7PX 5I8CA 1QFWL 2ZFCA 4X4KA 2BRRL 3WMPA 4PVNA 4H2CA 4HJSA 3WN5B 2XV2A 4HWZB 1EFXA 3LQZB 1SFDA 1U92A 4RISL 5I73C 5C0BA 5DHVB 3VWJA 4JDZB 3IDNA 4R7NB 1NGPL 3WUTA 3ZDXE 1KPUA 5F0PB 4U3FJ 2AVGA 3BQUC 1HQRB 5MENE 3D3VA 1M7UA 5JDSA 1OM3H 5MI0C 1FUNA 4KO9A 3LEVL 2WHVA 4LCCA 4UU9B 2WLLB 4F9LC 2K9UA 1OZHA 3T2NH 3V4VB 4ZMXA 2O6EA 4BZ1L 1TZGL 3LPWA 4YHLL 5AQ0A 4PJIF 3DETC 2NY2B 1ND0A 4MCZB 5EN2A 4FA8A 5GRWA 1VB9A 2XN9B 3T65A 4GUCA 2H6PA 5I74C 3TX4A 3HIZA 1YYML 4V1DE 5GRVL 2XBDA 2BS9A 3MJ9L 4LCWA 4U49A 1NAMH 3GJFK 2L7JA 2KZIA 3VXPA 5KVFE 1EFXB 3TEXA 2WT7A 3ELAT 4PLKD 5C0BB 4PUBL 4ABUA 3VWJB 4S10A 3APNA 4WAFA 3T1FA 4ELMB 4L3ED 1OARL 4PG9A 3D3VB 4K23H 1X6NA 4RMVA 2QVTA 4HCFA 2F19L 1M9WA 3U30C 5LBGA 1OIOA 3LN4A 4R7LA 1MRCL 1C16A 3K74B 3V0DA 1BWWA 1QRND 2E6PA 1SF3A 1ED3B 4OCXL 1RQVA 4UQ3A 5GZOD 2O5NA 1BF2A 4LCVA 4JKNA 4XTRD 1ND0B 5A6IA 3AGWA 4U1HB 3BD3A 1GJUA 3R7QA 3U7YL 3V4WA 4FRWA 1BDYA 4LU5H 1JF1A 4RQQB 1LYQA 4PJ8B 3EBAA 1DFBL 2JFCA 3P2TA 4D3CH 1AHMA 2HRGA 3VXPB 3HI1B 3HE7C 1GGCL 1AE6H 2W59A 2HFEA 3MA9L 2P49B 5K69A 2OZ4A 4OZHB 2ZUXA 3B9AA 3RHWK 3MRQA 3VWKC 2I8DA 1IKNC 2N7BA 1CDIA 4PG9B 1OSPL 1O5PA 1WITA 3O11A 4OGZA 3B5ND 3IBEA 4EJ1C 4QUOA 3NK4A 4FFVC 5DD3H 4ZDHA 1BD2D 3QUMB 2DDQL 1Y47A 3LN4B 1G7HA 1C16B 3MJ7A 4GKZB 4XPFH 4BUHA 3DTXA 5DMJB 5AEAA 3BOVA 3DVGA 5B66H 1SVZA 3LKNA 4ZUWB 3W57A 4UQBA 3IMSA 2CO7A 1BQLL 5D1QA 5I1LA 3Q2NA 4QO1A 3L2LA 4GI6A 1JRHI 4JPIA 4AYDC 4UIMA 2HCZX 4TVPE 3LS4L 4NDMA 2HJLB 5AYQA 4D0DA 4WI4A 1E5WA 1OW8A 4NP4H 3MCKB 1MAKA 4R7VA 1FBIL 5EDXA 2JF1A 1SHMA 3GEWB 3VDAA 2R69L 3DETD 2BSDA 1A6UH 4YR6B 5KAQG 5AW6B 4H5SA 2BNRE 5EU7C 4ZDHB 4M1CC 1FYTD 4QLRA 1SP4A 1WRFA 5FLUA 4YSCA 2B4CL 3ZK0A 1RE4C 3I6LE 1TTFA 5FIEA 1I82A 4MQTB 1JYNA 3VFUB 3TYYA 1MHEA 1KGCD 5D1QB 2BSRA 4QO1B 3ZE0E 1VEOA 1K8AQ 1AGEA 3QUGA 4HS3A 3MV9D 1ZGLM 4HC1A 4KX8A 2HFGL 2VQ1A 4IRZH 5MHSD 4XFJA 4NDMB 4R3SA 3V7AE 1MWOA 3HAEG 4QY8A 4XO4A 5H2BA 1OGAD 3MO1A 1BIIB 1CSBA 5HGHA 2GABA 2DEXX 1B4RA 4JHWL 4AW4A 4N6QA 4DPBX 5DHXB 2Z35B 4PRDB 1OXZA 4MQSB 2C4FU 2C5DC 1QL2A 3U48A 1OAJA 4EAEA 2Z92A 1QVGO 1YHQP 1NTKK 2V7NA 3HE7D 1NO4A 1LNUA 2WLNA 2Q20A 1CI3M 4KNQA 1FZBA 4AJWA 3WXWH 2HX9A 1RPKA 1MHEB 2ZYIA 4OZIE 1QLEB 1AFVL 1KJ3H 2OXHA 3VMOA 1HXKA 5TH2A 4XOCA 1ZTXH 1PG7W 5C92A 1KWGA 5KW9H 4JFFE 2XUWA 4NUMA 5H2BB 4JDTL 2N1TB 2V7QH 3IFLL 2EYSA 4FERA 2CK3H 3CXDL 3EJSA 5D2NA 5HVGB 1LTGC 2PLTA 2YKPA 3IMUA 4WDIA 2HMID 2G4GA 2WXNA 3UBXA 1BE3D 3TVMA 1VQOP 2B3IA 5D72H 3LW5H 2YPVA 3FN0H 4PRPB 4MXWL 3L6FB 4X9YA 4E42A 2VLRD 3AY4C 5HHNA 5SX5K 3O3DB 4GJTB 1BCCJ 4WQOA 3CZGA 4X6EA 5KYXB 4JHAL 3L74G 1SYVA 3HB3B 5DUBA 3ZT6A 4L2LA 2I5YL 4RJTA 2Q86A 3BH9A 4M1CD 3NJJA 4M93C 4U1IB 2X9ZA 4Y9BA 3S8FB 2R5BA 4LSPL 1G7LA 2Q7YA 1H19A 1CICB 5DMIH 3CPUA 3S36H 4QTHB 3NJIA 3NEXA 4LOFA 4OF5A 1AVYA 1YNKL 1IL1B 2LFEA 4OY9A 4BFGA 2W0KA 2WPGA 2ZF9A 4ATWA 1R0AH 4KKCC 2X12A 4IMLB 4QRUB 1DJGA 3QDMA 4LFHG 1JIBA 3NGBB 1GPOL 1RK7A 3MUJA 3U1SH 1LQBC 2JB6A 2EDTA 4Z7NB 4R9HA 4ZXBD 4C8XA 5CXPA 3QYMA 2JDIH 2B20A 4X6EB 1JSYA 3ALPA 4S1SL 4MDJA 5DTFA 3KWTA 1PX4A 3KBEA 3WUUA 4OGXL 2A9NL 3LMJL 4PJBB 4L48A 3U4BH 4LHUD 2JH2A 4GQRA 2XPGB 3ATDA 4A37A 4BFIA 1SBSH 2Q86B 1O6SB 4M7LT 3AB0B 4IBLT 3NJLA 1IX2A 5D5MF 2RIKA 1KIUB 4GPVA 4IOSA 3CE1A 2NX5A 4KROB 1ZS2A 1E65A 3GMNB 1MFAL 3MFGB 3T09A 5AOJA 5E8OB 5F7FA 3GSNH 5FLVA 4MDRA 5G4NA 5CJQH 1NMCC 2ARJQ 1HCFX 4XE0A 4ZO6A 2R1WB 5JNYA 5D7IF 5BZWA 4O9BA 1QLFB 4QTIH 4ESKA 3K91A 4FF9A 3MRPB 4UCFA 3MCYA 2RH0A 2A9MH 1GC1L 3CDZA 4XCNB 3QDAA 4TRPH 3WXVL 4Z7OE 3C60C 3VFRB 3FTUA 3DMMC 3QXUA 1UFUA 2RKLA 2BP8A 4PJ6A 3AM8C 1UA3A 5B7EA 4H8WL 2B88A 5AWNH 1GMEA 1H15A 3D09A 4MB5A 3BKJH 3SGEH 2BMKA 2AEFA 1JZIA 4N0UA 2IFNA 3MCLH 4PJ5A 4I0PA 1BYOA 4XWOC 4GG6B 2JJSA 4FNRA 4JFZH 1T1ZB 2YD9A 5DJAB 5GZNC 5A16B 1NIAA 4NPYB 2E8YA 1FE8H 1AP2A 1P5VB 4NT6B 3V4QA 3BCCE 1HOCA 3V6FA 1HFUA 4TL4A 4Y9FA 2LXCB 1MCCA 3UC0H 3WUWG 4JFYA 1HGZA 1BLNA 3SCMC 1N67A 4Z3EA 1KB9H 4LPUA 2E59A 4X8JA 4GW1B 2A45G 4P23D 5CEZD 2QQLH 3CFDA 3MV11 3KBHE 1LT9B 2H32B 4MFHA 2DMKA 4KKCD 1MCNA 4EN3A 4NM4H 4KHXA 1ILSA 1CXHA 3U46A 1SFCB 3P9WB 1BQHA 1PLCA 5K9KA 1NJ9B 4JRXB 2NY4C 3MC0A 4I0PB 1PAZA 3BVVA 3W0WD 3RRQA 2IH3B 3T2QA 2DWXA 1HU8A 1KIRB 1J1OL 3OB0H 1MHPH 3L54A 5E9DA 5B1JC 1P84J 1HIML 2BLFA 2Y0EA 1KYOI 3G6JF 4XMKL 4L5FE 4L37B 1HOCB 2JEEA 2IMMA 3WKQA 3F2LA 5LNDA 4AV4A 3D25A 1N86A 1L4AC 4OD3H 2VMCA 2IPKA 4BINA 1E6OL 1IBHA 1P5UB 3BUIA 3R1GL 5FYKL 3M6DA 4NSKA 1BAFL 4LASH 2QZ5A 1HHKA 2YQGA 4IRSC 4OLVH 3K5BA 2Y07H 2QPDB 3Q44A 1S9KC 3WFCH 3S35X 1EEYB 3MTRA 1QOKA 2XWTB 2Z31C 5T3XE 1NUGA 5I1JL 1OANA 3CFBA 5K9KB 1I4FA 4LLUA 5C09E 3HVDA 4ZFFB 1K4DA 2X4UB 3VI4A 5BRZB 4G6JH 1C8PA 1IQWH 4KJMA 4FNTA 5E9DB 3SDYL 2YKOA 1S9YA 3X3GH 4PJ0E 4DEWA 3ESUF 3C60D 3DYMA 4XNUH 4XO3A 3DMMD 5FUZL 5D7JC 2BVPB 3CX5K 1MFEH 4CVZA 3D25B 1AC0A 1UD2A 3G5VA 3U0PB 1QSEA 3BUYB 1UH4A 2IPKB 3HUSC 1P0SE 4B9PA 2WNXA 4ODHL 3JQOB 3C6LA 4JQXA 4BV1A 4PGBA 4ZSOE 6FABL 1QFHA 2WZ7A 4FQCH 1N70A 8PAZA 5DWUH 2VW7A 2PUQT 4NPJA 3O6LH 4HALA 5JORA 1VF5D 2I26N 4LKCA 2Y25A 3R8BB 3VXSA 1MWAL 2XWRA 4P04A 2DQHH 3SCMD 5I6NA 4YIQA 1EDIA 2EDBA 4ZUVA 4ZPVA 5JHMA 2QGBA 5C0NC 2J7LA 1JGLH 4Y1TA 4WI5A 1MZYA 4GIOA 4KZ0A 3L75D 3C6EA 4HEME 4HH2A 3BGMA 5BO1L 1E79H 1JCKA 1UTDA 4CVZB 4OLXH 2F61A 5EIQA 3TNMB 2ZCKH 1QSEB 5IQ7L 1N2RA 3CVDA 2QVKA 1A6VH 3MLXH 5BS0D 4HIIA 4Z8FH 2CO6B 1U8QA 2ZXBA 4U7SA 2F54B 4L4VD 4NLAA 3UADA 3N9GL 3UERA 1GMJA 1GGIH 3PP3H 5AOLA 1MFDH 1UUNA 3O6MH 5KVDH 2OA9A 4J8RA 1ORSA 2CMRL 2Y4SA 3T0XA 1JN6A 1L0LJ 4NQDA 4N20A 1M90Q 4LKCB 4CDGC 2ZUUA 3VXSB 1LL1A 1PZCA 3PQYB 1DQDL 1L4AD 4ZAKB 2GA1A 2ZP9A 4MNQD 1B9KA 1P6AB 1PP9D 3OR7B 2GPZA 1HWTC 1IAKB 5D7EA 2KP8A 2UZYB 2ZOLB 3QULA 4NO3A 3T77A 4JFED 3UCQA 5JOEA 4DK3A 1R3IL 5CINH 4IRSD 4WWOA 5ADPL 3MUDC 3IMTA 1TQCB 3A0OA 4KPHL 5L0QB 5BU8B 1DUYA 2WVSA 4GW5B 3T4AA 2Z31D 4LLYB 3RY4A 3AFLA 3AC0A 3SDCB 3NTCH 2Y7SA 4CKVX 4XCFL 4TUKL 1OZUA 1Q9OA 3TV3H 2OYKA 3MLTB 4EDXB 4HT1H 1FJKA 3C87A 3LIZH 4F8QA 4I4WB 1C9SA 1KCSL 1T20A 4PGDB 4W6WB 5D7JD 5F7NC 3G6DL 4D9QD 1T83A 1FAVA 3QDHA 5C8JB 4NWTL 3NESA 4R96B 2XZCH 4RBPK 2W95A 3ULVL 2VXVL 2WXPA 1DEBA 3UZQB 5J6HA 3F62A 3VRLF 4QT5A 3WMM0 3F7YB 4U1LB 4MZRA 4N0YH 3P9MB 3CVHH 4NO3B 4FG4A 2OGUA 2YXVA 3V6IA 5CBNA 5I1CL 4C56E 3PAZA 1X8YA 3WFBH 5TQ0L 1YEDB 3L5JA 3G04B 4HU2A 4NQEE 3MHVA 4Y4FC 2K8MA 1R5IA 3D85D 5KYYA 4N2IA 5L7XH 2X1XR 3M1BA 4OGYL 1WYJA 5KSUA 2RTTA 4M61A 1U7JA 1YEKH 4PTUB 1FLRL 3ECVA 2Y9YA 3V5HA 3KDPB 3MRCA 1JK9A 3EFGA 1GU4A 2BVYA 2O6CA 4WK4B 4Y4KA 3WGVB 4KVPA 1A5FL 4L1DA 1RK0B 4PRHB 4RMSA 4S1DC 5ESAB 5GGQL 3GLDA 3WAJA 1OSZA 3FN9A 2YPKB 4ANWA 1QWNA 4NJAH 2HWZH 1ZLSH 4XH2B 2IIJA 2JWDA 4QT5B 4V11A 5HHMD 3US0A 3CG8A 5GISL 3L71J 2ZUVA 2XX0A 3C75A 3RAJH 4YZFF 1XZ0B 4MZIA 1LP9E 4ZMVA 1FZMA 3OPUA 5GGRY 5K5YA 4XN8A 3UAJC 3VMPA 5KYYB 1RZIA 3B71A 5I8OL 2ZUSA 2JIXB 2XWBB 3FUEA 1AQ8A 4NXKA 4GFXA 1YEIL 4J4PC 1I9JL 1ID5I 3L7FB 3KGTA 3D0LA 2M3BA 1NEZB 2YXFA 4YZWA 3W9DB 1CGUA 5DHMC 5EPMA 2XBZA 1KTBA 1NUFA 1KGIA 5DQ9B 5C9JA 4QKTA 3ARDC 2CLVA 1R8EA 3LHPL 4PI0A 4M5TA 2CBOA 3CXFA 4PCYA 4RCAA 4AYCA 1SN0A 1IE4A 1PPIA 2BSED 1KLUB 2FE0A 4JO2H 4FYQA 4WHDA 5DA4A 1FZMB 4PGCA 3HC4L 3L9RB 3WFEH 4DQOL 3BYTA 4YFEA 3OJDA 2J1WA 2AJ3A 3FTWA 2QHRH 4AMXA 1F58H 2HVKA 3EFDH 1NBVH 2E7LA 2P7JA 4CGTA 5I1EH 4P2QE 2Y3AA 4QRBA 3IGKA 1W0VA 1BFOB 4UM9B 2BVQB 1I85C 3D0LB 4H25A 2MOVA 3L3HA 1D6EB 3L35A 1MRFH 1GS6X 1OHQA 3B56A 4E41E 1GKEA 9CGTA 4GQ9H 1OXYA 4YEEA 3WDJA 5HHOB 1BBJA 2IADB 4ODVH 2G2NA 3C5ZA 3QJVB 4IHOA 4JPKH 5HYSA 4XX1E 2E74B 3W81A 1IB5A 4FQXC 1G7IB 4OLWL 3QJRB 3HC2A 4PGCB 5DHYB 1A6AA 1CS6A 5C0AB 2DLGA 1FZCA 2C3GA 3C8KA 2RJMA 1KJ2H 1IBGL 4G5ZH 1ZA6B 2MNJB 2HVKB 1KTDB 4IFMA 1PIFA 3N1MC 3P1VA 4JN1H 1Q38A 4P2OA 5JHDD 2JE8A 5L4FA 2ADYA 5DJCB 3B2VL 4P2RA 1A9EB 2OCCB 3ZTNL 1ITBB 2E5TA 1JXFA 2HX8A 2EC9U 3ZBMA 1GAFL 3S3DB 1EX0A 1OM3L 4W80A 3G6EP 3BFOA 5IVOA 5JW4M 3T2NL 3ZSTA 3RVTC 5INDB 1JZ3A 3UAJD 2N1KA 1XFPA 2BSTA 1RCYA 2OMYB 1DQML 3UIYA 5HDRA 5L8JB 1YEGH 4MVBD 5CIPA 1MLBA 1PLGH 4ZMQA 1QBML 5SWSD 4PI2A 5HYSB 5FCUH 4LSQL 5EC2B 1R6VA 4J4PD 2PF6A 2GUOB 1CFQA 4FHJA 4HUVB 4QRPD 2H41A 2EXWC 4IGBD 3KVPA 2UXTA 4NZUH 2EIJB 1NAML 1GL2A 4G3YH 1RIUH 4OKVA 4A55A 4KQ0A 5DD0L 4YEFA 5C6PB 1TEGA 1TFPA 3TWCH 3H53A 3FQRB 3MLUH 3MJGX 3PWNA 2X9WA 5DZNA 3ARDD 3HRZC 3A6OA 1HL5A 1OQXA 3BT0A 3PGDA 1F86A 4G7RB 3FUMA 1U3YA 2JB5H 4MYWB 1KGJA 5EV7A 2NZ2A 3TM6A 1PDKA 3SKJH 3V6BR 1KFNA 2HPCB 1JS4A 5F7KC 5ANHA 1XL4A 2E43A 2N0MA 5CIPB 4LKXB 1MLBB 2VO8A 2PCFB 3IXTB 4WK2B 2L3BA 5FM4A 1JMZA 1GZPA 3RBXA 4LU5L 5CWSA 1VDGA 3C1LA 5DJZA 3KM1A 4D3CL 1KCVH 2OMTB 2VB5A 4OKVB 3IDYC 4N25A 1AE6L 3UTSA 1H8SA 4ZG1A 4WW1B 2D2CB 2BHUA 2YOAA 3ZRSA 4WKZA 3K2UH 1ZD6A 1ZHKA 4X4MA 3QZMA 3BZFB 1NH4A 3NFSL 1OT1A 2QPEB 3X14B 4CN4A 5F9WC 5TJHA 1E6JH 1U57A 5JA9A 3SPHA 4FQXD 1B0WA 3A23A 4XPFL 3WHE1 4W9DC 4HISA 2NDGA 1J11A 4NC2B 2PPDA 4LSVL 1MHHA 2FYUJ 4MA8H 3EYSH 4OV6F 4QCIA 2FY8A 4UB8H 1YTZT 1QZ1A 2G30A 5CWSB 4QXVA 1NYHA 3X3FH 1IVLA 3WDIA 2H5UA 5KANG 5FDWA 1BV8A 1JCCA 1HILB 1IMHC 3QH3B 3RVTD 1SMAA 3S37L 2HR3A 3FUNA 3JTTA 1CXIA 4K7PY 2VDQL 4A39A 3AE9C 2NZ1A 5D7KD 1JWUA 3BD4A 3DHMA 4DP4X 5IF0A 4PJ7F 2A0LD 3EHBB 1JTOA 4MQXD 4ELDA 2FEEI 4HZ1A 1NTDA 5EO1B 4TN9A 5MEPA 2EJ1A 4HIHA 4S1RH 2EXWD 2CLRA 1E43A 1VLXA 1YNTF 2GKIA 4I9WE 4NQSA 3H1KJ 4X0NA 2QSQA 5DEFB 1KORA 1HWGB 3UJTH 5C3LD 5J1SC 1HH6B 5DEJA 3F64A 5TQ2H 2CIIA 4PW9A 5F88A 5HI5D 3X12A 3W5NA 3RZCA 2OXGA 4KITB 5FDWB 5E2VL 5FCSH 1EXHA 4P5SA 1JPEA 1QSFA 2BVOB 3B1UA 3L1GA 1DE4A 1S7UB 1KC8Q 3JTTB 2YRLA 4U6XB 1HEHC 4K35A 2VWEE 3NQIA 5HGAA 4WEMB 2OJEA 4EPSA 2W91A 2K37A 4R5TA 2L04A 4LCUA 4LEXH 2R2EA 4OD2B 4ONOA 3IS0X 1P9MC 3RL2A 5IW1B 3AS0A 1CVRA 3V7MA 5I23A 3FH7A 3L45A 2AK4B 2CLRB 3WSQL 4KZCA 3QA3B 4PJIE 3LHAA 3HCVA 2XTJC 2VLMD 3ZHFA 3D2UA 3WXWL 4RX4A 5LBSH 2BNQE 1ZHLA 2EIKB 5FF6B 4ETYA 4PIBA 4DUWA 5L9DL 3FB5A 3VN0A 3TSIA 3RZCB 1ZTXL 3MACL 2RMNA 4UBDD 1IGCH 5IHZB 1IBYA 4IHBA 5GS2D 1HQ4A 3H9HA 5KW9L 1MFNA 2M2DA 4WCYL 1RVFL 1G6RA 4BWTA 3K6IA 5HDLA 1RK1B 4HJUA 2C9PA 1I3RB 1EBAA 3ECQA 3IS1X 1ML0A 3U0TB 3O45A 5DJ8A 2R4RH 4JDEA 4JY4B 1KG0A 2PCPA 2Q2LA 1YQ2A 1INEL 1I53A 1OVUA 2J8UA 4GSDH 3CC4P 2AEMA 1FJ1A 2WTOA 2P67A 4P3WA 1CCZA 4JBZA 2YHGA 1YMMD 3OXRB 1F45A 4NQQA 1IFMA 4NPFX 3LKQA 4M8UA 3HBGA 2X6VA 1JEKA 3GDCA 4I2XB 1DUZB 5BOZG 1S78C 1L7IL 1QABA 4OB5H 4B9IA 1UJ3C 4Z7UF 4WUKH 2FAUA 3TIEA 4M6MH 1K3IA 3QUYA 3L3DB 5DMIL 3S36L 2FLMA 4R6UA 4L1LA 3WFHB 2WJ7A 3DX6A 1TUPA 1MIEH 3H32B 4N2GA 1BMWA 5H4YA 1XL6A 3H1LJ 3QC6X 4LFHD 1RF1B 5IBLC 4AGPA 1MHCB 1YO4A 5MEOA 5ICYA 1IRAY 5JOPE 3L4WA 4OFYA 3EO1A 5C0RL 2V3EA 1KLFB 3HZMA 4OJAA 5CJ0A 3U1SL 1QYGL 2GG1A 4YFLI 5ENWA 2B59B 3PHOB 3NTNA 1J0YA 4DPCX 2PPEA 3KR3H 3P11L 1YECL 2ZE0A 4UAOB 4OF3A 2QKSA 1M4KA 1RZQA 2WKOA 3S5LB 1X9VA 4N86A 4ZJ9A 2JJTA 2NY6D 3WELA 1P2CB 1IGYA 4UNVA 1U30A 32C2A 2W38A 5KYUB 1E3ZA 5C97A 1GOHA 1T2KC 3VQMA 2QKIC 3TIEB 2V3DA 2OYIB 1RLBA 3D1MC 1ZY9A 1OP3H 3RWIA 1DJIA 3PAUA 1AANA 1BVNT 4GRMA 3IJ7A 1FDOA 3O8XA 4GO6B 1JUFA 2IH1B 4N3UA 3G3LA 3PPEA 3GSNL 4ZNCA 4LLQA 3D48R 3UYRH 5IESL 1AQMA 1S7QA 3DRQB 2UXFA 3MUZ1 5B38A 2VABB 1H9VA 1XB6A 2ZOWA 2H1PL 4M43H 3T5WA 2G5BB 2I27N 1UWXH 4HKZH 3WTYA 3FBQA 5IMKA 4OVUA 1IC0A 4RAVA 4G9FB 5T1LA 3QEHA 1QNIA 5I0ZA 1IGYB 4PQXA 3CSYA 2A2QT 3O6FC 4UQ9A 5J9PA 2WBJA 1GGBL 4MKTA 5FOBA 5HDBF 5AWNL 2WXMA 3NZ8A 5DDHB 2WLJA 4CVWA 3RWIB 3MCLL 3QAZB 1H6UA 3BLBA 4JFZL 3FCUB 5KBKA 3EJYD 1L7TH 1P7KB 3OHMB 3IN0A 4KHXL 2EDOA 3FRPB 1BZ7A 1FE8L 4JKKA 1NTKJ 3VFTB 3GMRA 1KCLA 2YK1H 1E42A 1NCAL 3MRRB 3NP3A 5B38B 4DPRA 1FN4B 2CA3A 1NU1J 3C2SA 3QG6A 1GW0A 3UEZA 3FQXA 3OPZH 1QL1A 2JCWA 3O2DH 3TJEH 3K8KA 3UC0L 2CDFA 2EAEA 4W9GC 5E8NA 4PJAF 4LPTA 4Y5YC 2QQLL 1G0XA 2XPYA 4Q52A 3BYYA 3CSYB 5IBLD 1Y07A 3FW6A 5ABAA 3F00A 3G7TA 1RUAH 4EXKA 4NM4L 1HTLC 1P7QB 4BH7B 1E2VA 1LTTC 3C5SA 4XCEA 1Q2NA 2KLSA 5DU7A 2XN2A 4XRCA 2GEQA 1U8NB 2G4EA 3KYKH 2OMZA 1LXMA 3OMZA 2Y69B 5D9SB 1MHPL 1BZ7B 3NCXA 3KBPA 3PH0A 4HB1A 2F8IA 4YSTA 5ACZB 2CQVA 4RAUA 1T2KD 5KYNA 3FQXB 2GM4A 2PP7A 5AVSB 2JI2A 2ZT9D 5ISZA 2YMKA 4WHYG 1DVFA 1JGDA 1OL0A 3Q8CA 5E8NB 4PLNC 4F33B 4LASL 1YEHL 4FQIL 4W9LC 3VQ1C 2Y07L 2ZYSA 2XWXA 1KXQE 1CDGA 2EACA 1XCXA 1GW4A 1KILA 2MNWA 4XMLL 4NQCE 5CBAA 1N73C 3IF4A 2A9BA 2XXCB 4ONGH 3QO0A 4J2XA 2E5YA 1Z3GL 4H20H 5E03A 3NIDB 4B9YA 1I1AA 3X3GL 4D2NA 4YAQA 1AR1B 4XNZB 2P42B 4PWGA 4QHUA 1MFEL 2O26U 1SQXE 4QWWD 4Z7WF 2KXPB 5EF0A 4D6TG 3PHSA 3LKOB 2ZYDA 2IOMA 3GD1C 3LZQA 3S4SA 3UG4A 1PGJA 4OVVA 2DLEA 4XMWA 1PFIA 3ARFA 4L2YA 3WJMB 1E27B 5HJGA 1UKQA 2NYZA 4YDKH 2VR3A 1XO8A 5D6CB 4M3LA 4FQCL 5D5ME 1SMOA 4ALAH 4Y7MA 2GYSA 3F8UB 4FFWD 4N78E 1OW0C 3O6LL 1KILB 3ULUH 4DETA 3FSWA 3OM3B 3EXLA 3FFDA 1ZV8A 2DQHL 1OVZA 2WVTA 4EVNB 3UBXG 1QLRA 2P5EA 4PS3A 4DVBB 5C07B 2MHAB 5I1AA 3BEVA 3KVDD 3CHXA 2BFVL 4NNXA 4AIEA 3QEUA 5D7IE 3TO4A 3JTBA 4HBCL 2FEDC 5D2LF 4J3WA 1R3HB 2DYPD 2NW3B 4OLXL 3MA7B 2B15A 2ZCKL 3BAEH 1NCHA 2CKBH 3IGAB 2C3HA 3GMLA 1UB5A 2RFXB 3PJSA 3UH8A 1WCBA 5KJ7A 4Z8FL 4WW2B 1FO0B 1BXVA 1GGIL 2FX9H 3SJVB 1MFDL 3H2PA 4PV8A 2C4XA 1TCMA 3O6ML 1RJZB 3CCHA 5AYUH 4A6YL 1JZ2A 1N6QL 1ZEAL 3ME0A 3JV4B 3UZVA 2P43B 1CLCA 1MVFA 3APFA 2OV0A 4KVCH 2QGEA 4NI3A 3RBSA 4W9HC 3P2BA 5TGBA 1CFVL 2JMRA 3IU3A 1WWBX 3GBML 4MLIA 1D5ZA 5I1AB 1W5CE 3NIFF 4K2UL 3ULSA 1DFXA 5DLML 1J9RA 3QUKA 3RWEA 4DGYH 3QHFH 5CCKH 4GKNA 4JO5A 2WPSA 5DLLA 2APWA 4IEFB 2W6BA 3PJSB 1IJNA 2VLLB 3UG3A 3PCYA 5CJ8A 1AO7B 3TV3L 5HYFA 5BQDA 4ASWA 5E8PA 4HT1L 5F6IC 3RGVA 4RGNB 1EZVE 4P59L 3QISA 5TE4L 2P28B 4WTQA 1UEYA 4FFZL 5MP6H 5FW7A 1YDPA 5I75C 3QEQD 2XZCL 2AKRB 2EYRA 5EU6D 4ZW6A 3VFPB 1DEDA 4PTTA 3DUHA 4AGLA 4HEPA 2FL5A 1N10A 2YARA 1EBPA 3ENEA 4N0YL 1LO4H 2CHZA 3E2HB 1CLZH 5DMKA 3G6JE 5FYJL 1JFQH 1WEJL 1CF1A 1ET5A 3QUKB 2XWZA 1MI5A 3TBBA 3TJHD 5FM5O 4PWJA 1W6WA 3N06B 3D9AH 4MNHB 4AQEA 2WV3A 1XIWB 5KVEL 4GKNB 3RI5K 4ODUB 5EIIA 1JCVA 3V52H 2IQ9H 3HC3L 3Q2VA 2L4OA 1P4IH 3ZIMA 3AQYA 3GLZA 1QR1A 1G1IA 3JV6B 3MLSH 5PAZA 2XXFA 3HG1B 4PD4D 3VUAA 1DJYA 2V2TA 3HRPA 1BPLB 2CDEA 2ATPB 2FO8A 2O1AA 3IBOA 4K8RH 4YWGH 3NACH 1BF5A 5J6GB 5TF1L 4LRIA 4JRYA 3VI3A 3P32A 1JFHA 4NJAL 1FFOA 2MCMA 2WSCH 5ICZA 1TQSA 2ADFH 5TFSH 4M56A 4JKLA 1FPTH 1DL7H 4Y5VB 3RAJL 3RDTA 5D4QA 1KEGH 5C0GA 1TT6A 3Q48A 4PJCB 1T1XB 3QCVL 2YXQB 2Z64C 3BCFA 3IVKA 1EEZB 4JB9H 1KUMA 3GHGA 2VLKB 1OOWA 3UTZA 2OKMA 3CC5A 2EXYD 4F58H 5KN5A 3FU7A 1SUHA 1TZOA 2V2TB 1BQHG 1L6PA 3ESNA 3QWRD 4XBGA 2XNAB 2FFDB 1HDMA 2ED6A 5D6DA 4L4TA 4AGMA 2ALAA 2FD6H 4ZX5A 4ICWA 4JO2L 3KXFA 3V5KB 2IQAB 2LXBA 2OSXA 4QF1B 5C7ZA 3GMPB 3UTTD 1ZVHA 2H45A 4K71C 4K8RC 1AHWC 3TN0D 4MJJA 3C6SA 2WXJA 1JGEB 3PGFH 2ESVB 2QHRL 3U9UB 2W92A 1NBVL 3EFDL 3VYPA 1A02F 1MCWW 1BGYG 3GBLA 1LK3L 3HS0B 4OLUH 4DZ8A 5EOCH 5I1EL 1M2OA 2EYTA 5IROD 2E6JA 2IBZG 2BSCA 1NWOA 1R47A 2IAND 5KN5B 3BPLB 3QNYA 2BM3A 3M0DA 5FYKU 3CU1A 1KYAA 2F15A 4GG8A 4O2EA 3MYZA 5H8DA 3UDWA 5FYKD 2CK2A 1IGJA 4OU3A 5I71B 1RE3C 3K5SA 4ODVL 1SLXA 4JPKL 1A3QA 1I8MA 5IT2L 3KXFB 3ZYIA 3VD5A 5KAFE 4PP2A 1TJHH 5J13C 4HJIA 4OCRL 4RGOH 4TTDC 4G5ZL 1DJHA 4JN1L 2W9EL 1SHXA 5F89B 1HYSD 2G3NA 3DK2A 2XCMC 3B3IB 3PGCB 5AAWA 1LTJB 1E9QA 2VMEA 3O4OC 3GB7A 1PPJG 4K5OA 1PEZA 3CWBE 4MA7H 4JO8A 3QNYB 2ZYGA 1K2DA 2DIEA 4S1QH 1K4CA 3VYOA 1U2YA 4ADGA 2GY7B 4O2EB 4ENEC 2WUBL 1JPSH 1N5YH 4PJGF 4NZFA 3JUZA 2K9FB 3VRLE 2XC8A 4WO4C 4JFDB 2J8OA 3CCQP 5HI3D 5C7XH 1YEGL 3MRBB 2EDXA 1RULL 3KLAB 3S96A 5FCUL 5GGSA 4UYQA 4U7MA 4F7TA 5DHVH 3W11D 1J8HE 3OMAB 2FBJH 3T0EC 4AV0A 2BP3A 4Q0XH 4Z77B 1EHKB 1EJ6A 4AYBA 4NZUL 1ZOYC 1AXSA 2WGNB 3RJOA 4G3YL 1S7XB 1RIUL 1VPOH 1A6WL 2CGRL 3IETB 4P57B 4HCRA 2J5WA 3H1JG 1PTZA 5CS7A 4C55A 2VDLB 3AXLB 1UXWB 1JPST 3GZQA 1W72A 4P46A 3GB7B 3V4VH 5F1IB 3RL0B 2A6IA 3ETBF 2KL6A 1G94A 1RHHA 2HA1A 2JB5L 4X6FB 3VXMB 3FOLB 1RERA 4P3DB 4Z76A 4KFZC 5I1GH 3ARQA 3FT1A 5KBMA 3I75B 3ARWA 2M3EA 1JUNA 3D07A 5GIRA 4N9OB 1KYOH 1NPUA 2DWEA 1FH5H 2MRYA 3MBWA 4ES8A 3S96B 4YZFE 3QDJD 3UMNA 1M2VA 4NPKA 1ZRTD 3FT3A 1AZBA 3OJMB 1ORQB 4F7TB 1KACB 2EICA 1KJVA 1YJDL 3DOHA 3K2IA 3DPDA 4YVUA 1NANI 2QMKA 1HT6A 3RTQC 3SQOL 5GS0L 1XTLA 2K9JB 3WN5C 4F7KA 3GJFB 3NSDA 2APBA 3K2UL 3ALXA 2A6IB 5C08A 3B2UC 3VXNA 4B86A 4F3FB 1U8OB 1NCIA 5IMMB 3QS3A 4ZUSB 2Z8SA 1E6JL 3QRGL 3HE6C 1FNFA 4A7TA 1U95B 3BW9A 1A4JB 4OLEA 4QRAA 4TTDD 2PABA 4O02A 3S5ZA 3DI2B 4L0PB 1G9NH 1Q9WA 3EYSL 4MA8L 4N0FB 4U7JA 2H4EA 1AKPA 3V2QA 4AGNA 1NTMJ 3Q9QA 1EUTA 2WMMA 2GT9B 5AW3B 1N7SB 1AS6A 2NY2C 1TFHA 3IDGB 1Q9KB 4NCC1 3X3FL 2A83A 3BVHA 1KEML 1ZSDA 3ULVD 3Q5YA 4PJDB 1EGJH 3DX3A 1YN7A 2EDDA 1FZGA 1H9DA 1PAMA 3QUMH 2CBQA 3LS5H 1G2CB 5T1KB 1T0OA 1ETA1 5I19H 4NNYA 3CXHI 1OAKL 1NFDA 3VWJC 5BW7A 1KJMA 3M9BA 3QDGD 3ZUCA 4MXVF 5D1ZD 2VR6A 4AZ8A 2X88A 3CH1A 1L6ZA 2B0SH 3T0ED 4KKPA 4S1RL 3V0HA 1BQUA 1Z9OA 4LCCC 2P24A 1DQLH 2M8XA 5BVJB 5GGRB 5EFIB 1V3MA 4CMHB 3IGUA 2ZKYA 4PBDA 1NMAL 1S7WA 4ORZC 4WUUA 5TQ2L 1TITA 5MEQA 2X4OB 4KK6D 3P9LB 4HBQA 4Y16D 4EDWL 1AOZA 3S9OA 5B1CA 5IBUG 3GMQA 1OW7A 4UUJB 1UOWA 5F72S 1G9NC 1HNGA 4BQ8A 1HHJB 2H0FA 1T2JA 3FH8A 1DD4A 4NNYB 5IFHH 3OKKB 5HJDA 1LO0H 3PABA 4NUPA 3QARA 2O61A 1G6RL 3PDOA 2OSLB 2IZ0A 4G8FB 5EU7E 4HU8A 5APSA 2P5WE 1A6TB 1E7VA 1TPXB 4L1TA 4YXLH 3BIAX 4D0CA 2P24B 4P5MA 1SQVJ 3M17A 5ESVB 3RTQD 4H2AA 3LKRB 1KFAH 3MCG1 5G5DA 1QBAA 2RALA 3UGXA 4NUJB 1S7WB 5LBSL 1SBBA 1MF2L 2Z65C 4PVLA 4QXGH 3GINA 2FECI 1CE1L 4OJFH 4HK0A 5I8EB 3VSTA 1IGCL 3HE6D 3Q3GB 4JFWA 5KLVE 2WXHA 5DS1A 5KSAB 3QIWA 1PV3A 5B66E 1DANU 2MSPA 3QFJE 5TE6H 4EEEA 4F7PA 4JM2D 5BUPA 5DVLA 1J0IA 3GMAA 1JTPA 4M5SA 5J1TC 4J27A 3FC8A 3ZL1A 2PTUA 3IJSB 2WXQA 3IFOA 1FV1B 1SJHA 2HODA 2XKNA 4FKKA 3GSXA 3V0WH 2O72A 3HHRB 4GSDL 1QLEH 3DBXA 4QR7A 3CCSP 3Q2CA 4MZ3A 3FONA 4FQ1H 2R0ZH 2Z4QA 5B8CA 1ZGLP 4XPAH 5HYSG 2BOCB 1M1JA 2WXRA 3PWPB 1FCCA 1NKGA 4WFHD 3RX9A 4FXGA 2M1KA 1X5IA 1MDTA 3Q43A 1TKWA 1XF5B 4GQZA 1WBXA 2HLAB 3NA4A 3FWLA 3CHSA 2YPLE 5D1QC 4OB5L 3LQAH 3V0VB 1Z9SB 4X4YA 5CLTA 4WUKL 3WY4A 1IC7H 3QIWB 3N42F 2VJ8A 4F7PB 1GZQB 4J3VA 3JWNG 5CJXA 1YQVH 3HNTH 1FA4A 3MHZA 1KMIZ 3T97A 2HYMA 3IFOB 1QTPA 2CJUH 4Y19A 3GSXB 2QGDA 2F8VA 4OTXH 3II1A 4PJFB 1IQDB 1OPGH 4JK0D 5IHWA 4YDVA 4LCWD 3PU7A 5DF0A 3RWDA 3I6GB 5AW7B 3G08A 2QDWA 1F11B 3RY5A 1LEIB 4G8GB 4DKTA 1OK0A 2FUTA 1KB5A 4Y89A 1ONQA 3WS3A 1VQLP 1E4WH 4EXPX 1KTLB 1R5LA 3SGJA 5E5UB 1IC1A 5IFAH 1G4RA 3QO1B 1J1DB 3OXSA 4HHWA 5LQBH 1NPJA 5CR1A 1QUNA 2L91A 2NDFA 3QJZA 4PJ7E 3FJTA 3KPRA 2MFNA 2ZPKH 3AWGA 3N0PB 3KWXA 4Q9RL 4JHUA 4N9GB 1ZTXE 2VSMB 4RIRA 4XVJH 1YG9A 5FXCH 3NJFA 2AXWA 2FATH 4OCMC 1L3WA 2JKIS 2O5XH 4RESB 1MG2C 3EGDB 2CA4A 3WNMA 5ADOH 1BOGA 4E9XA 3RWDB 3MROA 4DWHA 4WHTA 2KSJA 1I3GH 5ID0B 3G08B 1UD5A 1NCCH 2HFED 3GNMH 1HZHH 1UGKA 3CC1A 1X4ZA 1PYWA 3VB9A 4RWYL 3HUJA 5K5GB 2UYLA 2VLJD 2JKLA 1BCCG 1CFBA 3HB3C 4JFHE 4UT9A 5B1KA 1DVUA 4CC1A 4U1NB 3KCWA 2ZSVA 5HYJE 1MCJA 3ARVA 1NFIA 3EJRA 4P4KB 4XNMB 1P6FA 2F18A 1L7TL 4L29A 3MLPA 4HUNB 5D2NC 4AKQA 4ZQKA 1S8DB 1EDKA 5BXFA 1OFCX 3RWFA 4Z0XA 1QG3A 2YK1L 1K85A 1CTOA 2WITA 3TONA 1ZA3B 2BIOA 4OV5A 1BOGB 3PY9A 2WQWA 4WHTB 4W6XB 4GOEA 1UM5H 1UVQA 1NEPA 2UZIH 5GRVK 4XA4A 1KV4A 2ICWI 3TBYA 3S3PA 2K1AA 3OKEB 2FTAA 3IDJB 2IH9A 3O3UN 1DO6A 2H2PD 1RUAL 5A2JH 3BPCB 4KI1A 3EBIA 2XNDH 4H1LB 1PKQB 1MJJA 2CM6A 3AB0C 4LF3B 3D69A 1ZANH 2ZVOB 2QZQA 4IMKA 2YD7A 4OQ1A 3U1PA 4L3CA 4NKDB 3ZDZF 2OP4H 4U1SA 3KYKL 4PIRF 2YRPA 1P4LA 3ZO9A 3BPNB 1FDLL 3RWFB 2G75A 2ORBL 2ZXWB 2WSFH 4KK9C 2X0VA 2H32H 3W9EB 1SDDA 4P4RA 5DGRA 3ULUF 4Q89A 1UT1A 3QG7L 1FNHA 3RNKB 3RB7A 5I17B 3B9KB 4TQEH 2P8LA 4Z7UE 4I3RH 3MR9B 2JK5B 1MCQA 1RH8A 4AIXA 4HUKB 3SO3B 1J18A 3D69B 1N68A 3GXFA 3APDA 3KPOB 5L2JA 3HLAA 4JZJA 1KC5H 4ONGL 3SE6A 2D0HA 1P4LB 3DV6B 4BZ2H 4FFTA 5IB4B 3S6CA 4D6TD 2DYSB 4FTVD 1Q0EA 5DRXA 3VXUA 3EQ2A 4E68A 5FGCE 2YGVA 3V6ZB 3KJ4B 1SDDB 1S7VB 3KS0H 5EA0H 5APYA 3DUSA 3OZLA 2K6WA 4X99A 3WEXA 3L08A 2BDNH 5M1BA 4G6FD 1BFVH 3ZR6A 1A6PA 2KC0A 3IDXH 2P8LB 4OGQB 4YDKL 2BW4A 2IAMB 2QV2A 4WFGE 1UYWH 1S9KE 4ALAL 1LT9C 2M26A 4NN7B 4MNGB 2Y06H 2WWNA 3TVMD 3ULUL 1KB9E 4HIXL 3NIGF 5ERWA 3CFEA 2XACC 3LPFA 4I0PC 5KBDA 1RZKC 3BSZH 3SODB 1PQZA 5FHAH 3P0VH 3KYMA 1Z1WA 2YD4A 6PAZA 1A4AA 2LVEA 4M6OH 4M6NL 1SS1A 3P8MC 4R5VA 5CMAB 4XN7A 4CL7A 4YBHA 1EXGA 5KWYC 2CR0A 3BAEL 4Y5XB 2JI3A 1JRHL 1TTBA 3EBGA 4LDEB 1C7SA 2BK8A 2ZXQA 1CI6B 2A77H 5LCVA 3Q2YA 2GUSA 4AIZA 4F8LA 3M07A 1BXUA 5FO2A 3RK3D 4GS7C 4KUCD 1G0YR 5HDBE 3DX9B 3BRGC 3QQDB 4PN6A 5GPRA 3ZDYF 5EUOF 1J5CA 4JQIH 3AT0A 3IRZA 3IMVA 4H0LD 3MREA 4PY7B 3V79C 4KK9D 3QQ3A 1KV7A 4N6RA 1KBVA 4AJYV 4EI5B 3B8YA 4L8CB 3L3IA 3QDMD 2DM4A 2QSVA 4B5ZA 3IGLA 1PQZB 2PYEB 4BSWB 1CXLA 1X22A 1J0HA 5D7LE 2P44B 3EDKA 1FZEA 1T4KA 5IR1A 4GMSH 1HH9A 1XCTB 4DGYL 3QHFL 3ZT5A 2Z91A 5CCKL 3TOPA 1KDIA 4UQCA 3MV8A 1BFSA 1UWFA 4HKBB 2AI0H 3UZEA 3CUPB 1Z6JT 4PJAE 1S5HA 5G2NA 1I7UA 4IOSD 2NX5D 4XP1H 1FAKT 4PBXA 4HS6B 1TEYA 4FLRA 3QNZA 5GGVY 2Q1KA 1SF5A 3AQZA 4KVNH 2FIRT 1AG6A 1A2YA 1D5IH 3OLIA 5MP6L 3V6OA 3PL6B 4RWHA 3MOQA 3MLYH 3KEHA 2QSCL 5AKVA 3K6SA 5F6HI 4E9YA 2XRAH 2N7SA 1WBYB 2VXUH 3ML9A 3CFMA 3FQWB 4GKSB 1LO4L 4ZFGL 5B38G 1CLZL 2AGJL 3OWRA 4JFXB 5CBEB 1JFQL 2C9UA 1ZR4A 1AYRA 3DTDA 3D9AL 1T89A 3OSKA 3INUL 4TSCH 1HXMA 2PNDA 5DRZA 1B0RB 4G5AA 3V52L 2WIIA 1AZRA 5BQ7A 3E6FB 1G9MH 3IPFA 3TEZA 4U0QB 4PJ5D 2K9YA 1JV5A 3H9SE 3I3DA 1BEYL 2RAMA 5I66B 3P3RA 1CDHA 3QNZB 3C6LC 3MLSL 4FEMA 4I18B 2Q3IA 4JQXC 5I18L 5J0BA 2GJJA 4UT6A 2BP0A 1A2YB 3RVUD 3VGDA 3UO1L 1U91A 3GSRA 4YWGL 1ZIBA 3GSVA 3MRMA 2NUTA 3ZPDA 3NACL 1NGWB 3VXRE 5APUA 1FAIH 1WK0A 5E94A 3T2LA 4AENB 4X8GA 1R46A 1LVEA 1MQ8A 2ADFL 5B39A 5IJCC 2F53E 1C5DA 1FPTL 4I8DA 5D1XD 1DL7L 2Q8AL 1KEGL 5KVDE 2NXYB 2V9RA 3WBDA 1PEWA 1UM6L 1HYRC 1WAEA 4Z7WE 1H5BB 3DGGA 1ASPA 3QB7C 3QRFM 4HOZA 2IBBA 1TQCC 1VFUA 4RSVA 4EN3D 2BJMH 2R8SL 4J3OG 3LN5B 2ZXGA 5C0CA 5F3BA 1MLCA 2B1HH 2IEPA 3EOBB 3TNUA 3SDCC 4N0CC 1QD0A 3HE5B 1LDSA 3LZNA 1WZ1H 1FNSH 3F65A 3EJZD 2VSCA 4F8NA 4LVNB 1CZQA 2VNCA 3QUZA 2NUTB 2P7TA 3GSVB 5L6YL 1HGVA 3B9VA 4N8VB 5EO0A 3FT4A 1MFZA 2HXAA 2Z7WA 1G9MC 2OTUA 3FULA 4ZW5A 3K2MC 2VC2B 3RWJB 3B7TA 5LXVA 3CQPA 4R2GD 4OSUL 3L7EA 4B50A 4MJIA 4KH2A 1GVIA 2AQ3A 5D2LE 2VSKB 4PD4K 1IU1A 4OLYH 4AG4H 2AV7B 1BGYD 1CGVA 2F5BH 3ZKMD 3DGGB 2GJ6E 3LNIA 5GSRA 2J88L 1W9XA 3F89A 2IBZD 2IPUG 3SE9H 3PGFL 3EYQC 5EBLA 2CUHA 5E00B 5C0CB 3BT2L 3RJDA 3WO4C 1Q9LA 3DXAA 4Z3TA 4MX7A 4XBMA 4W4OA 5EOCL 1QFOA 2KHAA 4XPBH 3Q3DA 3O4LA 3CC2P 4G43B 2GHZA 5CCGA 1F4XH 3G6AB 1NCTA 2GJRA 4M62L 4JBSA 1MV8A 4XPGH 1Z9MA 1T03L 3FT4B 4QHMB 4XVTH 3B4SA 2HT4C 5JPMB 1J5IA 1M9SA 3TFKC 3K4AA 1EO5A 3NIFE 3OAKA 3MFFA 3Q5OA 1AXTH 1ROWA 4IOIB 5TTRA 3C6LD 1MCEA 1TJHL 4PP1C 3EW3B 1RJLB 1OE3A 2OJZL 3GSQB 2XZQH 1U93A 1PPJD 3L71G 1IGTA