5AVTB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avtB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avtB02
2C9NY 4M3LA 2ZFCA 4XE5B 1GTWA 1S9KD 2WPRA 2N9BA 3M06A 2QM7A 2YO2A 1HBWA 3P32A 4GT1A 5APSA 3KDPB 1OXZA 4AYCA 3L35A 2Q7CA 1GK6A 3VTPC 3TK1A 5APVA 3HE5B 5AW5B 1SLQA 5CMZA 1X8YA 5AVQB 3OAKA 4B86A 1CI6A 3M91A 4RESB 4C7NA 2WT7A 4AUWA 4HYTB 1MUUA 3M0AA 2E43A 1JUNA 5AW3B 1G2CB 4KHXA 2JJLA 1FAVA 2WPQA 1HUCA 1J2JB 5APWA 1NWQA 3O8ZA 2BASA 2Z5IA 2WWWA 3A7OA 3V4WA 1H88A 3TNUA 4JYCA 5AVRB 2Z5HA 3NFQA 1A02J 5AVZB 2Q5UA 3LIDA 2QM8A 1DH3A 2Q3IA 1CI6B 2WT7B 4C7NB 5APQA 5APUA 5AW7B 2ZXEB 3TYYA 4AQRD 3A2AA 1HJBA 2C9LY 3V5BA 5AVYB 3M9BA 1GK4A 3WGVB 2YNYA 1YYCA 3M9HA 3NMDA 2YO3A 3SWFA 1KQLA 5APTA 1GZLA 1CSBA 3TNUB 5AW0B 3VN0A 2R32A 1FOSF 1NAFA 3A3YB 3HE4A 4EOTA 1H8AA 5AW9B 1HWTC 5AVTB 3P7KA 2R3CA 2P7JA 2P67A 5AVVB 3V4QA 3MGNA 2XV5A 3KQGA 1OWAA 3VMZA 2XZRA 1S9KE 3M0DA 4I6MC 3WGUB 5AW2B 3P8MC 1IO4A 3I5CA 1T2KD 3VMYA 4DZOA 5AW8B 3B8EB 3VMXA 1GU5A 5APYA 1GD2E 2E42A 2P2UA 3LIEA 2R5BA 1T2KC 4LC1A 2VRSA 5APXA 5AVUB 2W27A 4C46A 1FOSE 4RETB 3HE4B 1CZQA 2R5DA 3L36A 3IR9A 2W6AA 2WTYA 1H89A 4JYBA 3L37A 2H7HA 2XU6A 1SP4A 5AW1B 3HTKA 2IPPA 3T97A 4I2LC 1JNMA 5AW6B 3HE5A 2WPSA 3NTNA 3MD0A 4GKGA 3VYIA 3NXSA 5AW4B 5AVWB 3A5TA 1A02F 5AVSB 1MV8A 2KP8A 1GU4A 1MFZA 5AVXB 3UIAA
chains in the Genus database with same CATH superfamily
1G2CA 4IU3A 4PHXA 3HUSB 4JFFE 4HJTA 3HE6D 1KQGB 4HGWB 3JV5A 3RZCD 4UQ3B 1K9MQ 5K39B 1I53A 4JZNB 2E74C 3C60C 4ZW5A 1EDHA 4KNUA 4NKDA 2DZEA 8CGTA 2R8SL 3G5XB 4QMEA 1T3FB 1Z5LB 1B6UA 4UB0L 1YA5A 5GGRY 1Q9OB 5IR1B 4WNQA 1OCCB 4BZ2H 1HHIB 1JUNA 2IH8A 2CBMA 3CLWA 4Q0XH 2ZKHH 2ZKXA 3DO3A 4RGOL 3CSFA 1FPTL 2OTJP 3U0PA 1QNZL 3BPCA 3PREA 4NM8H 4YWGL 2IDUA 5AOKA 5KAFE 4H26A 3RPBA 3ZTJG 1NPJA 1GOGA 1BLNB 1T0OA 4IRSA 6TAAA 4FG2A 2P24B 3QDJB 2C9RA 3CSTA 3B7RL 1WBYB 2G3ZA 3MREB 1PP9J 4GT0A 4PBWD 1OSYA 3TU6A 3BZ4A 4DAGH 4M61A 1I3RB 4PM1A 3VDCA 1S5IL 2ZSWA 3MV7A 4O2EA 5LGYA 4LQ1A 4R4NC 4R7DB 3DO7B 2E47A 4XBGA 5D7JB 4HETA 4GSQA 1G6RL 2YZ8A 2X4SB 2DQFB 3DUUA 3MUGA 2WQUA 3N5AA 1QFPA 1OVUA 2JFCA 3L48A 5CINL 4YHIB 4YDLB 1I1FB 3S3JA 4N78D 3D71A 1JWUA 1TJGH 3EKCA 4H1LG 5AOIA 1INDH 3KS0H 4KKLC 4XAWH 1FJKA 1A7PH 1FZCA 2UZXA 3QUGA 4LAJH 5TTRA 3O3DB 3HC2A 1M7IB 4QT5A 4QHKJ 5AVTB 3S35X 3UTSA 1VFMA 3V10A 4DPBX 1DBJL 5DRWB 1VJSA 1AE6H 2P5WA 5C09B 2O93L 1G9EA 4Z1PA 2VDOL 3EOTL 4QF1B 5F0MB 5E9NA 1VF5C 5JQ6H 2EYTA 1J48A 1PNCA 1RQVA 2NY5H 3QFGA 5DWPA 4I13B 2BVUA 5CJQH 2OR9L 3LQZB 3QSKB 3FZUC 4EIUA 1FFQA 1MZZA 1AXTL 3QG6A 4PSRA 4OI9A 4P5TA 3RWEB 1JHTB 1BQLL 3TT1L 3FQXB 1BEYL 4HUCA 4GMTL 4G9FA 4P3CH 3LNIA 4A37A 4B5EA 1SQXE 5KSVA 1J1OH 3ARGB 1WZMA 4KY2A 4BSVB 5IREA 1EDIA 1AJYA 3DX6B 4HW6A 5EUOA 1L0YA 3ZGHA 4N0FA 4AGPA 1RIHH 1R3JB 2H1PH 1IC1A 2Q1EA 2ZVOB 1AFOA 3WG7B 3SKJH 1B90A 3QUZC 2L5GB 2O01N 1NFDE 4PY8I 1NICA 4CUCA 5EN2B 3T1FA 2XKSA 4G6KL 2Y5QA 3RTLA 4KJPD 2R0ZL 3MR9A 4PLNC 3HC3H 1P1ZA 3A6CL 2OXHA 1XGTB 4HJSA 4CNIB 2H6PB 3D6ZA 4DWHA 4FXKC 4MNQA 3E6HB 4I1PA 1BYOA 2JJSC 4IS6A 5KSUA 2CXGA 2WJ5A 5CCHA 2ARWA 1U42A 1SJHB 4XMLH 4PVMA 3QZWB 4WV1A 1HAUA 2NZ9C 2IQ9L 3L1FA 2HT2C 2JK5B 4W9EC 1KENH 1NEZB 3CU1A 5IVZA 4BH8B 4X2UA 1XTLA 2G75B 5FA4A 1KIUB 1ORQB 4MNHB 3P0YL 4NXKA 4MJIB 4R5TA 3BW9A 3MIWA 1L7IH 1YMMD 1F4HA 3U9PH 1UXLA 4MB1A 4KK6C 1IVLA 1ES0B 3NT0A 3QNZB 4D0DA 1JTHA 3SKOA 1AQ8A 5CCKL 5ACZB 3D3VE 3FF7A 2HAZA 5C8JA 3G5YA 4RSYA 3T65B 3GKWL 3ARDA 1KIPA 5AKRA 4BFJA 3P2BA 3OA7A 3LN4B 4GRWE 5HYEA 2DN7A 2XTJE 2A1WH 3IJSB 2Q7YA 1A1NA 2FX8L 3EFFB 4KZDL 3UADA 3O2VL 5KZCD 4ODHL 1QLFA 4YL9A 1AV1A 3CFBA 4XNYH 1X9UA 5F96H 4JFDD 3MGNA 3G5ZA 4TL4A 4KRMB 3N1FC 3BVUA 5SX4I 3VWKC 3QWQB 2HZHA 3MRFB 2PP6A 1FNLA 1HILB 1UM4H 3FW6A 2X2YA 1OSPL 3NFNB 1IL1A 3DUSB 4RGND 5I0DA 4M5ZH 5FB8A 3KWWA 3L8QA 4L3EB 3S6CA 2AK4D 3CX5E 2X89D 1NTKK 2YAQA 3V5DB 1YRKA 3WS6C 3L4CA 4PRPA 3MBXH 3HFMH 4WBAA 2EYSA 5I71C 2K1AA 4GXVL 3PV7A 1H6UA 1SMDA 1L3NA 2FXMA 2F54A 3B3BA 4KXAA 5HYQB 1RMFH 2Q20A 1QR1A 1DEEA 4WY7L 4AKQA 1U95A 1WFNA 2G8YA 2DWEB 2ENYA 4NO5B 4OZGE 2NW3A 3PDOA 3HZKA 4RMSA 4G6ML 3VDAA 2WN2A 3EO1A 4BFGA 1QATA 1FIGH 1MCPH 3TH3T 1BMWA 2VQ1B 1GOFA 4M5YH 5D4JA 4V1DA 3F7YA 4MDRA 4WEMB 3QI9D 1TIUA 2Z31D 4LLWA 4Y5VB 1YJ9P 1QACA 3H32B 1QFOA 5AVXB 4HS6A 5IVXB 3O2WH 5E94A 5GZND 4Y1TA 2N9BA 4PP1C 2E4TA 3ORJA 3GSWA 3MV8D 5KOMC 3L73J 4TNFA 1QSED 1SQVE 4W6YB 1BZEA 2BO0A 3FT4A 4M43L 4QRPE 1U8PB 1KJ2A 1JAEA 4XPAH 3PP4H 5J1SC 1FG9C 3RPIA 2HMID 3V5KA 2UZYB 4G6JH 3PHLA 4RMTA 4N0RA 3PCYA 3WFCH 2R29A 1MLCA 3RK3C 3IWUA 3T8XA 2B1HH 1DJXA 4AUUA 4WY4D 5MP6H 1GPOL 4O51B 5GGQH 4AZ8A 1NH4A 1OWWA 2OM5A 5DUPL 1SQPE 4U1JB 5APWA 3WN5A 3FYEB 1RZKC 3GLEA 2ZP0T 4JO4L 3EHBD 3SKNB 4GRWF 4HWNA 3CZLA 3WE6A 4POZC 3DURB 1SVZA 2X4RA 2Q3ZA 3BEWA 2MTPA 1OKEA 4OZHA 3W11D 1F3DJ 1JD7A 1HTYA 1ZEAH 5T1DH 3MLWL 5EU3A 1P53A 1N7ML 1LHZA 2BCCG 4JR9H 1DL7H 3CCLP 4M9PA 5CMAA 1DBKH 1JPEA 2Y6TE 5EU4A 4DIXA 4MYPA 4E9QA 5FLVA 2XBZA 2UYLB 2LFGA 2AK1H 1R3HA 3Q2LA 1OWRM 3LRSA 3WJLC 4JO2L 4EUPG 1PV3A 1FAIL 4Z77A 5HY9A 1RZFL 1Q82Q 4OLVH 2BZCA 3DV4B 5E7BA 4KX7A 2FFDC 3CBJB 2EH8L 5IFHL 1E4XI 1UM6L 1YAZA 2FX9H 3UG3A 3VXSB 5ISZB 1FZBA 3E38A 2W65B 4MMXC 5HGHA 5AKVA 5BVPH 1KB5A 4MNQE 4I9XA 3US1A 3CMOH 1JVOA 1U8MA 2MOQA 3ESPA 3HN3A 4KI5D 1YEDB 2CNZA 2UZPA 4EKXA 4Z8FH 4L4VB 4S10A 3VCLA 1KIQA 4FMKA 1M1JA 5IHLB 3GJFA 5APYA 1OPGH 4B9IA 3MRLA 3T8MA 1QUNA 5HYJD 2HVBA 4KTEL 3SKMA 2R83A 1UA6L 3H9SB 4XMPL 3QUYC 2MNUA 4NC2B 4NPYA 3NIFB 3Q2VA 4ZX5A 1NTME 1A6ZA 3TJHD 2HPCB 5J06A 3VD1A 2WITA 5HI5C 4J39A 2IPKA 1C16B 3FU7A 2EVHA 3CMAP 4LSSH 1B4JH 2MSPA 4M48L 2MCPL 2YUXA 1A14H 4AC4A 3RHWF 5BW7A 1TTBA 2GJ6E 5DO2D 3H7LA 1AXSA 1GHFH 1WITA 2HCZX 1CVRA 3LKRA 5LNEA 4AQOA 4GKNB 3EOAA 1HS6A 2PPFA 2BW4A 4WWOA 5SWZA 1UJ3B 4L3CA 3HN5A 1I3VA 1FYTA 2AJXH 3FH5A 1SJVA 9PCYA 3C8KB 1HJBC 2FBRA 4P23A 4NB7A 2WIMA 3NAAH 4WDIB 3NCCB 4Y88A 3NSYA 4JFQB 2YSTA 3ZMNA 5FOBB 5B1JA 4PB0H 5I8OH 3QIUC 2FJFB 5DMKA 4XX5A 3HI6L 3VFUB 1BJ8A 1G84A 2N01B 1TTFA 2H9GA 5L0QC 1YQVL 3OKYA 1I7TB 1RL1A 2JXMB 4QY8B 2XDHA 4OW6A 3BPLC 5HDLA 2E43A 2ARJB 4ZAKB 3RDTD 2H3XC 4RZCA 1ONQB 1MREL 2QQLH 4HKXA 1ETZA 4HIXL 3N2JA 1G6RB 3H1JD 1MF2H 2GUVA 1E8XA 1O6SB 4NQQA 1P6WA 3I56P 4NWUH 1FVEA 2C9AA 4KNSA 2VZOA 3AQYA 4N2GA 4YDIL 4DGVL 5KLVD 3OVUB 5HDBB 4DEUA 4Y9CA 1JRHI 4EN3B 4KQ4L 4Z7UA 5JXAL 4PY8J 4ZFOA 4P46D 2MHAA 1AC6A 1YEGL 4HCRL 3KJ4C 5FHBL 1SY6A 5D2LE 1RURL 3HG1A 1T66D 2YPLD 1GIGL 1XL4A 4XNMB 1CI3M 3POCA 4K3JL 3GS4A 4OU3A 5DGQA 4MD0A 5E1AB 2E7LA 2ZT9B 4MMZB 1JWSB 4LE8A 4PJ7B 5DC4B 2VN3A 3V4UL 4FYQA 5IQLA 3C5JB 4G42A 1R75A 4OAWB 4TVPD 2VDOB 2YUZA 3D51A 3V0VB 4WHCA 1IC7L 5D7IB 4JQ0D 2ILLA 3RKDD 3RVWD 1EJOL 3SPVA 1NOLA 1KYFA 1U0QA 2UZIH 1BFOA 4F57H 2G60L 1TF4A 3BVNB 1BZDA 3MCKB 4YHLL 4UT9L 4ONFH 2P67A 5MERA 2AGJL 4WFHE 4LEOB 1OWAA 1TO5A 4AQAB 1VPOL 4P4RA 5C0BE 1NJ9A 4AYBA 4BKLA 4A55A 2E76B 3EQ2A 5ABAA 3WLWD 1KD1Q 5B39G 5KS9B 1FP5A 3CFCL 3BP4A 3AWFA 4K9EL 1VQ4P 4OBSA 2VRSA 3H1JJ 2J5LC 4DUXA 3M1BA 4OTXH 1Q0XH 1JGVL 1N5YH 1J5OL 4AG4L 3GMPB 2XWTB 3IKCB 1P7KB 4OFPA 1I8LC 1IAKA 4N0CD 3JYCA 5IHWA 4FNLH 2E6PA 3WKYA 4ETQA 3VXQB 1FG2B 4LBAA 4LESA 3I6LE 1KEGH 2UY6B 1F11B 4AE1A 3OR6B 35C8H 1ACYH 5KSAC 2NW2B 3GSRB 2MJZA 2F6AA 1JCCA 1ZGLB 1DQVA 4UF7C 4PV9A 2CJSA 3LQMA 3GWJA 3EADA 1SEQL 5CN2A 1FFPA 2RMNA 3FO9B 4KUZL 5TE6H 1LO2L 1X7QB 1M56D 2N7AA 1A3RH 2XV6B 1JCVA 2Z34A 1QX1A 4XGZA 4NBXB 2BDNL 3GMLB 4GI8A 4N2NA 3H1ID 5EBMA 2R7EB 1IGFH 2HTKC 1WZLA 1SN5A 5GGTA 3QBTB 1R0AH 3IGAB 4HDIB 4UU9A 3JVFC 5IROC 2VMCA 1HI6A 2Y2YA 4CN4A 5AAWC 2XRAH 1WPCA 4I0KA 4LLYB 5B7EA 1P4LA 3QRGH 3NK4A 4QHPA 3VQMA 2JF1A 1KBKA 2K8QA 1S9YB 3RVUD 5LGJA 3CPWO 4YXKL 2XZAL 1IJNA 1U3JA 4N25A 4ODWB 1A6UH 4AIZB 1RXLA 5I17A 1IFDA 4QRTB 3ZTNL 4X9BA 4ZO8A 2KZJA 5I6OA 4P59H 3U1QA 5E08L 3L9RB 3X12B 3FAWA 4FQJL 3VXUB 1VL2A 5APQA 4UYPA 3GF3A 1V5JA 4R6UA 5GS0C 2J8UA 5C97A 1Z1WA 3SOTA 5EZOH 3KJ6L 2K4AA 2LTQC 4Q7DA 1H3GA 1KFGA 1G0DA 1JMMA 1BQKA 1EUTA 3T9WA 2V5SA 2Y7LA 3LW5J 4D6TD 5AOJA 3K3QA 3ZYZA 3LIZH 4KTDH 4LL4A 3UIZA 1IB5A 4GJTB 1FBMA 2A6KA 4JG5A 5CILL 3UYPA 4IKJA 2Z7WA 4JVWA 3RGHA 5C3LD 4OIAA 1I75A 2I9TA 1KY6A 1TFPA 1KCBA 1UQSB 1GKEA 4PJIB 1XH2A 2B16A 4ZYKA 1BM7A 1TVBA 1CGTA 2F8OA 1GAFH 4XWGL 2R3CA 1AYRA 1RE4C 1GYCA 4LEEA 4CW1B 2B1OA 2E9IA 3B71A 1MFUA 2X4PA 3BKJH 3N44F 5FA3A 1HDMB 3VSQA 3LS4L 2D2CB 2GC7C 2VR4A 3VE0B 5A2JH 1AY1H 3L70G 4WFFE 2QEJA 2B3RA 3SGEH 1AKJD 3AVEA 3F12B 1BG1A 1KYOH 3BIBX 4H13C 4LAQH 3H1HE 1M3JA 4N9OB 1VADA 3S4RA 2VL4A 3ZUCA 1NMBL 5BOZG 4ZFGH 2YKLL 3AFLA 1JZ2A 5IHBA 4KUCD 3LIZA 4ENEC 3L72D 3DI3B 1TZGH 2V37A 5E0FA 3VGAB 2JJVA 1OOAA 4RDQF 1NTKG 3NEXA 2OJEA 4DH2A 3MRJB 1KZYA 1EEUA 5EZJA 4JEGB 4IIQC 3HRZA 2HYNA 3A4EA 4KRPC 4QJ3B 2BZDA 1KFMA 1EDLA 2H4EA 4XPFH 3AE7C 4V2BA 2VH5H 3BH9A 1N7SC 3HRNA 5CGMA 2VLKB 2GW5A 2W9DH 3NJNA 3W2DL 1FN4B 1NAKH 4P2QB 1G9ML 2XIBA 2YOAA 2XQBH 2VZ1A 3PJLA 4LCYB 5C0DA 3BKYL 1L0LJ 1JGUL 4HZ1A 5GISH 1CGXA 2H3NA 2FYYB 2E9WA 3LPOA 4ADIA 4AYSA 1E8ZA 1A4JA 3STLB 1PSKL 3T3MB 5FKPA 3WTWA 2OI9B 4OZ4B 4OF5A 1CQYA 1OCWH 4UQCA 3CFKA 2F0CA 3VA2C 3U6XS 3TZVC 5J9PB 1WICA 3HB3C 5FFGA 4NQEA 3GO1H 1UB6A 1CQKA 2FJHA 2J12B 5F21B 2BXZA 4ZW7A 5GQBA 4KXBA 1U33A 2G3NA 4Y9BA 3BDXA 1RULL 1MW2A 2W94A 3PLYA 4WW2A 1R6VA 1YPZE 3FQ1A 4X6EA 1MOEA 3KYAA 1ZHNA 1FDLL 1Z9OA 4OD1L 1NGZA 3IAQA 3T2NL 5I5JA 1SXNA 4HSAC 1FI8C 5SWSB 3SCMD 2JKXA 4GRLB 5L4MA 1NTZE 4F7PA 4KK8D 1XR9A 1RK0B 5IOKA 4TVSa 2EXSA 4M8VA 2R4RH 1S8DB 2XYBA 1BVZA 3NABH 1J18A 1JPSH 4L48A 5C0CB 3U7WH 1HKFA 1MCWW 1UOKA 4X7SL 2BNQD 4ZQKB 1FNSL 2NY2B 1S3JA 3WL9B 1X3DA 4Z7VE 2XCMC 1GVIA 2QE7H 2CDGB 4WK2B 4BRYB 3EJSA 1T6WA 4OJDH 4M7LL 2UXFA 5C0AE 1F4YH 5DMIH 3E80A 1NBYA 4Z7UF 3ZDYB 2Y6SC 4DK5A 2XV5A 1H0TA 3B7TA 4NCC2 4PVLA 4Q14A 5DQDH 3UMTA 1I9IH 4D2NA 4N87A 4KXZI 1GOHA 1KELH 2CK0L 1KTDB 5EC1A 3S98A 3O0RL 1IBBA 4ELME 1BHGA 1CGSH 1NKNA 1OT4A 3EBAA 1ET5A 2HWZL 2XX1A 4WTZG 1D5MA 3IMTA 2ZNWA 3H1KE 3GNML 4JE4B 2FLMA 1OW0C 4Z78B 4WFEE 1JUFA 4ALAH 3ITKA 3V4VA 3ZSTA 4Z7OB 1T1XB 3H2PA 3PQYA 2Z8SA 3MXWL 5HHMD 1SP4A 1JGEA 1XSIA 3PIQA 3CN1A 1OAXH 4F5CA 3NZHL 3VW3L 1MFAL 5SWSE 1U8HB 3OG4B 5BQ7A 3FUDA 4QYOA 2W1NA 4OGYL 3X2QB 3R7QA 5KBNC 4OB5L 4MQ7A 1BGYG 3IRZA 1LJMA 3V4PL 2YPKA 4UZUA 3LZOA 1Q9LA 1SLUA 1S9VA 2ZG3A 2X6MA 3HNVH 3MUZ1 4NSKB 4Y4KD 2M8XA 3ZL4L 5C9JB 3TVMD 3B9KC 1INQB 1SDDA 5I2IA 3F00A 4MBRA 4R3SA 1LP1B 2DQTL 4J8QA 1YYMH 2ZYDA 4ZS7H 2DTSA 1YPZF 4O5LH 1BQ5A 3TK1A 4JQVA 1SLQA 3B5TA 1JN6B 1WHOA 3K2MC 5BV7C 4GAJH 1LO3H 1J88A 3DGDA 5I8KH 2BP8B 3FCSB 1L4AB 3NRPA 4FN0A 1N6QH 4OLUH 1N86A 1QAWA 1CF8H 2VW4A 3ARSA 4YXHL 3G9RA 3D07A 4NRZB 3N41F 4PRAA 4RZKA 3J7HA 4MX7A 4UTCA 3Q44A 4O2FA 4UYQA 2YAPA 4L1SA 1XAUA 3B37A 3RTQC 1JF6A 1GYWA 3MNWA 2Y7QA 5F8QC 1P5UA 2GFBA 4JPVL 4KH9A 2EXWD 3APNA 1WBZA 3G08A 4KVNL 4LPYA 1NU1G 4N8CL 2XG4A 1UXWB 4MRBA 4RMWA 3D39A 4P2OC 1WDAA 1G4MA 2ATKA 4I9WD 1YMHB 3H53A 4LFHD 3QDGB 4DKFH 3LYRA 3MA9L 1FH2A 4JGMA 3R19A 3CLFL 4QR7A 3WGVB 3V52H 3I2CH 1N26A 1BE3G 3VGGA 4ELMF 4JFOA 4FFZH 1V8HA 1YEHH 3KPSE 2YA0A 3QXAB 2WSCJ 1QRND 3CXDH 1EZVD 1SNRA 1KYOE 1L6XA 3QDMA 4OCSH 1QKZH 5I9QB 1ZDSA 2ZJSH 3B5NB 4IRJD 5TE4H 2VDPH 4BFNA 1A9VA 3LZFH 4AOFA 2NXZB 1YCSA 2LW3A 2X28A 3CVDA 1BD2B 1WTGT 3HE7D 4LBEB 3IAPA 1I1CA 3NPSB 2ZXWB 3KHUA 3EO9L 4GSDL 3AM8C 4ABUA 1DP0A 1EBAA 1GGIH 2J8UF 5CCGD 3P9LA 4UAOB 4U6VL 4YDJA 1WCBB 2WOYA 2YLKA 3ARWA 1PNDA 3RVTD 5IUCA 4UTAL 5DUMH 1B2YA 2W0FB 5ALCL 3D48R 3KXFB 3NJVA 2OSLA 2EDWA 5JQ6L 1RF1C 4IM8A 1JXKA 3S2AA 4A2EA 4DGYL 3BP6B 4MA8L 2ZCHH 1OIOA 5DDHB 4FFZA 4M4RA 4GUQA 1FVCB 1X4YA 2UX7A 4X5XA 4AENB 2CIKA 4JY5H 3GMMB 1WT6A 1K5NB 5F6HJ 3K6SA 2WK2A 2A73A 1O5PA 1WS8A 4EUPA 4LSTH 5INDB 3DBXB 1EHAA 1OVVA 2IQAA 4PWFA 4FG4A 3BP7A 3C5ZD 3F84A 3FX0A 3UTQB 3H1LE 4UDUA 2CWRA 3HHRB 5CN1A 3QQXA 2VC2B 3Q3DA 3S34L 1K85A 4M29A 5BS0B 4NWTL 4G8AC 2J7LA 5LBSH 4HA1A 3SDCB 4LSRH 4UNVA 1CT8B 2BRQA 5CBAA 4EI5C 1UACL 3BX7C 1G7JA 2R1WA 2UWEB 1SFHA 2A6IA 5IP4A 4PD4H 3PNRB 4XZ4A 4GW4B 3BCCJ 1LGVA 4KXDA 1DHKA 1LT1A 3OAZK 3T2PA 2WBWB 2EKSA 1PPJG 5L4JA 1KCVH 1RZPA 3WELA 1LO0L 1QLRB 3NGBB 2W95A 2NR6C 1UKTA 5HI4D 4AQ8C 2JKJA 1KCUL 3FQYA 3CH8A 1GW0A 3WD5L 2FAUA 2GJZA 2MCAA 5GGVL 5JOEA 3FHAA 1MRFH 3GSVB 2GC4C 5DZJA 3WIIL 4BFRA 5E24E 2G9KA 3LN9A 3BKMH 5LAPA 4JYCA 1CXFA 5LBSA 4W7ZA 4I3SL 4KJQC 4XXCC 1BVLA 5HGDA 3CE1A 3P8CD 1I3GL 1XHHA 2DWYA 4MJIE 5LAXB 4GOFA 5L9DH 3M88A 2V2WB 5JLZA 2FEEI 3HE6B 4DQOH 3RZCB 5E6SB 1SQBD 1JZJA 1V7NL 3HNTH 1T21B 4X0KA 4RWYL 1WAEA 1S5LH 5E8NB 1CFSB 1OD9A 1RF0C 2BOCA 3DGGB 3HNSL 5IMMA 5E9DB 5TDNB 3MRKB 4HMEA 1DQLH 1QLEH 2X4UA 3C9NA 1PF3A 2YQGA 4LK4A 3TNUB 2IMNA 4YAQB 1KCRL 2JJSA 4RAVB 1FNGA 3IFNL 1M90Q 3BRGC 1KUMA 1IQWL 1MCFA 2F19L 4RWHA 3M0DC 1G5GA 5C3IA 1JZ6A 4CA4A 1P5VB 4HCFA 1JS4A 1N59A 1XEUA 1QWHA 1NBZA 4FQQA 4KNQA 4HB1A 2BH0A 4OD3H 4TNEA 1K2DB 2C3WA 5AOZA 3W1ZA 4TUKH 4CVZA 4FL4B 4PJGA 4DKDC 1DANU 1OM9A 1PFOA 1WJ3A 2FRGP 1UUNA 2KS1A 3ARFA 3B8YA 1JFHA 3BGMA 4M6NH 3PAZA 1MNUL 1ZW0A 1OB1A 3QIBD 4LLVB 4HF5L 3ZKXB 2E42A 4KOCA 3FTUA 4L3EE 4W9KC 2BIMA 4LC1A 1R3LB 4QYAA 3WTXA 2UY7B 1FZAA 1CLZL 1RUPL 3IRPX 2NY4D 4LLDB 4ONHA 3TEYA 2F61A 1N4XH 3DO4A 4LLAA 4NYLA 4EDWH 1T5KA 2XACC 3IFPA 1U91B 4IDJL 3D39E 2IPPA 2IGFL 4PRBA 1DQMH 2XPZA 4OCXL 4OCMC 1CDCA 4Y99C 3DI2B 1FC2C 2PUQT 1KGIA 4PG2C 5F7YC 1AGFA 2BHYA 3N42F 4XVSH 3EH2A 2MQCA 2BNRA 3QQ9D 1PGQA 4ZD3H 3P4OA 1CL7H 2Z93A 1NDTA 5JOPD 3FTYA 4BQCA 3F6JA 3MLRL 2ZSVB 2RQ8A 3ZKNC 4Z76B 1B0RA 3QJHA 3UG5A 3VWKA 3U1AA 4GT1A 1C1EH 4Q9BA 4TVPL 4AEIH 4U31A 2ZWSA 5GHWL 4HPOL 2WUBL 2DM3A 1HXYA 4K07A 2W8ZA 1RZQA 5DEZA 3WS6A 2PPDA 1AG0A 4R96A 1L9RA 1WISA 2FBJH 1J9QA 1IM9D 1YQ4C 3L3KA 1XBRA 1ZJAA 2Y0DA 5HYSB 3MUDA 4L8SB 3PH0A 3NCMA 1OFCX 3TP4A 4CMHC 3V95A 1MVYA 2OTWA 4EE2A 1TZHB 1S1CX 3RWJA 3ESNA 1QOKA 1Z32X 2FB4H 5FGBC 2CKNA 4C4UA 3MCLL 1U3YA 2ERJB 2VL5B 3BEVA 5DJZB 3V0WL 5DFVC 3HRPA 1MCHA 2ZJSE 4PH8A 3A2AA 2WCPA 1C08B 4PJXB 1TJHL 4NO0A 3PGFH 2GAZA 3SDDC 3AW5A 1ADQL 1AHKA 2CLVA 1SS1A 4NO2A 3W9DB 4BCZA 3SBWA 2WXFA 1DBBL 4GQRA 2FR4B 4NFBA 4DGIL 1J9CT 2V17L 2N3JA 1F00I 2CRIA 4RVBA 4U3SA 2WZ0A 4AMWA 5B1AB 4Y8AA 4U6YB 2YD5A 1QW8A 3LH9A 3LQAL 4G72B 4BQBA 3PGDB 1V3JA 1PFCA 5HI3C 3WY2A 2FX7H 3IDXL 1D5BA 2B14A 4MBOA 5DWUL 1GCFA 1VAHA 4OLXH 5IK3A 1PKQB 2AXJA 4F2MB 1RIUH 2AJUH 5E7FA 2WB1A 3VFGL 1CBVL 1NGQH 3SDAA 3CXHI 2ADFH 1YMMB 5DO8A 5IJKC 4BFBD 4JKLA 3O6LH 4IOIB 4Y2NA 1IFJA 3QJSB 5B7MA 4XHJC 4JRXB 3QRBA 2MPVA 3FRPB 1NEPA 3JC22 5DJYA 4RCAA 3IDGA 1XFPA 5FUOH 3N1MC 4ZDHB 2Z64C 3VUAA 1DR9A 2R2BB 2F8XC 4R7VA 5FGCE 4G9DA 4PD4E 4NQXB 4XI5D 4U1HA 1DD3A 1AD9B 1G7MA 2DKUA 3KPOB 4OZFB 3VFVB 1WIOA 4XVTH 2XLLA 1NCDL 2I60L 4HEPG 3BATA 4HKZA 5KVFE 1OTUD 5KZCB 3K81A 1PG7W 3E1IA 2D3LA 2DWDA 1UYWL 2X7LA 1L0LK 4LU5H 1C7TA 2BX5A 3FB5A 3VGEA 4ENZA 5I19H 5I1KH 5JOFA 3MLUL 4ZMWA 1CIDA 4PJDB 1FLRL 4KGLA 2QQNH 4TOYL 3DRTB 2Y36L 3I50H 4E41E 5DUBA 3N0PB 5EUKA 3SE4C 5B1KA 3P32A 2H47C 1S9KC 4MZ3A 4RGNB 2IBZG 1VGEH 1VGKA 3O8XA 1IFNA 5D7JC 2Q7CA 3HD7B 4N5ED 3SE8H 3F7LA 1T5XA 2Z7YA 4PJ8A 1N12A 1TCMA 4YZFF 2BOLA 2PTUA 4HYTB 2EE9A 2GCYA 2N0MA 3QUYA 1PZ5A 5ESQA 2B39A 4YDLC 1REIA 3EDKA 5CP3A 3IU3B 4W81A 3UL4A 1S5LE 4JG1L 1ZR2A 4KKCD 1WH0A 1OT2A 1I1AD 1JZ3A 1RERA 5IKCB 5AWNH 1PIGA 2H2SC 3UFIA 4ZXBA 5HDBE 5DRNA 4HLZG 5FECA 2NPLX 2Z31B 2FD6L 15C8H 1VPCA 2B1AH 2ZPKL 3DX7B 2OL3H 5LCVL 1ND0A 4C4KO 4Z7WB 4U6XA 4K3AA 1HJBA 1XCTB 5FV2A 5HHOA 5JXEC 1A1MB 3QORA 4C8XA 1QHOA 3H56A 1UVQA 3SGKA 3MV8B 2QR0B 2W9LA 3SODB 2KNCB 3QH3B 1E9OB 1QSEB 1PU0A 2CPCA 2OS7A 4HV8B 4I5BB 1KGYE 3TM6A 4JGJA 5JW5A 3UC0L 3S4SG 1LWUA 1H19A 2P46B 1EQWA 4UM8A 1T6BX 4MYWB 2F7QA 4UB8H 1M6UA 2KPNA 5D7IE 2DQMA 5C7XL 5J8OA 2Y69B 4WY4B 1M8OB 5DJ8B 3GD1C 4DN3L 3SN6N 3UP1A 4DJMA 4DN4H 3ARGC 1ASQA 4Z0XA 4BJLA 3V4QA 2EUZA 3BLBA 1BSHA 1PD1A 3C8HA 5JDJA 2PWGA 1TTUA 1VFAA 2OL3A 2WSEH 4IRZL 4W80A 4N22A 2AQNA 1DJSA 2CGRL 2E7HA 1T0PB 4HZLA 4XWOD 3S36H 5KS9E 3X3FH 4UQ2A 2QV4A 2V5RA 4NHUB 1TYJA 3HIZA 3DDGA 4ORGA 1F4WL 3JWOH 4D9LH 3MO1B 4OLYH 2VSCA 5F3BA 3CDZB 3IM1A 4LRIC 2ESVD 2G4EA 4F7CA 3K74B 5DT1L 4MKMA 1MWAH 2F1EA 4FHBD 1MCJA 2P5ED 2W07A 3VFMA 4XNBA 2WLNA 2HKFH 3CFEB 1BZ8A 1V3KA 4JN1L 3KLSA 3NTCH 1L9SA 1KXTA 2FGWH 4X6FA 2ZG1A 5ITFB 5KANG 2JSFA 1ZT7A 3QZPA 1GA2A 2B5IC 3L2LA 3NSDA 3TO2B 3KM1A 5IW1A 2WPRA 2F5AL 4I48B 4UV4L 1BZQK 3QA3B 3QR1A 2YO2A 1JHLL 1SQQG 1NL0H 3H0TB 4IBZA 1CICD 2BEQD 3MV9A 1BCIA 2YK1H 3ZXAC 3D6GA 2DWXA 2ZXBA 5HYJB 4IGBD 2OYHB 4RISL 1HF9A 1TT6A 2D0FA 4NUGL 1RPQA 5HJGA 4C7NA 3KLAB 1CDYA 3NZSA 4QXTA 2X4QA 3X1NA 2ENJA 1MWAA 2V7HA 5I66A 4RO0A 2JKLA 3VRLE 2EXTA 2EILB 4KDTC 4DP0X 1QPKA 4ZFFB 1V3LA 4NDMB 1JGDB 3PWUB 5EZPA 3QB7C 5H94B 1KYAA 4X7EC 4WU7A 2JKSA 4POYA 2BASA 5AZUA 4NQDD 2HJFA 4BFIA 3O81A 4JO1L 5EIQA 5HHXH 1ICTA 5BUPA 2HODA 2VN5A 6CGTA 5LNDA 3OKEB 3K72A 3D7PA 3D50A 2J73A 2Z35A 4GUCA 1TTCA 4OCYH 2XWZA 1NFIA 2DIEA 4PBDA 5DI8B 4APXB 2VE6A 3HW7A 4QRSB 1KN2L 3VFRB 4UQBA 2BRRL 1KILA 4ZTOH 2XJLA 3CXHD 1JOIA 3LAFA 1IGML 1E43A 1PLCA 3HC0B 3RIFK 3R06A 5EO1A 3V8OA 3OHXB 4I8DA 1XMWA 4JZOA 1S5HB 4FQ1H 2QPUA 3QRLA 1ZANL 3RDTB 5FW6A 4L1HA 3V2PA 3B7UX 1KCWA 4PJIE 3L3GB 4K9JA 1U3HD 2ZUQB 2GSIB 4QI3A 4W1TA 3RQ3A 4HIHA 3QC6X 2EDLA 2HJLB 2ZWKA 3OZ9L 5B38B 4Y5VC 4YHNB 3CFJB 2ITDB 1U92B 4JFPB 3ZN6A 3SOBL 4IW4C 1SYSA 5H8DA 3BO8B 3GSQA 1FV1A 1UM5H 1UC6A 4ODXA 1ZPUA 4DZOA 4P46B 4WWKB 4YVNA 3VM7A 3VXMD 2VXTL 3CDGA 3L6FB 5J6GA 3QHZL 1MIEL 3WXVH 1PZCA 5I8EB 1T7VA 4X6DA 2YPLB 1QSFD 3CZNA 4O02B 4E9LA 3F7KA 4YX2H 1BCCJ 3HI5L 3MNZB 5CZVL 5I1JH 5IUSA 1ZLUK 3N04A 1BFVL 3FUJA 1WFTA 5FYKU 4PW3A 5F1KC 2OQJB 2ZUSA 3KLQA 1Q94B 3P11H 5D6DC 1BF5A 3QNXB 2O1JA 2VLRD 1A7OH 2WSFH 4QRQB 3S1KA 2WPSA 2F5BL 1FZJB 1E5AA 5JHDD 1M7LA 3ZLQC 3ECVA 3VJ6A 3AE4C 2WLYA 5JDSB 5CBOA 1DLHA 5LVEA 1UATA 1RZJL 3QR0A 5E00B 2DI7A 2PP8A 1PVHA 3AG1B 1RE4A 1EAQA 4JM2D 3VTAA 5EOCH 2FYZA 2VLKE 4OQ1A 4D0BB 4QLRA 2AEPH 5B8CB 4P2QE 3GSOA 4HALA 1JBJA 5FDYA 3MROB 1BPLB 2K3RA 4ODVH 3T4AB 1K73Q 5EEZA 3ZE0B 1ZS8A 4LPWA 1HL9A 3AEAC 3DOIA 4N86A 1KLUA 2ODIA 1ZOXA 5D5MB 2Q3XA 4X6CB 2H6UA 4X50A 5I1CL 3U36A 3X14B 4JDVB 2WZPA 1DX7A 2VC2H 4AV0A 4PP2A 4GMSH 1LTGC 5D4QA 4HJGA 1UWYA 3TCLB 1LTTC 3HLAA 3BT2L 1ZLVK 1JZIA 2QGDA 4PJCA 4DFIA 3DVFA 4U1NB 3KWTA 1NWQA 1T89C 2WXIA 4TSBL 3Q5TA 4C4BA 2G3MA 3DOSA 4N9GA 2HG5D 4NUJA 3A24A 3ULUF 4UB8E 2HSIA 4WCYH 1IBZA 2A45I 4KGJA 3P4MA 3CC5A 1CI6B 4PJIF 1M56B 4OM0L 4YEEA 5M95B 3MC0A 4QO1B 2FTAA 2QSQA 1IAOA 1ZV9A 3O41A 5C86A 2A06G 2CR0A 3AAZA 3B4NA 2XVBA 5DU7A 3K4ZA 5DK2A 4LIQL 5TPWL 2D03L 2NTFA 2N56A 3ZHKA 2FZ3A 1H3PL 1GJIA 1OAKL 4JRYD 3RUGB 4KK9D 1A7BA 5H35B 5KVDH 3G5VB 3MV9E 3KBFA 3Q6GH 1YUHA 3R0NA 4Z7NB 2JJUA 5AAMC 1T20A 4Y4HD 2BP3A 4Y5YB 1QWUA 4I85A 4YPGB 3SDYL 3HR5A 3V7AE 5JPNB 2NOYA 5HHNA 2CUMA 3SPJA 3O45A 4H20H 2IANA 3S8GB 4ZUTB 1QA9A 2BOBB 1Q9KB 2X0WA 3ESMA 4C83B 5AYUL 1BBJA 4I89A 4DSYA 4M03A 2DTMH 1A1OB 4D9QE 2W6JH 2LLLA 4PJ5D 2EE6A 3LXUX 1AS8A 3BI9X 4J3UA 1GJUA 2E75D 4AM0A 2VJ0A 4HC1H 1R5VB 4PV8B 3PV6A 1B2WL 1Q1JL 3QAZB 2FH6A 4DKAA 2YJLA 2FNWA 5E2TH 4IHOA 2EACA 4ZAKC 4XPTH 2ZCKH 3QZWG 4HBCH 4UTBA 2XVGA 1NMAL 1ZXQA 4HIIB 1AR1D 3TT3L 4W9CC 3RB7A 2XNXA 4RBPH 2NZ9D 4EOWH 1KILE 3L45A 3IDIA 2NX5D 2HT2D 1AQTA 1USZA 1OHZA 1FO0H 1XR8B 5K1NA 2DBLL 1TSHA 2A6JA 1UZ8A 3QXVA 4EN3C 3FO2A 4L8BA 2J6EL 1DQDH 3KLHD 4WVZA 3O2DA 5ICXA 1L2PA 3HLKA 3VRIB 4MCYA 1LE9B 4HH2A 3L2NA 4H88H 1I8IB 4G7VL 4S1DC 5JQIB 2YSSB 1JNHB 3FHEA 5APVA 3FU0A 2I5YL 4PJ9A 4W93A 4GKSA 1C5CH 2ZT9C 4MMZC 4Y2DD 3DX1A 4XNXL 3OLDA 4XN2A 1OL0A 4N90E 5I24A 1CFTB 4QCIB 2VYRE 1P4BH 3MOQA 4O4YL 4XPGL 2DQJL 4X4XB 4L0PB 2R23A 1BECA 4W6XB 4AUJA 4M3KB 5T1KD 3ISYA 4GIPD 4QRRA 5BZDA 1SHSA 1DQQB 4R90H 5D1ZB 1K04A 1M1SA 3BSZL 3CFDA 4XN8A 5D7LA 3UJTL 1QD0A 4B5ZA 4PJBA 2X38A 1FZKA 4DOHB 3N9GL 2VERA 1BDDA 4ZO6A 4JFZL 2E76C 3M45A 3MPCA 3B9KA 4YO0A 1FIEA 3PRJA 1KBBA 1LJ2A 3HTLX 3MRCA 2VDNH 3V9EA 3RNKA 1JV2B 4PLJC 3WHXA 1LO4H 2K4WA 3BZFA 3ZDZB 3ZHLA 4ELKB 5I1EL 1GYAA 4B53A 1NCOA 2OMVB 1VERA 4JLRA 4XTRD 2Y72A 5DFTA 4HX1B 4G8GD 5T3XD 4F3FA 4BK4A 4J23A 1EQ7A 4JDZB 4JKWA 4Y4FD 3QVAA 4U3FJ 4LDEB 4PWEA 1BGXH 1U2YA 2NQDA 5TH2B 1TNMA 2Q3AA 1KJVA 1RUKL 2KLRA 5D2NB 1HHJA 2Y1AA 1U93B 5CU5A 1IC5H 1BD2E 1P4IH 5DVPA 3Q1MA 3FU6A 3KL5A 3L81A 3RTQA 3EYSH 3L75D 4C56D 3ZW3A 3FFDA 3A4FA 4JZJA 5CN3A 2BC4A 4JJ5A 4JW3A 4HS8L 3BXNA 3VGBA 4XC3H 1OCOB 4OJCA 4QRAA 2H32H 4Z0BH 3APMA 4P2OA 2VXVL 5HSFA 4P2AA 3E1F1 2CO6A 3O6QB 4FA7B 3SE9L 4G5AA 4LSQL 3PJSB 2YIUB 2DKMA 4Y1AA 1FZGA 5K9KB 5DRZB 2L7QA 1YNKL 2IDBA 1F45A 1ZRUA 3PABA 5JNYA 2XV0A 5CSBA 1T7ZA 3KPLB 3RE0A 3HBPA 5LJYH 1FZOA 2J21A 4F80A 1OGAB 4TUOA 2E27L 4KBPA 4J8RB 1HEZA 4XPHL 4YDMA 4EI0A 1S4XA 3QW9A 4PGCA 3O3AA 4CC0A 1MVUA 5AVSB 4ZMTA 3I6SA 3HCVB 1FGVH 3KMDA 3S88H 3L71G 1MN4A 2V5MA 3LXCA 3MJ8B 1EXIA 3AM8A 1ROWA 3W67A 1W8NA 1QVOB 2H32A 3CDFA 5DHEA 3V6OC 1PQZA 4X6DF 3MGOA 3N6YA 1EJ8A 2UWEE 4N6QA 1E5YA 5AKTA 3KVQA 2PW1B 1F8TH 4OZFH 1T5WB 1RU9L 1QG3A 1E27A 3M07A 3MFFB 1E6OL 4A6YH 2YARA 4BHUI 2KZKA 3EJYC 2FO4B 2NRDA 2OR8A 4D3CL 4GYBA 4H4NA 3UPCA 4DP1X 3GMRB 4X5PA 5I1GL 1DZ0A 3E8UL 3BAEL 5FS5A 2BIOA 3MRHA 1TXKA 2HXAA 3IT8D 1PP9E 1QFWL 3ECQA 5HHMB 3L9YA 1QTPA 2BWQA 4IIZA 4JG0H 5LGHL 4AH2B 4Q6IA 4L9LA 5TDPB 4CMMA 5KW9H 4WHDA 1BX2A 4ATWA 1A4KA 1AIZA 4NENB 4HEPA 4L4TE 5DS2A 5FFOA 4HULB 4FQLL 1AH1A 1Z9PA 3BMWA 4XP6L 4ERSH 2VXUL 2B88A 2ZZUT 4Y4KB 3NYKA 1TYEB 5KVDE 3N3EA 4JFFD 3ULVH 1T0MB 5FCUL 2WQXA 4DW2H 3P3SA 1Q8MA 5KYXB 5AL0A 1F3DH 2EYRA 3VB8A 5DD5L 4X42A 5ICZA 3G6JA 3F7QA 2X9WA 3WIHH 5E9DE 3CFUA 2HVJB 4PJCF 3FUIA 5CSZA 2BSTB 3W9EB 1KB9K 2IFFL 2NR6A 2W60A 2V2TA 4MLIA 1J5IA 5ERWB 2WMPA 3ATDA 3OWEA 1CXHA 1ZD6A 5CJ5A 2IIJA 4N1HB 5D8JH 2AANA 3EDFA 4Z5RB 4F37K 2ZYGA 1EC5A 1JXDA 2VIRB 3ELQA 1UTDA 4JO8A 1RQUA 1TJIL 3EJJX 4WJ5B 2VLJA 1KLFA 5ILTL 3K4AA 3NJIA 3TYFB 2FEEL 1YNLL 4CAGA 1J11A 1OW7A 1G1CA 4KH2A 3TC9A 2VERN 1E42A 4HT1L 2W9EH 2BVQB 1OW8A 4LPVA 1OP3K 5AVUB 4XBPB 1S9XB 4G5ZH 3WIHA 1Y47A 1JHKH 5D7LE 4FJYA 1N0XH 2OI9C 4PJBE 3RAJL 1U8NA 2HLFC 1ETJA 3R8BB 1WG3A 5C07A 1NC2D 4ZX3A 3S4SA 3H9HA 1QRNB 5HP5A 2P48B 2IH9A 1JMXA 2A4CA 5GRXG 4YBQD 3L54A 2XA3A 3SSUA 2IOIA 3AGVA 3K71A 1HIML 5JHBA 4AM0Q 4IRJB 1S5LX 1WLHA 3WSQH 4FTVB 4N2EA 5JR1H 3D06A 1TQVA 4DVBA 1QBLL 1UUSA 3AS0A 2AF2A 3HE7B 4APQA 5CBEA 4FXGA 1RZIA 2ZFCA 1QX8A 1AO7A 1N0LA 4OCWH 5GGVY 3OWRA 1UH2A 5E23A 4JFWA 5ECJE 4GRLC 1BOYA 2IVFC 2ZWNA 1E28A 1LP9A 3TBSB 4ECNA 5DMJB 2GG1A 2QJKB 3MV01 4NM4L 3EJRA 3O11B 2BP0B 1BA9A 4XO5A 2F58L 2KLTA 3RL0D 2I9LA 1ZN5A 4PV1B 2OJZL 3LRGA 2R3SA 3VI4E 2NY2C 1ID5I 3K7UA 4F8PA 4Q2ZB 4KMQA 4BGDA 1UXSB 4R26L 2ALWA 3QEQB 2ZCLH 3A0OA 3GGWA 4F9LC 4FFVD 1AHMA 3KR3H 2WUCL 4UQIM 3WXWL 4Q89A 4Y1AE 3C5ZB 3OAZH 4R8WL 2A9AA 2DYPD 2P47B 3ZMRA 1SQXD 1CB4A 1NDMB 1OAJA 1S7XA 2ADIA 4YPJA 5J12B 4DT2A 3E9UA 2QADD 1JPTL 4LDOB 2JCCB 4G7RB 3OL2A 4G6AC 4MQSB 4U4BA 3MCG1 4Q6YA 4X7FC 3KE0A 3MRNB 4ZS6C 1MPAH 1CZ8H 3M9BA 4QHNB 5BRZE 3K2KA 4F91B 3O6KL 5LBGA 1EO8H 1CSBA 3T6ZA 3Q8EA 2YWYA 4K3DL 5CD5C 5J56B 4LCCB 3QCUH 1BZOA 1E79H 5C0ND 1XF3A 3DYPA 5E8PA 3TBTB 3RX8A 1JTTA 3A67H 1MCEA 3GSUA 3OAUH 4K8RH 1GGCL 1WC7A 4OSUL 3UGEA 4YXWH 2XUWA 4PJBF 1TENA 3TONA 3ETBJ 3NJLA 3D2TA 3CBRA 4KVCL 4NOFA 5KYUA 2L7UA 3UIYA 5D70H 2J58A 2M3EA 1MQ8A 1LNUB 2HRLA 1D5XA 3L1EA 5FGBA 4YPCA 4F2ME 5KJ7A 5F3FA 1KZQA 2GUSA 1D5IL 3B8EB 1LT9A 5DYOB 3G7TA 4M5SA 1YQ3C 4XXDB 3QUML 5HDQH 1N2RA 1OM3L 2QT6A 4JRXE 1TYRA 4M7KL 3M9QA 1AXIB 5IBUG 4PBVC 4BK5A 3D3VD 5IROD 2EDKA 4HGMA 5A6IA 3FU3A 5AW1B 1DDTA 1E65A 2D4DA 2H45A 3SB3A 4JFEE 4YUEL 1W6WA 4NT6A 3RA7H 2CO7A 5E2UL 3T4YB 5KJRL 1OGTB 2ISDA 4UIKL 2XTJD 3B4SA 2WIIB 3GZQA 3D0LB 4FYSA 4N2DA 2LXBA 1IFGA 3L73E 3UPRB 5C0GA 3TEWA 1AQDA 3VI4F 1YEKL 2VISA 3SO5A 5DJ0B 4K7PX 3FBKA 1I7RA 1K4CA 3GC3A 4U1KB 1QMUA 1YJDH 2IAMA 3VFPB 4O02H 1TMQA 4LSUL 4PJDE 5BRPA 1C7SA 1AJ7L 5JIKA 2ZF9A 4EXKA 4ZW8A 2IF7A 3K0WA 4K15A 3TYGH 3WFHB 1ZT4A 3BFOA 1RUQL 4X80L 3MTXA 2AABL 3OGCA 4TSCH 3CCVP 2IDQA 3QIBB 3EZ8A 3EJTA 1U8LB 4RGNE 4XMUA 5K39A 3CX5D 3OHMB 1X9RA 4HQQH 4ZK8A 1JY3N 3UPAA 5CZXC 4IRSD 3H3BC 2CKBH 5IHUL 2NY4B 3MLXL 1LE5A 1NKRA 3V6ZB 5F88A 3ERXA 3ULVE 4WHYG 1TZ8A 1W0WB 3AWGA 4WO4B 4RNRA 3ZDMA 1I3UA 3DDFA 3RZWA 3REWB 5IR1A 3H4FA 5E56A 1J12A 4K9EC 1W72L 3ARQA 2B15A 4DCQA 1UKQA 3B5NC 4WUKH 5C6PB 4WW1A 2HH0L 3ARPA 4X8JB 2NXZC 3WTTA 3BWSA 4UMSA 1PX3A 2G5RA 3NPSC 4OV5A 1WWBX 1YHPA 2BJML 2P24A 5DD0L 5CUSL 4ZPVB 5EFIB 4HXAL 3MREA 2C7UB 5DEGB 5I28A 3GZKA 5I73B 2QQKH 3EJZD 1U6AL 1FNEA 3PHAA 3MLZL 4JY6B 4HSCX 4LL1A 5C0IA 4R7DA 1SQVD 2C5DC 5FWQA 3DO7A 1QSEE 2CKBA 4JQIH 5D7JA 1RE3C 4QRPD 2R1XB 2BMKA 4YLQT 2R9HD 5DQ9B 1TEFA 2RR3A 2X4SA 1IM9B 1KYDA 3RWHA 5E6UB 3S3PA 2OV0A 3LW5H 1A9EA 1A8ZA 3UYOD 4GQZA 2J88L 1MHEA 1NAFA 2ZOWA 4YS4A 3MNDA 1H8AA 2IG2L 3D0AA 3ROLB 3TGUJ 1IKOP 1SQPD 3QCTL 3QZBA 3O3DA 2GBAA 3HPLA 3X17A 3H1ZA 1ORSB 2NXYB 5I1HH 1VFBA 3QK0A 4HIJB 4DVRH 4DKEH 2DQGH 1T2KD 1P2CB 1I1YB 1Z3RA 3JTTA 4JKPL 1DVUA 5B1BB 5BXFB 4NNYA 1KC5L 4TQPA 1S7TB 1AGEB 1SXAA 2DJSA 1G1IA 2WQWA 3G6JF 1YNTA 3NIGE 1IEAA 4Y9FA 4YE4H 5DJCB 5I5IA 1KFAH 1W2KT 1KTRL 4JQIA 2HVKA 1YN6B 3T5WA 3FQRB 4UQ9A 1LEGA 1HYRC 3I6GB 4NLHA 3UTZA 4ZMPA 3CCHB 1HTLC 3GSXA 5D72H 2QVIA 2J2ZB 3MBED 1MG2C 5GS1B 3NGBC 2A0LC 1VZHA 2BVPA 2OMTA 4R4LA 1PDKB 3L74D 3UO1H 4K0OA 4P9MH 4I2LC 4PWIA 1IAIM 2C0XA 4HIPA 5F89B 1E4XH 3HAEB 3HMXH 3TZVD 4BZ1H 2AEFA 4L23A 1KG0B 5E9AA 1JHTA 5FUCE 3UDWA 2E56A 2CA3A 2WSKA 4OF3A 1T22A 3ULVF 3Q5PA 3S0PA 1T0NB 2E7CA 2WSSH 1F4XL 3VFWA 1JZDC 3PAYA 3I3EA 1U3ZA 1NHLA 5FYKE 4MNQD 3AU0A 3FF8A 1IFHH 4N4YB 5CCHD 1DUYB 1JNNH 1ZHKB 4KI5E 4AV4A 3UTOA 3HE6C 1CFNA 5HD8D 3RZCC 3L3OB 1GK6A 3BP5B 4XP4H 4WWID 4N2FA 1WRGA 1SQPJ 1JK8A 3D05A 3TA3A 5AB2A 5E5UB 4XP5L 5KJ7E 1NTMD 2V7NA 5CJOH 2H6PA 3ALPA 4M6OL 2M2DA 1P7QA 4BZ1A 2FT8A 3S36X 2HYMA 4XNUH 4WI0B 2CR3A 5DK0B 2J1ZA 3WEBA 5CIPB 5LDSA 4J2XA 3EFGA 2GJ6D 3LH2L 4P3DB 1OANA 3T0AA 3MRQB 4NQCB 1W8EA 4XO9A 5FW8A 3ROOB 1YN7A 2OMZB 2VLME 4BH8A 1LP9F 3ARDD 3T0DA 3C6LB 4FL4C 2G75A 2ZUYA 3S3DB 5F7AA 3L74J 1D9KD 1RJLB 1FC1A 3MJ6A 1RFDL 3DJRA 3ZKXC 1FVDA 4N2IA 3WUWB 5CD3A 1NKGA 5E5LA 1KGJA 2VQ4A 2MKLC 5DVMA 3TN0B 3UH8A 1A6VL 3BUPA 3K0YA 3D69A 4LCUB 4QIRA 1R24B 1KYUA 1IKFH 1YYLH 1T7YA 2XY2A 4DZBA 1ACXA 5ACZA 1KULA 2C9QA 2QFPA 2Z8WC 3DXAA 3NIGF 4DK6A 4UB6H 1ZTXH 5GSRA 3ECBB 3OZLA 3QO1A 4B6ZA 2NYKA 1DLFL 2DQUH 1VKXA 3A6BL 5T3ZH 4EBQH 1OHQA 4G1EA 5KVGL 3VD2A 3LSOB 3I02B 3IE4A 3GPEA 3QFDB 3P9MB 2C3XA 4JPZB 1XF2B 5DJDA 1I1AB 2QPSA 1JRHH 3F65A 2DLEA 3VXOB 5T1LD 1KXQA 2E5TA 4B9PA 4AEEA 3L5IA 3MRBB 4MJ6B 3MRFA 1UT1A 1AKPA 2R5BA 5DD1L 1PIFA 4F7EA 1IC4H 3T09A 1RK1B 5IB2A 3TO4D 2W6BA 2VRKA 2YQ3A 3TBVB 3TJEH 4GSRA 4RMRA 4Y89A 2DQCH 2B87B 3V0AC 1CXLA 3AS1A 4KZEH 1EVUA 4J3OG 4L8SC 5IB5B 5BNXD 5EA0L 2A74B 2TAAA 1HH6A 3AREA 5A40E 1A7QL 3MODH 3HE5A 4QXUH 3BIKB 3ZIMA 2FBWC 3VYIA 4RFEA 5DHVB 2DWEA 4HUKB 5FGSA 3CIAA 2WYTA 4MNGA 2WB7A 5DR5L 2KERA 1FNAA 1KFNA 2LU3A 1EAPA 3X11A 5IV2B 4YXLL 1IZNB 1QBBA 2GITB 3VFOB 3T2OA 2WVTA 5DEJA 1GTFA 4WFHD 1DDHA 1VLXA 2ERJC 3S8WA 5KAIH 5C0BD 2PTTB 1NGYA 5F7LB 3JWDL 4NQTA 1U36A 1XGRB 4OF7A 4P9HH 3UO8B 4M8QB 1NAML 5IG7A 1A3ZA 5T3XL 2FECL 3QQDB 2GTWB 5H37H 1TCRB 4X6CE 2R69A 4KJPC 5E2WL 2JDIH 2FIRT 4M6ML 3VI3B 1U8CB 2NY3B 4TUJA 4OZIB 3EW3B 2QZQA 2VDKL 4R7NB 3T6XA 2OX5B 2AV7A 4M7ZB 4FMFA 4KNTA 2ZXGA 1JY3O 1JD9A 3I6LD 2Z4EA 1EJ6A 3IDMA 4PBXA 1EIBA 1A9BB 4XPBL 2YQBA 3CD4A 1OAYL 4ZZKA 4OJYA 4MJ5A 2EH7H 5I1AB 2GABA 3SKNA 1EO7A 5BZZA 1UKSA 3NCBB 5DZLA 5HJ3A 1H6EA 2F9BT 2DQIH 3UMNA 1GMEA 1KT2B 5T1JA 3SQOL 2C4FU 1BAFH 2LR2A 2WW8A 4YBLB 1NUDA 2BY2A 3HKFA 1WAPA 5KBKA 3O4LA 4AGLA 3V4LA 2V3EA 3FJTA 3NMEA 4FMVA 4IGBB 1N68A 4Z95H 4ZUSB 3CMGA 3ZZLA 2C8NA 5LQBH 2OMUB 5KSBB 5LXGH 2K6ZA 3GSNL 2WQYC 1HQRB 3AUVA 4ZUWA 4I77H 3F58L 1FCGA 3JTSB 2AAVA 5E2VL 1KWGA 2WSCH 5GSVB 4Z7NE 4MXWL 2J6WA 4Q9CA 4TUUA 5E4EC 3F62A 4YSSA 2WLLB 1A2YB 4F58L 3DMMA 3CFMA 4AW7A 1L7TL 5TFSH 4EVNA 2NMSA 5ISZA 1HNGA 3QJFB 5KTEH 3BZEA 3S9OA 5DVKA 4JQXA 4LARH 2OYKA 4NNPL 5TQ2L 1YEDA 4RA3A 4MWFB 4EI5D 4L4VA 5F0LB 1SOSA 2YKOA 4LF3B 4RGNC 3QFJE 3NJKA 2AJZA 3HE4B 1ZTMA 1I4FA 4UV7H 3IF1A 4XCCH 3BWUC 5SWQA 4E42A 1HHGA 4K5LA 1IFRA 4JS7A 1X5KA 3E0GA 3GTNA 3RGVD 1C16A 3WJMB 2D4FA 12E8H 3IJHB 1MXDA 1FH5H 1WGOA 5AUMA 1CLCA 3K8LA 4R0LA 5JHAA 1L0LE 5IOPA 4JFUA 5AB9A 5E99L 3QGVA 1A7NH 5EORH 2Z31C 1ZLUH 1YNTF 4ODUA 3FRUA 3PWNA 3B3IB 2MEJB 1KCKA 3C8KA 2BHFA 5GZNC 2QTEA 3KWXA 4WFFD 5DJ2B 3RFZB 1WBXA 4H8WL 4J3SA 5E5MB 3VXMB 4FZ8H 4WDIA 2XFXB 2EQDA 3MA7B 5FOBA 3H1HD 4E36A 4M1GH 3SGEI 1QSFB 4CSZA 1KYOI 3KGSA 1UB5A 4WU5B 4GG8A 2HMIC 3KVDD 4GIFA 3AADB 5J1AB 3FQNA 3USSA 2H26A 4YBHA 1MJ8L 1I7TA 5KLVK 3ARTA 3EZJB 1INEH 3MLSL 1CD1A 4WY4C 2ARJA 1X9VA 4ZAKA 1E2ZA 4ODTH 4B9KC 2VLRB 2JB5H 2NNFA 1ZSDB 5HDOA 3O8ZA 3EBGA 1RIVL 3VSVA 1PZSA 3OKNA 4DHLA 1YITP 1EHLL 3EGSB 1MFCL 1N64H 2E46A 4UB6E 1ZTXE 3R1GH 1DH3A 1UGKA 5KYWA 5JMOC 4DOHE 2WT7B 4JM2B 2DB8A 4O58L 4HOXA 5T3ZE 3ZE1B 4Z23A 1C5DB 1FSKB 4R2GD 1URIA 1ZLVH 4QUOA 1Y6KR 5FUZH 3W11C 2X87A 4PJEA 5L88L 1SGKA 2QQQA 1X5JA 3ILQD 3UX9B 3C1LA 3MYJB 1VQKP 4OUOA 1GMIA 2C3VA 4YIQA 4ZTEA 3VXNB 4U2ZA 4QOKE 4HKBB 3ZDZE 2A6DA 1CFVL 4MD4A 4Q9RL 4MMZA 4B9ZA 3ZL2A 1X5FA 5C6TH 1J5DA 3C5JA 4X9FA 4IDLA 1XIWB 5L8RJ 4H2AA 3V0VA 3U4BH 1Q2NA 3H9ZA 5FUCC 1TZAA 4G8EB 3O6MH 1Q4NX 3FT9A 4NI3A 3RIAK 1F1DA 1F18A 2BNUB 4PPTA 2CRMA 3BVNA 1G94A 1XZWA 3GXMA 4K3EH 1QO3A 5DK3A 3W39B 3WIAA 4FHKA 2ZIDA 4KHXH 4W9JC 5AG9A 2CAKA 2HG5B 3P30H 4C57C 3U6RA 4KI5C 4HUUA 4CVUA 2FL5B 3DX0A 4UIMA 1KBGH 2AKRA 4LCVA 3ZKND 3MSPA 1ZA3A 1NTZD 2YD8A 4C46A 2B9AA 2OYHC 1T6AA 3B7SA 3B56A 3FCUB 4U1SA 2GSMB 3W3BA 3JUYA 5L4FA 2XBTA 3MRIB 1ZY9A 5KAIE 3R18A 1OK8A 4XBMA 1WFJA 3HR6A 3CWBJ 1DJIA 1K4DB 1OGAE 2BM3A 4CC4A 4UT6L 4FQXA 2CLRB 1BMGA 2X4NB 2EXYD 4JRYB 4A7SA 5C0AD 3SBRA 1IGYB 4FNSA 1LEKB 2MPAH 1J5HA 4KROB 3WFBL 2XN2A 1H3WM 3GSRA 4Y4HB 5DO2C 1ZGLA 1EDYA 2EDRA 1ASOA 4N0UB 1KC8Q 3BKCL 3CVIL 3LNFA 3MRDB 3MYZA 4N3UA 3HZVB 2NY7L 3FO9A 4AMXA 4LT7A 1WAAE 4BXLA 2EINB 3DBSA 4GB9A 3QYMA 5BOJA 5BMFL 1J1PL 4R4BB 3GBML 4WJG3 4OLWL 1OGPA 2GIYA 3CHRA 3WY3A 2OMBA 4O2CA 3D18B 3H1KD 5CS7A 3SDDD 3BRTB 1FAKT 3M91A 3OMAB 4ISVB 3INOA 4HJIA 2E75B 1HWGB 3AT0A 3KPTA 4PJFB 1LD9B 2VLLA 5AD0A 3OHXC 4HUVA 1XCQB 3GB7A 4NKIL 5BVJB 4CKVX 3NJXA 3EOBB 3R0MA 4GBXA 5E4OA 2BSSA 3RDTC 5SWSD 4YTPC 4G3YH 1S7RA 1AR1B 2ZUQC 4ODWA 5IIEA 5D7HA 1DFBL 5HI3D 4QRTA 4NJ9H 2NX5B 3O4OB 3LN5A 3A21A 2IPTL 2CCLA 3ZT6A 1MFEH 4PMFA 3X13B 1RSYA 1MJ7L 2JLLA 4ZI8A 2XWBA 2ZOKA 1UT2A 2XBDA 4N1CA 5F1IB 4P46C 4WWKC 3VXUA 2AEIT 4MZ2A 3T04D 5K59E 8FABB 3V6OA 3JT0A 1GK4A 5F71A 4HU2A 1G0YR 1T66C 2OSWA 4QTFA 2VAAA 2Q6WA 2J4WL 4XMWA 1GL2B 4HBQA 4AYGA 4AL8L 3V0FA 5HVGB 1TNNA 2D7PA 4KMTL 4ODBD 4PRNA 4Y2DB 4NLAA 1JGLH 3QZNA 1P9MC 3CLQA 3FFCA 4PN6A 2ZP8A 4DP7X 3U46B 3KNBB 4PRHB 4B3EA 3RVWC 2OMWB 4UOW0 2C9XA 2RCSL 1JWMA 3K2UL 4NBYB 5E79H 4R4FH 3LKSA 1P84J 1AQKL 3WV0A 4V11A 2EDQA 2BK8A 2Y1VA 3P3RA 1F6FB 1Z9SA 2IBZX 1QBML 1HL4A 2AAAA 2AQ3A 3LZRA 2O6DA 3S8FB 3LKPA 3VD3A 3GIZH 5B8CC 5HDWA 1R3IL 2CXKA 1EEYA 1NOAA 3JZ7A 3LIEA 5E8OB 1QFUH 2ZOLB 3T4AC 3EGXA 3VE0A 3WLWC 3CVHB 3FN0H 1QABA 1MCOH 4IEFB 1MLBA 4P4KD 1OVRA 4Z3HA 2ADYA 1HZLA 1G7LB 2NY0D 4FQ2H 4DQAA 1KIRB 4GEJA 3KCPA 4EZJA 5DC2A 2OYMA 1BQHB 1U58A 3COOA 3KPSD 3GMQB 3Q5RA 1AIFA 1NAMB 3FXDA 2PRRA 4G8GB 1KYOD 3SJVA 4BZ2L 1UIIA 3BCCE 2ZKHL 1VCBC 3ARBD 4YL4A 1M1XB 1G1JA 4FTVE 1VZGA 5IMKA 3Q8BA 4RMQA 2VDKB 2H2SD 4PGDA 4M3LA 4YNYA 2ZYSA 5MEQA 3GHGB 3B2UD 4C56B 3IDNA 2DL9A 4WK4B 5IFAH 5D1XA 1FN4A 4P5MB 3PGCA 1JF1A 4DAGL 4WUUA 3GG2A 4IL6H 1NUGA 4L8DA 3HAEH 3NZUA 1URQA 1QEWA 3ZE2F 1EZLA 1JXJA 4U05A 5MENE 1JY3P 2ENSA 3STLA 5E6IA 2FYNB 3LHAA 2GY5A 2ZAGA 1PGRB 3FONB 4BXSV 3VWJB 1DN0A 2N0KA 3FT2B 3MLTA 4PB9H 3QEQE 4XVUD 5C7ZA 1TJGL 3KPQB 3RIFF 3AECC 2GK0B 3RVUC 1M71A 1INDL 3I75B 3S5LB 1NIBA 1AP2B 2IEPA 4XAWL 7TAAA 1A7PL 1HQ4B 4Y5YC 1V54B 3H1LD 1MAMH 1X7TA 3NIDF 4QGTA 3ARGD 5JPNC 3RWCA 4HK0A 1NBVH 5C2UB 1MZ9A 1S7VB 4ZX4A 3GSNB 3RL1B 1I8KB 4NX0A 4PREB 3UEQA 1LYQA 1F90H 4XOEA 5HGAA 5GRYA 2ARJQ 1MRCH 1AE6L 5E1GA 2M3BA 2PCPB 2NNXA 1JG9A 1KYOJ 2FE0A 3GMOB 3UBHA 1DYZA 3E7KA 3HZMA 1RK0A 3N1GC 4Z3GA 1TQWA 4PD4I 1NM9A 4GO8A 4DGWC 1ZHLB 4P5RA 2NY5L 3KBHE 3QAZC 5GIRB 1JPGB 2PYEB 2FYUK 5CJQL 5J89A 1VQMP 1F58H 3H6PA 1AVAA 1NFAA 2D3NA 4LLMA 1U57A 2Z8RA 3VFTB 3WL9A 1NGWB 3BRVB 1B0IA 5E6YA 1FFTB 5I8CB 1CLYL 3PDDA 1N6UA 4JL1A 4F9LA 3AY4A 3N06B 3MUHL 1ZIAA 2ENQA 2IWEA 4P3CL 1BSNA 2K9UA 3EH1A 3HI6H 4A68A 4E5XG 2UXGA 4X4YB 2XZRA 1J1OL 1ZOYC 3LNGA 4JDTH 1P7HL 3K6NA 4PJEF 3BPNB 1E0OB 4MJID 2N1TB 3IWVA 2AXFA 1F6AA 3MX0B 4JFFB 1T04B 1RIHL 4LSVH 2H1PL 3SKJL 3WFDH 3UAEA 3CZFA 2LXCB 2B9BA 5CBEB 5FO8A 5J5EA 2YMTA 4HISA 1BJ1J 5KOVC 2R0LH 3B2VH 1F6LL 1HINH 3E1RA 3HC3L 3PDGA 2VUYA 4BKTC 2FEDD 5DQJA 1G7IA 4GXUN 3FWNA 4KC3B 3T97A 3SY0B 3IMVA 4NPFX 2BY1A 3DX8B 5DRXB 4HCRH 3WYRA 2IC2A 3LRKA 1C12B 4J3OH 5AKSA 3U0TB 1RJYB 1U8HA 4ZMOA 4D94A 3EYFA 4JFVA 4XMLL 1JY2N 4NXSA 2A83A 5D4HA 2B3IA 5EWIH 1OP3H 3HZYB 3WNIA 4LKCA 5JORA 4C55A 1KENL 2VWEE 1HN1A 4OQTH 5DJAA 1CGYA 3L16A 3MRRB 2EO1A 1MCBA 3WAJA 2VKWA 2MRYA 1L7IL 1INQA 4LSPH 4Q9QL 4L3ED 1TU2B 4TLSA 1N70A 1S46A 1LP1A 2YBGA 4HD9A 5DHVH 5C08A 3U9PL 1WO2A 4ASWA 2YIHA 4YDKH 4B7IA 2Q8AH 1O7DC 4L0ZA 5BVZA 1UH4A 5AW3B 1AGBB 5GRVL 3SDXA 5L8KB 2HRGA 3D39D 4HCRA 1CDUA 4K35A 3U4EB 5CEXA 2TRHA 2EC9U 4IBWA 4NRZA 2A1WL 1NLDH 4BV1A 2NNAB 3H1JG 5B38G 1J7VR 5D2NC 3BDYH 2HP4A 4XNYL 5KLVG 3L3JA 5FF6B 3MDJA 5F96L 3QNYA 1KJMB 3SGDI 2PW2A 1BWMA 5I30H 3ESUF 2DIAA 1CL7I 4M3HA 3EYOA 4WHTA 3I6KB 1UM4L 5E79E 4ZMNA 2WNXA 4I3RH 4U49A 3PWPA 4FE9A 4M5ZL 1XH3B 2YIUC 4UT9A 5JHMA 4HJJH 1XF5A 2DQDL 3KBPA 2H7WA 3LB6D 5B22A 4DP9X 3HI1A 4BA8A 4AYMC 2OMYB 3FQUA 3HFML 3RL0B 3BQUA 1KPUA 5GS3A 3AG3B 4GOEA 3L7EB 2F7IA 5D1XE 3KYNB 3NFSL 4P9HC 4H25B 5JUEH 5A7EA 2QSCH 2YD7A 1QTYT 1RMFL 3EO0B 3L08A 3EWKA 1EMTH 2BDNH 4G71B 4OJAA 1IVTA 4JDEB 4Y16A 3B5NA 2K9JA 3F89A 3CLEL 3DIFB 2ZYAA 2LVCA 2ADJB 1FIGL 3G4SP 1MCPL 2XSKA 4F33A 2DYPB 1S7SB 2EO7A 2OMXA 4M5YL 3BJ91 3VFSA 1WFIA 1RP9A 4U1MB 4ABWA 2G2RA 4LBEA 4LHUA 2XWRA 1XT5A 3AE1C 1WCBA 3O2WL 1YEIH 1SOQA 3OR7A 5EOQL 1IKNA 1DJHA 4MA7H 3QWOA 3V0DA 1EH9A 1FOSE 3KXFA 3U79A 1U8OA 4NRYB 1EXGA 1SEBA 2ATPA 1ZHBB 2AV1B 4HFUH 3PP4L 4XPAL 2OARA 4AENA 2YBRB 4NC0B 1C9SA 2KOGA 2GI7A 2CPUA 4G6JL 1ZXGA 2Y9RT 5I26A 3LHPL 3WFCL 1B4TA 3EG9A 1W6LA 4IOFC 2B1HL 3CUPB 5B4MD 5INDA 1NWOA 1B6DA 1JSYA 5GGQL 5MP6L 1QYGL 3MTRA 4HHGA 3NCFB 1RK7A 4NJAH 4S1QH 2HLAB 2YS4A 1NIDA 1M2VA 4EAEA 2V8MA 4U33A 1CWVA 1XTCC 2QFRA 5DJUB 1N10A 3MBWB 4QRUA 3VVVA 2RJMA 5ENWB 2YEZA 4PGJA 4F1ZA 1F02I 4Y4KC 5BS0A 3NJMA 2QTVA 3VG0H 4CILA 2VR9A 3D09A 1CT8A 2CK2A 3RVXC 3OJ2C 5DTFA 5ETUA 3LRLA 3H1IG 5AW5B 1ZEAL 2JIXB 5T1DL 1A6TA 3CSGA 4LLUA 1SYVA 4JR9L 1JZHA 2BCCJ 1DBKL 3D3VB 1X5IA 3T6QC 2Y5EA 1I7UB 1QLRA 4PLOB 2AK1L 2W0KA 1G2CB 4IU3B 5F97E 5CLYA 4PD4D 1ZMEC 3L9BA 3C6SB 1RZGA 4GRWB 2XTJB 3ECUA 3QJXA 4R5XA 3T0XA 4GSUA 5F44A 4B3VA 5FAAA 1OE3A 3MNVA 3K5RA 4NQCE 2FX9L 5F9DC 2QVAA 4NKDB 2GBUA 1EZUA 3EJQA 2DOCA 3ZDXF 1XGYH 4WNQB 4E41D 2VAJA 4LPTA 3US0A 3UZEC 4Z8FL 3CK0H 4AE0A 1ZMYA 3HE6A 2IFMA 1DVZA 3IJ7A 3RZCA 2ICEC 4QJ4B 1OPGL 3U0PB 3BPCB 5J13B 1CFBA 5E8NA 1CFSA 5GRWA 4F8LA 4HWZA 4D6TG 1RD6A 2YD1A 3DGGA 1L0PA 4IRSB 1TG8A 3ZYOA 1CU4H 3VFGH 1CYWA 1FOSF 1G9MH 3BZ4B 3RU8H 1VHPA 4ETYA 1JNLH 4M61B 4FJZA 4LSSL 1B4JL 1AZRA 4O2EB 5C08E 1SFCA 3BKYH 4GRMA 4IRJC 5F9OH 2XWXA 4ZMDA 4JFXA 3BAIA 4PLKD 3G5WA 1A14L 4XBGB 5E2JA 1P5VA 4IMKC 3VYPA 5KEZA 1QLED 4NQVA 2P80D 1GHFL 1GJWA 3HE7C 3WU1A 3SDXE 3UCQA 4NO3A 1EGJH 1T1YA 4L37A 3OKDB 4PGEA 2AJXL 1JWUB 3RVTC 1THCA 4M62H 4LLVA 1DBMH 3NAAL 2QJKC 2W27A 2AEQH 1FZCB 1GZQA 5BUGA 1YY9C 3IN2A 4PB0L 2X4OB 4QT5B 4ZZFA 2R4SL 1U8KA 5I8OL 2XN1A 2ZT9D 3L72G 3UTSB 4U0RB 3CQPA 2BP5M 1EZSA 1U91A 3P0VH 1L9MA 2C9PA 5IMLA 1RUAH 3CGTA 2DEYX 4MZIA 1T1ZA 1WA2X 3PWPE 4OCNC 1G43A 2QQLL 5DS1A 1OAUH 4UOJA 4OKVA 1O75A 3C5ZC 3DJSA 3U2IA 2EYTB 5J12C 5FEBA 1MF2L 2Y07H 1OZHA 2OPCA 4M02A 4TVUA 4NWUL 3DOHA 2DS4A 3FSAA 3UBGA 4U6HB 5E8DH 4JPKH 1JY2O 2I69A 3MGTB 1XEDA 1BIIA 1FWXA 3MOBH 3QG6B 1JERA 4G11A 4P5TB 4KJYA 1JMZA 4FYRA 4WNJA 2V4LA 3MHZA 3DETD 1MIMH 3IMUA 4G9FB 3OQ3B 2GUOB 3NH7H 2Z1KA 1Z9LA 4KKRA 5KSVB 2V9TA 4FFWD 3VI3E 3NUKA 4LCCC 4OZIE 3U9WA 3O6FA 4Y19E 4L8SA 4N0FB 5H4YA 5HI4C 1A6WH 3ZGIA 1XGPB 3CHXA 2BS8A 1IE4A 2VMEA 5D93B 4ILDA 5FV1L 4AVKA 3BRDA 2UXTA 2N4IA 2Z4TA 3FB6B 3OMIB 2UZIL 4QAMB 1FRGH 1TVHA 4F57L 1QGKB 2Q76B 3ZMEA 3QWRA 1AOHA 3MR9B 2ZXXA 5T1MB 1P1ZB 5F7DA 2OXHB 2CUHA 4ONFL 1KOAA 5C1MB 4BWNA 1E9PB 4MNQB 1OZTG 4XMVA 4IS6B 3I3BA 4F37F 5CJ4A 5KSUB 1EDKA 3DHMA 1FHNA 1M9WA 3MHVA 3ES6A 5C0EA 2YO3A 3CXFA 2QJYB 5L4IA 3SDXF 3TS8A 4J3OF 2Q86A 4EF3A 3IFLH 3CHOA 5IVZB 4OTXL 1Q0XL 1N5YL 5KSBE 3BCDA 4LCWA 2FR4A 2A5UA 5FA4B 3VD0A 3ZZQA 3SDAD 4L8CA 3BW9B 5D1QA 4FNLL 3QJQB 1NOHA 1ZR4A 3HPJB 4JREB 1KEGL 4YHMH 3IAGC 2CGZA 3CHPA 2BY0A 35C8L 2FYUG 1ACYL 3PGDA 1JTHB 2QDWA 1JB0J 3J2PA 4GH7B 2VWEC 4YQXH 4MD5A 2NSXA 1BCCE 2K78A 2WY3B 4AUYA 2HLOA 2Q8BH 5C8JB 3G5YB 5D6CA 3ARDB 1T83C 2WNGA 1KIPB 4KJWD 4B7LA 5TE6L 1L0QA 3Q43A 5I76A 1D9KB 1A3RL 4A66A 3QIBC 2OK0H 2BIIA 2MMXA 2Q7YB 3V55A 1A1NB 3KL0A 1E9QB 1QLFB 1FORH 1IGFL 3V4PA 3CFBB 1R0AL 4AJYV 2NY4C 3S3CB 1SBSH 3HBZA 3ZT5A 3G5ZB 2VRQA 3DJZA 4ZDHA 4WO4C 2XRAL 3TLRA 2OTUA 3QRGL 2AERT 2I7OA 3F3HA 3O8XD 2WM0A 3KWWB 5FB8B 2BIHA 1HEJC 3CVHH 4B95C 1A6UL 3QO0A 5T33H 4PJ8D 4MXVE 3SBQA 4PRPB 2BS9A 5EO0A 4LOUC 1E5BA 2EYSB 1J1DB 3CCRP 1SOKA 4P59L 1IU1A 3AQDA 4JFDA 4HH9B 2C0WA 2XIIA 5IM7B 3GXDA 2O61B 1IC0A 2D2CD 5I73C 1QR1B 1DEEB 2AXWA 4LNRA 1IBYA 2NW3B 2YMXH 1MHCA 3AY2A 2HX7A 3PDOB 4GEIA 3HZKB 3GDBA 4P2CG 5EZOL 2CRYA 1ET8A 3W38A 2AK4A 2X89A 3TO4B 3MOAL 1QSFE 3F7YB 4ZXBD 2VZUA 3D4ZA 1Y7VA 4LLWB 2LHAA 2RFXA 1MFNA 1O9ZA 5EF3A 1MHHA 4HS6B 4AQ1C 3FL7A 3IDJA 3VD7A 3LIZL 2FWUA 3IU3A 4Q58C 3U1PA 2ZKWA 3PHOA 5E94B 2YC1B 4EDXA 3ABMB 2DDQH 4BIKA 4EEEA 3GIVB 5ALCH 3GSWB 2VN6A 2VOTA 4LVOB 3PHQB 2DBJA 2XXCB 5CCJA 4WJKB 2XV3A 1TDQA 3T8VA 1HHHA 1OW6A 1KF9B 3FT4B 2ADGA 4PRDA 1QVGO 2E9JA 5IKCA 2Q9IA 4Y5XA 2NXYC 1GAFL 2ZAIA 3V5KB 5KAQF 3QI9A 2VLKD 4UNTA 3BKJL 4P2QD 4LL9A 1WK0A 1MLCB 1HHKA 1YEJH 3DX7A 2WQAA 3OLGA 4HXBH 4Z7WA 3TF7C 1OO2A 1AS6A 4LFHG 4AZ8B 5GZNA 4BYHA 3F8UB 2QSIA 3L70J 3OTTA 3MV8A 2QR0A 4LAQL 2HB0A 3WN5B 2X3CA 3B2DC 5GS1C 4HV8A 4TMPA 2AJYH 4AI7A 4DKTA 4ZFGL 3K8MA 2HLFD 4K7FB 3ZPDA 3AMKA 1TZGL 4UTAA 1EZVG 5GXBB 1HXKA 2X4RB 2XZZA 3MP7B 3BEWB 2W0LA 3AEDC 1NTKJ 4WY4A 3N44B 3HKZA 4AIEA 5EU3B 5IVNA 3QG7H 2JP3A 3APFA 5CMAB 3NCYP 2XPGA 3UAJA 3ZX1A 4XPFL 3FYIB 3RWFA 2VH5L 2ZXDA 2YAFA 3LRSB 1M6OA 2W9DL 5F0JB 5CGBA 1NAKL 4Z77B 1XTGB 2MWCA 5HY9B 5LN8A 4MXVF 4H8QA 3L3OC 4AW4A 3QR2A 2F68X 2XQBL 4PCKA 3FDWA 4URTB 4NHUA 2EEXA 4R7XA 5L8LB 4I18B 4IBVA 4W4OA 5M7QA 5GISL 3TPUA 4ANWA 5HGHB 1NGMB 1K3ZA 3WIFA 3E9TA 3GF7A 1U8MB 2FCBA 5DFAA 5TE7H 4OD2A 4XI5C 1OCWL 2WTRA 3BASA 1M1JB 3MV9D 3GJFB 1UJTA 2EDMA 4HS3B 3MRLB 4X98A 1K72A 1OTUC 1Y07A 5DZVA 1BYPA 4K3HA 3SKMB 3L7FA 5CLZA 4LOEA 4PGBB 4N0UE 4YEFA 1KB3A 4LCWE 3C6LC 4NPYB 2HA1A 1A6ZB 1RQ5A 4E5XA 3HUJA 5ABDE 5D1QE 3TO2A 2IPKB 2Y3NA 3FU7B 4QHKI 4ZS6D 4ZODA 5HHVH 3H0TA 3TN0C 4LSDA 4JN2A 3TNNA 1OY3B 3ILEA 1OAQH 4N5EC 5HYJA 3AG2B 1FZFA 3RJQB 2R4RL 4RJTA 1AXSB 5ID1A 3H3PH 3LKRB 3NABL 1JPSL 4PJFE 3EOAB 1BGYD 1O7SA 4YH6A 1BV8A 3U7WL 5ID0A 4ES9A 3SWYA 1U8JA 1OTTD 2B4CH 4L3CB 4I1RA 3RGVB 1FYTB 3B83A 3NP4A 3P2DA 3D6YA 4NP9A 4ZFFA 4FFYH 4G7YH 1C5BH 3L3IA 1N5AA 3PWUA 2WWWA 4KKCC 1X5XA 1F4YL 5L2KA 1KILD 4FKKA 2Z5HA 3E1ZA 1I1AC 5DMIL 5DMKB 4UINH 5F1NA 1YG9A 3M7OA 5CJXC 4YHOH 2H9GB 2HUEA 3FTGA 5DQDL 1ZGLP 1I9IL 2LAAA 4YSRA 3C75A 4U3HA 2CCWA 3OKEA 1KELL 5CP7A 4WSKA 2J44A 3OLIA 4RZCB 4U3FE 1SQBG 4HKXB 1CGSL 4KRLB 1ETZB 4CJ0A 2K8MA 2APFA 3MLVH 4JCLA 3OAYK 3IN0A 2YAOA 1YECL 1FVEB 3QUKA 4ALAL 3BQVA 1L4AD 4N90D 1I8MA 2Z92A 3MN8A 3OHXA 2A74C 3IETA 4Z7UB 1SQMA 3MLRH 4ZFOB 2MHAB 3Q8CA 4HIQA 2VZVA 1OAXL 3GLAA 3HC4H 4PRHE 1XWVA 2PXYA 1Y18A 3HG1B 2J1KA 3GLDA 2ZUVA 1CG9B 4MD0B 4F7MB 5ADOH 3ZQ9A 1A25A 3CFJA 4Z7IA 2WAQA 4HKJA 1BGYJ 2GB2A 4FG6D 4I87A 4AYID 3HNVL 1WD8A 3ZL1A 5EH1A 4P46A 3GFUA 4XWOC 4HFWA 4R2GB 4X6BA 3AZUA 3SPVB 3L1OH 3L6FA 5INCB 1YYML 2X3AA 4NZTH 2ORBH 2Y23A 4ZS7L 5JIDA 3HMWL 1VQLP 1Z5YD 4O5LL 1MCNA 4MJJA 2F7PA 2NY3C 4GW1A 3SBPA 5MERB 32C2B 1MKMA 4GAJL 2CHWA 1LO3L 5I8KL 5KUMA 1XH0A 3VGFA 4D8PA 1MKFA 2X53A 2XN9A 3NA4A 4M7ZC 1Q94A 3CQQA 4OLUL 1LTJA 4P4RB 1N6QL 1CW5A 1CF8L 1NJ9B 3QNXA 2O5ZH 1J8SA 4RMVA 1K8DA 3NCXA 4XOAA 1FZJA 1U9KA 2X1WL 4ZKUA 3TIEB 3STZA