5AVTB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avtB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avtB02
3TK1A 3M0DA 5AW1B 1GU4A 5AW9B 1YYCA 1SLQA 2WPRA 5AW3B 2R32A 1SP4A 5APSA 3VMXA 5AW2B 5AVWB 2Z5HA 2WPSA 3MD0A 4GT1A 2C9LY 4C46A 3L37A 1CI6A 3L35A 3LIDA 5AW7B 5AVQB 4AUWA 1NAFA 3P7KA 3HTKA 3M9HA 1HJBA 1G2CB 2Z5IA 5APYA 2WT7A 1T2KC 5AVVB 3NMDA 3V4WA 3I5CA 3TNUB 2QM8A 4HYTB 4RESB 1JUNA 2JJLA 5CMZA 2E42A 4I6MC 3A2AA 3NXSA 3HE4A 3HE5B 1NWQA 3VMZA 3LIEA 3A3YB 2Q7CA 4C7NA 4AYCA 5AVZB 1MUUA 5AW8B 3L36A 3WGVB 1FOSF 1GK4A 2XV5A 3SWFA 4GKGA 3VYIA 1OXZA 3M06A 3WGUB 5AVUB 5APWA 2QM7A 3T97A 2Q5UA 3A5TA 5AVSB 2R3CA 1FAVA 1MV8A 2WTYA 2R5DA 1H8AA 2IPPA 3M0AA 2WPQA 4RETB 1GD2E 3TYYA 1HWTC 3VMYA 3O8ZA 5APQA 1FOSE 4KHXA 2KP8A 2P7JA 5APTA 2R5BA 4M3LA 3VN0A 4DZOA 4EOTA 2XU6A 4LC1A 3V4QA 2WWWA 3VTPC 2P67A 2W6AA 4I2LC 4B86A 1CZQA 1OWAA 4XE5B 2W27A 3KDPB 3KQGA 3P8MC 3TNUA 1GTWA 1GU5A 1H89A 2YNYA 3M91A 1S9KE 1HUCA 1CI6B 3P32A 5AW5B 2H7HA 3HE5A 5AW6B 5AVXB 2Q3IA 3MGNA 2ZXEB 2E43A 3B8EB 2C9NY 2YO2A 1S9KD 1MFZA 2WT7B 1A02J 1X8YA 1KQLA 2P2UA 5AVTB 3UIAA 1GZLA 3M9BA 3NTNA 3A7OA 2N9BA 2YO3A 5APVA 5AW0B 4AQRD 1H88A 3NFQA 5APXA 3HE4B 1T2KD 4C7NB 1IO4A 1A02F 2VRSA 2ZFCA 4JYBA 1CSBA 5AVRB 5AVYB 1GK6A 5AW4B 3V5BA 4JYCA 1DH3A 3OAKA 1J2JB 3IR9A 5APUA 1HBWA 2BASA 2XZRA 1JNMA
chains in the Genus database with same CATH superfamily
2BCCG 4UNTA 5D4JA 4GS7C 3N3EA 2B4CH 2BW5A 4I77L 3B3IB 4GOSA 4F15B 4JPWL 3A6CH 4EI6A 2KPNA 4M1GL 4TTGA 2N59A 2D3JA 4ZMYA 1G7QA 4HAKA 3MD0A 2Q7AA 2ICEA 1MFEH 5KN5A 1JWUA 1YSOA 1KCLA 1A3LH 1JGDB 2IJ0C 3NCEB 1FCGA 3UOAB 5C97A 1IGYB 3EBHA 1UWEL 2DJUA 1HXKA 3H9SE 3PWVB 5GS0D 1EAPA 3LEXB 3IRPX 4TF4A 3DV6A 3ERXA 3HN5A 1WC7B 3Q2YA 1Z5YD 1MRFL 1LILA 2JB6B 5CMZA 5IFAL 5EO0B 1QYGH 3L9RA 2OS7A 4IDJH 3D39B 3GO1L 5JHBA 4DJGA 5I18H 1BYOA 3WUVA 1ML0A 4K94L 2WO4A 4JKNA 4UT9L 4FZ8H 1EEZB 1II4E 1PIXA 4LMQE 4D9QD 4G9FB 3QE5A 3VXME 3WIIH 2F54D 1DVXA 1KB3A 3VCLB 4KKAD 1EHXA 5KTBA 4X5WA 3PWPA 3K8KA 4PP2B 1NM4A 2HJFA 3VSQA 5FF6A 5BS0A 3GHBH 2FB4H 1R3KA 3IE9A 5E4OA 4AQ1B 3HMWH 3EYQC 1NC4B 2E9GA 3WIHL 5L8RJ 4YSPA 3CLEH 3PWPE 4RAUA 4AEHH 1JY2N 1ETZA 4OF6A 4RGOH 2CBQA 2XOTA 3TPKA 4NX0A 2NYZA 5GSRA 4D3CL 3MRJA 2ZKHH 3FQTA 3RWCA 2ZF8A 3U79A 4PIRF 3V0WL 3H3PH 2AANA 5T5NG 2EE3A 2NSQA 1QEWB 4K5OA 2ZUUA 5AFAA 2JP3A 1T6WA 3KDPB 3KYMB 2VE6B 2JXMB 3BEVB 3R4RA 4Z3IA 1CXFA 4PW9A 3NZHL 1OAQL 2ZAIA 3DXAE 3B71A 2YGVA 4C8XA 2Z7ZA 5MP6H 5L2JB 3FRUB 1NCDH 1OP5H 4BRVA 4HHAB 5IQMA 2FEDC 4KROB 4YIQB 2RQEA 3ULVF 1W16A 3W81A 1KQLA 1U7MA 5KLIB 5HTSA 1VFUA 2X40A 1FH5H 2QIWA 2A99A 2BFVL 2XJKA 3RGVA 3LIZL 3APDA 1YJ9P 3QZWA 3SQBB 1MG3C 3GNMH 5CJ4A 3N42B 1S5HB 3L3JB 4KPHL 4GH7B 1X79B 2P8PA 4PJXF 3BDBA 3OZ9L 1TLMA 5F1NA 4JAMA 4LKXA 1OK8A 2EC8A 3LMJH 1Z5HA 3TA3D 3IVKB 3BZFA 3DYOA 2XA8H 2A83A 3X11A 1VFMA 3H1JE 3FAWA 1ZLDA 3RUGB 1AGFB 5JDSB 4NQCB 4OZHF 1W72H 1UYWL 1M6OA 2P5WA 3CC4P 2QADC 4RCAA 1I3VA 1EJFA 1KIRB 2WBJB 2FYUD 4OV5B 3FDWA 3OC5A 3GKWL 2CR0A 2Z7WA 1JD9A 4X83A 4BQ8A 4PRDB 4B41A 5SX5K 2MPVA 2R2HB 3P3TA 3ZDZE 1JNHB 3GSXA 2HMIC 2QKIB 1JCCA 2ATPA 1E28B 4DAGL 4OKDA 4HOXA 2GCYB 1M2VB 4DNLA 1X5JA 3HLAB 5IY5B 1YJDH 4GODA 1C5BH 1NBQA 5KSAA 2V7NB 4HFUL 4DGWC 5CILL 4JHBA 4P2RD 4ZMOA 4R7VA 2W6BA 1HHJB 2WMPA 3KR3H 1UB5A 2G60H 3LTVA 3QJXA 2F61A 3QS3A 5I19H 1U8JB 1J12A 3INUH 4PP1D 1MXGA 3MRNA 4DFIA 3AITA 1YDPA 3A5VA 1NCTA 4A7GA 2XN9D 2H1LM 4F8NA 3MZTA 3WE1A 3VRLE 2F53B 4ELMB 4O2FB 3TV3L 3MLPA 4CC4C 2F18A 3V4VL 2JQMA 1DSFH 1N7ML 1J1DC 3S2CA 3D0AA 4P06A 1IGFL 2XCMC 1DFBH 4F9PA 4QOKA 5I1KH 2MCAA 3HD7D 1QSFE 2BNQA 5KAFE 2XG5B 3BAXA 5EU7C 4Q74A 2L04A 3SOBH 5A2BA 5GISH 1YNTF 4KHTH 1WZ1H 1ZTMA 4YR6A 1TZAA 2OP4H 5I74B 2BNQE 1KILD 1A7OL 2CM6A 2D4FA 3KYOB 3RBGA 1K8DA 1GZHC 4YC2C 5I0WA 3A67L 3O3UN 3MV8E 1FN4B 1N3NA 1U2YA 4LOVA 4P9HC 3U82B 4AUJA 1ICTA 4XWOD 4QXGL 3V0HA 4HXBH 1OSZA 5INDB 1G7HA 2OM5A 4CMMB 1AQ8A 5IW6A 4I4WA 4R9HA 4XC1L 2ICCA 1INQA 3CH1B 2WITA 5L0QC 3G3ZA 5HHOD 4NCDA 1IBBA 2H26A 3JV4A 2M8RA 3A7OA 5CP7A 5FYKE 5GGUA 2VDPH 1NPNA 4Y16C 4WWKB 3TVMA 3ZTEA 1N8RQ 2R0LL 3EXLA 1WA1X 4BH7A 4X7SL 5EO1A 3NSDA 3O4OC 2MEJB 2A6JA 1TFHA 4RISH 3S3CB 3CC7P 3U0PA 1HX0A 4KTYA 5AVYB 4OLYL 1HHGA 5HI5D 4XMVA 3LRLA 4MJ6A 3SGKC 1Z6JT 4HJUA 3VJ6A 3U46A 2P1YA 4NT6B 2IDFA 2MPAH 1PAMA 1HCZA 4KRPD 3ULUH 4R0LB 3BCDA 3DX8B 1RCYA 3HKZA 4MCNA 2P5EA 3ZZSA 2UXVA 1RZJC 3C6LC 4LRNH 2HRPL 3AQYA 2JKTM 1H3PH 3ROLA 1RQ5A 3J27A 2A0LC 4HBCH 4PWGA 4J27A 3QIUC 4KTGA 4BSJA 4HIIB 4MHHI 1BMZA 1SOSA 2F8IA 4HIEB 3F58H 3KCPB 3HR5B 4DGYL 3OF6D 4BINA 4KO6A 1F11A 3ALXA 3DVGB 3U0TB 4PCKA 3BSZH 1WCQA 2F54B 3QDJA 3MUGA 3BYTA 5ACLA 4N5ED 4MXVE 1X0TA 1FNLA 3HCVB 4PSRA 3HLKA 2EKJA 1Y8AA 4Y5XA 2WVVA 3GLEA 2AZUA 5JIPA 5TQ2L 3DX1A 1DYZA 4LSQL 4M56A 1JTPA 4XRCA 3VXQB 3HS0B 5IQOA 3PGCB 1KNOA 3OWEA 4UOQA 4HK0B 3HN8A 1IC2A 1NWOA 3L3IB 5SX4I 3ZRCC 3ATFA 2VDLH 1A64A 3V5KA 1GKOA 1YY9D 2OSYA 1XZWA 2R0KH 2ZUSA 1FLTX 5JHLL 4EN3A 4JB9H 2ADFH 1RIVH 4ELKA 1KB5A 1W0WA 3EHBD 5APTA 3MGTA 3KVDD 1PD0A 4H25A 3ZHLA 1BZ7A 4X6CF 4U6TA 1KELH 3V7MA 1F1GA 1UM6H 1AO7E 1BQLL 4C54A 4LB8A 3EFFK 1SQPE 3U2SA 1LL1A 4JM4L 2OYHC 1SDDB 1WWCA 4HQQH 1DEDA 1NO4A 3KMDA 3SN6N 1IGIL 3GSNA 1RUAL 1KB9H 3II3A 2H2PD 1AZZC 1U8PB 4U05A 4NKOA 3WNIA 1MJJA 2ZG3A 4WGWB 3T8XA 4U0RB 3H1JJ 3KZ8A 3IAGC 4XCNA 3CFJA 1JK8B 5DRWA 4JRWA 1SQ2N 4AQ8C 4WI7A 1U95A 1WRGA 5I1HL 4NP4H 1NCBH 3QUMB 5JHAA 1TJGL 4HCGA 5E2UL 2X4RB 4JCWA 3AQDA 5MEOB 3TA3B 4DGIH 3EDFA 1MCPL 3WAJA 1NBZB 3H54A 4B50A 2NY7L 3NPSC 4OLUH 1Q90D 3COOA 2IBZE 5DZVA 4JANB 2C9RA 5SWZD 3ZL1A 2BWQA 3VXTB 1D7MA 1DH3A 4K71B 5CHNA 2KSEA 4G6FD 3EJJX 3FB7B 5JQHC 5I5MA 2JLPA 3V0FA 4MLSA 3PRZA 2G3AA 4N2NA 4L2LA 2JTDA 2IH1A 1K4CB 1IVTA 1HINH 2OMNA 2FYUG 4JZNA 4PJ0H 3VD7A 5GHWL 4OD1H 1AAJA 1ZSDB 3UJTH 2E75C 5ID0A 2OGUA 4OGAC 3S3JA 3CIAA 4LGRB 5LGHL 1Y6NR 4JRYA 3OXRA 4P2RB 5ICUA 3VE0A 1UKTA 4FQJH 2YAFA 5JR1H 5I8CB 4PVMA 4NO5A 3IU3B 3FTGA 1TNMA 2Z93B 4ASVA 2G8YA 3GHGB 2E7CA 2GTWA 4QO1A 2QLYA 5DZOA 4HULB 1H6UA 5C86A 4V2BA 2V5YA 3CMAP 1XR8B 5DUPH 4UV7L 3QEGL 3UPCA 2XN9B 3MLWL 3NESA 5D7KE 5KJ7E 4NQTA 1JY3P 1TCRA 1BXAA 2J72A 4NBXB 1AOZA 5DJCB 1D5BB 2YUXA 1MHEA 3ILQC 4M1CC 3KPLA 3ZIYA 4WKXA 7PCYA 2VXUL 3IDIB 4WZ9A 4EJ1C 1OZHA 4OLWL 1CF1A 3T2LA 1ED3A 4MAUH 3TASA 3VOPA 2Y2TA 4KNUA 5CO1A 3HD7B 2GUOA 3WFBH 1QMUA 1TFPA 3EG9B 4Z3GA 4NPKA 3CMOH 3X1FA 4ZUVB 3RTQA 1URLA 4K3JH 4CMHB 3IGLA 1VERA 3OKLA 1C5CH 4PGDB 3FZUD 2OTUB 1INEL 1YC7A 4N6QA 3ZKXC 1GIGL 2NQCA 1ULVA 1KILB 4UIKL 2EILB 1IAOB 4XP9L 4G7VH 5IB1A 4F7EB 4TPRL 1GJIA 1O5PA 2YAOA 3INOA 4WU7B 3BKJH 3KPPA 3N50A 1ZA6A 4OKVA 3QS2A 3RRQA 2LABA 3V6ZB 1QHOA 2Y0EA 4JRFA 4U31A 3U4BL 1UOLA 5C0AE 4A2EA 5C09E 5CS7A 5DJAB 3LNFA 3VFUA 3ITKA 2JK5A 1ET7A 2VH5L 4X5XA 5FO9B 1LWRA 5HHOB 4PRIA 4LIQH 1NOHA 4AW7A 1OOWA 1B0RB 3MOAL 3U6RB 4W9ZA 5G5DB 1IJDB 1KXTA 4LAJH 5JW3H 2B7DT 1BECA 1UCTA 3WJJC 5T1DH 3WS3B 1RULH 3L3HA 5CD3B 5APVA 2Y3NA 1CGTA 5F0JB 5I5IA 5F2FA 2ROXA 2ITAA 4JFOA 2CE6A 3IKKA 1Q9OB 3R06A 4JHUA 1GJWA 3B5ND 2Y4SA 1T21B 4KRPB 5GRXG 1OM9A 4AYBA 4IRJA 2J5UA 4UU9B 3BAKA 4OR1A 2WQSA 3DBSA 5EEWA 3G04B 5I76A 1MCOH 1QSVA 3CUPA 4H8PA 4LASH 4XOAA 3OG4B 2WTPA 1YYCA 1IRAY 2FXMA 4X9FA 3LZQA 3RX5A 4U1GB 1MCDA 4PWJA 5E99L 2YIUB 3S4RA 1CD1B 2J6EA 3L3KB 5JPNB 2XWTB 2BW4A 2XYBA 1QFOA 2IFNA 2H2SD 2AJUH 4FFVC 4OFYA 2WVRA 1YUKB 1JXKA 3ZVVA 1L4AC 4AYEC 1P4BH 1ASOA 3NP4A 1J1PH 2N0MA 3D51A 3K80A 2H6OA 3T65B 5F7WC 4KXAA 4Z7OB 1M3IA 2CH8A 1KPVB 3AS3A 4ADJA 1VFAA 4TVPL 4EI2A 1FG2B 1TTAA 1KFNA 1HDMB 2ZKWA 5ISZA 1AZBA 5CGTA 5DZJA 3PAVA 4UBDC 1RE4A 4ZUUA 5GS1A 1FO0B 1OAJA 2IPUK 4HF5L 2WQYC 4KKQA 4N2AA 3UTZA 2C7FA 3MRQA 3WO3B 2B77A 3TIDA 1PZSA 4X4YA 2Z7UA 1SQPJ 3D85A 2COVD 5KG9B 4JRXA 5DD3H 1AZVA 5F8RC 4AYFA 2K4AA 4CC4A 5CINL 5HYSA 2I07B 5IBTL 4B5ZA 4CSPA 1T1YA 3NACL 4H8WH 4QHPA 3DNKA 3P8CD 3RWGB 3T4AA 1UATA 4K8RL 1S8DB 3WD5L 1RK0B 3QI9C 4AMKH 4IL6E 4P5TD 4C59B 4E0RB 3M8OH 2B4CL 3EO0B 1PFCA 1ZDQA 4Q0XH 4CSSA 3A6CL 2QDWA 5CLTA 4L29A 1T83C 2FCBA 2Z31D 1MLCA 1S7TB 3MNVA 3QIWC 1MIEL 2B1AH 1MFEL 4Z7WA 3MBWA 4F2MB 4UUJA 1T1WB 1DJYA 2LHAA 2EQDA 1A3LL 4D6TD 4F2FA 2ETWA 2C1OA 1AIFB 3P32A 5CIPA 1P7KB 2XV6B 1IKFH 1EDKA 4Y9CA 3MRMB 3O3AB 4E9YA 2PWFA 1P9MC 2OTWB 2PTTB 5FW6A 1H0DA 5IF0A 3VFWB 2R0ZL 5LNDA 5KOVC 3ARVA 1PGJA 1S5LE 1UIIA 1BXXA 1TEGA 4IDJL 4GSQA 5C08A 4I0PD 3V0VB 4XPHH 5I18L 2YK1L 3JVGC 5D1QA 4J23A 3G08A 5TFSH 5SWZB 4KX7A 1OE1A 1QBML 4G6FB 1AXSB 5E1IA 3MRFB 4G82A 4XNXL 4FQCL 2FEEI 5AAWC 4NQEE 5E8NA 5D1QE 1NFAA 3VMOA 3PREA 4JG9A 2JKSA 4ZXBD 2GTZA 3QDMA 1KLUB 4I18A 3IU4H 5FOBB 3ESUF 2FB4L 3SE4A 5E5MA 2G0KA 1NIEA 2FR4B 1E4WH 2VLJA 3TBTA 2JNZA 3IFNH 3CLEL 1A9BA 2PO6A 4CVZA 4AEHL 4A7GF 4XB3A 4RGOL 1CE1H 1U8CB 3C6LA 1P69B 5IGXH 2ERJB 2L3BA 4BUGA 3T4AB 2X9ZA 4Z77A 2F08A 4L8SB 4IKKA 5FXCH 2EXYD 2JWDA 4A66A 4PCSA 3AS0A 1X5LA 3AW5A 2CU9A 1YEKH 4J3OD 4PS4L 3UTTA 4HU2A 3HTKA 3Q1SH 1JZEA 4WWIA 2TRHA 3L70E 5I1AA 1AGCB 3PAUA 1AIZA 2FJFB 4WW2B 1OCWH 4YGAB 3LS4H 1YTZT 5FFGA 5TQ0H 1NCDL 3FO9B 3NZ8A 4NRXA 4LK4A 3VGBA 2H3NB 1D5MA 5BMFL 1NKOA 4FA6A 5DHYA 4GQZA 4WTQA 3HR6A 2M2DA 5C0RH 3Q05A 3VFOB 1WBYB 2JCWA 3H0TA 4ZJ9A 3VP8A 2X1OA 1K85A 4KKNA 2WTRA 1ZLVK 4JN2A 4K2UH 2Q3ZA 3GNML 5IMKB 4PR5B 3QNYA 4PY7A 1NTKK 4FRWA 4QRTA 4ZDHB 4E9SA 5BOJA 4N9GA 4GRWE 1EAOA 3UPRA 1K2DA 3K5BA 4JQIL 3C8VA 1OWWA 5ENWB 3ASOB 5LN8A 4G8FB 2JCCE 2WWKO 3LMJL 4HK3N 5IESH 2PP8A 2PXYA 2JV6A 3NMEA 4ZQKA 4ZAKD 3VWJC 4AJ0A 1DLHA 4XN5A 5EEYA 1CK0L 1NUNB 3BUDA 2XA8L 1SQQG 1IAMA 3FTZA 4R4BA 2CRIA 1AH1A 4Q6IB 2ZXCA 1BM3H 3H9HA 1LTJA 2B5IB 5HDBB 3HE6D 3QULB 4XN4A 3VD5A 3KLHC 4GQPH 3V5HB 1JCVA 4EOTA 2XKSA 3WL9A 3T0VA 4H0HB 3DX6B 4JCMA 3FCTA 3RIFK 4ACTA 3TNUA 1SQVK 1MI5B 1TVHB 1PZCA 2CQVA 1E5BA 3WLBB 1U8MB 5IJVA 4X8JA 5F9WB 4GG6A 4TTDD 2PTUA 4APQD 2ED9A 4P0DA 1BZ8A 4DH2A 3PP3K 1HH6A 4ZFOA 1BQRA 1YJDL 2VRQA 1C5BL 4OGXL 1R5LA 2E74C 3DIVA 1Q2NA 4YFLI 3EYVB 5D2LF 2WPGA 4EIBA 3BSHA 4UF7C 1IGJB 2YO2A 4TLKA 1TJIL 3DX7A 3IDGB 3O9WD 2LTQC 1BVNT 3KR3L 2ALAA 2ICWB 2G60L 2OPCA 3NTNA 4JQ0D 3E3QC 1EXGA 2WCPA 3B5NB 1EJOH 3VI3A 4IOIA 5I19L 3HE7C 1GAFH 4UT7H 1OAXH 4JUSA 4QIRA 3JUYA 5F7DB 1WWWX 3RWEB 3QUYA 2Q8AH 4P5MA 4XAWH 4YEEA 4JYCA 5I75B 1YAIA 4BFIB 5EULV 5B8CC 4A7PA 2FJSA 5A2IH 4KKLD 4DZBA 5IT2H 1ZHKB 2VQ1B 3JWDC 3SE6A 3PGDB 5HGHB 4C47A 3CWBE 2HA1A 4N2MA 3TPUA 5AW9B 1TVBA 1O5DT 5G4OA 1FVEA 1T1XA 4HUCA 1CFSB 3KLAA 5CJ5A 1J1XH 1L4IA 2BWDA 4MN4C 1EZVY 5DI8B 5J1AA 4HIPA 3FT3A 5GISL 5KUMA 2R27A 3UZQA 1NCCL 3PABB 2OP4L 1DE4B 3LW5H 3LV3B 1J87A 4YE4H 4ZMXA 3NH7L 4U1IB 2R7EA 2R29L 4RRPA 2BVQB 1FUNA 3ZUNC 3OLDA 4K0OA 1FDIA 1U93A 3F5WB 3MROB 3AE9C 3GXPA 2XQBH 5EZIH 4YXLH 2HFTA 5F1KC 4XPAH 2RKLA 2N7SA 4FQHB 4EQ3A 3OA7A 4UOJA 1ZVSB 1QSEA 2VR3A 5DC9B 1YYMH 3MLTA 2XQ0A 4OJCA 3TEYA 3OX8A 2QSCL 3KD4A 5DO8A 5B1JA 2XG4A 1CIDA 4GXFA 1JERA 3KDMB 1C5DA 2AF2A 1L9TA 2OMUA 4UQAA 5FO7B 4HWEH 2C4XA 5IROA 3W11C 3NT0A 4GT0A 2DYRB 3IDNB 3T2OA 2IFMA 1IIKA 4RISL 4GP5B 2Q87A 3WEAA 1CLOH 2ZX8A 4X6DF 1AHWC 4P5TB 4MNHA 1E0OB 3EOBA 4F91B 5DC2A 2CCVA 4LF3A 4G9DA 1ILUA 3ML9A 1FIGH 2MPAL 2A2QT 2A45I 1I1AD 4RAHA 3CN4A 2OZNA 3IBEA 3NZSA 1IFHH 3T4YB 2AXGA 4LLAA 2Z31B 3KXFE 3RZWA 4WY4A 2XVBA 3VFGH 2J5LC 4PJFA 5FYKH 2WZ6A 1EH9A 2F7OA 4O51A 1H3PL 1G2CA 3HBZA 1U36A 3OGCA 3UYRH 2Y06H 4D6TG 1GSKA 2NX5A 4BEIA 5KW9H 4HBCL 4XBGB 4OY9A 1R46A 2PABA 2ZKYA 1AGBA 5FYJH 5BV7C 1HHKB 3CGTA 4UB0H 2OYIC 5I26A 3HRZB 2X1QA 3MV9D 3F58L 4I0PB 4G2AA 4I2XB 4XNMA 5C0CA 1A5FL 1TZIA 1IEBB 7TAAA 2QT6A 1TF4A 4Q52A 5B3SB 2VT0A 1NCNA 2VDKH 3LS5H 3LNGA 1ESOA 3CVCA 5K39B 2QPSA 1WZLA 5CLZA 3T3MB 1SJHA 2A7BA 3GRBA 1A7QH 3E38A 4ZXBB 2IDSA 5J11B 2BP0A 3QORD 1KXQA 2RB8A 5C0EA 3ETBF 1L0LE 1JMMA 5LDSA 1S9VB 1OD9A 1XTMA 4KZCA 1KFAL 4XAKD 4OCNC 2Q0ZX 3MLYL 4BFBD 3L70J 4UM9D 1RJLA 3ARFC 2M0BA 3ML8A 2ADIB 4JDTH 4QTHB 2Z1KA 4ZMLA 1PZUB 1NU1D 2Q76A 1U58B 4YHOH 2WZ0A 5IQ7L 1L0NE 2R0KL 1KJ2H 3ILPA 4NIYE 4HA1A 3SWYA 2KT6A 4JB9L 2WSKA 4KK6D 5JOPE 4FTVA 4ZNEA 4D7BA 3CV5A 5BUAA 5HYQB 4RFNC 4Z3TA 2H32B 2M83A 4K5MA 4EDWL 1DX7A 1E43A 1KELL 1JF5A 4NZRL 1UM6L 1E9QA 1R3JA 3FT4B 4F7MA 2AJZB 4J3OG 4BZ2A 2FT7A 2ZP9A 3OKEB 2X70A 2DPKA 2ATKB 3VB8A 2V5RA 5D2NC 3DBXB 2BCCE 1OB1B 4YWGH 1URQD 3GS7A 5AVVB 1MAKA 4XNBA 3W9EA 1XF2B 3BIKB 4PJ5A 4YFLF 4WNSA 2IBBA 1VCBC 4OQTH 2ZJSE 5D7EA 1ZA3A 3PIQB 2DM3A 4HPOH 3LXUX 4ABUA 1A2YA 4HEPG 1JGDA 3TH3T 3NPZB 1Q82Q 5C07D 1NCBL 4BXLA 2O4EA 4X7TA 4YDMA 3WEXA 2IALA 3TDKA 1GGTA 3ARDC 3ZE0B 4ZAKB 1FL3B 4B3EA 3CLWA 1EXHA 3HNVL 1SHWA 4BFFA 5B3NA 3V0IA 2YLKA 4GO9A 4L76A 1MUJA 1MH5A 3AU1A 3SGDH 4AENB 5JHMA 4WFHE 1XVSA 5HD8D 3OL2A 5D72H 1EXUB 3HE6B 1DVYA 2I26N 3LRSB 3NJVA 2IQ9H 2XWJB 4RFOH 1HSBA 2E6PA 1GSMA 3O8ZA 4G9FA 4PGZA 3KYNB 4ETYA 3D39E 1P84I 1HNYA 2BNRA 2DQUL 3VCLA 4LCCA 4OZ4B 3QXVA 1YEHL 3ZKSD 3S2AA 3B56A 1JWSB 4OD1L 3CN1A 4G9FE 4X50A 3ZQ9A 4APQB 5F0MB 4EYYQ 4XPTH 3SGJA 3O3BB 5LDUA 4PD4H 2Y2WA 4IKJA 1I8IA 4L0PB 4G8EB 2DIEA 4A2HA 1N73C 1FBIL 1R3LA 1FI8C 5IZ7A 4R90H 5TE4L 3O45B 1TZ8A 3FH5A 3FU3A 1U21A 4WI6A 5GRVL 1VADA 3O9WB 3TCLB 3DURB 5CU9A 3P0VL 2IGTA 3KBPA 2APWA 4FOMA 3BPOB 1DQJB 4GFTB 3CWBJ 2BOLA 1P5UB 2CALA 3EH1A 4ISVB 3FU5A 5ITBH 2YLHA 1F6LL 5JXAL 4E9TA 5D93B 1ILSA 4L8BB 2JXMA 1EEYA 1YZZA 1FJ1B 2AITA 1UWXK 5KBPA 1NGMB 3G7TA 3ARUA 4OVUA 5KBKA 4DIXA 2PW2A 3IDYB 5FWRA 1NDGA 3AY4A 3MRPA 4MAUL 1JPGB 2F8XC 4QCIB 3SDYH 1D7DA 4KK8C 1MCFA 4NQVB 4N2BA 4YIQA 3WFBL 5KYYA 4JM0A 3E2HB 3H55A 5AOKA 4BE6A 1PZ5A 3CMOL 4MD5B 4MAZA 1AYOA 2DQEL 5ETUB 1C5CL 1OPOA 2ICES 3LHPH 4N87A 3LKRA 1L3NA 4F9LA 3VXSD 5C0BD 1M1JC 2VXSH 4P23D 3L3JA 1SVFA 4TNGA 5EUOB 4BXVA 1KFGA 4DGVL 1KTMA 4G7VL 4LEBA 4FQ1H 1MCNA 1MSPA 1KIPA 2GY7B 4J3SA 2HLEB 3PLNA 2JMRA 2VDMH 1MCIA 3BKJL 3OLIA 2GUYA 2JDIH 4X5RA 3BDYH 3KBFA 2OJZH 1OTSC 2PUQT 5ABDE 1SGKA 2HLFD 3VD9A 1ASQA 1OGAA 3JUZA 3DSFL 3CVBA 4W81A 2CBPA 4NQCA 2UXFA 3B2VH 1Z5LA 3MMEB 1RZ8A 2GM4A 1JZ5A 4Y9BA 4OV5A 1B4LA 2FWOB 4UZUA 2P28B 4XX5A 3RUGE 1FFNA 5KZCD 4XH2B 1AQ5A 4QWWD 5DU7A 3ABZA 4NQCE 5EFIB 1CGYA 4Z7WF 4XZUA 1X6NA 1SQBK 3MRGB 1NEUA 2P42B 3HLAA 1YQVH 5FV1L 3UZEC 4HS6A 2EDBA 1FZCB 4BDVB 2VQTA 4PRPA 4JFYA 1YEEH 4XXCA 3FUNA 1VACB 1LQBC 3GBLA 4F20A 1I1AB 2PAJA 2WQ8A 3ISRA 3KS0J 1NAML 4XCYB 2OXHA 1TMQA 1JTHA 3G6JA 5GGQL 4A6YA 4GG8B 4JM2C 1KJVB 1G6VK 3UTQA 4MQ7A 4ONHA 1UZ6E 3SO3B 5AB9A 2H47C 5CGYD 2C9PA 4XO5A 1GZPB 1MCOL 4LASL 2HPCA 3IMTA 3ZYOA 5JXED 2MRYA 3VRIB 2HWZH 3WN5C 3DWTA 3H2WA 2DKUA 1L0LJ 1EJ6A 3J7HA 3AEFC 2IH3A 1MVYA 2XNDH 3MV9B 2AJUL 2ITDB 4R7DB 4W1TA 3RVTC 5BJTA 5KYWB 2F53E 4ELME 4W6XB 1J1PL 2Z1PA 5D6CB 4L74A 1PKQA 4WDIA 4C83B 4R4LA 1R5SA 5BXFA 5AW6B 1WZKA 1B2WH 1L0NJ 1H0TB 1M9WA 2JO1A 2OR8A 5G4MA 5B7EA 3EJQA 1RUKL 1W80A 3QORB 3T6QC 1EDQA 1OW0C 1S4IA 4NQQA 1XF3B 4ZMQA 3KEDA 4FQIH 1RF1C 1U8LB 1GC1L 2J3SA 3NIDF 3O6KL 5JNYA 1TU3F 4L1HA 3HE7A 4UM9B 2MIZA 1UOKA 2WQWA 3F2LA 3KJ6H 4S0SD 1QGKB 4ZKPA 1CI5A 1JXJA 4F7TB 2J6EH 1QVFO 1NU1G 3POCA 2AVGA 5T33H 4N90E 2BCCJ 1KLGA 3EADA 4OD2B 1YUHB 3TCXA 2QHRL 2BOBB 1G1IA 2AJSH 4H8WL 4ZX5A 5DUBB 3DOSA 1UJ3C 2R51A 4JNXA 4U1KB 3L2MA 4AMKL 2E6QA 5FECB 1LXMA 3C5XA 4ALAL 1N6UA 1UXSB 4EKJA 1K5NB 3RFZB 4Q0XL 2E9IA 3H1KD 1A8JH 2WGNB 4FQQA 4XVUD 3SE8H 2OMWA 3UBHA 4NT6A 1URQB 2XPGB 4HP5A 1P6AB 4YHNA 2YD2A 1YMHB 1VSCA 2B1AL 4L2YA 2G4GA 4POYA 2YRPA 3WTYA 1S7RA 1A0QL 3BZ4B 1HIMH 3WFCH 2LVCA 3H85A 3OXSB 1IKFL 3SKUD 3VQLA 3X17A 2H8PD 4HMCA 3WNNA 5C07B 2DQFA 2OX5A 3RWDB 3VXUA 3D3VA 3T97B 1XCWA 4QHNB 1ZWIB 2PPEA 3MRHA 4YFEA 5JZ7C 2FH6A 3HRPA 1A1NB 4NRYB 4XPHL 3TU6A 3IKCB 3CFDA 4HIEA 4AYDC 3KCPA 3I75A 5GRJL 4Y1TA 1T8ZA 5DRXA 3AECC 4L1DA 1IL1B 4OSUL 2WLIB 4WI3A 2DTMH 3GMMB 3DVGA 1W6WA 5FEBA 1UXLA 2Z7YA 1YBKA 2GJPA 2F54A 2WPQA 2AKRB 2EC9U 3IU4L 1XGYL 3MJ9A 5F3HB 5GSVA 4X0KA 1XTGB 2G3MA 1YN7B 4RGND 1E4WL 2JJSC 3NAAL 4D9QE 1S5LH 3IFNL 5CIPH 4X9YA 3IXTA 2F54E 2LU5A 3CZGA 5ES4B 2GBUA 5JPMB 1K5WA 1WAPA 5IGXL 1RIUH 2VRKA 3DPBB 3N6YA 4JO5A 3ZDYF 5LG6A 5BZDB 3CBKB 1I9RH 4XMUA 1CZQA 4TVUA 1A7PL 5I0DA 2DQIH 3Q2LA 2BS71 1I1YA 4LLQB 3EH3B 2JKVA 3H9YA 1MW1A 3KLLA 3Q1SL 4KJWD 1NIAA 1IM9A 2J57A 3JTTB 1OQOA 4G3YH 5FGBC 1FVDA 2BCKB 1HF9A 2GHZA 1OCWL 1DCLA 4BELD 1RVFH 1F97A 1CXHA 1MFZA 4JBZA 4G80A 1ZK9A 2YPKA 3ZE2B 3KPQA 2Y5TB 1DEBA 5C0RL 4YXKH 1ZSHA 2EECA 1M8OB 3WHXA 4ENEC 3FTXA 3VX0A 2PWDA 1U8PA 4C4BA 1BIHA 1ZT1A 2VN4A 2QV2A 4KXBA 3WAKA 4QLWA 1BVOA 4K2UL 1R5IB 3L1OH 3P3SA 4JY4B 2OMZA 4HHGA 4PYGA 2DOCA 2V3EA 1YEDA 3ARFA 5FOJA 3VXSB 4FA8A 5HVWA 1VQ8P 3OAKA 1PIGA 4P23B 3DGGA 2QSQA 5C0BB 2ZQKA 5HBBA 4GKNA 5IESL 1XTCC 2JR8A 2WM0A 4BCXA 4KQ3H 4KGJA 2YMXH 3CVIH 3WTWA 2G5BA 2PYEA 4K73A 2GSMB 4NPEA 1S7XA 4HALA 2VWEE 1T0OA 4BQ6A 4Z8FH 1YI2P 1UEYA 2MQCA 1A65A 4Y4FD 1BM3L 3RP1A 5I9QC 2AS5M 4B7IA 4XNYL 1HWGB 1KSRA 1IFNA 1Q9LB 1KCSH 3KLKA 1CXEA 1CI6A 4K5LA 4P2OC 4YHIB 4NLAA 1HYSC 1KGXA 3HAEB 1QWUA 4EI5D 2YZ8A 4Z3JA 5KZCB 1PLCA 2XTLA 3HAEG 2EVIA 1A6AA 5IHZB 5LNGA 3X14A 4PJFF 1DVUA 5B22A 2P80D 1IQWL 2FYUE 2BHZA 3GB7B 3FXDA 3HC4H 4K23H 2GEEA 2K78A 1T6VN 4N25A 3L36A 3OKKA 2COQA 4WO4C 3JC22 1EJOL 5K5YA 2A5UA 2W0KA 1NFKA 4UT7L 3L8QA 2G75B 2ZKXA 1JZFA 3AM8A 4P2RE 3TO4C 1LE5B 4RMWA 5C0ND 4XAWL 2Q8AL 3SPGA 4W9HC 2CK3H 1A4BA 1ZHBB 2HT4D 4GUPB 1YQ2A 3SZ6A 1IM3D 2FBRA 3ES6A 3ATBA 2FT8A 3RZCC 4I88A 5IT2L 2XVKA 3FT1A 1V3KA 3MNDA 3HFML 1ANUA 3O8XC 4ZFFA 4UINH 2FQFA 3PDDA 1WFTA 5T3XH 4IGBD 2XN9E 5A2AA 3EDDA 3C60D 1FHGA 1BVKA 4UILH 3RL0D 1J1XL 5HDQL 1KJ3H 4MD4A 3GSUB 3QEUA 5AWNH 5TH2B 4QF1B 3PWUA 4PUBL 1EXIA 2F7QA 2X4NA 1BWMA 1Z9SB 3CQQA 1DD4A 2EAEA 2Q8BL 4YE4L 1A4JB 1DQMH 4QKTA 2Y7NA 3BN3B 2ZWYA 3WLWC 3F12A 5KJ7C 2XQBL 1JGUL 1ORQB 2IEPA 1KPUB 2KLTA 4XPAL 3V6ZA 1BDDA 1KILE 2ZYIA 4E9WA 2G2RB 1MCKA 3DSNB 3KWWB 3QJFB 3LD8B 3MACL 1MELA 3QHTC 3QARA 5I71B 1PZ2A 2X6UA 2ED6A 4JFQA 3VGHA 2HT3C 1FNAA 4HWEL 1KB9K 5E1AA 2EEDA 3V5BA 5G5DA 1HWWA 1OANA 1Z56A 1V27A 4OJAA 1ITBB 3Q5OA 5HHOE 3D71A 4JDZA 2YPLA 3IM1A 1I8LC 3MXVH 3B9KC 3GG2A 5IBLD 3CCHB 3TTSA 3ZXAC 2FZ3B 1AJ7H 1FIGL 1L7TH 5F93C 5E23A 2W8CA 1IFHL 3HUSB 5I16B 4UAOB 1OW7A 5E9AA 3H1KG 2XQYK 3BVXA 3SJVA 4ATTA 1EUTA 3VYNA 3RNKB 2BOCB 1OAKH 1M1XB 1QLRB 3ARZA 5AOMA 5IVXB 4X6EA 1AS7A 5KOMC 3TBVB 1YMMD 1HILA 5E8EB 4GRLD 4H8QA 5A2JH 2H8PB 5DEJA 4OFVA 4AUWA 5KW9L 1KGWA 4AMWA 4QAMB 1I82A 3GSWB 5FYJL 3D06A 1I7RA 3HUJA 4UB0L 4NKDA 4DPCX 2UZXA 4NJAH 1CXKA 3NCYP 4HPHA 4RQQB 3IDMA 5F88A 2ZX9A 4P3DB 4MMXA 3D2UD 5I1GH 3A3YB 3LS5L 2VDKL 4H88L 3RWIA 5I73C 1N7LA 2VXTH 4POZC 1A7QL 4N28A 1IAII 1XGTA 1DBJL 4H20L 4NDMB 1ID2A 4M62H 2JQZA 5T1MB 1IKOP 4NN7C 1KPVA 2GQHA 2YSSB 4RGNB 1FG2A 3SDCD 1G6RA 5KAQG 3KS0H 2KYVA 3SE9L 4CADB 4R3SA 4Z7OE 4JDTL 4IOFD 4NM8L 2EEXA 4LCUA 1NEZA 1OAZH 1E65A 4YHOL 2OMBA 4PCYA 4XB7A 2ZYGA 1MEXL 2DLEA 1BQHA 2WMMA 3RB5A 2ZOLB 3B5GA 1GGIL 4JVPA 4Q4EA 2KI6A 3BO8A 3MUY1 1OSPH 4N8VA 5D1ZC 2CPBA 4C4KO 2BSTB 4NB7A 4QAWA 2D31A 1XBDA 1NMAH 5DJZB 4JG1L 1QUNA 3V4VB 4BSVA 2VJ0A 1S8DA 1UT2A 2AXCA 3PLYA 4XVSH 3PHSA 2EC9T 3WU2H 3LKQA 1I1CA 5LNEA 3F85A 4KC3B 3CTTA 3EO0A 4YWGL 1Z3RA 1T66D 1DBAH 2E43A 2P7TA 4DCKA 2NPSC 1BVLA 3IMSA 3ELQA 4JFFA 4GAFB 2C9XA 1QVOA 1RF1A 3VD2A 1NJIQ 3VXPA 2F7RA 4LHUA 2GA1A 3HZYA 3B3BA 1UGNA 2QR0A 2RALA 1KB5L 3TOPA 3X3FH 1DQDH 3C8KA 2V2XA 3GS0A 2DWEA 1ZLSL 4F2ME 2J1YA 1OF0A 2ZCKL 1BX2B 2BY0A 2FNBA 4Y4FB 3V0VA 1MCWW 2FYUJ 5D72L 4L5FE 4JQXC 5TK4A 2VJXA 2IQ9L 4UM8B 3L2LA 4PV8A 2XDJA 1NOAA 5KKZC 2ZJSH 3GSNL 2CLRA 1Q94A 3P0GB 4M3HA 5F71A 2QVAA 3FQNB 2P47B 3TJEH 4HSAC 3NCWA 5SWZE 4EI5B 1L0YA 2VKXA 3G6JF 5I17B 4ZO8A 1R1CA 2NZ2A 4LCWA 4XPTL 4AQAA 4LOFA 3LDBB 1A6WL 1FZMA 5HYJD 1GTNA 4G6ML 3RLSA 3FT0A 1GL2A 5B38B 2DWYA 2G2NA 2EDWA 1B4JL 4MD0B 1DBBL 1E4HA 4HMEA 4PREA 1WBXA 4R90L 5B38G 5F0PB 4HZ1A 1XZ0A 3ZZ1A 2O5YH 1BLNA 5ITBL 4ADGA 2L8AA 3MRLB 2XETA 5AYQA 1RH8A 3L4TA 2AABH 1IAKB 4UV4H 3P30L 4PJGB 1HL8A 1T5WA 4YHPB 2FJFA 1IM3B 3MCG1 3F7RA 3F7PC 4X42A 4PJAA 1NJ9B 3FO9A 6TAAA 3L5HA 4TNWF 4IGBB 3C60B 5CUSL 1GD2E 4N6RB 3RL0B 1WBYA 3S35L 1H8LA 4X6FB 5BVJA 3V2QA 1XEDA 2QGCA 5ECJE 5KSVA 2R9HC 3OMAB 2L7UA 3LHPL 5LO7A 4J3BA 4HB1A 2VXSL 4TVPD 1FGVL 5MERA 1HL9A 3IDXH 3QBTB 3FT2B 2X05A 2VDML 4BK4A 3I50H 1CI3M 5K33A 3FB6B 1XMEB 4KNSA 2XTSA 1BJ8A 3BDYL 3MNZB 3W37A 2OJZL 1FE6A 1XIWD 1TZOA 1IBGH 1B6DA 3S8FB 4Y2DD 2BDNH 3Q3GA 1T0MA 1ZDSA 3C2AL 3ARPA 3G6AB 4M48L 4Y5YB 5C0IB 2VQ4A 2YD0A 5HGBA 5DSCB 4CU6A 3QSKB 3VDAA 3P4OB 3CC1A 5DEFB 5BOZG 2YAEA 1L6XA 1NSNH 1NC2D 5KJRH 3FXIC 2D7PA 3VFVA 3NCJL 3ZDXB 4N22A 3V9FA 2AFNA 5HDBE 4OAWB 1F2QA 5DMGC 1L5GB 4K8RD 1I7ZA 1LEIB 3AE1C 2Q5BA 3ARXA 1IARB 3VXRD 4YSDA 3QUHA 1GGBH 3PPEA 1ZP0C 3PXJA 4B6ZA 2H89C 2VZTA 3FU7B 1YQVL 4AI7A 1A4KB 3WEMA 4HH2A 1MI5E 4LMQI 4O5LH 5CJXC 3CHXA 1FE8L 1SQBD 3IJSA 1OLZA 4J3VA 1LTTC 4L48A 4YK4C 4P57A 1LO5A 3WHE0 2NZ9C 4OH8B 2QMJA 3U9PH 3CDFA 1TYEB 1PIFA 4IBYA 3FUMA 4NOFA 3DYPA 3T2QA 1YMMB 1KC8Q 2F6AA 3HC0B 4G6KL 4GRLB 4F37K 4LLYA 1OVZA 2W83C 1XGPB 2ZP8A 4PVNA 5EBMA 1TSRA 2HWZL 1FHNA 4JVUA 4J1UB 1JPEA 1OE2A 2KH2B 1YRKA 1JI2A 3GLAA 4MXWL 1KJMB 1HEZA 2HLAB 2BVEA 1OAUH 5DRNB 2PN5A 2DQHL 2PFXA 5FHBL 1MLBA 1NM9A 1CFSA 3D2UB 2XHNA 2UVFA 3SDDC 1O6SA 1B2WL 2CHZA 4IU3A 4FERA 1JY2P 4BFNA 3L5IA 4A6YH 4YDKH 1ETJA 1ZOXA 1Q0XH 5T1KD 5KYXA 5TE6L 3L72G 1H3UA 3LV3A 3FBQA 3ULAB 3PHOB 2VLLA 3F01A 3K2KA 4JY6B 5F89B 4EN2A 3SDCB 3CFCH 1H19A 4Y4HA 3BX7C 4MAYD 4UB6E 4PJ9D 1KY6A 3I02A 3IFMA 4P3CH 2YA2A 1Q86Q 1E3XA 4PBXA 2KERA 1AQDA 2J6EL 2QTVA 1DN0A 1DQLH 3BZ5A 5DLLA 5T33L 1H8AA 4W4OA 1JV5A 1IFRA 5IHBA 3N9GL 3MODH 2AJSL 4AQOA 4YBHA 3PL6A 5D7SH 1FYTA 1PV3A 2JKLA 2YBRB 4IBSA 4G42A 4JG5A 5D7JC 1GMJA 1TQCC 4Y9FA 2XJLA 2YC1B 1XGUB 3II6A 1JGEA 3GRWA 1HTLC 2W8ZA 1UASA 1WAAE 2D2CD 5BZXA 5GGVY 4NWUH 1RY3A 4PJIA 2P67A 1BOGB 2GJZA 3IF1B 5DMKA 3DGCR 1NMBH 1H8SA 4AZ8A 3KNBB 3P8CE 4AQZA 1XCQA 2E27H 2A73B 3F00A 2KC0A 3UYPA 2JEEA 3PV6A 3V0EA 1M05A 3B4NA 4P4KC 2ZUWA 3ATAA 1A02J 1UA6H 3L4FA 4MA3A 1JHTB 2Y0DA 1R19A 4DP4X 5GQBA 3WY2A 1HL4A 3GI9H 5LXVA 1JRHI 4D6TE 2OMYA 5C0FA 2WLLA 2PCPB 4FJZA 2VRSA 1IQDB 2W0LA 4FL4C 4GSRA 1A1OB 1RK1A 4KI5F 4I48A 2DTML 3DECA 4FQXD 2K3TA 3QA3A 3OJVC 5C7ZA 5C6WH 4KJQC 2HFEA 3DIDA 4GSUA 1JNMA 3I9GH 4I2XE 4F1SA 5L2KA 3UJIH 3IETB 1DTUA 3TK1A 1EHKB 1RZQA 5HHNB 1AC6A 4XGZA 4FXTA 2EEBA 4HX1A 5HYJB 3OR7A 3SBWA 3ZE1B 1SFCD 5HHVL 5GS0H 1HYRC 4KDVA 2K0RA 3DPDA 2L4OA 1H5BC 5HY9B 4L8CA 3MJ8A 2FSEA 5AW7B 1S9WB 1I9RL 3ALWA 2IZ1A 4HXAH 4JJ5A 4BCZA 1QZNA 2DQIL 4R84A 3TH4T 1A25A 1HAWA 2DQJL 1LO4H 4NUQA 4XNZC 5LVEA 4G3YL 1C8QA 2WK2A 3SE3A 3STZB 3CH8A 1EO5A 4DVRH 3QG6B 1A6UH 3FT4A 3ARGC 3BPNB 4HC1A 4FXKB 1RVFL 4GEIA 5I8EA 1JVKA 3AXLB 1WAEA 4FS0A 3MJ9H 5E79E 3D50A 3JT2A 5D71L 4OJDH 2DV6A 4LOEA 4Z7UB 3BE1H 5IHWA 4YXKL 3OB8A 1B9ZA 5JW4N 2EZ0D 1J0KA 2V2WB 4OF5A 4PHXA 5DYOB 5BO0D 2CDGB 8FABA 5IP4A 5ACZB 1BYPA 3L1OL 1TJXA 3QQDB 4HEPA 4CSTA 1N18A 1XCXA 1N0LB 4MSWB 3BKCH 2HRLA 5H4YA 3PGFH 2EH7H 2K9FB 2WYIA 2NNAA 2YGOA 5FYLL 5T3ZD 1A9EA 3E6FA 4JL2A 5E9NA 4IMKC 2PMZA 3SCMC 32C2B 2AXJA 3QK0A 3IDJA 4OGYH 3L7FB 2DD8H 4Z8FL 1Q7YQ 4M6NH 3EFGA 3T2PA 1XIWB 3DETC 5LCVA 3D69B 4PLNC 5ELIA 1BV8A 4MB5A 4Y2DB 5EUKB 3KBEA 4TT3H 4Q97A 3MLXL 3ZE0E 1IZNB 1EBAA 1WIOA 2X44D 4WI5A 4NZJA 1MQ8A 3IGKA 1J10A 3L5JA 1NC2B 3DX3A 4L0ZA 3MOBH 1DFXA 5AALA 3FCGA 3NEEA 3WKMH 1FC2C 1RU9H 4M7LL 1ZV5A 1BPLB 1FCCA 3Q1MA 2MNWA 1FFOA 4GBXD 4HFWB 1ZS8B 3VXRB 2ODHA 4PWEA 2EICA 3C5ZA 2NPSA 1YHQP 2LGNA 3E1ZA 2BIPA 4OUOA 4JLRA 4M7JL 3UPAA 4ETQB 2ICWJ 5BUGA 3HC4L 4G8EA 1LT9B 3QUMH 4C55A 2P9RA 2VLKD 3DRTB 5BVZA 5DUMH 1AD9B 3BFQG 3O9WA 2DQDH 4LLDA 3HUJF 2EVHA 4HIJB 3WTTA 4H5SA 2DKSA 4KXZH 1G7PA 3NCYS 1SEQL 2B14A 3L74D 1A47A 3MYJB 1JFQH 2GHWB 1J5HA 2WKOF 1YNKH 3WTSA 3FOLB 4NKIH 4NQUA 4DK6A 5MEND 2OV0A 1FJ1A 2Y1ZA 4YNYB 4XVJH 4OZIF 3PWLB 4PJEA 4UQ3B 4D7PA 4E9LA 5T3XL 3MREA 4M3JA 4ODVH 4ZFOL 2JKIS 4LL4A 1MFCH 4GIAA 3AU0A 2F74B 1KJ3L 5HXMA 2E0PA 4H13C 2K3HA 3QCVH 3ESMA 5AWNL 3GMAA 8CGTA 3QRFM 1C08B 2VXVL 4R26H 4CC1A 1BHGA 4PYHA 4ZOEA 3K0WA 4AQ1C 2R1XB 4HJ1A 1EGJH 4Q6KA 1CT8A 5T1KB 1DQML 4NJ9L 4UDUB 1N7SA 4FX5A 3EGXB 3FO1A 2I7OA 3WY4A 1QRND 3VRJB 4MAYB 3KW8A 4PJ9B 3M0DC 5F8QC 1T1ZB 5EUOE 2DLFH 3FFDB 5EB9A 5CCKH 2K6ZA 2VC2B 3UROR 3NCXA 3AG4B 3BP4B 4CDGC 3MXWH 1KCKA 4YO0A 1YHPA 2DQ6A 2WN3A 4ZD3H 1I7TB 2YA0A 2Y72A 3FQWA 3JWOC 4RZKA 5KBNC 1JFHA 1X9UA 4XXWC 2MQ0A 4GLRH 3BAYA 2D3VA 5LXGH 4KUCD 2Y6SD 3G9AB 4DW2H 3FQUB 5AVSB 2AQTA 4EDXB 2QVTA 3SKOA 4KROC 3REWA 4JDVA 2VIRB 5FUOH 4ENZA 4XR8C 3T3PB 2IBZI 5KLIC 1MFUA 2YRBA 3OAUH 1KB9D 3GUFA 2D2CB 1NPJA 4GMSH 3LZFL 4IKIA 4PI0A 5HPMB 1DVTA 3Q1EA 5HYIA 1ES0A 3UBXA 2DN7A 3P3UA 2KOGA 4ZMPA 3GF7A 1SQXK 4D6TJ 2RA1A 2VLRA 3SD2A 1SQPK 3TGUG 1OAKL 5J56B 3FFCA 1LMIA 2YXMA 3NCCB 3QVAA 1NGZA 3S8WA 3KQGA 3G5VB 1PDKB 1NCGA 4XBEH 3VNYA 2FYNB 5TISE 1VQ7P 1JMXA 1LDPH 1MFMA 4IIZA 5D7HA 5MEQB 2ZSVA 2FQGA 2PCYA 5IB4A 3NJKA 1EZSA 1NPUA 2B08A 2WHVA 3D87B 3MBXH 4ONGL 1U8IA 2WBJC 1S9KD 4Z7VB 4KJPD 4R7DA 4MVBD 1CLYH 4GAYB 3X13B 5I1GL 3X3GH 2JJVA 4OQ1A 1RE3C 2BIHA 2EYSA 3LJ3A 4PD4K 3SYQA 4FQXB 2QKIC 1LYQA 1QPXA 4LEOA 2MJZA 4X7EC 2DMGA 3MV9E 1PLGH 3O0RH 1X44A 3VG0L 3LN4B 2YKLL 5EU4B 1JAEA 2W59A 4GNKB 1CFNB 3W67A 3APNA 4WI2A 4ORGA 4NNYB 4DT0A 3LQAH 1ZN5A 1SFCB 4HKJA 2ARJQ 4OB5H 2CK2A 1D2PA 3BP5B 4OV6F 3KPNA 3S34H 1R5WB 3ZW3A 1NH6A 1N6VA 3FX0A 5B1KA 1MJUH 4XAKE 3V6FB 3VMXA 3LPOA 1HXMB 4HKBA 4PJAF 4U49A 3VTTA 2ZZUT 1OSPL 4ILDA 3AVEA 4QT5A 1GGCH 1NU1E 4XMWA 3IMRA 1NMAL 4IRZH 4ODWB 5DWUH 4ZSOA 1ZHLB 1EO8H 1FZJA 2P49B 2VJ8A 3MPCA 4JFED 4PRBB 3B1UA 5FO2A 1K5NA 3TN0D 3RFZA 5IMMA 2XKMA 3HI6L 2WXLA 1DBAL 2LU3A 3U7WH 1ACYH 1G6RH 1P5VB 3WO4B 1D5RA 5I74C 3W39A 1YMHA 5EU6D 2ZXWB 3O4LD 5I6NA 2NXZD 4G7QB 3TBWA 4ZMZA 4P2QD 4LBEA 5IUCA 2G30A 1EC5A 1AD0A 4U7JA 3X3FL 1XXFC 2EIZB 5DJ0A 3C5JB 4NUJB 2WXNA 2P8LA 2WXIA 4P2YA 3T97A 1H3XA 2A77H 4RO0A 2WQUA 3K71A 3K2IA 2CUHA 4BA8A 4NRYA 4BZ2L 4NPYB 2C34A 4ZUSB 5C07E 1JXFA 1OIPA 2IH8A 4LNRA 1J8SA 4N3TA 1BJMA 1BVNP 1IBZA 3Q5YA 1NTDA 4MS8C 3GGWA 1SOKA 4YDNA 4KO9A 4XHJC 3TJEL 1HC1A 3IK2A 1RZKH 4MDJA 3HMXA 3F6IA 3JQOB 1G7MA 1G9MH 2VW7A 4GBXB 3VACA 1A6ZB 4P99A 1YY8B 4WUUA 3TCTA 2YNYA 1MF2H 1ZLEA 3K2MC 4JL1A 5EEVA 3RPBA 3GXMA 2N01B 4WTZA 1IFDA 1SNRA 4YZFE 4GMTL 1R3HA 4L5FH 1NFDA 5DS8A 2IPKB 4DK5A 2VLKB 4TNVF 2YEZB 3DO4A 5JOEA 3GC3A 4QRPD 2WT7B 3V8CA 1OTTD 4ZYKA 5GS0C 3ECUA 4PJXB 4GB9A 4IEFA 1WVZA 3VI4B 3CFMA 4HUWA 1P1VA 4ZODA 4HOMA 1RKRA 1Q72L 4HGWA 3H7LA 2NR6D 3JZYA 4UV4L 3QYCA 3IPFA 2IAMD 5EZPA 2ZYAA 3L74G 4B96A 3ZTNL 5MENB 5FB8B 1OM3H 4S2SA 5FKAB 4OZHB 2NUPA 1SBSL 1ZTXE 4MA7H 2DWDA 4L37A 1UXWA 3DMMA 4KKAC 1ZT4B 1W2EA 1JPTH 1FV1A 2MOGA 2PPFA 2V2TA 1Z32X 4MQXC 2RCSH 3ZE2E 4IHBA 2W07B 1WGVA 3DVIA 2V33A 4HKZA 3SGEH 4F8PA 3VXSA 4M93B 3IDXL 3I50L 4IM8A 4OFKA 3RKPA 3UL4A 3H2QA 3O2VH 3E6HA 2O6CA 4HH9B 2WANA 3ZHKA 1NANI 1QRNB 3L17A 2V3DA 4LPXA 1IBGL 1QEXA 3VXSE 4A67A 5C0BE 2BDNL 1T2KC 1ROCA 3H1HD 1Q9LA 2J4WH 3A6OA 3K3QA 1X7TA 4ZOCA 1AS8A 5KS9A 4PV9A 4PJIF 3O6FD 1QI5A 3GMNA 1Q9KB 1YQ4C 1X5MA 1XGRB 1N8OE 2QZQA 4OCWH 4ONFH 2K8MA 3UGUA 4EOWH 35C8L 3VH8B 1GZQA 4XP4L 5L8KB 3BWSA 2KHAA 1GGBL 5JA8B 4HZLB 2VW4A 3NRQA 5BU8B 3VH8G 1BF8A 2E5TA 3LH2L 1HN1A 1PMYA 3DHUA 4WF7A 1UZ8B 3MUJA 3FHEA 5LG1A 1YNTB 2YS4A 1XAKA 2XTJD 1OARL 3CFTA 4J7RA 2GI7A 4HUXB 1FVCB 2WLMA 1U8QB 5EF3A 3T0DA 4WV1B 3H1ID 2ZCZA 4B9IA 4XVTL 5F7UA 1LE5A 4FHBD 1KEGH 1MW3A 3SBPA 3ME0A 1DBKH 2GFBA 3NTCL 3HG1D 1KYDA 1WFOA 2XQYG 5IR1B 4K71C 1H9VA 4FMKA 1MPAH 1E8WA 3LNHA 3TX4A 3BD4A 3BW9B 4GSDL 3EFDH 1P4IH 1HOCB 4O02A 1RUPH 4OCYH 4YSTA 1BQSA 1N6QH 4EIZC 3THMH 3WIFB 3N06B 2ZXEB 3TBBA 3CU7A 3LN9A 1EBPA 5KVEH 1TEYA 3QEQD 4G5ZH 1J0ZA 3OHXA 2PW1B 2Y1YA 2R1YA 4YDKL 3MCYA 5D70H 4A6YL 2MTAA 1Q0XL 4ZK8A 1NDMB 1CGVA 3Q5TA 4E2OA 1ZVHA 1EANA 4I3SH 1KQFB 1NU1J 3CZFA 3CFCL 2YQBA 3D0VB 3SO5A 1D5ZB 4PBWD 3O6QA 4EVNA 3PRJA 4KBPA 1VKXA 5AOJA 1ORQA 1OTUD 4GT7A 1VGKB 4OF3A 4CN6A 2HYNA 1A3RH 4PP1C 4FHJA 5IQLA 2VO5A 3NDZE 4G71B 4D8PB 1Y7VA 1Q8MA 3TFKD 1N0XH 3UO1H 5I66B 3ETSA 5D7SL 4IIQC 4L3CA 2G9KA 4RDBA 1CVSC 1MZZA 2BEQD 3HHMA 4N8UA 1AS6A 2AEWA 2QBWA 5BS0D 1X4ZA 4JFEB 4U6YA 2G9HA 3HD7C 3RK2D 3M17B 4HJGA 5I0YA 4NWUL 3J07A 5EIIG 5F1IA 3A24A 4QRQB 5AVQB 4JPZB 1NMBL 3TN0B 3MCKA 2ZXBA 1JZJA 1SYSB 4ADIA 2E27L 2QGDA 1UOWA 3KWTA 4AT6B 2KYIA 1KILC 2NY4D 3CXDH 5EU6B 3RL1A 2EVJA 5D9SA 3T0AA 3O4LB 2GUSA 5FDWB 4Z3EA 3N2JA 1VB9A 2NXZB 3H1KE 4FNRA 5AG8A 2JKXA 5CU5A 1IEAA 4P2QB 4RX4D 4RRPM 4XWOC 5E8EA 1W15A 3KGRA 4KKBC 2H8PA 4YAQB 5C6TL 1E50A 3DX4A 1T03H 3O3DB 3RY6A 2F19H 1LK3H 5IVXE 4PJHA 2CHWA 4N2DA 1BDYA 2BM3A 2BVOB 4BQ9A 1YEGL 3CZEA 5EHFA 4E9VA 5M95B 4QY8B 1JZGA 3QNZB 2R5DA 4WCYH 2MCPH 1AQHA 2WLYA 1WO2A 2NPLX 4X6CB 4U6XB 3I9GL 3ASNB 4DWHA 4KNQA 1SOXA 2CIIA 5J1TC 5LLIC 5HPOA 3II2A 3N0PB 3N41F 1FAKT 5HI5C 5CZVH 1OGTB 1JN6B 1WWAX 4PTUA 1ZLLA 3IGFA 5CR1A 1CGXA 4IS6B 4YHLL 2ZCHL 2V6HA 3V4QA 3PWJB 4X0NA 4WW1A 4L8DB 1P53A 1NAMB 3TNNB 2XV2A 3LQAC 4HWBA 4RGNE 1EFQA 4YUEL 5F9JA 3FUHA 3MOQA 4QRPB 4PJEF 1EAJA 3SHSA 2NLJB 4NQXB 3ZMNA 5ADOL 1AQTA 2GI0A 3B9VA 2P5WD 2FO1A 4DFHA 3STLB 3VFRB 2VZ1A 1RZIA 1IC5H 4U1GC 2NUTA 5JPNC 2YIUC 3MFFB 4N0FA 1JBJA 1CLCA 1JTTA 4Y5VA 2IAMB 3DTXB 5DJZA 4D9LH 3K6SA 3G5XB 2BERA 2XICA 3Q8CA 1LTIC 1H88A 1TTGA 3MJ9L 3QUZA 4YGVB 3REVB 3KLQA 4Z7NE 4EEEA 1FFPB 2CXKA 1BYNA 4RAVA 3BE1L 5KSAD 1OT1A 1VEPA 4C7NB 1QFUH 2HR3A 7FABH 1ZK5A 2A4ZA 1XDTT 3ARWA 3IN6A 3EJYC 3B37A 4NC1C 4N5EC 1OWRM 3V6OA 1U8KA 4NQSA 5HHXH 3ARBC 1DDHB 2BC4B 2C3XA 1WHOA 4MDIB 2M3EA 1F1AA 2EH7L 4DP7X 4UNVA 1PZBA 2XFXB 3NJNA 4KRNA 2PYFA 4OGYL 3FQRB 5I8KH 2DD8L 5I6PA 4M6NL 1YY9C 5KSBA 1DJGA 1TJMA 2HRGA 3OPUA 4HC1H 4LLVA 3TT1H 3CCQP 5E8PA 3QO1B 4EUPB 4QOKD 4Y19D 3PG2A 2OSLA 1TOXA 4L1TA 2P8MB 4OTXL 3KPOB 2EJ1A 2NY2D 1TDQA 4EUPG 5DQ9A 3H1HG 2F5BH 3O6FB 1IKNC 4PJ7A 2VR9A 2QTEA 3WFHB 4HGMA 1RU9L 4JEGB 5L6YL 4F7KA 5EU5A 1N68A 5DLMH 3TGXA 3IPEA 4X98B 5I2IA 4G8AC 3TNMB 2D0GA 1T0NB 2H2PC 5CBEA 2Q86B 5HDRA 5KYNA 2ITCB 1G9MC 5C3LD 1LE9A 1G9NC 5DUML 3RBXA 3WXWL 5DMYA 1RI8A 1SMDA 2IOOA 2DQDL 4AZUA 4D9RD 2XTJB 2J8UA 2IDBA 1LTAC 4UDTB 3QO0A 5AL8A 5LCVH 4Z78B 5AZ2H 2ZG2A 2F68X 2Q20A 4NO0A 2K8QA 3G5YB 1N59A 3BVTA 5CSZA 4DVBB 5DJ8B 4DPBX 1FC1A 2JI2A 3QG7H 5F44A 1KGYE 5FYJD 4NKIL 4BKLA 3HG1B 3L7EA 3H1IG 1GW3A 2W60B 3LKOB 1F00I 2G3NA 1NFIB 3MLUH 1XL6A 2V7HA 1ZOYC 2FQEA 5C0GA 1Q9WA 4PJGE 1E9PA 1MY7A 5DA4A 1KYAA 4TQEH 3C60A 4EI6B 4OI7A 3QCVL 1JZ4A 3R19A 2XN2A 1GTWA 2JJUA 1R5VA 3MV11 1F4WH 4R26L 3QEQB 3ETTA 2ICEB 3FO0L 4ZFQA 2P5ED 5KN5B 1X22A 1I1RA 3SIKA 3VMNA 1JWUB 4N2FA 4B9GA 4BHUI 2ZNXA 3BIAX 2NRDA 1EAPB 3FT2A 2XKNA 4J4PD 1U33A 4OVVA 4X4MA 1E5UI 4EBQH 1N4XH 2GSGA 3DV6B 4L8SC 5KVFH 3LB6D 1X9RA 3WV0A 2DLFL 2R23A 1I8MA 1NCHA 5CCKL 4WENB 3L9RB 1L0LK 3U1SH 2W81C 3FO2A 4K3HA 3MXWL 4XP6H 1Z66A 3GF3A 4KV5F 3AS1A 1JNNH 3BUYA 4X4ME 2E7HA 4ZD3L 4XT1C 5CHXA 1T89C 2C9UA 4R4FH 4IK6A 4RKUJ 3ROOA 1R6VA 3OKOA 2NTFA 2DM2A 2Z35A 3ULSA 2DIAA 4WW2C 4WKZA 1WZMA 2BRQA 5BNXD 5LXGL 2ZTBA 1TSHA 5GZOC 2B3IA 1JHKH 2EP6A 2IWGA 3QDJD 3RTLA 2XZRA 4X5WB 2Y7QB 5EEUA 3H1KJ 3BGFB 1AV1A 2HJFB 3GXNA 4U0QB 5FF6B 5FUOL 5BS0B 3EDJA 3OAUL 3RK2B 4GMSL 3ZDXE 3C5SB 1I1FA 1A4KA 1T2QL 3G5WA 3R7QA 1CGWA 2YGPA 2QQKL 4FULA 4RAUB 4F93B 4KK9D 3FZUC 1ETZB 1GYWA 1KBGL 5I15H 1Z7JA 1OVVA 1TQVA 2NY4B 2DM7A 5GSRB 1Y07A 1E27A 3FU8A 3MO1A 2DAVA 4WTWA 3MRJB 4FXLA 4CU8A 3RWCB 4EN3D 3TP4A 1SQXD 4ZT1A 5K1VA 1YMMA 2HJKA 5HJGA 5JO5A 2FHCA 4H40A 4XBEL 4W80A 1LDPL 3FPXA 3L4VA 4NHUB 4Q6IC 2ARWA 4ZMWA 3ILDA 4YOKA 4LSRH 1BF5A 3MBXL 1LEKB 1YMME 4PQXA 3RFRA 4JREB 5M1BA 2WQVA 3LEYL 3CN0A 4LDLB 4NFDA 5IM7A 5F9WC 4N8CL 4P59L 4F7CA 1PLGL 2CO6A 3O0RL 1HH0A 3QZWB 2YOCA 3WJLC 4PEEA 2HTLC 3AWFA 2L5GB 4AX3A 3HJ0A 3QZWG 3FHAA 4HUNB 4B9FA 5F1NB 2HG0A 4JAMB 4LKXB 5F89A 3V9CA 1HGVA 1GRWA 2NCMA 4OB5L 1GY1A 3BZFB 2FECL 2FHBA 3B5NC 2BXZA 4HJJL 3S34L 5DHVA 2V9UA 3T0EA 3X11B 4JCLA 1YPZF 5M94B 1MJUL 5AEAA 4X8GA 1M6OB 4XCCH 5TDPA 1GGCL 1IC1A 2P5WB 3RYMA 5I75C 4JKPH 1KCUL 3DHJA 4PJ8C 1A4AA 1HTYA 3AXIA 2DF3A 1EO8L 3GHEL 3TYGH 1K72A 1RD6A 5HHMD 1SM3H 2H2SC 2ARJA 5FA4A 4FZEL 2XZAH 2FEJA 1NBVH 1R17A 5KSAB 1ACYL 1G6RL 4JRYD 1URZA 1A4CA 3C9NA 3KNBA 5C0DA 3LYRA 1AOHA 2WMPB 1EAQA 1UB5B 3H4FA 2VMDA 4PLKD 3GMOA 4ECNA 1GCFA 5DZLA 1SY6A 4F33A 3MRNB 1T3JA 1UD3A 3IWUA 1YDPB 3C12A 5SWQA 5F97E 2A77L 1IFIA 1WT5A 4YDZA 1XF1A 1CR9H 3UP6A 3HI5H 4NPJA 1KN4L 3AFLA 3QIBA 4IIQA 2LXBA 1GOHA 1N2RA 3NJXA 4QOKB 2BSRA 4Y19B 4CKVX 2IADA 2Y6TE 3P4MA 1ZGLP 5BUPA 2VDQH 3BDXA 3I84A 2NY2B 1U8HA 2EDNA 5D7IA 3BEWA 1DLFH 3FYIB 1MJ8L 1OSYA 3MRIA 3OB0H 3RTQD 1NKRA 1RZKL 2RJMA 3QB7C 4JO8A 1O6TA 4H8VA 4LCYA 4P5TC 2FX8L 2WJ5A 3BESR 4YR6B 1HL5A 2WCGA 1O7VA 2BCMA 3RI5K 4HJEA 3HC3H 2Z5IA 1MF2L 1K8DB 3OLGA 4BCYA 2Z31C 3FUFA 1N3NB 1RAMA 4DKAA 3MTUE 2NY5L 2N1TA 4Q2ZA 1NWQA 1OSZB 1G7HB 3K0YA 1M90Q 3K6FA 5GGRB 5EBWA 4I4WB 1L0XA 4S1SH 4DUWA 5AENA 5HYJE 1INQB 2V9QA 2ZXDA 2AQNA 3ZE1E 3EJRA 2WO2B 4PRID 4OCLC 1KV3A 4HHWA 2RACA 2H26B 3CCEP 5FM8A 1J8HA 5CBNA 2EH8L 3JV4B 4HWZA 3PY9A 5CWSA 3RL0g 5CP7B 2EIDA 1U3HA 1HQ4A 1Q1JL 4I0PC 5GGUB 3TVMB 4AL8C 4BH7B 4NZUH 2IO5A 2A6JB 3LZNA 1K3IA 3CQFA 3U0PB 4ERSH 4MA7L 1HHGB 2XKUA 1RPKA 3LN5A 4MJ6B 1VEOA 5HDLA 1PLAA 2Y5EA 2WSDA 1CXIA 3VJ6B 2VDKB 2V2WA 3U46B 4ZXBC 5J11C 4UYPA 4JFTA 5CFHA 5ACZA 1NH4A 2RCSL 5HDOA 4M6AA 4Z7UE 4WUKH 2CM5A 3SFDC 1USEA 2XXFA 3NJHA 2P5EB 1MN4A 3IPBA 3S9OA 4S0HA 4KZDH 3MJ7A 3Q8AA 5K5GB 1GU5A 4NM4H 3ROLB 1YJNP 3L3GA 1N2DC 1ZTXH 2WWMD 2QADD 2J25A 5C2BH 4TVPE 2K70A 2YJLA 2C26A 2ODIA 1RURH 3D69A 3SQOH 4LOUC 4Y2DA 3T8VA 2X2HA 1EX0A 1BE3G 3Q13A 4J3OC 1QFWI 4OF0A 4OFYD 3I2CL 4JE4B 2J2ZA 5FCUL 4XI5D 1F11B 1U9KA 4XZ4A 3SDAA 4OCWL 2OBGA 4XN2A 3VMAA 4EOWL 3AXHA 2VUYA 5TJWK 4XOBA 4ASWA 1F41A 3QDJB 3MUGB 3KYAA 4QD2E 3EO1A 2DM4A 1J0YA 1RH5B 3VXRA 1CPUA 4Y5XB 4HKZH 4Q8BA 4XN9A 3G6EP 2WVVB 5ISZD 3QFJA 1CDIA 2VNCA 4F7PB 3MZGB 1HSAB 2APFA 2I9TA 4XRCB 1M57D 1SHSA 2FFDA 3RX8A 5H35A 5IWLA 4AG4H 1KNOB 4H44D 1LT9A 3QUKA 4IDLA 3VXRE 4JFZH 5GIRB 5TK2A 4NAMA 3FU6A 4JRXD 4PJHF 2P26A 4PJ6A 1YEWA 3V5KB 1EHLH 1ZCRA 1VEMA 2ZX6A 2H7WA 5J06A 4ZAKC 4EN3B 5F7BA 4C56A 1KEMH 3SSUA 2WZ5A 1KB5B 1W0WB 2ZP0T 4FLOA 3MGTB 3MP7B 1DBKL 1SQBE 1FS0E 4H25B 1R9FA 1BZ7B 3HNSH 3U6XA 1C16A 1UM5H 3WKYA 3VSUA 3N43F 1HFUA 1YC8A 3BGAA 1KORA 1XB6A 1MPAL 2X2JA 3HE6C 4Z0BH 3VWKA 2HTKD 5I0XA 3EDKA 2CLVA 4G59C 4G7RB 3EFDL 4LU5L 5KAQF 2UUDH 4KTDH 3GBMH 1RUPL 4OCYL 1KQSO 1F4XH 1RJCA 3THML 4DKTA 2VDNH 3BGMB 1JUNA 3PFUA 3GSNB 4ZTPL 4I77H 4PI2A 4GPVA 2F74A 3A2AA 2APXA 4UB8H 2BY2A 4JPWH 5KVEL 1ZEAH 4G5ZL 4NKOB 4M1GH 5C39A 1MJJB 4MJ5A 3T8XB 1P0SE 4TTDC 5DZAA 3VG9B 3CFNA 2ZG1A 2XWZA 4JQVC 4XCNB 3CFJB 3DDFA 4OCRL 5GPRA 4RMSA 4FABL 4XX1G 3LKNA 4X6DB 4D2NA 2XXGA 4U33A 5DRWB 4HIQA 4I3SL 3RUGF 2QJYB 1W8NA 1BSNA 1ZKAA 4OU3A 1TYJA 3PH0A 1FDLH 2ZWLT 4U6HA 1JZ3A 4QHLB 3NIFF 2FXPA 4MAYA 1P5UC 4GIPD 3ZY7A 1T1ZA 5C08D 1MRFH 2UYLA 3FFDA 2ZNWA 2ZD0A 4GP4B 3GO1H 1A21A 2VXQA 1GOGA 4NIKB 2NNFA 5J3HD 4RMUA 1U3ZA 3AWGA 4K94H 5CHNB 4XP5L 1X6LA 1KDIA 4O02H 1J9RA 1BPVA 3CG8A 3FN3A 4M5ZL 1LDSA 4BUHA 1F90L 3KLSA 4K3EH 3IDYC 4KKLC 2IH1B 3BT2H 3QDMD 5HHMB 4JZNB 2QPEB 2AEOA 2P43B 1I4FB 2VLJD 1ETB1 1YCSA 3HC2A 1AFVL 5ID0B 3UMTA 1HUCA 5AW5B 3WN6A 3L81A 4JRYB 4K9JA 4MNGB 3C6LD 5CJQH 2NRGA 3OXRB 5J12C 4BJLA 2GPZA 3I3BA 3CXDL 2A9NH 3BH9B 3MGNA 3W0WA 4KXZI 3T3PE 3VE0B 5KSBF 5EPMA 5DYFA 1TEFA 1FNSL 2EACA 2A38A 3FTGB 4G1EA 4D3CH 1E79H 2NOYA 1MZYA 1T80A 2GTWB 4JQIA 4QO1B 5FYLD 3M1CA 2QELA 5AW0B 3UTTD 3Q8BA 3V0WH 2GJ6A 5DO2D 2H1PH 2JIXA 1KZQA 4WWID 1ZV9A 2JF1A 4PJ7F 1LK3L 1OB0A 4YBQD 1T89A 5MEQA 1GTFA 2Z0BA 4NYLA 1NWPA 1TCRB 2N7AA 5E5RB 4LE8A 4YHZL 1CDBA 2VRAA 1MHEB 3KPLB 3GRWL 2MSPA 1I8KA 3QJVB 5BQ7A 1U2HA 3WTXA 1NICA 4HJGH 3GMRA 4HWNA 4PMFA 5FK9A 5GZNA 1ED3B 4B9PA 4ODSH 2XXCB 4BK5C 4WCYL 3N1MC 2MCPL 2GUOB 1D7CA 1XQ4A 3WCYA 4BE5A 4KMQA 2NY1D 4Z7VE 1SLQA 3D4CA 2BFVH 3RTQB 3OKLB 2KLUA 2R8SL 1FZCC 2J8UF 4WJ5A 5EU4A 3LNDA 3AEEC 4KPHH 3C1LA 2B59A 1FZOA 3CLQA 3L37A 2CGZA 2PXYD 3KAAA 3OZ9H 3VVWA 1UA7A 3X2QB 5IB1B 4IFFA 5J13B 2NNCA 1T5XA 4YDVB 3KPPB 1ZA6B 4OKVB 5GTHE 4IMLB 5A2LH 3K5RA 2CPCA 3IFOA 3SO3C 4GRMA 4ODXB 2YD4A 1PGPA 4PGBA 4PBDA 4TYUA 2JK5B 4X5XB 1FF5A 2WVTA 4GLRI 4OIBA 3GM8A 4PRIB 1RHZB 4XNQA 3VD0A 1IC5L 3LIEA 5FO8A 3NQIA 2JQAA 3WMPA 3PV7A 4ODWA 4WNQA 3AAZA 4H0LD 3MHZA 3GKWH 3GPSA 4L9LA 4Z3FA 5T3XD 4RSYA 5AAMA 1XR9A 1DEEA 3L3HB 2OCJA 5IVXA 4ZUWB 2BIIA 4TOYH 2YMKA 1X5IA 3DUSA 2A9BA 2KB7P 3VFPA 4HFUH 5I24A 1W2BO 4JFOB 3BVNA 3QORC 3R06B 3L73D 5HHXL 4JFDA 5LN4A 2IBGA 1VZIA 2NTSP 3A21A 3FU0A 2IXQB 3NSYA 5DJDA 1U57A 4HWBH 2DI9A 3GT6A 3QYMA 4TUJA 2PLTA 1NKGA 1P6WA 4ANXA 3DJTA 5B1CA 3CUPB 1PGRB 4RBPH 1KYOH 2IANA 3V4PB 5B7MA 3M6DA 3BRFA 1R34A 3TT1L 4HC1L 4AGLA 4KK6C 1BA9A 1SJXA 4FFWD 5T3ZE 1ECYA 4LBAA 1IGFH 4MWFB 3GI8H 3B8SA 1BXUA 1QPKA 4FXGA 2XPZA 4GW4A 2F5BL 5D1XA 4FLRA 1QFPA 2Y7SA 4TSBH 3OR6B 1MCCA 2P45B 1VPCA 2E75D 1E30A 4X99A 2LVEA 5DLML 2Q6WA 2B16A 5AVTB 3SWKA 1VFAB 1URQC 1X5XA 2ZUQC 3DOIA 5IVOA 1KXVC 3D4GA 1SQBJ 5ISZB 1CFTA 3I6LD 4ZUUB 1NOFA 3T08A 1J8RA 5GS1B 1M57B 4Y4KC 3UTZB 3MRQB 4H44B 3TIDB 4PJDA 1FL5A 3CPWO 2VLKA 4QXGH 1S7QA 2V5MA 3SDXA 4X4YB 3L75E 5CEXB 1QSED 5LCVL 1AP2A 4JRXB 5AZ2L 6FABH 4AYFB 4TKWA 4A2GA 5HYSB 3K8LA 2VLKE 3L1FA 2B87A 4W68A 4WTXA 2D9QB 5E24E 3NA4A 3QG7L 1B88A 1T1YB 1BFOA 2ZE0A 5HYSG 3GMQB 4PJXE 2PP6A 3VI4E 2PTVA 2L7JA 2OJEA 2R0LH 2EDRA 2X38A 3FB8A 3MLUL 4X7SH 3S4SA 3S97C 3L74E 4L4TD 2WPSA 1R4XA 3L08A 3ZTDC 3TURA 2WOYA 3A6BH 3GIZL 4ZO7A 4FA7B 5CCHA 3DA0A 2X12A 2UY6A 3EOTH 4TQEL 4L29B 5MENE 1BFTA 4G8GA 2O1AA 2YZ1A 4B7LA 1MLCB 3MNVB 4ZS6D 5DVNA 4W7YA 4WY4D 4OZHE 4YJZL 4IJ3B 4Z7WB 3MBWB 2APTA 3V4WA 4UUJB 2C9AA 3ZK0A 3HVNA 3RIAF 2C1OB 3LPFA 3I3EA 4K3DH 1KTLB 1I8UA 3Q7JA 4EBQL 1N4XL 2NX5D 5KVFL 2FY8A 1H0DB 3HN3A 4UAHA 3NZUA 4OZGA 3KVQA 5E9DA 1QWNA 4Q6YA 5C08B 1KGUA 1PL5A 4XP6L 1JNNL 1K4DA 3OG6B 5C0CD 3GWJA 2XA3A 4R4FL 4UTAA 2AXFA 2XFGB 3HZVB 3RX9A 2LFEA 1QRNE 3CMEP 1OP3H 1RZPA 3PHAA 4DGYH 2CA3A 5E7FA 3JWNC 1XGRA 1JHKL 2CO7B 4CRPA 5E8NB 4A68A 3RX7A 4Y89A 1UH4A 3MC0A 1KLFA 2GTZB 3QDMB 3LZPA 1OEZW 4MS6A 4I18B 5HGDA 2HYMA 4W6WB 3UABA 4U1LA 2R2EA 2KQNA 1N9PA 2VLJB 3FKUS 3TBTB 3NIGF 5E6UB 3KXDA 2LAAA 5TQ2H 4D0CA 1A9BB 4LSQH 1S7VA 4CVZB 8PAZA 3TWYA 3C6LB 1UCBH 4HSQA 5SWSA 5I15L 3AEBC 4OZFA 2V8MA 4Z77B 1P7BA 3EBAA 3PXHA 1MVFA 2HAZA 1KB9E 1PY0A 2ZXAA 4FTVD 4AITA 5JHLH 1G84A 4P5SA 4JZJA 1IBFA 3NIDB 3UTTB 3HTKB 2HVKB 2J59M 5D7IF 5I1AB 1L4AD 1SLUA 5D55A 5GGRY 2CPUA 3UAJC 5CXPA 1D3CA 4BFGA 4N1CA 4M4RB 4PWHA 4NQDA 3PUUA 3QDAA 2IAAC 4NRXB 3TM6A 3WDIA 3CCMP 1D5MB 4JM4H 1DJIA 4W9FC 5DHYB 2Y9ZA 5IVNA 1C9SA 4PJ5D 1IGIH 3B9EA 4QWWC 1JF1A 1RUAH 3H0TB 4F80A 3KGSA 1MOEA 3SGEI 1GR7A 2WTRB 2NY1B 4JN2B 1SRDA 5CCGA 4JMXA 3P2TA 3QNYB 2PCFA 4PY7B 4QRTB 5DMIL 3V52H 1IE4A 1NDMA 3RY5A 4N9GB 2HKAA 4JKKA 3S35X 3UPRB 3RGBA 5B5EH 4DUXA 2PXYB 4ZQKB 4BXSV 4XWGL 4OFDA 1DLHB 2VTFA 2MQGA 4PJ0E 2OTKE 2YD5A 4R4BB 1CTOA 1MFVA 4U7MA 1MCPH 3DO3A 4B9JA 5F3BB 3H9HB 1LTJB 5A3ID 3GDCA 4XCEA 4UT6A 3BPLB 2PP7A 3BUIA 4JKPL 5KLVD 3WJMA 1ND0A 4I1RA 5JXEC 1U42A 3WL9B 2BNRD 4W9JC 3TYGL 4K94C 3FCTB 3NSXA 1SM3L 3TNUB 4H0LB 4NP9A 1WPCA 3AQXA 5EIIA 5IJVB 3IN2A 3NJMA 4X8JB 4GG6B 1EUUA 1PW3A 1HH6B 4ZFOB 1A6VH 2NDGA 3T0XA 2VDOL 2P3YA 1U4FA 3TN0A 4M03A 2O3JA 3JTBA 4ATWA 4Z7IA 4JFEE 4OLVH 4AT6A 3MI6A 1U41A 6PAZA 4Y1SA 4P2CG 3NCMA 3T04D 2A4CA 5FDWA 3PS6A 3VI3B 4IOIB 4U3FG 3L73G 4P2QA 4DO6A 4RETB 2EE9A 5EU6E 1BZ9A 4P5MB 4R5XA 3O4LE 2ZWNA 3LD8C 3JVFC 1FNGA 3MLWH 5I71C 3ZDYB 2ADYA 2DMCA 1CYWA 4P2QE 1AY1H 1IU1A 1FDMA 4C7RA 4DZBB 3UBFA 3AREA 3NK3A 2VDQL 1TVBB 1S5IH 2HP4A 3TPUB 5A43C 1R24A 1FVEB 1T1XB 1MY5A 4ZMAT 3KLAB 3OAWA 3EH5B 5J1AB 3L75J 2ICWI 2E75B 3UZQB 1SQQK 4AKOA 3MGOA 5K59E 1CICC 3HC3L 2PWEA 4PBVC 4XVUC 3S5ZA 4A2DA 1INEH 1UUNA 5GGTA 1GIGH 4X6CE 3HUSC 1SY6H 4UAOC 2R7EB 3TF5A 4XP9H 3CI9A 2EDHA 4N2EA 4H1LA 2AK4A 2Q7YA 3D7PA 5JW5B 1U93B 3B4SA 5GTIE 3IAOA 4RRPG 4BWUA 1E8YA 3TNNA 5B66E 3L74J 4NC0B 2VL4A 1OGAD 1PQZA 4S1SL 2NXYC 2F8VA 2OL3A 4U2YA 1QSEB 1GJUA 2AJYL 1MHPH 2NLJA 1B4TA 4LSSH 3N40F 3MLTB 4P8QA 1NKNA 3OX8B 4QHMA 4LAQL 3NFPA 3STLA 2XG4B 1UADC 2WAHA 2Y7MA 1QTPA 2IX7C 2NR6A 5L4MA 4LPUA 2OMUB 2X6MA 4QRPE 2ZOKA 4NZUL 4PS3A 3CD6P 3HMXL 3MZWB 1I9JH 4L4TB 1SF3A 1U91A 2Y25A 2PR9A 2YAMA 4B53A 3BH4A 4MNHB 3EOBB 3HOGA 3MX0A 4LF3B 4PRPD 5J9PB 3KL0A 4JGMA 2W91A 4JE0A 1G0DA 1SVBA 4HKXA 1D7BA 4WY4B 3ENEA 4N2LA 1BP3B 3B6SA 4V11A 5LBVA 4TNVK 2WZAA 3F64A 4PJFB 4QRBA 4KZDL 1WBZA 1QHPA 4J8RA 2CBTA 1G2CB 4NM4L 1GGUA 3OGCB 2K6YA 3KPEA 2QSTA 1ODAA 3KVPA 2XIBA 2NX5B 3GRGA 3QNFA 4YVNA 5C2BL 4HYTB 4XOEA 1AGBB 2NZ1A 3SQOL 1PL3A 1S9XA 5E99H 3QO1A 1LWJA 4PLOB 4ZMDA