5AVTB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avtB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avtB02
3HE4A 2P2UA 3V4QA 5AW2B 3A3YB 3M9HA 2QM8A 4HYTB 1CI6A 5AVWB 1GD2E 3VTPC 1IO4A 5APWA 1MFZA 1CSBA 3V4WA 3KQGA 1GK4A 5AVVB 5AVQB 5AVXB 4EOTA 5AW6B 2WPSA 2ZXEB 2H7HA 3A7OA 3VYIA 3V5BA 3M0AA 2WT7A 3P32A 3NTNA 2Q5UA 3NXSA 5AW1B 4B86A 2R3CA 4KHXA 1FOSF 2XU6A 3L35A 5APSA 4C7NB 2Z5IA 2WPQA 5APXA 3L37A 2W6AA 5AW8B 5CMZA 2C9NY 2P67A 3KDPB 5AVUB 3P8MC 2WPRA 1H88A 5AW0B 1DH3A 2E42A 4XE5B 5AVSB 3VMYA 2R32A 3T97A 4DZOA 2JJLA 1CZQA 1HWTC 1JUNA 2ZFCA 4LC1A 2P7JA 4I6MC 2WTYA 1GU4A 3WGUB 2E43A 3MGNA 3M9BA 3NFQA 5AVRB 3VMZA 1SLQA 1NAFA 3M91A 1GTWA 3HTKA 3IR9A 3SWFA 3WGVB 3LIEA 5AVYB 3TK1A 3VMXA 1S9KE 5AW3B 1T2KC 1MV8A 3M0DA 2YO3A 1JNMA 4I2LC 1CI6B 5APTA 1X8YA 1T2KD 2YO2A 1KQLA 3HE5A 1HUCA 3OAKA 5AVZB 4M3LA 3A2AA 2WT7B 5APUA 4RETB 5AVTB 1GU5A 3TYYA 2N9BA 1OXZA 4GKGA 1SP4A 1FOSE 1A02F 1A02J 3L36A 3TNUB 1YYCA 5AW5B 4AQRD 1H8AA 2KP8A 1HJBA 2W27A 5AW9B 2BASA 2XZRA 3I5CA 5APYA 1MUUA 3HE4B 2Q7CA 3B8EB 5AW4B 3VN0A 3UIAA 3TNUA 2IPPA 3MD0A 2R5BA 1HBWA 2YNYA 2Z5HA 1GK6A 3LIDA 1J2JB 3A5TA 1FAVA 4JYBA 4C7NA 1OWAA 3HE5B 4GT1A 5AW7B 5APQA 4C46A 2R5DA 1G2CB 3P7KA 2Q3IA 3NMDA 3O8ZA 1NWQA 1H89A 4JYCA 2C9LY 4AUWA 4AYCA 1GZLA 5APVA 3M06A 2VRSA 2WWWA 2QM7A 2XV5A 1S9KD 4RESB
chains in the Genus database with same CATH superfamily
1YZZA 3T08A 1I1CA 2ZYIA 4MNQD 5B1JC 1UJ3B 3KL3A 3VFNB 1MJ7H 1S7SA 4N0CC 4U2ZA 3C8DA 4YEEA 5AOZA 4Y9GA 1SXNA 2BP8A 4L8BB 1EMTH 4HWEL 3L1GA 1A0QH 2D03L 1VFAA 3RGHA 4PJEE 3UJIH 1WT5C 2A6KA 3ULUF 3U0WH 1QBBA 1FZCA 2WNXA 3HMWH 2K8QA 5EOTA 4NAMA 2X2YA 5HJBA 1QPKA 3G9RA 3DBXA 1HHKB 4G6MH 2Y5QA 1TETH 1HVVA 2J59M 1UFUA 1PYWB 4IU3A 3M07A 4ZUTA 4ZMZA 1JVKA 2YPLE 3IBOA 4RWYH 1KTBA 3L3GB 4APQA 5H4YA 3GSXB 3FKUS 3WTVA 3I2CH 5F7FA 3RHWF 3LHPL 3MV9D 5JDSA 3P77B 3IJHA 1NEZA 1ORQA 2QKIB 3V7MA 2F7OA 4PIRF 2FYUE 2K1AA 3NIGB 1GS6X 3HE6A 4ISVB 4IRZH 4WUUA 1CDBA 2ICWI 3BAXA 3FL7A 1VQ4P 3PGCB 3T4AA 3AE7C 5D2LA 4HPOH 3CQPA 4N2EA 4C57C 2FXOA 5I1HL 5I1JH 4MB1A 3RX7A 3ZQ9A 1BJ8A 4RGMB 1NGMB 4JBSA 4BFFA 3VWJC 3STLA 3GDCA 2QQKL 1KGUA 5DQJB 4KKPA 5DRXB 5B3JE 4LLMB 4LRNH 3Q7JA 4QY8A 2FYNB 2V17L 3DX0A 3MUUA 4GW5B 3W9EB 4WTZG 5DD6B 3S37X 4MN4C 4H5SA 4ZFOB 2NT0A 5GGSA 4L3CB 1NFKA 4DKDC 4G6FB 1RZIB 2IXQB 2IH3A 1YEDB 3L4XA 2E5EA 4HQQL 5F0LB 1C5DA 1NCIA 5B1BB 1AQTA 1SQVG 3TO2B 3ZKNC 3DJ9A 4XGZB 4ELKA 4NQXB 5HY9B 1AD0B 4M1CD 3GM8A 3V0WH 4S10A 2IDCA 2PYEA 2WAHA 2FGWL 2X3AA 3M17A 4KQ0A 4WSKA 2C26A 4JZNA 4GO9A 4YS4A 1XH1A 4AW7A 2BIQA 4UOW0 4OD1H 5EUOA 2QMJA 1LVEA 2CLVA 1JXKA 2K4WA 3TPUA 3NP3A 3VM5A 1UJTA 4OCYL 3UZEA 1QL2A 5H37A 1DYZA 1PZ2A 2BHUA 3B6SB 1LGVA 2V7NA 1EX0A 2DWSA 4ODUB 4UNUA 4FNSA 5DEGB 3S98A 1LE5B 3WJLA 1JIBA 4PRAB 2A6DA 3O45B 4YHZL 2PYFA 4XVSL 2P48B 2XNXA 5D4QA 3T3MB 3D34A 2OYLA 4W7ZA 2B7DT 2GHZA 4HWUA 4PG2A 1QSED 1ECZA 3PFUA 5BO1L 5DJZA 1FJPA 2DYPB 5FKPA 4Q6YA 2ALAA 1UA3A 4DP1X 1KN4L 2FYUD 2YIHA 1XR9A 2JKTM 5IW6A 2VDLL 3LRGA 3OAZH 4PRNB 3CXHH 2ZWNA 5DK0A 5KZCB 2EE9A 1DLFH 3BDXA 1IC2A 5DD6A 1W8OA 3WCYA 1F6FB 2F0CA 1N59B 2PR9A 3Q05A 2GJ6A 4FFZL 1Z9LA 1PP9E 4FXGB 4N0UA 2EEAA 5T1DL 4DFHA 1DBBL 1AC6A 2Z8WC 4D0BB 1BHGA 3SE3C 3H42L 1OP3K 1QI4A 1AO7B 3Q3GB 3RJOA 4Z7AA 2QLVB 3TO4B 5CHXA 2VH5L 2DQDL 4F1ZA 4XCCL 1JK9A 3W5NA 1LE9A 2V5MA 2EDOA 3ABVC 1A7QL 3O3DB 2JLPA 4XPFL 1PG7L 4YSQA 2CLVB 1D6EB 1FL3B 2VN7A 2ZXAA 3VFUB 4X5XB 4POYA 1TR7A 3DVFA 4K3DH 4KZCA 2LLGA 2NNAA 1YEJH 4M3KB 4ZPTB 4ABWA 1S3JA 5I1KH 3BP6B 2DKUA 3KBHE 4MJIE 5C0EA 4D9QE 2E7MA 1EGJA 4DOHB 1KELL 3KPOB 2O3JA 3U4KA 3UPRA 3APNA 3CCSP 3MO1A 3SZKC 4DT2A 1JPTH 3IJSB 2E75C 1UG9A 2R29A 3MBWB 4IFFA 4WEBL 3SDAA 3U7WL 5TE7H 1KEMH 4U1IB 3INUL 3H3BC 3CX5E 1EEZB 4I18C 4AEIH 2L7UA 4AGPA 1J1XL 4ZW3A 3HC0B 1JMMA 3IAOA 4Q4EA 4M8QB 5HYJD 5DJAA 4ZFZA 1SLUA 1TNMA 4YDJB 1XR9B 5IW6B 2IWGA 1IIKA 3AREA 4W70A 1IGIH 4Z7WB 5J13C 1KLFA 4OLVH 4Y7MA 5LJYH 4A7VA 4QMEA 2H1PH 4N8UA 2VDQH 4OLZH 4WJG3 1FU1A 4K7PY 1ZHLB 4ORGB 1TVBA 3G08B 1YCSA 1JWUB 3VWJA 2RFXA 1MFMA 2DL9A 1YJDC 2D9QB 5HJ3A 1XHHA 2X9WA 4Z7WE 2R2HB 4GQQA 3EYSH 4NC1C 1XF5B 1G7IA 3VG0L 1YHQP 1UZ6E 4R3SA 4WHCA 4MD4A 5DRZB 3R4YA 3ZTJG 3VU2A 3T3ME 5GZOD 1EUUA 3WTWA 3LIZL 3QIUC 1N3NB 2C7FA 4P4KD 1WCBA 1A3RL 1A8ZA 2EE6A 4GXUN 4JDEB 2F8IA 4GUPA 3SQBA 2IOIA 1FFRA 2RQEA 1KMGA 2E7HA 4AVHA 1JCVA 4E9VA 3Q1MA 5GS0D 1XCWA 4OLYL 1RU9H 2CUHA 4YSPA 3C5ZB 1KYOD 1JVLA 3ARTA 2VLJA 3MROB 4MA7L 5BZXA 4L3EE 2WW8A 1UM4L 3CCRP 3KWXA 4S2SA 3ZYIA 1MUJB 3F7VB 5EORH 3UMNA 4B9PA 2ZJSE 1U2CA 3I9IA 3ILPB 1M71A 1MKFA 4AZUA 4D6TE 1YN6A 2P42B 4PVNA 1UXWB 5AW2B 2WVUA 2DKMA 1Y9BA 1WYJA 3WUZA 3NABL 5MEOA 2YAHA 1OAZL 2XFGB 4Z7WF 4HXBL 4G2AA 5DHEA 4UV7L 2ZQKA 4F33B 2MKWA 4FLSA 1H3VA 3VD7A 1LTTC 1NLDH 4QAWA 3QG6A 4NS0A 1MHCA 1UZ6F 3LKSA 1I9JL 2P5PA 5F1OB 3UERA 4AZ8B 4DUVA 4GRLB 4CMMA 3P9LA 3LIZA 4LLDA 3V6IA 4TSAL 1KB9I 1OY3B 4N1EA 2EDWA 4HULB 3VTAA 4W7YA 1X6NA 2P28B 2WAQA 2WKLA 2YQBA 2O6EA 5GRUH 1HEHC 1KYOJ 4XA4A 1FSKB 4KKAD 2A0LC 3N5AA 3O8XA 4D2NA 1EVUA 4V2CB 3MSPA 4DEUA 4XPAH 3OXSA 5GSVB 1EBPA 4HSAC 1INQB 2E7BA 2W8ZA 2ZSVB 2K7QA 5CF3A 5KBPA 1XD0A 1QKZH 4HIQA 1CE6A 2JQAA 1JHLL 2VJ8A 2YA0A 3KLLA 4A7TA 2DBJA 1CD1B 1SN2A 1CFTA 3WNJA 1SZNA 3BQUA 5F21B 2ILLA 3AT0A 1LO3H 3H32A 3HCVA 4IU2B 2DJSA 1IGCH 1EZSA 1OQXA 3AACA 4W6YB 1OAUL 5DFVC 2VLLA 3GO1H 2H6OA 4PJCF 3P0GB 3MRNB 5ITBL 5EF1A 3SYCA 4DPRA 5AW3B 3QRGH 3HD7D 3I6GB 3PDOA 4WWNA 2EDKA 4I89A 1AGFB 4GS7B 2AJZB 4HIHB 5EBLA 4BXLA 1UASA 1NIBA 4E2OA 4F8OA 4PBDA 5EU6E 4ZMVA 5FR3A 4ODSH 4P2RE 1PKQE 1VCBC 3MI6A 4OZFH 2Z92A 3IXAB 3L4ZA 1OPOA 4NT6B 4YZWA 3B2UD 3RGVA 3UGXA 1Z9SA 1GMJA 3MRPA 5EOQH 5I17A 3H7BB 2B14A 1PY9A 2R51A 3CQFA 5ENWA 5CEZH 4WQOA 1BGXL 2XCMC 4JPSA 1YQ3C 4OJFH 4IOIA 3PWVA 3ZL1A 4RFNC 4M7LT 3EGSB 2WSCJ 4OFPA 3AXLA 5KVEE 5EFIA 2HODB 1YSOA 4OT1H 1IC7L 2Z35B 2A0LD 4MDIB 3AEBC 1MY7A 3BLPX 3KCPB 4HGWA 5I8CA 4JG1H 1FDIA 4AYSA 3Q2LA 3ULVC 3SO3B 2V2XB 3C6LA 3GXTA 2IZ1A 2WSKA 1HCYA 3MRRB 4U1IA 2ZF8A 3ZU8A 1LO0L 1LWUB 3MRHA 1NU1J 3OC5A 5K9JL 5EA0L 5KW9L 3WIHL 4B0MB 1SHMA 1OSZA 5CO1A 3ZKMC 1AQDA 3SKOA 1QW9A 3LN9A 1IM3D 1V5JA 1L4AC 5SX5K 3ZT6A 4Z76A 2QM7A 1QSFD 1BM7A 4URKA 1FFTB 3CLEH 5B7EA 2OYPA 1LQBC 5JW5A 5KJ7C 2Q8BH 2HLAA 5I5MA 3S2CA 2OMUB 3S9OA 3H1LE 2KT6A 3NUKA 3ZE0B 2C9PA 1L7TH 2FIKA 1PX4A 3L81A 4JPQA 1NJ9A 4X5PA 3U0TB 1ZLUH 5IFAL 1MQ8A 2WQVA 4L4VD 2JKVA 1EDJA 1LEIB 3ERXA 3FH7A 5I1DA 4AL8L 3OKNA 5IQMA 2ZPKL 4JX0A 2FD6H 4MJ2A 5JLZB 4QYOA 5KANG 3C08H 3QXWA 5CWSB 4C7NB 1BMZA 1LO2H 3L8QA 1CBVH 4Y4KC 1NWOA 1NDGB 3GPEA 4F57L 1JZEA 4UM9B 3VTMA 2OAAA 5LAXA 2XTJB 2HTKC 1XCXA 4QTHB 4XWOC 2WTRA 4ZODA 2O5YL 1MSPA 3CXHE 1E65A 1HHIB 3QQ4B 1L9PA 2BZ7A 4X7DC 4YNYA 5DZAA 5FFOA 3VA2C 2XVLA 3MXWL 4AKQA 1OARL 4E41E 4GSXA 1SMAA 3N06B 5CZRA 5EUOE 3IGUA 1ML0A 1ZV9A 4RDQF 2Z0BA 4UQ3B 1ZSDA 3LCYA 1U3HA 4NQCD 3LRLA 1YQ4C 3AXHA 1DANU 1TJIH 2X4OB 3O0RH 4PJIB 3QI9D 4Y4HA 3ZTCC 2IFFH 3GWJA 5ABDE 5KYXB 1KYAA 5KUMA 5AVYB 2JCCF 1N7SC 1YYLL 1KJMA 4RDQG 3TXAA 4A1RA 2E7LC 1XH3A 2VXVL 4QXTB 4MAUH 5KJ7D 3DJZA 5CKGA 4K3AA 3SQOL 3F65A 5HVFB 3GSVB 1A64A 3VNYA 2EVHA 3D33A 4PTUB 2CWRA 1N2DC 2FEEI 2ZNXA 4YEFA 1VL2A 3F89A 1F3RB 3IMRA 1NCDL 1BGYD 1EDHA 2A5UA 4CU8A 2VYRE 1NMBL 1OAJA 1CI3M 5MHSE 4Z7UE 1C9SA 3T0DA 4DIXA 3TZVD 3OR6A 5IT2L 1LWJA 1VQNP 5INDA 3KYKL 5DR5H 4AWJC 4AJWA 3PH0A 4N2NA 2VLMD 4PRDB 3WYRA 3HG1A 2DMKA 3H1HD 3GSQA 1AGFA 4TT3H 1GDTA 2Y0DA 2DQIL 2NNFA 2ZPKH 3QNZA 4GP5B 2WZ7A 3DBSA 1NBQA 1Q0YH 2HJLB 4D9RE 4FCHA 3EOAA 5AW7B 3CZFB 4HFUH 3SWYA 2JTDA 2C9XA 3FGAD 2CR0A 1T3FB 2NXZB 4F24A 1MCEA 3U1QA 1NC4A 5D70H 1L6PA 4A63A 2PCXA 2NXZC 4JL1A 1XZWA 1K2DB 5J6GA 4OFQA 4I77H 1NEZG 1EXHA 4KV5E 5BV7H 2ZXQA 4X5RA 2FWLB 1R5LA 4Y4FC 1D7BA 1DBKH 4LKCB 2HR3A 4UU9A 5KTEH 3KQGA 2JF1A 2A6IA 1NPJA 1FORL 1H19A 4G5AA 5KYUB 5FAAA 3E6FA 3PF2A 2G0LA 3CFCH 2A06D 4GAGH 5SV3A 3RUGA 2Y0EA 4B6ZA 2DIBA 1S5LE 3D25A 3RVVD 2YN5A 2AXFA 4ZMAT 3QWOB 4L5FE 3ULVE 1H3TA 2KH2B 2WSCH 5GGTA 2APSA 4U1JA 2GJ6D 4QXVA 5I74C 3UG4A 4YLCA 1BZ8A 1P84I 3F2LA 3JWOC 5CCGD 5C7XL 3Q2YA 3QFDB 1FWXA 4UYQA 5AAWC 5HYQA 4YR6A 1G4RA 3WFDH 1IO4C 5FO2A 3WIFA 3EG9B 2IWKA 3PGFL 2F54A 1FVCA 1VQKP 5DMGC 2RH0A 3CFQA 3EYVA 3FO1A 2YMKA 1WBYB 3Q5OA 4HFWB 4IEFA 4MVBD 5BUPA 3JV5A 4Q9BA 4PRPD 1T03L 1ZGLA 3MBEB 2NY6C 4O9HH 4QRAA 1NTZD 1TNNA 2EH8L 4Y1SA 1CVSC 1TFHA 3CFEA 1IM9B 2GFBB 4NPKA 4LSRH 1F97A 5T1MB 1YECH 3LRSB 1FPTH 3FUNA 1W72A 5CCHC 1SM3H 1USQA 2ZIDA 5T5FL 1P6FA 1S7VB 3GSNB 1U3HD 3L5XL 4LCWE 3CHRA 4NQCA 4NZRH 5I23A 1PLCA 2YBGA 2K45A 1I1AD 3H1KJ 2QQLL 3UOAB 4NWUL 3M0DA 1MVYA 1AIZA 2JKXA 4L9LA 4NRYB 5TGBA 4KKLD 4PGBA 4GW1B 4ZPTA 4DN4H 5CJXA 4OIIL 1T2KD 3LS5H 4ZUSA 1OTSC 2Y1ZA 2XDHA 1J05A 2ZOWA 4LGPB 2V3EA 3QUYD 5E5MA 1WJ3A 1X5HA 2V2TA 4WI5A 3N44B 5EC2B 2J20A 2C9QA 3LKPA 3OB0K 5TQ2H 2IFMA 4GG6F 4PBVC 2IH9A 1MREL 1ETJA 4IL6X 1SQQG 3BAEH 3IETB 4MBRA 4PUBL 4JFPB 3G5XB 1PLGL 4H26A 4WHTA 5DUJA 4W93A 1MZZA 1S5IH 3UBHA 5CCGC 1HZHL 4JFED 3RNQA 4PJBF 3UO1H 4I5BA 1SQPG 1KLFB 3VSUA 3U1AA 1G6RB 1BGYG 3ASOB 3FFDA 4NFCA 1UIIA 3SBQA 1EMTL 3WHXB 4HWEH 1OOAA 3A6BH 2AQRA 5LGJB 4XNBA 3R19A 5EFWB 4MS8D 4M6NL 1U8HA 4PM1A 3GXPA 1IAKB 2DM7A 3PLYA 1FZAA 2F53B 1NGZA 4XPBL 4IRSC 5JQHC 2AK4E 5F89B 3FSVA 4C55A 4XRCA 2G4EA 1CI6A 3BPCA 3RI5F 2LU3A 3WTUA 2Q2LA 4DOHE 4TV3A 5AVVB 2P8PB 4N68A 2ZXBA 2X2JA 4RCAA 5AALA 2BCKB 4P9HH 4ZUWA 3T3MF 4CMHC 3EYQC 4IBUA 4PV8A 4MCYB 3IAPA 5B3JF 4J3XA 1HXKA 4LF3B 1IFGA 2C3WA 5IQ7L 1C08B 2RD0A 4L0ZA 4P5RA 4L3EA 3GMRA 2G2RB 3P0VL 4QT5A 5APXA 1M05B 2VOTA 3IWVA 1CTMA 2BIHA 4LVHC 2YFNA 4OB5H 4X6CF 4GP8B 2E7DA 3D5OF 4L8DB 5JPMC 1QAWA 3O6FB 1DH3A 4GKNB 4PBWD 1TVDA 4W9CC 3UZVA 5DS8B 1TJHH 4O58H 4OY9A 4Z7VB 3L3OC 1N2RB 2OZ4H 4BJLA 2WOYA 2GBTA 4G9DB 4CC4C 3LEXB 5E1HB 1BZDA 1NCCL 3BT0A 2VDQL 2X41A 2Y2TA 4OLZL 1ZV5A 4U2YA 4JM4L 2XQYG 3RWDA 1K3IA 1OKEA 3G6DL 3IB4A 4HS6B 4U7KA 2PFXA 4CN6A 5D7SH 3MJ6A 4HH8A 1TQWA 5C3IA 3ML9A 5LGJA 4HH2A 1V7NL 4NJ9H 2NPLX 3NIGF 4IIQB 1OT1A 1E40A 1PD1A 3FQRB 1B4JH 2GUOB 1U21A 3UJJH 4PJEF 1FCCA 2ZOKB 2IO5A 2GTWB 4KI1A 5TE6H 3BP4A 4Y16C 3GZOA 1LEGA 3MC0A 1KBBA 2DICA 5HGDA 2IANA 4ICWA 3RGBA 3KGSA 3RKPA 5E2TL 5E8PA 5HDBB 2OV0A 2AEJA 1VQLP 3WMSA 2ZYRA 4MJHA 5KSBF 4X6CB 3WEMA 2POHA 4HGKC 4PD4H 1DDTA 1U3JA 2EQDA 2ZOLB 3C60D 4I0PB 4YHZH 3ULUC 3C5ZA 4ZOAA 3PDGA 1SYSB 2NQ3A 3CFIC 3S5ZA 3OF6A 1PZUB 2EDNA 3D69B 3VXQB 4M4RA 4F20A 5M1BA 1A9VA 2GI0A 1AZUA 1A2YB 1DQJA 3FULA 5CP3H 4N2MA 1E5ZA 5F8QC 5JIDA 5EZPA 2H5UA 5D2NB 1Y47A 7CGTA 1FZGA 1G1KA 2YAPA 1A9EB 4JDVA 1JHTB 2BEZF 3EFOB 4OUOA 5D93B 1U42A 5HI4C 3DKHA 3H6JA 2FQEA 2ZCKL 2XIBA 3ARWA 4H8VA 3QXAB 1AV1A 4LKXA 3ZIMA 3H3PL 1BZ7B 5L8LB 3GSWB 4UTAL 5T1MA 3SDYH 5IB1A 1B6DA 3P0VH 4LLWA 3BLKA 1WZ1L 3II3A 1HE7A 5F0JB 3PHAA 4OGXL 1KDIA 5FGBA 5LNDA 5SWSD 3RL1B 5TFSL 4JBZA 2I85A 1MOEA 2X53A 2XWDA 2P80D 2NY0B 3R4DA 5IHUH 1R9FA 1A1NB 4BH8A 3F85A 5I9QC 1URLA 4GRWE 3WE1A 3S5LA 3WS3B 2PPAA 4KJYA 5I1HH 1J05B 5CJXC 4F7EA 6FABL 1YQVL 4HUVA 5C0BA 4Y5VC 1NFDE 1VCAA 1BVNT 2FBWC 4POUB 3WUWG 3P32A 1CLVA 2APXA 3BN9C 3DO3A 4LOFA 4TTDC 2VR5A 5EIIB 4UAOC 1L6ZA 2KDYA 1CLCA 3EYFA 5SWSE 3IYLW 4XNUL 2EDHA 5EOCJ 1VSCA 1KGJA 8PAZA 1DIPA 1N19A 1VFUA 1X79B 2IXQA 2O1AA 3PNRB 4FYSA 2V0AA 3AS3A 4HISA 3P11H 1JY3N 5CJBA 3S37L 4LK4A 1HJ0A 1T89C 4RNRB 2P9RA 3BW9A 3MBEA 1M6UA 2BNRE 4PQXA 2BVPB 4QXGH 1OAXH 3U1SH 1DEDA 5BV7B 4X6FB 3BFOA 1Y8AA 3V2AR 4JQIL 5EBMA 6CGTA 3VGAC 2NZ9C 3AB0B 2VZVA 4JFYB 3PGCA 5F9AC 1XB3A 4FFZA 3FHEA 3CMEP 3EOTL 4WY4D 4WB4A 4MJ5A 5H2BA 1LILA 3S96A 4URTB 3DHJA 2MQCA 5JORB 2FYUK 1P7QB 3JBG7 1EFXD 1XTLA 2F58L 4YUEL 3THML 4QHMA 1NCJA 3QJUB 5KVMC 1AIFA 4X6CE 5MP6H 3MJ8B 4IK6A 4QY8B 2ICES 1URQC 3DGGA 4OCSH 1YEIL 4WI0A 1NTMJ 1IVLA 1G0XA 2WUBH 3FSZA 4S1SH 5EF0A 4A38A 3SFEC 1HXMA 1ZA6A 2OP4H 2QADB 2A6KB 3LXUX 4J1UA 5FKPB 2R0LL 2YLKA 1QQDA 5JYLA 3QORB 2G2RA 4QT5B 4GRWF 3MOBL 2UZXA 1A65A 3FO1B 1MLCB 3B2UC 3BD4A 5ICXA 2J1KA 1GPOL 1OP4A 3QEUA 2EO9A 1NFIA 4U1LA 3KWWB 4BBWA 5B8CC 3K2UL 2OR9L 4OM0L 3GZQA 4KKBD 1TJXA 2X5PA 3B6SA 3IN2A 1ZOXA 4HJGH 1X7QB 5CINH 5HHNA 3KWUA 2R23B 3MUGA 4WY7H 1AQ8A 4EEEA 4DZ8B 3L72E 1HXYA 1PAMA 4HSQA 5EU6D 1B9ZA 2V7QJ 1OP3H 1KMIZ 5FGCE 3OJMB 4NKQB 5APVA 4PRHB 2X4SA 1UJ3A 1S4XA 3VFNA 1RPUA 3ISRA 1A3LL 1DO6A 2C1OA 3BH8A 5H94B 3GKZA 3DTDA 5I1KL 4WJ5A 3Q13A 1DJHA 3QULB 5DFWH 2QKSA 4I1PA 1MCWM 4UT6A 5F1SA 3QH3A 2HKHH 2IH3B 2UUDH 5EN2B 3RWFB 4DP0X 2XA3A 2H6UA 3DECA 1ET5A 1KBVA 3VRIB 3LOWA 3FUIA 1FG2A 1DVQA 2YPVH 4WTZA 9PCYA 3IGFA 2VXUL 5BMFH 2OX5B 3GBDA 5C70A 4LU5L 5GQBA 5C0BD 3CZSA 2CGRL 3BP5B 5FUZH 2MQ3A 3QDMD 5EU7E 3MXWH 4GY4A 1QKZL 1QQDB 1ZA3B 4OFVA 1J86A 2KSEA 4K5NA 2K9FB 1UM5L 1JF1A 2OQQA 4Z7QF 4AQ8C 4ZTEA 3OJVC 5CLZA 2D03H 4E5XG 5F1NA 3BUYB 4OLVL 3SD5A 4ZFOL 4JY5H 5B8CA 1BFTA 3GMAA 2H1PL 3KLDA 2PO6A 2KL6A 1QP1A 4LP5A 5FO7A 3M1CA 4UV4H 1MJJA 3BZDA 3BVVA 3I6LE 2R15A 3EHBD 4Z7QE 1N8ZB 4N0FB 2OSYA 4OZ4A 1SF5A 1JOCA 3A4FA 1K8DB 5A6MA 1CZ8L 1TQTA 3FQRA 3BUTA 4F7EB 5GISH 1FCGA 4UB6H 1CDYA 5IBLD 3O11A 3RUGE 3TWYA 4BZ2A 5I18L 5EOTB 4FNPA 1F00I 1YYML 3BZFA 4TSBL 4XHJC 2CA3A 3NSDA 4YVNA 2HT4D 1SFHA 2V5TA 1R3HB 4PRHD 4WIQA 5GTIH 2FYYB 4PJDA 4QTIL 3I75A 5F6HI 1V55B 2WSFJ 3ATDA 1AKJB 3PWJA 1T6AA 2C3VB 4JM2B 2Q3EA 2F54D 2HYNA 1L0NG 3RK3C 3GLAA 2BOLA 3BW9B 4NPDA 4LIQL 3DOSA 5CINL 3H1IG 1RZ8B 2QPFA 3CVHA 2ALWA 3JV4A 3M6DA 3OKMA 3T0XA 2ADJB 3TBSA 4YFLF 2VERA 3D08A 1NA8A 3QHFH 5F7WC 2H89C 3HNTH 1KJ3H 1SLWA 3BVNA 2PUQT 1KJ2B 3F12B 4UZSA 1FNGB 4LP4A 4TVUA 4EI5B 5L2JA 2DQIH 4F15C 4LEBA 3HRZB 4X8XA 3CC7P 3HUSC 1JHTA 1MAML 3EFOA 4H8HA 2BP0B 2Z31A 3GS0A 4A68A 2YBRB 3MRKB 2JE8A 4Y5YC 3WD5L 1UH3A 5DJCA 1FE8H 3A4AA 4ODHL 1KQGB 5F1NB 3RDTB 5H4ZA 4ZXBA 1OAZH 4JUSA 1NUGA 3B3IA 1JV2B 4HUXB 4Z1PA 2A9NL 4Z5RB 3QUYA 3WFZA 1CLZH 3IE9A 4I77L 3BVUA 2CO2A 3EHBB 3WOVA 1ND0B 3E6HA 3GINA 2R44A 1MVUB 4X7TA 1GKOA 1WH0A 3ARBA 2GM4A 1ZHNB 3CXHJ 3FCSA 4QJ5B 1LP9A 2HFGL 1EXUA 5IBLC 2H3NA 3R8BB 3SJVD 5JOEA 2XWTB 4L0PB 1QATA 4MSWB 5JPNA 3CZFA 4RFNB 1FC2D 4KMQA 3STZA 3AFLA 3NZUA 3GHEL 3AREB 3WJLC 2DS4A 1X5GA 3CLFH 3A47A 3FUDA 2HRPH 2NX5D 2ARWA 1H0TA 3ESVF 3B5ND 3DYMA 4PLJC 5D2NA 1SDYA 5DDHA 3VFRA 5A7EA 3TGUE 3RK3D 1YI2P 4YAQB 3VFSB 3WFDL 5HGGS 5I18H 1GCYA 4J3UA 4J8RB 1FUNA 5FM4A 4DN3H 4UT6L 2ADIA 2GK2A 1L4AB 1VQ7P 2BNRA 2HTLD 3B2MA 4E9YA 1BX2B 4HS8H 2FHCA 4HCRA 5H35B 4Z7QB 4ADGA 2Z31B 1HEZB 2DTMH 4JFEE 3A21A 3QYCA 4P46C 4F7TB 3QA3B 4GW1A 1L9NA 4IJ3B 1T2JA 1NICA 2IWEA 4AYFB 1RXLA 3PXLA 1BIIB 3FSAA 4KTYA 5HHMB 1Z5LA 2HPOA 2B15A 3HC3L 3NOIA 4N3TA 4OVNF 2P7JA 1A1NA 2D7OA 2D0HA 4JG5A 1DSFH 1NBCA 1JK9B 2A4ZA 2VLJB 2F7IA 3ARBC 4M00A 3CSTA 3CG8A 4NNPH 3RDJA 4ZFGH 5KYNA 3CPLB 3NZSA 5E9NA 3HJ0A 3TNNA 2ITCB 5FCUL 4FADA 2YKQA 4XXWA 3EYFB 3CJJA 4KUZH 4ZRGA 3SBRA 2NR6D 3GQFA 1R3KB 3DX9B 2EACA 3RFZB 5DJXB 3UTSA 2IDUA 3D85D 2Y6SC 1BZ7A 3QUZD 4WGVB 4EUPB 2VLJE 5CLTA 3IU4L 4JFOA 1KZUB 1ACYL 1FNAA 5AYUL 4DVRH 3KWVA 3DV4A 2GEQA 2FX7L 3NQIA 3AU1A 1AOHA 5IB5A 1T0MB 2XWBB 3DVGA 5LBSL 4YO0A 1ORSB 5GGVH 2ZVOB 2LT9A 1QZ1A 2Z3FA 2YKKA 3AQDA 3QDJA 5IP4A 1U3YA 2VLME 4ZS7H 1DN2A 3V95A 1LTJA 3BUYA 3SDXA 2FYYA 2YPLD 1BD2D 2KERA 1F3DH 1VEPA 1TZAA 1EDIA 5JQ6H 5MHSD 2NTFB 4NQDB 4U3FG 2VQTA 1HHHA 1I7UB 1AFVH 3I3DA 3A5TA 3QDAA 5IFHL 1B88A 1V3KA 2OULB 2XTJE 2DQJH 4JMNA 5CEZE 4HD9A 3L6FA 5D1XA 2DPKA 2QJDA 3ZGIA 43CAA 2ZP0T 4A2FA 4GG6E 3QORA 2XHNA 3ARFD 4HEME 1CTOA 1HN1A 4XVJL 2DTML 3BKCH 3TEUA 4BWTA 4KK8D 4HK0A 5I19L 1XF4A 1DBJH 4R97B 1ZLSL 5C39A 1N7ML 3D85B 5HGHA 1OK8A 3O2DA 2E59A 3PXHA 1R24B 1VZHA 3BDBA 1FFNB 3PP4L 2BINA 4O58L 4N8CL 5C08E 2W1NA 3BIKA 2AITA 4H13D 2WT7A 2YGQA 4LQFH 5ILTH 5KKZC 3C5JA 1BYPA 2BIMA 2BW4A 5I24A 3SDAD 1CGSH 2GUOA 2ZXDA 2L3BA 2O61A 2D3VA 3QIBA 1QEWB 5I1CH 2Q10A 5TF0A 4DJGA 1U8NA 3L3DA 1D9KB 1EPFA 4L4TA 1S7TA 5DJTB 1JNJA 1C16A 2C3HA 5C0DB 1PKQA 1QR1B 1VPOH 4YC2B 5ALCH 3LRHA 3UBFA 3TYGH 4XE5B 3EO1A 3QCUL 3GTTA 1QLFB 4YSDA 5FHAL 1BSNA 2XDJA 4K3JH 4S1QH 5DD0H 2BFGA 5EO9A 3TFBA 2RAMA 1U4EA 2L7EA 4WK2B 3OW2O 3I56P 2JSFA 3CZNA 4LVNC 1KCRH 3BKYH 1B3JA 4N2KA 5GGVL 4CU6A 1T3UA 3HI1A 1G84A 5H2FH 2G3MA 2IH1B 4F27A 1OHZA 4N0RA 2NXZD 2FO1A 2AABL 3H1KD 3VWJD 5CILL 4FA8A 1IB5A 2YIUB 2YC1B 3OZ9H 2VDQB 2HVJA 3LIEA 4IRJB 3BZ4A 1FNHA 5JPNC 1F8TH 4BFIA 1UACH 1EERB 3CMGA 3FFCD 3KPRE 1KC5H 4NQEB 3RNKA 3QUXB 2IPUG 2KKQA 3OXSB 5GSVA 2GYSA 1HUCA 2HJLA 2L0DA 3IEAA 4IKNA 2ENSA 3VI4B 4XMPH 1ZD6A 4JMXA 3AMKA 4B0MM 1E9OB 1UQSA 4Q6IA 3LN5A 2AZUA 2IAMC 2Y4SA 3AADB 1EFXA 3J8F7 4FNRA 5GTHH 5E6IB 1Q81Q 2HWZL 5E5RB 3SDAB 1ZLWH 3VGDA 1D3CA 4QOKB 4TUOA 4Y5YA 4Z7UB 4CMHB 3TBBA 2NLJA 5KTBA 3QIWD 2GCYB 2JKWA 1C5BL 2OSLA 4MKMA 2DQEH 1PAZA 5EMYA 3D3VB 1NKNA 4KH9A 1G0YR 3T0EB 1BM3L 2C4FT 5FECA 5JHLL 3BVWA 5BNXD 1BAFH 2ZUVA 1N6QH 5DJYB 1D5BB 2P5EE 2EP6A 1ZXKA 1SEQL 3MBED 5AB9A 1ZVHA 4AYID 2WINB 3CVHL 3L45A 1BFVH 3PNWB 2Q3IA 2WLIB 1CGSL 4F58H 3RGVC 3O6FC 2DQHH 2K7PA 2VM9A 4X5WB 4BDVA 4ZKUA 2CKBH 2JB5H 3SSUA 1A5FL 1GOHA 4H7VA 5ITFA 4U3FD 1PCXA 2HT3D 4IRJD 1AZNA 3EYUL 4B9GA 2H9GB 1AGCB 1RZPA 4FTVD 3K6OA 4YDLB 3X13A 4F37F 2J5UA 1NUNB 3FOLA 4V33A 4QHLA 4CC1A 2X87A 4AE0A 1OT2A 1FH5L 4RQQA 1EQ7A 2GA1A 1XGTA 3LMJL 4KO7A 3FYEB 5C09E 1YMME 1TPXB 4MDJA 3H1HJ 1IZJA 1E3ZA 2I25N 3MGOB 4GEJA 1XGQA 2F6AA 3IDMA 1TYJA 3NJVA 4QTHA 3OZ9L 2OL3H 2XRAL 4WW1B 5FYLL 3ZTDC 5ISZE 3V4VA 1Z0MA 1VGKA 3DOSB 3CZJA 2FJFA 4FNUA 5IKCA 2A77L 5JHBA 4MRCA 2RCSH 4P5TA 2QHLA 3IAGC 2A45G 2AQQA 2MEJB 2W07B 1O9WA 4CGUB 1UWEH 4HXAH 4XAKE 2X1OA 2Q6QA 5C09D 4A39A 3S2AA 2FYNC 5EN3A 1OZHA 4KXBA 5C0AD 4CW1B 4KTEH 2MCG1 3TBYB 4PJGB 2GKIA 2B87B 1YNKH 2A1WH 2WINA 2P1JA 4HKZB 2E76B 1Q1JL 4HJJH 1J1OL 2FSDA 3ZE2B 4UANA 4EDXB 4IRSD 3PAUA 3BSGA 4RFOH 1MREH 5EU6A 4EPSA 5EEXA 1P84K 2R0LH 4MFHA 1GR7A 3VE0A 3T9WA 2KNCA 3KVDD 2HJKA 1HS6A 1KILE 3GSOB 2V8MA 1E67A 1M7LA 1B4TA 4NKOB 2VAAB 2V8LA 4PPTA 4JZJB 3B43A 2YO2A 3O8XB 4R2GD 2VUKA 4UU9B 4OR1A 1KGXA 3ZRCC 2E75B 3T0WA 4Q6KA 4JZJC 4Y9BA 4J3OC 1NFDF 2Y1VA 2Q86B 2WXPA 3VI3A 2RMNA 4G8GA 3ZK0A 4OD2B 5IEKB 1OANA 3P3TA 4X6EA 5L88H 3L5IA 5F3HB 2CKBL 1U8NB 3L3DB 4YBLB 2F5AL 3ETTA 1GVIA 1RUKH 3L9RA 5HYIA 3RVUC 1F11B 1ID2A 1YJNP 5EF2A 3EZ8A 4XWGH 4ZG1A 4AUYA 5FUCC 4K23L 3O2WH 3D8MA 4MWFB 4NCC1 5CEYB 4EIGB 1FH5H 3HFML 4YHNA 1X22A 4J5VA 1JZ2A 3W9DA 4MCYA 3LDBB 3SY0B 3MVSA 1S8DA 2ZKYA 1NMBH 2DD8H 5E4OA 3L70D 2AFNA 4YDVB 1JRHL 4LNVA 5EBLB 3KYKH 1XAUA 4Y0GA 3REWA 1QA9B 4A7GF 4E5XB 4BFNA 3FSWA 1UM6H 4GKZA 4P23C 3U4BH 4AQEA 5DUMH 3WKNA 1Z1WA 1BOYA 4QIRA 3VE0B 2ZUUA 3B2PA 4P05A 5IJVB 2E9JA 3BEWA 1T4WA 4XNUH 1U8HB 3TJPA 5LXVA 4PWIA 3QIUB 3TH3T 4JREB 1JWSA 3X12B 4XVUC 4L9LB 5TGBB 5BRZB 1IC5L 3PXJA 4HFUL 4EOTA 1FAIH 2O93L 1I7UA 2QSVA 3AE9C 2ITCA 2ZAGA 1Y6MR 3GZKA 3CZKA 4NQDA 5D7SL 1YTZI 1IE5A 4MZ3A 4XC1H 4DWHA 1ZT4A 5DHVB 2Y7QB 2WO4A 4BRYA 4X9YA 1FOSF 2YPKA 1B4JL 1LP9E 2OXHA 2VLKD 4Y99C 5DMIH 2UV3A 1RMFL 3GI9L 3MJWA 4M7LL 2H0PA 3PWJB 1JPEA 1VKXA 4OI9A 5I66B 2ZYSA 4FFYH 5I6NA 2WMPB 2NX5A 3BCCE 2BDNH 4M5YL 5I26A 4DEWA 4OQ1A 2XWBA 2LTQC 3LKNA 3QNFA 1PEZA 2X09A 3HHMA 5B39G 3ARZA 4LSQH 3RNQB 1SDDA 1QFPA 2Y7LA 3CSYA 4WDIA 3ARYA 4N2HA 1JK8A 3OG4B 2HG5D 5C1MB 4UTBA 1ETB1 3TNMA 2H2SD 2V3FA 3STBA 4JKNA 3VMZA 3PG2A 4J6RH 1A2YA 1TETL 4XCNA 3WEXB 4HWBL 4JFFA 2CKNA 1LTJC 3B9KB 3RE0A 1JWMA 1N6VA 5IHWA 5EUKB 2CSPA 1VF5B 2GY5A 2KLUA 3EGDA 1MWAB 2DMBA 4WW2A 4G59C 5CU5A 2OGUA 1VF5C 2XPYA 1BXXA 3PFQA 4CADA 1DQVA 3B5TA 3HFMH 1H0DB 1MAKA 1QBLH 3LH2H 3W1ZA 5F96L 3QO1A 2OMXB 3WLWD 5IQ9B 2EDBA 4HDIA 1XXFC 1J5OH 2ADFH 5I1IL 5I15L 2M3BA 3TA4D 1XCQB 5E8DL 2P7TB 3QQXA 5AZ2L 2JWAA 5EIIG 3ZVVA 1WAAF 4D7PA 2H88C 1NEUA 2HB0A 2QQLH 1YYCA 4HD5A 3NSYA 3K8LA 3FRPG 4MHHI 1WGOA 2XZZA 2PP7A 1Z7JA 3G9AB 1HWWA 3T0AA 2WQ8A 2NNRA 2ZOUA 4WFFE 2LQRA 3GJFA 3NP4A 2XOTA 1ZT7A 2WMPA 2ZT9D 1FH2A 2XYCA 3V5HA 4ZFFA 1CVRA 5BQ7A 2F8OA 4GG8B 1KXHA 2GC7C 3QNXB 1DFXA 4WY4C 2R0KL 3LXBA 4G6AD 3KR3H 4K5LA 4LASL 4ORGA 2C9LY 1FHGA 1RZ7L 2YPVL 4BQ6A 4HH9B 4UM9D 4HUMB 4OIBA 5I73C 1P6AB 3U9PL 1IL1A 3ZKQD 3X13B 3CFMA 3JWDL 2W6BA 4S0SD 1NGYB 1PPIA 1DVFA 1YEWA 3IN0A 5E8NA 5SWQB 4KKNA 2EDDA 3TVMA 3L70G 1V10A 2BHYA 5KAFE 3O3BB 3HZVA 1T0PB 4U7SA 3R06B 4X7SH 3HC2A 2PWGA 4IW4C 4HBCL 4WI8A 3SOBL 5C0JA 3VXUB 3QORD 3PHOA 1XSOA 1KBPA 2L91A 4Q4IA 2Q7NA 3IFLH 5DJYA 4NP4H 3TEZA 3MLTB 5GRVL 1T83C 2QTVA 2VJXA 1FO0L 4EI5C 4KZEL 4ZMWA 3AWGA 4AT6A 1PGPA 3B9EA 3T8MA 5HY9A 4X98A 5DVOA 4RWHA 1NKRA 1FDMA 4HWNA 3KYNA 5HPMB 4NB7A 3AM8C 3AC0A 3CE1A 4CBZA 3LZNA 3ARGD 1I1AA 1F90L 3MZTA 1E28A 1IAOA 5LCVH 1KJVB 4GW5A 4J39A 1VACA 1J0YA 2VH5H 3UCQA 2QZ5A 4FJYA 4C56E 3IJEB 5KLVG 4D8PA 3T77A 4ZFQA 2VWEE 3WAJA 3O4LA 4WFFD 1VPCA 4QWWC 1SXCA 5H37G 3RJQB 1HGZA 1BGYJ 2HFTA 3CVCA 2GTZB 3N0PB 5C6WH 4L4VE 3K8KA 3QEQA 2WB7A 4GPVA 5L6YL 5F7NC 3BT2L 3OHMB 2J4WH 4ZDHB 5IMOB 4JO3L 4PSPA 5D55A 1C8QA 4ISVA 4WK4B 1INEH 1BAGA 4W6XB 2RB8A 3VGHA 2FFDB 5KYYA 2Y7NA 5JXAH 3DX9A 3HG5A 3LQAH 3U2JA 4P3WA 4X4XA 2NUTA 1RIHH 5C0BB 1PD6A 1RZ7H 3OMZA 3UJJL 5KN5A 3IDXL 4LGDE 4QR7A 4PJGA 3PHOB 5D7EA 1OWWA 1BE3D 1EHAA 3SBWA 1QACA 4NYLA 1EXIA 2B2XH 1IK7A 2NCEA 2X2IA 4FG6D 4BQCA 1NIAA 2PPDA 3IDUA 3HBQA 3K6SB 4YK4B 4U4BA 1QWNA 2NY2C 1SHWA 3MLUL 3QRFM 1B3IA 4D0BA 4D0CA 1G7QA 2OJ1A 4OV5B 1KYDA 4WI9A 3ZSTA 4P2QD 1P4BH 4TNEA 1ICTA 4QHNB 4XZUA 1FG2B 4FA6A 2E8ZA 2J8UF 5I19H 1KYOE 2V7QH 1A4KA 1KIQB 1FAVA 1NOLA 2WYTA 1XZ0A 3HMWL 5GHWL 3SDCD 1QI5A 2HVBA 4I8DA 4CDGC 4U0QB 1WLHA 3GNML 4B27A 5APQA 3FB8A 1SBSH 4F15B 5D1ZC 5F3BA 1FBIL 4P46B 3B83A 5IIEB 2YAFA 1UM5H 2WWWA 2TAAA 3JTTA 3LHPH 5F6IB 4P07A 5LKNA 1WAAE 3ZKMD 2Z92B 3S34L 1NDMA 5E99H 3TESA 3MYJB 3FU6A 4G80B 5E6IA 3QDGB 5A2KH 1I1FA 2YOAA 5GJSH 3MACH 4JCWA 4IYKA 1XAKA 3B7SA 5DEGA 1RP9A 2G3AA 2O6CA 4FS0A 3DROB 5IM7A 1LTXA 2FIRT 2R0WH 3SGKA 1MLBA 2CO4A 3UBXG 3EW3B 3DX6A 5MEQB 3BPLB 4M5TA 4O2EA 4HGWB 2DI8A 5ALBL 5CEZD 3HG2A 3KGUA 1LT9B 3C6EA 5DJAB 4ZFZB 5FA3A 5FO9B 1UM4H 1ZIAA 4IRJA 2DW3A 4ZSOE 3NMEA 1OD7A 1ZTXH 3OLDA 2BVPA 1FNEB 3CMOL 4YDNA 3DI3B 3P40A 1YNTF 1YDPA 4AQEB 1NCTA 1CDUA 3WELA 1DEEG 4J4PA 4TMPA 3GMQA 4I2XE 4DKTA 1CZQA 3G71P 2FGWH 4CC4A 4AYGA 1F3JA 4OZIE 4P2QB 1UACL 4R0LC 5ES4B 3RWGA 4HIXL 4HUWB 3APDA 2J8HA 5IK3A 1A6AA 3SDCB 2WBJD 1NTMD 4IFDK 1CG9B 2XFXA 4DO5A 4UB0H 3LZOA 3AE2C 2A4CA 2MNWA 4EI6B 2HFFB 4ZQKA 5TDPA 4UILH 1W72L 2PR4L 1N4XL 1WC7A 3MLUH 1PLBA 4KJWD 1NCAL 3CXHD 4DQOL 5B7FA 1GL2D 3QG7L 1RERA 2I7OA 3POHA 4XO4A 5FM5O 3CX5K 3QBTB 1P4BL 4JFEB 2VC2B 3TURA 2NX5B 3GHBL 5FO8B 1AO7A 3ARDA 4NKDB 2BW5A 3BZ4B 3IVKB 5BU8B 4AL8C 3OAKA 2UWJE 1C12B 4HJEA 4G7QB 2WLHA 3H2PA 4GRMB 2CMRL 2B9AA 3JT0A 3APCA 4I4WA 2P26A 2WNWA 1AANA 5FYJU 4ECNA 1D5XA 4R6UA 1UGKA 4PYHA 4BCYA 2W60A 1NTDA 2VXQL 2DM4A 4WO4C 3NSFA 3B9KA 4WKZA 5DCCA 5JIMA 5D4HA 4XCNB 3AGWA 3WEXA 4MNHA 1LK3H 1AIFB 2HRPL 2VDPH 1L6XA 4DP4X 4GUQA 5JHAA 4NEHB 1RQ5A 5FUOL 1GJIA 1FLTX 4XVOA 5CR1A 3AUVA 1SJMA 3LKSB 4K7PL 4TQEL 2YUXA 2WXFA 2CA4A 1L9OA 5J7CC 1BE3G 2A45H 1D9KC 4LLUA 4TNFA 2DF3A 2XZCL 3IFOB 4JJHA 3WNKA 1KZYA 3L3KB 3DMMD 1UB5A 3KPMA 1L0LE 1FVDA 3ETSA 2WBJC 2X4TA 3K1DA 4K3DL 4KK9D 1RQVA 4AQ1B 2OYHA 1BGXH 3CLQA 3LRMA 3J2PA 2HUHA 1QMUA 4S2SB 4CN4A 2RTTA 1RFDH 4WDIB 5EIQA 4XP9L 7TAAA 4RO0A 3MPCA 3OR6B 3MJ7B 3OD3A 4FFVD 1QTYT 1T7YA 3U7WH 3V9EA 3SPVA 4YXHH 3CBRA 4AIZB 3K91A 3KJ6L 4XVTL 3T2NH 5EA0H 3TZVC 4XP4H 3KPQA 4KHXA 3S3CB 3IDGA 1BF8A 3VXTA 4RGOL 4KTGA 4APQC 3ILEA 2Z93A 5DXWA 2XZQH 2EDFA 3MXVH 1A02N 3P8MC 5E6IC 3V2NA 4OKVA 2AABH 1U8KA 3VGGA 1M7DB 1T89A 2EDXA 1EZLA 3EOYG 2X2HA 2AGJH 2I60L 5H37H 1J5HA 4YHYB 5HJ3B 1A4AA 4ZI8A 3HG0A 4NOBA 4JFHE 4YHYC 5LBSH 1E27B 4XXCC 1YMMB 5ESAA 1KIUB 3W38A 4NZTL 2Q9IA 5CIPA 3S7GA 1BJ1J 1BLIA 4NQDE 5HHPA 4NWTH 2CJUL 5E0FA 3V7AE 4MVBC 4KI5F 4A7QA 4G8EB 4PRIE 4Y1AA 5HYSA 3F6LA 3OKMB 3NSXA 3VB9A 2QDWA 2VQ4A 3QXTA 4HIEA 5IFJA 2HWZH 4CVUA 1QNZL 5ACLA 4IM8A 3ZDXF 1BQUA 1BDDA 4YQXH 5IJKA 1NOHA 1DQMH 3FT1A 1NZRA 4OU3A 2XC8A 3W9DB 4H13C 5LBGA 4DOJA 2YK1L 3L4WA 4XP1H 1SQPE 2WIIA 1PU0A 5I76A 2EXYD 3TV3L 4H13B 2ETWA 1I9IH 2L8AA 3RVVC 4FDWA 3ZMNA 4FFVC 1SXBA 5F1IA 1QPXA 2JIXB 3CGTA 1K6QL 3VWKA 1E28B 1S7UA 3P9MB 2OW7A 4JRXE 4O5LH 3RK2B 2DH3A 3ABZA 4OFYD 2FECL 2W59A 2FK9A 4JFFE 5EBMB 4J8QA 3E9TA 4MNQB 4X9FA 4EKXA 5LDSA 1T04A 3QPXL 1ECYA 1JXJA 4ZNCD 2ZP8A 5FGRA 3QHFL 4Z78B 2OKMA 1MVUA 4S1DD 5DUML 2Y72A 1TMCB 3VGBA 4R4NC 4Z76B 3PQYB 2PETA 3MYZA 1VLXA 4XODA 4RRPG 4F9PC 4FMFA 1TKWB 3PRZA 3WY4A 2JK5B 1NAYA 1UCTA 2K8MA 5C0EB 2VL5A 3GRWA 1T6VN 3TPKA 5FCSH 4ODHH 1E3FA 1Y18B 2J58A 2WCSA 2HG5A 4EZJA 5L2KD 3W57A 2MKLC 1OAQH 4XMLL 3L9BA 1MFAH 4LRIC 1VQ5P 4QXWA 1CLZL 2VABB 3QCUH 4MYWB 4Y19B 4PH8A 5DR5L 3SODB 4RLDA 3EGSA 4NZUL 2JQZA 1OE1A 4FLHA 1INDL 1HTLC 5B39B 4HBQA 3BGFC 5MEQA 4J3OD 2E76C 1OWRM 3L70J 1M6OB 3B37A 3B9VA 5AOLA 1KCWA 3P02A 5JPMB 4DAGH 2LU4A 4MMZA 3Q2VA 3B4NA 1KIQA 3ASNB 1Z9SB 1VB9A 3UAJA 2WN2A 4XZUB 1YA5A 3ZE1B 3BCDA 5DC4B 5CGYC 4ZFFB 1WFIA 1P7QD 4UIMA 4W6WB 3C9IA 4PCKA 3L37A 5ITBH 4UIKL 2A06E 1XL6A 5LUMA 2B1AL 4WRLA 1KJMB 3L75G 2VM4A 3QRGL 5FW7A 4E0RA 1H88A 4DKEH 3BMWA 4OJCA 4ZXBB 4HF5H 4XMWA 2F15A 3LS4L 1IAIH 4IIQC 4NBYB 4ZXBC 3WV0A 2Y0SA 3HD7A 1MHHA 2YWZA 4M48H 3MZWB 3NEOA 4RIRB 3N40P 3KLAA 4X5QA 4RFEA 2JB6A 5CFHA 1UYWL 5HGAB 3TFKC 3EUUA 2YMTA 1X5MA 4TPRL 3GIZL 3TONA 1YY8A 1OX3A 1TKWA 1TQSA 3LDBC 2Y24A 3BDYH 4QXTA 5DK2B 3OJ2C 1VHPA 2VN5A 3F62A 2KMWA 4CVWA 2E6PA 1AHMA 4E9QA 1K85A 3ROOB 1XMEB 1E9PA 2C34A 2FX9H 4R26H 4UUJB 4OD3H 3Q5RA 4Y1AD 2QJPC 1NDGA 3CTTA 2HT2D 4KI5D 4UDUA 4UM9A 4AYMC 2AAAA 1HEJC 4PGZA 3RURA 3JXAA 3L74D 2YD8A 3D18A 5B1AB 4L8CA 3ARDC 1JWMB 5KVGL 3FWLA 4NERA 5T3XE 4NNPL 3A24A 4UINH 1Q94A 4JRXB 2CO7A 1SEQH 3FB7A 4XBPA 3HKFA 1S9VB 3W11C 1AACA 5ESVA 2WGXA 4WZ9A 4F58L 1U7JA 1R3JA 2EYTB 2J8OA 4C56A 4DTGH 1ZV8A 3TZVA 2EIZB 4LLHA 3CX5D 3O4LE 3Q1SH 1YECL 2W27A 5I6KA 3OKYA 3QWOA 3I5CA 4F5CE 1OVVA 1GS8A 4KJPD 2XQBH 5CCKL 4B95C 2WVRA 3UJTH 1U8PB 2FX7H 5EO0B 1I3VA 4D9QD 4D6TD 2IZ0A 3LPGA 5DYOA 1YY9C 3SE6A 4BRVA 3V0AC 3MRGA 5JMOC 2ZWSA 1CWVA 2NY0C 3M8OH 1NL0H 4CSPA 1GYWA 1RK7A 1K2DA 4XMZA 3QYNA 4AUJA 3IMWA 3PWPA 4X4XB 4GXVL 4WK0B 3RIFF 5C0ND 1BMWA 2VLRE 1CFQA 4LVOB 3H8NA 5E4EB 3FOMB 3QDHA 4Z3IA 4I85A 4G42B 1RVFH 2KI6A 4K73A 1WIPA 5ELIA 2JV6A 3LNHA 4Y2LA 4PS3A 5JIPA 3KPSE 5DO2C 2DEYX 4OCLC 4FFYL 2A45I 4B53A 3QWRA 1X3DA 5FOBB 2E56A 1FGNL 2YN3A 3LAFA 3U2SA 4F9PA 5T5NF 1YNKL 2Y07H 4U1NA 5E8NB 2Q6WB 35C8H 3L5HA 4H0HB 1HSBB 1TYEB 3FCTB 4LSQL 1CC3A 1IBZA 2D3JA 3OC8A 4GT0A 1F0LA 1FQ9C 3KPEA 2X3CA 2IFFL 3O2VH 4OI7A 3DX1A 4X99A 4MDJB 4OD3L 4TRPL 3FB8B 4J3OG 4N0YL 5HI4D 4QEGA 4Y4HD 3BSZA 4L3EB 3CFNA 1MDTA 1JPFA 3WKPA 1IBYA 2JNZA 2ZJSH 3V6FB 2CO6A 3BWSA 3U6XA 4Z0BH 5IQNA 2ZAIA 4FQQA 1T5XA 4JO4H 3T3PF 1KCSH 3V4LA 1NH6A 4KOBA 3QS3A 2YD2A 5JOFA 4K9EH 5D7LA 3RZCD 4EBQL 3TIEB 1OE3A 3DROA 3L75D 4AEHL 1I7RB 2R56L 3QDMB 3NH7H 3CH8A 5BVPH 3T6QC 3ECBB 4S1QL 1HILB 4ZW6A 3ZHLA 2O01H 1NM4A 3F7YB 3KPQB 4NRXA 2W90A 3PY9A 2CBMA 2QADC 1XH0A 2WXRA 3HAEB 2GTWA 1WWWX 4PGCA 4RSYA 3WHXA 2KLSA 2R4SL 4HETA 1QVFO 5GZNA 1AJ7H 3JWOH 3ESMA 2NUPB 4YOKA 3N9GH 1GU5A 3N43F 1NL0L 3L54A 1WHOA 2JJUA 1WWCA 1FE6A 4R7LA 3D0AA 3RWIB 2BHZA 4AIEA 2X9YA 2Y23A 3TT1L 4AQRD 5D2LE 4OBRA 1H8AA 1HKFA 3S88H 1A1MB 1IEAA 4MD0B 3FYIB 3L74G 1OW7A 2ICCA 4TL4A 1JPSH 4PI0A 1N5YH 1I31A 2BSED 2DBLH 2FY8A 5IWLA 5D9SB 2NQDA 4GQPH 4JN2B 4NYLB 4DQAA 3RK3B 1II4E 4ASVA 5E2TH 1NFDB 3BZ5A 2RMZA 2YMYA 4C47A 2JKJA 1JGLL 3GS4A 4EOWH 3O6KL 1GL4B 1CN4A 5CCJA 5DA0B 4GAAA 1FHNA 1JZIA 5HHOD 3EJJX 3SHSA 3L1OL 4XXDA 4PJ9D 1LHZA 4NLHA 1AGCA 1VF5D 4W80A 3G5WA 4N0YH 1N8RQ 3KL5A 4G82A 2O01N 2UVEA 4OZHE 4D6TG 4B60A 5B66E 5JHLH 3MCKA 5SWZB 3TWCH 1AC0A 1MJUL 5DWUH 5APWA 2IBBA 3RDTD 3G5YA 3FUKA 4XAWH 3QZWA 1SQXG 3KWWA 3SOTA 4O00A 4N6JA 4LCIL 1LK2B 3TT3L 1P4IL 2YSSB 1F90H 2R1WB 4R4MA 3CN4A 1GC1H 1SVZA 4ODWB 1J48A 3FTUA 3OMIB 3RA7H 1T7XA 5HI5D 1KB9D 3BEVA 5TE7L 1C7TA 2ED6A 3P3YA 2N56A 1EJ6A 2OTWB 3DSNB 5CZXD 2PRRA 1MCCA 2H8PA 2WANA 4OTXH 1OAKL 1WG3A 3A23A 5L4IA 4UQDA 2VABA 5EO0A 5D1QD 4Z7NF 4HKJB 3KLSA 3VW3H 2DZEA 1F5WA 4PYGA 2CIKA 5KYWA 1NTKJ 1JUNA 3CHSA 1VKXB 1LWUC 4IFMA 3SY0A 3LN5B 4LSSH 3CFBB 3W39B 5D1ZD 5FM8A 1L0LD 2EXWD 5KJ7E 1MFVA 2FJUB 1KEGH 1E0OB 5FYLH 3GMQB 2ZYGA 1OFCX 3GJFK 4DGYL 4AH2A 3HKZA 1KN7A 1NPUA 3A5VA 3OXRB 4UZGA 1B0IA 4EXKA 5HP5A 2P5WA 3NPZB 2EUWA 4NI3A 1U93B 3EDDA 3OKLB 4JQVA 4BQBA 3T65A 1YUKB 3VGEA 1JPSL 2PXYD 1UWFA 2GITB 1R3IL 3TK1A 1YC7A 2ICEB 3EADA 2AK1L 5CBNA 2F08A 3EFDH 3Q06A 4G8GB 3JSSA 2PAJA 5FF6B 3RU8L 4KJWC 5AD0A 3EZJB 4OGYH 3U59A 3SBPA 3G3ZA 1Q0EA 4JGMA 1Q0XH 2N1KA 4ZD3H 1J1OH 3VXUD 4PG2C 5KLVK 5HHMD 2FJHB 2Q87A 3H9HB 2M83A 3U7AA 4HVBA 4LPUA 2CHDA 5F89A 5J3HD 3FU5A 4N5UA 3RRQA 3D06A 1M2VB 3QHZL 3UG5A 5L9DL 1I7TA 2KXPB 2HRHA 2W80C 3A0OA 1GYVA 1Z9MA 4YXLH 2APWA 4HAGA 3UTQB 4FXKC 2WLMA 5F9OL 3FUEA 5I8EB 1FVEA 2IDQA 4RMQA 1JY2P 1IBHA 5IMLA 3TWCL 4L4VB 1HAWA 1TLKA 4FEIA 3ROLA 1MFEL 1YVLA 3IMTA 1U57A 1NC2A 3FRPB 3NCFB 3TGUG 1YEIH 4HBCH 1RLWA 1SN5A 1PZ5B 4H44D 2V7HB 3I3BA 4XMUA 2FR4B 4S1SL 2XV6B 3LEVH 4UOQA 1H3PL 4N3UA 4JPKL 1J8RA 2UY6B 2HN7B 2EXWC 4X2UA 3QFJE 4Z7UF 2Y3NA 5SWSA 3P0YL 2PCPB 3DVIA 4YSCA 4GAFB 3AE4C 3HE7C 5D4IA 1YC8A 5E6UB 4V11A 4RGOH 3SN6N 1GPOH 3KYNB 5ECJE 5HPMA 4XNQA 4MA8H 4WV1B 4Z7WA 3C60A 1FC2C 1EDYA 1PW3A 4FZEH 3NACL 5I5JA 1OIOA 5JNYB 2X6VA 3MA9L 3PJSK 3KGTA 3TJHC 4G7RB 4ZX6A 4PVBA 3G6DH 4XO5A 1S7XA 2JFCA 5C07E 4WFGD 4QJ4B 2D2CB 3D39D 4DGVH 1NMCC 2EDQA 3BFQG 2UWEF 4KJYB 3T3PE 2A4EA 1KTMA 5DUPL 4NNYB 3MRGB 1HSAB 5CAYB 2GTZA 1RULH 2ATAA 4HC1L 5L6YH 3NTCL 2I07A 2X12A 1Q94B 3BP5A 4LFHD 4X6CA 1RI8A 4ES9A 3BWUF 1N70A 3NJXA 4N8VB 4YHNB 2AC0A 1AS8A 3T3PB 4YBHA 2Q7YA 3BXNB 4XWOD 4TOYL 2K4AA 1NM9A 1RIHL 1WDAA 4NI6A 1BXUA 3BGMB 4C4KT 1OGAD 3EF4A 5KKZB 2J1ZA 1LE9B 1ONQB 3BQUC 2F7PA 2BCCJ 4KWUA 3KZIH 4B9JA 4P2RB 4U3SB 1FNSL 5GGTL 3RL2A 3V4VL 1U2YA 1RIVL 4HKZH 6PCYA 2OYIB 1JNNL 1RUMH 3BEWB 3IJHB 1FBMA 4N0UB 3L08A 1U0QA 4U3XA 3NZHH 4MASA 3MX0A 1OTSD 3VP9A 3FPXA 4BK5C 4RNRA 1NU1D 1FJ1B 3VJ6A 2TRYA 4I2XB 5BZDB 1LTAC 1RCYA 3ATFA 3GLZA 3IPFA 1BYNA 2EZ0C 3DX2A 4KY1H 1KLGA 4HWBH 5E2WL 5HHOE 4QHPA 5KAIE 4AX3A 3ZHDA 1F02I 5FK9A 1SP4A 3M7FB 1A02F 4HIIB 3V4UL 3EOBA 1AP2B 1G6VK 1IKNC 3IBEA 4A66A 5B7MA 5IZ7A 1T20B 1XV8A 4M7ZB 4JHVA 1OP9A 1NSNH 1KXTB 3VFUA 3FT3B 4QKXB 4X5XA 4RISH 3AXIA 5IHUL 4FXLA 4ZPVB 2V5RA 3OPZL 1QX1A 1BOGA 3HS0A 4KX8A 2GJ6E 3OWRA 3EJZC 3NACH 4N1HB 1Q8MA 1UCBL 3IAQA 4B96A 1IUZA 2VKWA 3DBXB 3Q0HA 4MKTA 3TN0B 2FSEA 5E8DH 5E9AA 1ILSA 4Z18A 2JJWA 4M93B 3QUXD 3RIAK 5IFAH 1GW6A 3LVEA 3BCCJ 4GT1A 4BUQA 4R97C 2AJZA 1F6AB 2VR7A 4HIHA 4EF3A 1H89A 4G9FE 1JGVH 1RH8A 4FE9A 1S9YB 4DAGL 4JPWH 1T7VA 1ZTMA 3WNOA 4PB0L 1GMIA 1M7UA 1JYVA 4P2RA 4PAZA 5TQ0H 4ZK8A 3MODL 1LJ2A 3QJFB 4HLEA 1G9NL 1PZDA 4P46A 3WN6A 4MA1C 1GIGL 3X3GH 1BCIA 1FNFA 2UXTA 3NK4A 5BUAA 4K8RD 3CD4A 1TU2B 5C09B 4FQXA 1Z32X 4AW4A 3UAFA 1RF0C 2HLOA 2YMXH 1I3RA 3OL2A 4PP2B 1OALA 3FO2A 1CE6B 1X9LA 3QAQA 1L2PA 1D6EA 1FL3A 3ZKND 2XG5B 4M5ZH 4IJTA 2O5YH 1PDKB 2IGFL 3FXDA 2C7UB 4OF7A 5E6RB 5B38A 3QCVL 4RZCA 1OL0A 5JQIB 4NENA 1N73C 1Z3GL 4PVLA 2YEZB 2AJSH 5DQ9A 3V4VH 1CFSB 3GMNB 2GPZA 1OF2B 2D0GA 1NTZG 5SX4H 4BM7A 4L1SA 3QQ3B 4H8WC 4W9DC 3CXDL 4TUUA 2KZIA 3GXNA 2GJRA 3GSUB 3VI4E 2VR8A 43CAB 1MCIA 1Q9WA 4P5MB 1A8JH 3O8XD 1BQLH 4R2GB 1BQHA 1ZVSA 3RWFA 1YYLH 5TH2B 3MV11 4TS6A 2G60H 3TN0D 1T22B 1UT2A 1ED3A 3H54A 4TUJA 1YEFL 4DPCX 3WGUB 2R1XB 3MRPB 1PMYA 4G8AC 3N41B 3TSIA 1D5XB 2VZOA 4PJGF 5E1QA 2MSPA 1VERA 3TV3H 1J1PH 2FQDA 4LFHG 2B1HL 4QRPE 2WYZA 3HTKA 1FA4A 2PYFB 4RAUA 4WNQA 3LD8C 1GMEA 2PW1B 1S9WB 5J11B 1OB1B 4U1SA 4XZ4A 4HPOL 1MV8A 2BXZA 2PLTA 3ABLB 3TNNB 4UNVA 3NSCA 1VEMA 2FJHA 3F6IA 3ZE1F 4EN3B 2H3KA 1I1AC 3HR6A 1GGYA 4BZ1A 2NZIA 3PTZA 2UXFA 4YSOA 2BOCB 2OMWB 5I1DB 3CUPB 3F83A 5FLVA 4BHUI 2XZCH 3ULUE 2EVGA 4EUPA 3H6PA 1LP9F 3OKDA 3HVDA 1CD1A 1FVEB 1XSKA 4JFHD 4X4YA 3PWLB 4UWQB 4UBDC 4MA3B 4B41A 3VRLF 4HG4J 1QGKB 2J4WL 4FXKA 3T0BA 1T8ZA 2GK0A 3DLQR 3T0EC 1F3DJ 2ODHA 2UWEB 3BE1L 2GABA 3QEQB 3ZJAA 1I7RA 5C0JB 4LCWD 3RX8A 3RVUD 3CN1A 3IU4H 4BA8A 1JTPA 4X7CC 4PJEB 4JM0A 3KJ6H 2J6EL 3IJEA 4QD2E 4D8PB 3P7KA 2OMNA 1J9QA 1CT8A 4HS3B 4N2AA 5DC9B 5FWQA 1U3ZA 4PGEB 2DLGA 1GZLA 2YKPA 4BE6A 3DA0A 2EECA 1RZGA 1TZGL 2VW4A 2Y07L 2QPEB 2X4NB 4MS8C 3O6FD 5E95B 3CXDH 3RZCA 2FVNA 4EI6A 2HFFA 4ZQKB 2Y36H 3FN9A 1GZHC 1BQLL 4KKRA 4FG2A 4JB9H 4U1SB 2Z1PA 3DTUB 4DO6A 5I1AB 5F93C 3X1GA 2GJZA 3KLHD 1CSBA 1JZ7A 4K7PX 3W2DH 3UGUA 2CPUA 5GGRA 1GTNA 4PJDE 1XGPA 3F01A 5EBWB 2WQAA 4XVUD 2GBAA 1JEKA 1TOXA 1WHPA 3WHE0 2EUZA 4NUJA 3S34H 1QFUL 3EYQD 5CZKA 3GTVA 4XNZB 4AEFA 4YSSA 5HYSB 2XU6A 1S72P 1TQCC 2Y7MA 3AG3B 2B77A 2K9JA 2VITA 3BPNB 1MHEB 2O30A 2O6DA 3LVTA 4N6RA 3B9AA 3TBTB 1U91B 1PGRB 2I32A 3PABB 3QO0B 1CGUA 2F53D 2Z35A 3ME0B 5I75C 2DQMA 2NNXA 3R1GH 2FB4L 3L5XH 4FNLH 2QPSA 2X6BA 3LZFH 5I75B 1KJ2A 3F12A 4LCWB 2VJ0A 5DHDA 1WMKA 1HYSC 3QIUD 4XCFH 2IDFA 4BZ1L 1MFBH 1IGML 3C8VA 4EKJA 4HEPA 4W4NA 1U8IB 3SYPA 1KT2B 2M1KA 5B38B 5EZLB 5DJCB 3SKJH 5GS0C 3O4OB 4CSZA 2H8PD 3OAYH 4R8WL 3MYJA 2X4TB 3UTSD 4Y19D 4N78D 4IGBC 4EIBA 1EAPB 5FS5A 1JPTL 1S9KC 4MZ2A 2WKGA 4JJ5A 1IFHH 4BFGA 2BIIA 2P10A 1N86A 3B34A 4I18B 3BVNB 3ETBF 3N4XA 1PY4A 5ADOL 1N5YL 4ZMTA 3VXRA 5F8RC 1E6JH 2B1OA 3E8VA 3RBXA 4KH2A 3KLHC 1KB9E 2KUTA 1FS0E 5JHDB 1HNYA 2DLIA 4G8FB 4GRLD 1TZ8A 3GSVA 3ZL2A 3V6ZA 3UPCA 3L72D 1SJVA 1JDCA 2R9HD 4BGLA 2Q8BL 3SDDA 1MUUA 4W9GC 1V7ML 3QQDA 2EIBA 3VMOA 4X4ZA 5I2IA 1RZJL 1J9TA 2KZ1B 1DBAL 2PPFA 2X89A 4J4PC 3T6ZA 4F7CB 4UTBL 2EH7H 1G1YA 1MIMH 1L9MA 1WTLA 4IL6H 1X5JA 1NU1K 3VDCA 1K72A 3UTPE 1Y0LA 3SO5A 1A7BA 3OMAB 4ZTPH 5HXMA 3QJFA 4CU7A 1RZKH 3DK0A 1AXIB 2WZAA 4GKSA 3LYRA 2CCVA 1RZFH 2OR7A 3LIZH 4PGDA 2Z8VC 5TDPB 2GUSA 1G7MB 5L0QB 3WXWL 2WWMC 4IDJH 1IT9L 3QUZA 4F93B 1ZT1B 4ZMNA 1QVOB 1JE6A 3NPSC 5DJXA 3K72B 3UTSB 5IG7A 2XG4B 2XIIA 1JRHI 3GW6A 4QRFA 1A6TB 3IRZA 5KAQG 5CBEB 5JW4R 3SDCA 1JM0A 1ZDQA 5FUCE 5C0RH 3IVKA 4JFDE 2FYVA 3US9A 3LTVA 3OBAA 1BLNA 5TTRA 3N42B 3V5BA 3M0AA 3DNKA 4TNWF 4FABL 5TISH 2WBKA 2BP5M 4I3GA 4LKCA 4WY4B 4J3WA 5TF1H 2BSTA 4W68A 3BH9B 4AYDC 1LTIC 2Z91B 3NIFF 1XZ0B 3CFDA 4OGQD 2HVJB 2FUTA 4LARL 1LK2A 1BZ9A 2WLYA 3MZGB 1NC4B 2QPUA 2ZX7A 5TH2A 4EBQH 4WWOA 3DUUA 1H9DA 2NY4C 2R56H 4L29A 3FN0H 1IFMA 5HVGB 3VRJA 5CD3B 5JO5A 4GAYB 3CH1A 2X1XR 1OCRB 3GM0A 4EAEA 2WSSH 5LCVA 3QFGA 4KXZH 3VFGL 5D1QC 4HZLA 3UIZA 3F3HA 1CR9L 4MXVE 2ESVA 3JT2A 3MJ9H 3LNFA 3TA3C 1T3FA 2X6AA 5EF3A 1KYOK 1M57B 1MCFA 5FA4A 3VMXA 1IILE 3M9QA 1E8XA 1XCTB 4FLRA 4MJ6A 4AM0B 5AAWA 3D3VA 1KWKA 2N1TB 2VMEA 3UCRA 1HI6B 2F1BA 2OK0H 1R46A 2VC2L 3C5XA 3ET9F 3K7UA 1LNQA 5AYQA 3C75A 1SY6A 4Z1MH 1ADQA 3ATEA 1HL5A 1PPJD 3C5ZC 4A55A 2H32B 3OA7A 2PCFB 4FZ8H 2WCGA 1GL2A 2Q1KA 4E68A 3D0LB 2KP8A 3DDGA 4A7PA 4HC1A 3QFJB 4OGQB 1PS3A 4Y4HB 2AXJA 1T21B 3QQNA 4OGQC 3SDXF 4PI2A 3CN3A 4L8DA 1DUYA 4FMKA 1QFWI 4QRBA 3NN8A 5F0PB 3HVNA 2B0SL 3L3JB 3UTQA 1RL1A 5TFSH 5GJTL 2JB6B 2X4RB 4N8CH 3AEAC 2WUCH 3Q8EA 4MA8L 4DK3A 3FONA 2QRXA 4K8RH 2Q8AL 3L72G 1NAKH 3DX8B 4J3OH 4XN5A 2J21A 1H0DA 1MXDA 1DSWA 3EO9H 4TQ8A 4CW1A 2I27N 4Q9RL 2YXVA 1YQVH 3GUTA 2WBXA 5HHME 1CU4H 2EIMB 3N50A 4K55A 2GFBA 4OJDH 1JAEA 3KXFD 3TA3A 3UTTB 5K5YA 1OGAA 3FO9A 1IC7H 1EEYB 4Y2DA 4A37A 3J7HA 4Y5XA 4KX9A 3RAJL 1BZQK 2AW2A 1NCOA 3WJJA 3L13A 3TPUB 1M57D 3WNLA 1IAKA 3NTCH 3VXMA 3WIHH 5DF0A 1AZBA 2HLFC 2X42A 4X9GA 4BGDA 3PJSA 1KCRL 3BKYL 5JR1L 3TM6A 3FZUC 3TBWB 1VADA 2K9JB 2IAND 2VITB 1D7FA 2VZ1A 3NT0A 4ZSOB 3MFFA 5BCAA 2D4FA 3E7JA 4U1JB 1AVYA 1RK1A 2I9LB 1OAQL 1Y0LB 1IE4A 4RQQB 3AWEA 4ZZKA 3GF8A 4K3EL 1AZCA 4H5SB 2ZWYA 1KB9K 1P7KA 1P53A 2G5BB 4P46D 4ZFOA 5KBLA 2Q6WA 4JM2D 3QFJD 3U36A 3G5XA 3MDJA 1T0NA 4AITA 3VU1A 2OXHB 1VQMP 4DN4L 1U8IA 2J6WA 1S5LX 1A9BA 2I07B 1R34A 1A0QL 4XT1C 1DQQA 4IBSA 3RTQB 4GFXA 4MMZC 5DK2A 2EICA 3UDWC 1L0ND 4ZBJA 1CICC 3O2DL 5D1QE 1ASOA 3I50H 4OUUA 2WLIA 3TLRA 1IBBA 3IDIA 2DWDA 4PD4D 5HHOB 3V6FA 2JKSA 2OMTA 3FO2B 3FC8A 8FABB 1MCWW 3UP6A 3PWNB 4HF5L 4RDBA 3PV6A 3CSYB 4TLSA 5FFGA 2R2EB 2R69H 3G6AB 3KXFB 1L4IA 1MHEA 3GI9H 4M7LH 4H4NA 3ISYA 5FXCH 3P54A 5MEPA 3QNZB 3ECQA 3BYTA 3QHZH 4FHJA 4X8JB 4Z95L 4IIQA 1ZE3C 4ALAH 4E0RB 1CJYA 2YO3A 3QC6X 4BQ9A 2Y0CA 2AV1B 1L0NE 5F9OH 2UZYB 1BD2E 5GJTH 3REVB 3VFMB 3CH1B 4GKOA 1MCSA 3OPZH 2Z6FA 1JGLH 4LHUB 4U1NB 4WV1C 5PCYA 4FQXD 3TYYA 1ZKAA 2HLFD 2IANB 2K6ZA 4WTQA 3SJVB 3QGVA 1DL7L 4DZBA 3BOVA 1AR2A 1YNTB 4NPYA 4QRPA 5DRWA 4X0NA 1CQKA 1YEKH 1DUZB 4PJAF 2CBTA 1PVHA 3KJ4C 4GJTB 5E4IA 2BS8A 1CFVH 1MCOL 1NBVH 2O6FA 2YNYA 2IANE 2J12B 1KXTA 1ET7A 5DJ0B 1RSFA 5DT1L 1JZJA 2UX6A 3N91A 5E9DD 4L8CB 5ISZA 1U7MA 4GOEA 1L3NA 4W9JC 2HKHL 2YSTA 4TNGA 5C0IA 5F6IC 3V4VB 3PP5A 3ZMEA 3N1MC 2B5IB 3TEXA 2F8VA 3PGDB 4P2CG 3MV8A 3POCA 3VMPA 3K6NA 2P52A 4FQLH 4AYCA 1HX0A 3F7RA 4M5ZL 2AXTH 3L7EA 5BJTB 2PP8A 5BMFL 1JBJA 4GG6B 1J18A 5MI0C 4NZ8A 1VFAB 3J07A 3KXFA 4ZOEA 3PWLA 1BWWA 1M1SA 2R27A 4YLBA 3D51A 4WKXA 1DUYB 3RFZC 2AXWA 3GHGC 5E24E 2FQFA 2B87A 2EZ0D 4LSSL 1QSEA 2CZNA 4D3CH 1P5UA 2PWHA 2XN2A 2BVOA 2A73A 1LT9C 3P2TA 2VLJD 1AXSB 1KTLB 4E9WA 4D9LL 2CDEA 3MLWH 1EHLL 3NTNA 2XIDA 5D70L 4PV1B 1TDQA 3C1LA 2Z4TA 2B20A 2XN9B 4JY6B 4KROC 4P06A 4P59H 1DJGA 4P5TB 1OGPA 2KQNA 3D18B 5DS2A 3RBSA 1MIEH 1HDMA 2AJVH 2IPTL 2XT1B 4WU7A 2AJYH 3CWBJ 2ZVNB 1J0IA 1GZPA 5GRVK 2AK1H 3AZUA 4BRYB 4KNTA 4KJQC 5KG9A 1WRFA 4MNGE 3H6AA 4R90H 4TL5A 1HOCB 1UZ8B 3FB6A 4QTIH 3T97A 4JK0D 1JNNH 3B7RL 4JM2F 1DBBH 3EKCA 3ZDZE 5ICZB 3JZYA 4AGMA 2VNCA 1I1YB 5E4AA 1NIDA 5F9JB 1NU1G 1NGQH 1LQSR 4ANWA 1YEEH 3PREA 3D3VE 2D31B 1WSST 3F7YA 1OQOA 4JFPA 1TO4A 3NCCB 5INCB 2OMVA 1GTWA 3NJJA 4DESA 4YDIL 2K1MA 3SWFA 1ZANH 1KTKE 5ANHA 1K3ZA 1VZIA 4HU2A 1Z9OA 5FGBC 3MGTA 3R2PA 1GYCA 1ZR4A 3MRRA 2OL3B 4M03A 4NUGH 4OQTH 3ZL4H 4YPCA 2AEPL 2NW2B 2XXMB 3ZDXB 4GIPD 5AEAA 2ZCKH 1A3QA 1S9WA 1E7VA 1KG0A 5L7XL 1H3XA 1T66C 2CRMA 3ME0A 4LSRL 3S5YA 1BE3E 3VRIA 2D2CD 3D39B 3ZGHA 5I1JL 2IAMD 4UDTB 5LWYL 1IGYA 2BVTA 3K5RA 4A2HA 4HH9A 2FFDA 3L9RB 3VI3F 5KYYB 3Q01A 5L2KB 4IOFD 1D6VH 4AYBA 3DUSA 3BIBX 1HXMB 2RN0A 1ZA6B 4L8SA 3RB7A 1E4XH 1PL3A 3P4NB 1AE6L 1I7ZB 4Q97A 5K69A 4HIPA 1LL1A 3KHQA 2CHNA 4M6AA 5DVLA 3V0DA 4NGHL 3I6KB 1IGIL 2OQJA 4Y4FB 3UG3A 4KAQH 2NTSP 3II6A 2IMMA 3MNVA 3N41F 2Z5HA 3Q8AA 1X5ZA 4P2OC 4X4MA 2D2OA 4BSVA 1QTPA 1U95A 2N9YB 1GIGH 4XB3A 3V0WL 4AQ1C 2ZG2A 5D1ZI 3OHXC 3BZEA 3ARXA 4N2LA 4QNPE 4XC1L 1OGAB 1MG3C 4XBGB 1KJVA 3LW5J 5I0ZA 1E2WA 2AS5M 1KPVB 3ZR5A 4DP2X 2YJLA 1GGCL 2D9CA 4JGJA 4EYYQ 1TTRA 2BO0A 3VXME 4QRSA 4XBPB 1ZLVH 2K3TA 4QNPF 4OLWH 4PJIE 1P0SE 1HQRB 5C2UB 12E8L 3BP7B 4M5YH 1HZHH 1DQKA 1ACXA 4X5LA 3NJNA 3U7YH 2YPLB 4F2EA 1QWHA 2PO6C 3AQXA 4R96A 5CGTA 5IWLC 4ODUA 1XGZA 3B2VL 2NW2A 3UYOD 5FKAA 5K9KB 1BQ5A 4JQIH 4ONHB 5KS9B 2OS7A 2E9GA 2IAMB 5DZOA 2N59A 2V3DA 3PQYD 5DUBB 1T66D 2P5ED 4ZUUB 1T0NB 2XQ0A 1Z9NA 3IN6A 3BAJA 3C6LB 3KDMA 1G5AA 4TVPH 1WGVA 2XWJA 3I02B 3Q44A 2D7NA 1KGWA 4GRLA 3M46A 3DHPA 2WSFH 1U4FA 3PCYA 2EO1A 5HVWA 2X28A 4J3SA 3U0WL 3IGAA 3HB3B 3UTPD 1P4IH 5TK4A 2KLTA 2JJVA 2ZCHH 3VFOA 4CNIB 3E1F1 1AQHA 1N64L 4N8VA 4TNWK 4U7JA 5GXBB 2HRGA 4GSQA 1MEXH 4PJGE 5G4NA 2XN9A 5CNHA 3EJUA 4Z77B 1IJNA 1OPGH 3HG4A 4ABUA 4XXWC 2AV1A 3BKJL 3MCKB 3AEFC 5D7HA 1DEEA 5AAMA 2NMSA 1KTCA 1NCCH 4UOJA 4XNXH 4PLOB 2V37A 2NRGA 1MDAA 3X11A 3C2SA 1GOGA 3F64A 2Q3ZA 2GBVA 3ECWA 2ZSWB 2DH2A 4E9TA 1IJ9A 3D0VA 5JIQA 2KIKA 3DC0A 1WA2X 1I8LC 1M1JB 5FDYA 3SE8H 4OGAC 2ARJA 4AEIL 4FQPA 5F7DB 4FQIH 3W11D 3QISA 2F74B 1X5XA 2J6EH 1A6ZB 1GSMA 3BN9D 3CFKA 3JWDC 1T2XA 2W0KA 1C7SA 1WAAA 3LD8B 4FJ6A 4I9XA 4RGMC 5I0VA 1AY1H 4WWPA 4KNQA 4QCIA 2WV3A 5CS7A 2QJPB 1W9XA 2WQWA 2QJKB 3BKCL 1L5GB 1JF5A 3L7FA 3PJNA 4LNRA 4HK3N 2WPVB 5D2NC 3ZKXB 4K4KA 3OX8A 5B3SB 4WSGA 5IOPA 3KPTA 4I1NB 5IB2B 4CMMB 2K3RA 4JRXD 5FYKH 3V0VB 2CGRH 5FUZL 3GI8H 1UD8A 2G3NA 4M8QA 5BO0D 5F7MC 1G5GA 2FBJL 2VDRL 4GEIA 3T8XA 2A06G 3IS0X 5ILTL 5MEOB 4RGNE 4XP6L 3E9UA 2VDLB 2ESVD 2ZP9A 5DLML 4G8IA 4QRQB 2VLKE 5I1CL 2BEQD 2WWMD 2QM8A 1J8SA 3RZWA 2Y5EA 1FYTB 2HT3C 4UTAH 3OKOA 4JE4B 4JG1L 4XCEB 4HIJA 2A9AA 3FU9A 3GSRB 2GSGA 2E76D 5I9QB 3RVTC 3LEYH 5EO1B 1J1PL 5K9JH 1DO5A 3FTGB 4L1BA 4YBQD 5IF0B 1T20A 4CGTA 1ZHNA 5E8EA 5ECGA 1IU1A 1UEYA 2KZKA 2CALA 5LGHL 1HZKA 5KSAC 4XX1G 3SKJL 2H1XA 1X5KA 1A14L 5DD3H 3ABMB 1QLEB 3QULA 1JV2A 4Z5RA 3HR5A 3CVDA 3GGWA 1BD2A 1U95B 2A6JA 4NHUA 4OZFB 5HPOA 3GLEA 3O4LB 3SKUD 1PG7H 3V9FA 1QLRB 1W8EA 3OQRA 5CD3A 3VFRB 3WMQA 2ADYA 5ADOH 1D5MA 2JKRM 1N0LA 5BS0A 1HH6A 3RIKA 4MXVF 1WA1X 4QGTA 3TIDA 2HH0L 2NZ1A 4TSAH 1VRSA 1YQ2A 2TSAA 1ED3B 3D87B 4R4LA 1W0WB 3LPPA 2DWTA 2LABA 2UXVA 3MLXL 4FL4B 5E70A 3U4EB 3VXSD 2AV7B 5BV7C 5KZCD 1E5BA 1M4KA 2CXKA 5CXPA