5AVTB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avtB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avtB02
1FOSE 5APWA 1NAFA 3A3YB 5AW7B 1MFZA 1OXZA 2P2UA 2H7HA 1A02F 2W27A 2WPSA 2R3CA 2WWWA 3O8ZA 5APUA 1G2CB 1GK4A 5AVQB 1YYCA 3M9BA 3MGNA 3HE4A 3MD0A 4AUWA 3VN0A 3NFQA 1CZQA 5AW3B 2WT7B 2Q5UA 2Z5HA 1H8AA 5APXA 2YNYA 2Z5IA 3NTNA 5AVWB 1JUNA 5APYA 2E43A 2R5BA 3HE4B 3TK1A 2ZFCA 3B8EB 2C9NY 3HE5B 3M0AA 2WPQA 5AVZB 3VMZA 4AYCA 5AVUB 2IPPA 3KDPB 3I5CA 2E42A 3P32A 5AVXB 3L37A 3A7OA 1A02J 3KQGA 1JNMA 1OWAA 2KP8A 3P7KA 1KQLA 2R5DA 1GU5A 3HE5A 1SLQA 1X8YA 2Q7CA 4EOTA 5APSA 1SP4A 2XV5A 5AW4B 3A5TA 3M91A 3VMYA 1CI6A 1CSBA 5APQA 4LC1A 1H88A 5AVRB 4XE5B 5AW5B 3M9HA 3V5BA 3V4WA 2W6AA 1IO4A 3T97A 4B86A 1GK6A 5AW1B 3HTKA 3VMXA 3SWFA 4DZOA 4GT1A 2P7JA 3WGUB 4AQRD 5AW0B 5APTA 1FAVA 4HYTB 1FOSF 4RETB 4M3LA 5AVTB 2JJLA 2VRSA 1HUCA 3M06A 2XU6A 4JYBA 3P8MC 4KHXA 4I6MC 5CMZA 2BASA 3UIAA 1T2KD 4I2LC 5AVSB 4GKGA 1J2JB 5AW9B 5AW6B 1MV8A 3LIDA 2Q3IA 4C7NB 3VYIA 4JYCA 3TNUB 2QM8A 2N9BA 5AW2B 4C46A 3M0DA 1S9KD 1CI6B 2QM7A 2WT7A 2P67A 2XZRA 1NWQA 3IR9A 3WGVB 5APVA 3LIEA 4C7NA 2YO2A 3NMDA 3L36A 3TYYA 1MUUA 1H89A 2WTYA 1GTWA 2C9LY 3OAKA 3TNUA 5AVYB 1HJBA 3NXSA 5AW8B 2YO3A 1HBWA 1GZLA 3L35A 3A2AA 1GU4A 2ZXEB 4RESB 1T2KC 1HWTC 2WPRA 2R32A 3VTPC 1S9KE 1GD2E 3V4QA 1DH3A 5AVVB
chains in the Genus database with same CATH superfamily
5D5ME 1YNLH 3Q6GH 1MLCB 1FZEA 1L5GA 4QY8B 5DVKA 3TO2A 1PW3A 4Q9RL 1EZVD 5BNXD 4LOFA 5E8OB 1ITCA 4OGQB 2HUEA 2V5SA 4PW4A 4B5ZA 2GFBA 4C4KO 2Y1YA 5AYUH 1T03L 3BKCL 3GKWH 3EO9H 4D6TD 4U4BA 4XZ4A 2FYZA 4F80A 2YRLA 2IF7A 3PIQA 3FONA 3QJOA 1J5OL 3MUGB 4A39A 4P99A 4L8DA 5T3ZL 5IHHA 1LNQA 4Z3TA 3QUXD 3QWRD 4LVHB 3NSYA 2Q9IA 1MPAH 1TR7A 1UD3A 4PJHB 4MZRA 2N0KA 1YEFL 2OL3L 2ZT9B 3N4XA 1TVHB 1NCNA 1RK0B 1W8OA 2ADIA 3M7FB 4XN8A 5BJTA 3IBOA 1UACH 2OP4L 3I6GA 4BV1A 4OFQA 1ND0A 4RGOL 4XNBA 2UVEA 3BZFA 2OJEB 4AYFA 1DBMH 1QA9A 4L18A 1EO8L 5DQ9B 1KB9K 3UGXA 1PLCA 2DMKA 1K6QL 2A9CA 4G3YH 4V11A 4PJ6A 2EEDA 4ASWA 5AENA 2HH0L 5KZCD 2XQBL 4IIQA 3KXFA 4NJAH 2LAGB 3O3EB 4WW2B 1ZOXA 3ZBMA 3IDMB 2I5YH 5IG7B 1N70A 3TH4T 1BCCD 4AW4A 3L72G 2W6BA 2AK4E 4XXDA 3C6LA 1DJSA 4WO4C 4PTUA 5FYJU 4Z1MH 3FRPG 3RX8A 3V0FA 1S5HA 1K04A 1I8UA 3IKCA 2HPOA 5DQDH 3MTUE 2FUTA 3ITKA 1S7QB 3V6BR 1XGUA 3UTTE 3ZHNA 4YWGL 3U0WH 3HZKB 4WKZA 3U9WA 2D31B 5TE4H 5AVSB 2PTTB 5F96H 4U1GB 5FCSH 1N26A 1U9KA 4FQXC 2UXTA 3LIDA 4NPDA 2WYTA 3GXIA 5DUBB 1A47A 4FQXB 3WS6C 4GKSA 1Y7VA 1QO3B 4WNQB 5CCGA 2FYYB 1ZHNA 1JTHA 3CCJP 1RURH 5TF0A 5K59E 3CX5E 2NTFA 2WN3A 5ANHA 2VDPB 1VSCA 3X12B 1IRAY 3OV6A 3MUY1 3QJXA 2A6JB 3MRJA 2J58A 1I1FA 3P9MA 1CBVH 3BAEH 1JERA 3FO0L 2ZF8A 2PPFA 1T0PB 1DJZA 3H3PH 3DVIA 4LASL 2KL6A 4JPZB 4KVNL 2DH3A 4IOSD 1IGML 2CDGA 3L3KA 5D4HA 1HE8A 4HSQA 4RMUA 2X41A 1KMGA 3VM7A 1CIUA 3MACH 4J3VA 2UV3A 1J5OH 3OMIB 4NKMB 3KYKH 2DH2A 5B7FA 5GRJL 2ENYA 2WXQA 4R26H 2X7LB 1SQPG 3M88A 4IRZL 5AQ0A 5C71A 4KKZA 2WLYA 3ECBA 3IDNB 1H8OA 3NESA 4HAGA 2V7HA 2AEJA 2QADC 3B1UA 1DSFL 5CZXC 4ZK8A 1D9KD 4IRZH 3BATA 2IXQA 2NY2B 1AIFA 1BG1A 1BAFH 2YKKA 4LCWD 4S0SD 5B1KA 1TQBB 1UB6A 3DBXA 2W9EH 3QORB 3QAZB 3IFMA 2W0LA 2X1QA 5FW6A 3C60D 1IGMH 1GZPA 4PGBB 5J7CC 1MCOH 3DOIA 4I2XE 3FB5A 2VO5A 4Q6IB 1KB5A 2WPQA 1SFCC 2WV3A 3VRLF 5DS8B 5TISH 3Q8FA 3MBWB 4XHJD 2K9FB 3MXVL 4IIQC 2ZYDA 4FJYA 3MJ7B 3CH1B 1SVZA 1YQ2A 4M43L 1XDTT 1I3RB 4OT1L 4NPYB 4PIBA 1FP5A 4ZJ9A 2VUYA 1CYWA 2BRRL 4MJHA 2NXYC 3TBYB 4XNDA 1TLKA 2OLDA 2PTUA 1YEEH 5F7HA 1WV7T 2OR9H 4RBPH 4DP1X 4JRYD 4QLWA 4U1KA 4Z3HA 3L75J 2YAPA 1J1DC 2KOGA 3IWVA 1CSBA 2ERJB 4NS0A 2NSQA 2P45B 4LIQL 4U4IA 4YFLF 2HLEB 3V0EA 4QNPE 3N7NA 4HDIA 1OV8A 1HXMA 3J07A 3QWNA 5F8RC 1ML0A 3TBVA 2ZXQA 3D85A 1LP1B 4ZMQA 1QPXA 2WQYC 3AAZB 2A83B 1P4BL 1HILA 2BZDA 4GG8A 1S7VB 5KS9E 2NZIA 2NYZA 1Q38A 1T6BX 3HUJE 3EXJA 2B4CH 3I55P 5BRQA 2YD4A 1TQSA 3ZTDC 2CHNA 1R3JB 4AEIL 4I6MC 4J8QA 4ZFFB 4YNYA 1E4WL 2O01H 1GRWA 1UENA 3E7JA 1SQPD 4YIQB 4KQ3L 4BKSC 1YUHA 5B3NA 4KK9C 2XY1A 3U7AA 4PJDA 2DM3A 3D1MC 2Y1VA 3FTVA 3E2HB 2VABA 5HGAB 4GUQA 1EPFA 3P54A 2GJRA 1BWMA 2WBWB 2E5TA 1E3ZA 2NNAB 4HK0A 2HODB 3AT8A 4WFFE 5AW2B 5D1QE 2ZOWA 1GYCA 3TL5A 2MJZA 1NUFA 1RUQH 3QA3A 1ORSB 5LG1A 4M02A 4Y1AA 1HI6B 4Z7AA 3Q8EA 3BXNB 2C9LY 3QUYA 4P46B 5EOCH 4OQ1A 2J4WL 2FYNB 4H44B 5DA0B 3FO9A 4KI5E 1MREH 5FFGA 4LU5L 1KD1Q 1QI3A 1S5LE 5MEOA 4DP5X 1CLOL 1T8ZA 3GUFA 5JUEH 2V7HB 3LNGA 4CU6A 3T9WA 3MRBB 4J3OH 4PS8A 3I6LE 2BCMA 1JP5A 1UM5L 4JFZH 4RWHA 1JPST 1E79H 1CL7L 5T3XL 1M7XA 3GO1H 3BP4B 1IBBA 5I0ZA 5I1CL 4GSDL 3UZVA 1AGFB 3QDME 3W68A 3QYNA 1SLWA 1LD9A 1S9XA 1Y1DA 4QHLB 5H8DA 3Q6GL 5K39B 1I8MA 3I3EA 5GS0C 3R8BB 1KELH 3O6LH 3M1BA 1O6VA 4XNQA 3SYOA 1N4XL 5B38B 5DHDA 1ZLUH 3EF4A 4MLSA 1MCQA 4NENA 2AV7B 5HGBA 1NFKA 3NSDA 3OPZH 2WIIB 2Y9YA 3LNFA 1YHPA 4XR8C 3QIUB 1LP9A 1JGUL 4WBAA 3VDBA 4ES8A 1BREA 4AGLA 1HSBA 1PKQB 4KX8A 1XR9B 3LW5H 1G9ML 1S3RA 3FHQA 3VD3A 5BQ7A 1QATA 4XPHL 2NY5C 4QRPE 2ED6A 3EFDL 3BEVB 4KJYA 5CJXC 5DD1L 4ZFOB 2HTLD 2VLJD 3S88H 3CDYA 1AS8A 5EU4B 3H1LJ 2YFOA 2NYYD 3US0A 2X2UA 5EBLA 3EH2A 1LO3L 4UB6E 3ZMNA 4WTZA 2ADGB 2DTML 3QA3B 4GBXD 1AZNA 4GI8A 3BW9A 4F8TA 4PGEA 4AIEA 4F91B 1AJYA 5IOPB 3NCBB 3MJ9H 4AX3A 3QPQC 3CFKA 3PQYB 2A06E 1KN4H 1MJJA 1XD0A 1FBMA 4ZMVA 1I7UA 5B1JA 3M1OA 3V4VH 1X9UA 4ZI8A 5B8CA 1FFPB 4IMKC 4NQUA 4Z1PA 1EJOH 2XXFA 4ODSL 5C3IA 2N1TD 1ZA6A 4LGPB 1SJVA 3SGEI 4F7TA 1U3HB 1OM3L 3QO1B 1EZVG 2YKLL 4HXBH 5AW6B 2VDQB 4G9FD 1QX1A 1BGYE 1BQSA 3LYRA 2DWDB 5CFAA 4ELDA 3SOTA 1CXKA 1UWXK 4JRXA 4PRNB 3VA6A 4Y2DD 2WZ7A 1JGVH 1SOXA 2VLLB 3WL9A 1CDHA 2BSCA 4LCVA 4GRWB 2JJTA 1KXVA 5BRZE 5IW1A 1NHLA 2WZ6A 1W80A 3B6SA 4L4TB 4LSVH 5C0IB 5E00A 4GB9A 1NWOA 1M7UA 2WNWA 1RJYA 4JANB 1MHCA 5CHNA 1T1XB 4Y8DC 2H1LM 3LSOB 3CLFH 3SYAA 3GNML 4LSVL 4UU9A 1HBWA 3U6XA 2EEFA 1XGPA 5DJYB 3FT1A 4Z78B 4PCKA 1QUPA 4FHKA 3S34H 1GW6A 3NIDE 3UZEC 3NCYP 5DK2A 4B9KC 3HS9A 2M1KA 1NC2A 3S35X 2CBMA 4E36A 4J8RA 1WZ1L 5I6LA 2Y2TA 4A7UA 3GBML 4XODA 2ADGA 1H9DA 1I8LC 4LLUB 2I60L 4PJFF 3F7YA 2CPUA 4A66A 4ACPA 2X40A 4Z77B 3ULUH 2O6CA 3KYOB 4UUJB 1DQVA 2V6HA 4DCKA 2UZYA 1QHQA 2XG5B 5FYKD 4ZFGL 4Y4HB 1L0LJ 1XAUA 5JXED 5HDBF 5LBVA 1CDBA 1BGYD 1ODAA 2XTJB 3MD0A 5JOFB 1QSZA 2C9PA 5CZRA 5T3XE 2F54B 1UCBL 1HEHC 3HLKA 3DGGA 4Q89A 1FGNL 1XSJA 1PKQA 2XWTB 4FFZL 2JWYA 1S9VB 4NC2B 4AJ0A 3GXPA 4MAYB 1I3RA 1JUNA 2P49B 3C5XA 2R0LH 4UT6L 2X1PA 2WW8A 5HGGS 1KB9J 1UIXA 2WB7A 2GEEA 3CFEB 3D0LB 5JW4M 3QIBD 1PY9A 2VIRB 1J5DA 3SBRA 1J0HA 3V0VB 4Z8FL 3SIKA 2CK3H 1SEQH 4FXLA 1MCBA 4PB0H 4AMKL 1EMTH 4DK6A 3L37A 2VW6A 3QPQD 1P1ZB 2V9TA 5CLTA 5I30L 4X98B 4IL6E 2EIDA 5I71B 4GI6A 4LQ1A 3BT2H 4BQ9A 3PGFH 2AF2A 3HVDA 2LR4A 3AU1A 2KLRA 1MCSA 3ARRA 2XV0A 3IU4L 4K73A 4J7RA 1FNFA 3D4GA 1W72L 4G6AC 3BUYB 4PRPD 1X5YA 2MRYA 4BHUI 2NYYC 4Y8AA 3CDCA 5EC2B 3S35L 3U4KA 5I30H 1GJWA 2A45G 2EDKA 2EJ1A 1FC2C 2DYPD 3LMJL 4UI2A 5I74C 2ICCA 4NQED 4LC1A 3BFOA 3CC5B 5LN4A 3DHPA 3VQ2C 3EFOB 1CGTA 3FTZA 3SY6A 5F9DC 4EN3A 3MRHB 3ULVD 2BIPA 4GT1A 4UT7H 4FD0A 1L9PA 2W92A 3QEHB 4H13D 3MVSA 2HMID 1FE8H 1FVDA 1SXCA 4RFEB 4ORGB 7CGTA 2QQNL 2YXWA 4RMVA 4TVPH 3CMAP 3IJ8A 4JKPL 4Z7VA 1MHPH 2AEPL 3TT1H 4N4YB 2WQWA 2MOVA 3L2NA 1EGJA 1EEZB 1CTNA 4TSCH 1G1JA 3HAEG 3V4PB 2IH8A 2OJZL 5ESAA 3T5WA 3CWBJ 2WSKA 2Q8BH 4M7KH 2K7QA 4H1LB 1RK1A 1XBRA 4X9IA 2E9BA 1GAFL 5GGRY 1ZEAL 3Q2LA 3NFPA 4WFGD 2CJUH 3JVGC 4DK5A 4I0PC 2UZIL 1GMIA 4NCDA 1XH3B 5HI5D 1XGPB 2D03H 3KPRA 3NJKA 5DJYA 1W15A 5J9PB 2YGNA 2WLJA 3QIBA 2D2CB 3CN1A 4S1SH 3RWFB 5E2JA 1HTYA 1XGUB 3QEUA 4NWUL 1H3TA 3RUGE 1KYOI 2FJHA 3O3AA 3GZPA 1AOHA 4FMFA 4ORZC 1DSYA 3GKZA 2EXTA 4NFDA 4AZUA 2XFXA 3F3HA 2AEOA 1QP1A 2AXJA 3VWJB 1JMXA 3IXAA 4PJEE 3T65A 4LLHA 4C7RA 4F8PA 3RZWA 1MRDL 1U41A 3QH3A 1O75A 3QPXL 3ZYZA 3K2KA 4FYTA 2QHRH 4Q9BA 2WP3T 4X2UA 1J1PL 1TTCA 4KKQA 1CURA 15C8H 1EZLA 3RL2B 1NL0L 1ZTXL 1P4BH 1MXDA 2Q76A 5DFVD 3TFKD 2VKWA 1LNUB 4IBZA 5EEWA 3CJJA 4CBZA 3RK2C 1EZVE 1HL9A 5IOPA 5CCKH 2MKVA 5LCVH 4UQ3B 2A6KB 4B3VA 5MENB 4AG4L 3QZLA 3RL0g 2IAMD 2NCMA 2KC0A 4G59C 4XPHH 5IIEA 7PAZA 2OTLP 4FYSA 4XP4H 5E9DA 3LN5A 1A7NL 2HLFD 3WJJA 4KY2A 1JYVA 2WXLA 3TO4A 1AA0A 1PLAA 2K1AA 2N1TA 3TWYA 1WC7A 2R51A 3C87A 4WUUE 2L7UA 3TDKA 1NCBL 4IS6A 1QR1B 1BQUA 5D72H 1SFCD 1M57B 4LLVA 2IDSA 4U3XA 2Q86B 3A4EA 5JW4Q 3FHAA 4IRJA 4WGVB 4XNXL 3V6FB 1N4XH 2FYUJ 3E80A 3RY6C 4F8QA 3O6LL 3FQ4A 5BPPA 3JBG7 2CQVA 1G7JB 3GSVA 1YECH 3RGUA 4NKDA 4HW6A 1QR4A 3VD5A 1G43A 5AD0B 4ZDHB 3UEZA 1HKLL 4CSZA 2N0MA 4LL4A 1BF2A 1RZJC 1MFVA 2BIQA 3HBZA 5EV7A 4YDIL 4TL4A 3BN9D 3MCKB 4N0UA 1FIGH 2IANB 5CJOH 3TJHC 4JDVB 1RLBA 4XNMB 3L74G 1JCKA 2EABA 3OHMB 3DRQA 1CLOH 1AACA 3FSZA 4JFOB 5JDSB 1OSPH 2NPLX 1DBJH 4LFHD 1J9SA 2FUQA 3TV3H 4ZRGA 1VQLP 2XTJD 1PAZA 4NWTH 4DN4H 3DX0A 5D6CA 2K3RA 3PNRB 4ZTPL 3LEYL 2NXZB 1WTGT 3RDJA 1QABA 3CX5K 1TMQA 3VXME 4BUHA 2J8UF 4NNPL 3IRCA 3LH9A 4W7YA 4G43A 3HPJA 3IFPB 5L88L 3RL0D 3MLVL 1SHMA 1MELA 3D87B 4GBXC 1I9IH 1TKWB 3RVVC 4HJTA 3JV6B 4UM9D 2XN9D 1AQDB 3D8MA 4PLKD 2VC2B 3GM8A 4BSWB 4I9WE 1JCVA 4IBVA 5DEGA 3TO4B 3RPBA 3CFUA 3VMNA 1N7LA 4L1TA 3O6ML 2BVEA 2FEDC 1KCRL 4HEME 2IH1A 2A1WL 3I9PA 2YAOA 3LHPL 1RD6A 5E8NB 3SDYL 4X4MA 2CCVA 2Q1KA 2EKSA 2NR6A 5DU7A 2PFXA 3B9KC 3BAYA 1HZHL 3O3UN 4PJXA 1WLHA 1MWAA 2GSIB 3EDJA 4H2CA 4I18A 5EF3A 3CIQA 3QUYD 5I0DA 2YLKA 3N85H 3HE5B 1BOYA 3OKDA 1K4CA 1ZR2A 2AFNA 2CBPA 2P43B 4U0QB 5F6HJ 3LS5L 3VX1A 2XWJB 4OD1L 4PRIA 1H3XA 3NMEA 4ZMWA 3FQXB 5F93C 2C1OB 3WIFB 4EN3B 4Y4FC 2DW3A 1Q1JH 3MOAL 1QRND 5C6PB 2NLJA 1U8NB 2F74A 2V3DA 3QEHA 4KQ4H 1KJ2L 4OGYL 3B5TA 1SJHA 1NCAH 4ZODA 3QI9B 4IRJC 4DVRL 5HYEA 1I8MB 2VDRL 2LU7A 3ARBC 4R4FH 2FTAA 2OL3H 3V6FA 1EGJH 3H4FA 1RPUA 4Z0BL 4O2CB 1JL8A 1BVLA 3GRBA 1T3UA 5DVMA 5IROA 1MF2L 3GMNA 4HMEA 4L3EE 5KLIC 3M07A 2HJFB 2ICES 3BSZA 4HLZH 4LPCA 1Z9LA 2OTKE 1F3DJ 3ZMRA 5BW7A 5JOEA 5CUSL 6FABH 4RX4D 2K3TA 1YSOA 2JKJA 4GSRA 1PZAA 3STZA 1S4IA 3GLMA 4OUUB 4AMWA 1YPZB 3HG4A 1FJPA 3VI4A 4I3SL 4G80B 2YWYA 2XG4B 4PJ5E 3E1IA 5F7DB 3EOTH 2IAMB 3QH9A 1PGQA 4ZW5A 1JN6A 4R84A 2H6OA 1R17A 1RI8A 1XEUA 3U7YL 1DDHA 2OMXB 4Z7UB 1XCWA 4GW4B 1YYLL 4FG0A 1AE6H 3MJGX 1BJ1J 1QFWI 4H20H 5A2IH 2VL5A 5DJ6A 4F5CA 3KXFB 5MI0C 3EOYG 1OZTG 3OL2A 2WTYA 3IF4A 2BRQA 2E27H 2HVBA 5C0CB 1F2XK 2ADYA 2WWNA 2R8SL 4N8CL 4UAHA 4L2LA 2DJMA 3HVNA 1DO5A 1RURL 1AZUA 1AP2A 4J6RH 1JFQH 1VFBB 3NK3A 4EVNB 4N8VG 2ITFA 4XZUA 3KPLA 5ANMB 4YDJA 3C6LD 3W82A 3WNKA 3VGAC 4LE8A 4Y28J 4H44D 4Q74A 1RULH 2BSEA 5G4NA 3GUTB 3KJ4B 1HWGB 1KMIZ 2J21A 2OZ4H 1BGXH 2GSIA 3VH8G 2VLLA 1L4AB 1TF4A 4V1DB 4GY4A 1FBIH 3NIGF 4JPKH 4TSBL 1U42A 2YR3A 4M8QB 2R29H 2YIUC 4G6FB 3CHOA 2KUBA 5J11C 3HFML 5CCHD 2V5TA 2HN7B 3AXLB 4KMQA 4OH2A 5KVMC 4L73A 2GITA 4RX4A 3WSQL 5C2BH 4XN2A 2NY4D 4JHWH 2IPPA 1MHHA 4D6TJ 5JR1L 1GS7A 4L1BA 4XN9A 2ADJB 4WDIA 2F19H 4PVBA 2HH0H 2Z35B 4TUJB 5AL8A 1DVFC 2EIBA 4XPGH 1P84K 4U6TA 1NJIQ 5LBSL 3TYGH 3D9AH 3TVMC 1VEPA 2RN0A 3QULB 3WU1A 4AV0A 3H1LG 4PJGE 1BVZA 3N85L 3SKUD 1XB6A 2K4WA 3B7UX 2ZF9A 4A2DA 4E9SA 2NPSB 2HVKB 4YO0A 2VXSL 3G6AA 5ACZB 4HS3A 5TH2B 1N0XH 5EU3A 3A22A 1AIFB 3EJRA 4H8HA 1SDDA 2O5YL 3ME0B 2MMXA 5A2JH 4MAYA 2V0AA 3TH3T 1KCUL 4KX7A 2H26A 3EYFB 1CWVA 5CJOL 5ICUA 2CD0A 3MYJA 2B1OA 1LGVA 3BKCH 3GKWL 5CF3A 3CCMP 4QXTA 3EW3B 5AYUL 1GC1H 4NAJA 5EU7C 1Q86Q 3RU8H 1QWNA 3UADA 5MEND 1KORA 1LTBC 4JZOA 2QKIC 3V2RA 3RDTD 3CAFA 1BECA 1RZQA 3ARGD 3FCTA 2UUDH 5BZZA 4MMZC 4UQ9A 3LKOA 4JN1H 3V10A 3ZQXA 4LLWA 4XWGL 3HMWL 2H7WA 1ZMEC 4G43B 4WFFD 4K3JL 2NQ3A 1CK0L 3D51A 1DQLH 2JB5H 1MI5A 1BZ7A 4BE6A 3H9ZA 1N8ZA 5JMOC 2ED9A 4H8WH 4D8OA 5D5MB 4DP7X 3FYIB 2ICWB 5EF2A 1MUUA 2ZAIA 4P5TD 1XIWB 2BFGA 1AG6A 4PJCE 1IQDA 4KNSA 2MCPL 3WUWA 1MLCA 3L35A 1P5UC 4LCYA 1DCLA 3D12B 3EBGA 2KK7A 3FOMB 2ZXEB 1ZVSB 1AD0A 4KI5D 4PRIE 1QL2A 4YDIH 3ZQ9A 5JIKA 4WK4B 3U0TA 4ZFZB 1CBJA 4JM2F 3OKLA 1F4AA 1N0LA 4XBPB 4YC2C 5FUCC 1DN2A 3PREA 1JZEA 5AOKA 2ZONA 4EF3A 1SMDA 4H25B 3CCRP 1A7QH 2XQYK 5SWSA 3CC4P 1ET7A 2R0WL 4JKLA 1MCWM 1HHGB 2JKWA 2F5BL 4QRUA 5JHAA 5C97A 2XNAA 2XETA 1K8IB 4PW3A 4HEMA 5AUMA 3VXUA 2LTQB 4UIMB 4LEXH 4FI7A 5B22A 4AE0A 2HG0A 3CE1A 3BRDA 3FCUB 2XICA 1AGBA 1VEOA 3WY1A 3AE2C 2X1OA 4X4XA 1IX2A 5CJ0A 5E1AA 5CM1A 1MVUB 3IS1X 1W8EA 2CGRL 4WHTB 5KLVG 4ZZFA 1F4XL 2FH8A 2MIZA 4JHZA 1XCTB 2BSSB 5E7FA 3RWEA 1BA9A 2AGJH 3O3BB 4NM8L 3VXMA 5A2FA 2FWLB 1YITP 2W81C 5FA4B 1VQMP 2K3HA 4ZXBC 1RZGB 3B2VL 5TGBA 5APSA 1JI2A 5AW4B 3HUJB 5E4EB 4GQ9H 4XVSH 1U3NA 3OAUH 3W11C 4Z7VF 2BCKA 2FXPA 2IQAB 4WY4A 3F62A 3QBTB 2JKXA 1GZHC 1RUKH 1BD2E 3RIFF 4C4UA 5AW5B 4KJPC 4TLTA 3WNLA 2HA1A 4OF6A 4HZLA 4KROC 3OXRA 3C08L 4DZOA 3BAXA 3CCHA 3D34A 3O6FA 4AENB 4S1QL 1R9FA 4HSCX 2H1PL 1USDA 1XWVA 4PRHA 4YHOL 5B39A 1UYWH 1JPTL 3ZHLA 1MG2C 2EUZA 2VITA 4LSQH 3FCTB 4G1EB 1T2KD 3HE7B 4PY8I 1UH3A 3PAZA 3IM1A 4JO2H 5I1LB 5JIHA 2C0WA 3BN3B 4FQ2L 3QG7H 1N7MH 1YVLA 4H25A 1SQBE 1KJ3L 5IR1B 3NCEB 5EU5B 1X5XA 1WRFA 1PPJE 1CTOA 4NN5B 1EFXA 2ZXDA 3Q43A 3CD4A 3JUYA 4UZUA 4FQCL 1Q0XH 2QZQA 5DJDB 3KWTA 3MI6A 3ILDA 4MXVE 3L3DB 1WT5C 3BX7C 4XVOA 3OJMB 3RIFK 4PJXF 4X4ZA 5G4OA 1XIWA 1EEYB 4MTMA 2M2DA 4NN7B 2VZ1A 3BIKA 5E6SB 4UT6A 2W80C 4CUCA 5ICXB 1ZHKB 4E41E 1K2DA 3PP3H 4IQHA 1DEEA 4K9JA 4N2HA 4YGVB 1H89A 3N1MC 3U2SB 2ZCHL 1JZ3A 3D70A 2WWKO 4V2CB 4WU7A 3QDGB 1KWGA 3IDYC 1U8PB 1F8TL 5EO1A 4X6FB 1R24B 3BT2L 1S3JA 4NRYA 1CXIA 1FNSL 5T1KD 4PJHE 4J1UB 4QRRB 3SDXA 4UDUA 3KWWB 1SM3H 4MA7L 1CFNB 1J10A 1OE1A 1OL0A 1OE3A 4XVUC 1PZ3A 4GRLD 4W9FC 2Z4QB 3K5SA 3H1KJ 1V10A 2QELA 3P3RA 4JO8A 4AQ1A 4JW3A 3VXUB 3QWOC 2ITDA 4MAUH 5AZEL 3F7RA 4XNMA 3BDBA 9PCYA 2DOCA 1OSEA 4GG6B 2YSSB 5C6WH 5A6IA 3FUIA 3CCHB 4IRZA 4Q6IA 2OTPA 4LVNB 4ZUVB 2G5RA 3DMMC 1I7RA 4CBPA 2XBDA 1F41A 4HS6A 1J0JA 2HUHA 2WVTA 3GSOA 4L8SC 4BCYA 3MJ7A 5SX4I 4ETQA 2FHCA 1VJSA 4PJEA 5ALCL 2WBJB 3MCLH 3TC9A 2HFTA 3L17A 3FGAD 4MA7H 3ETTA 3MDJA 1E30A 4UQ2A 4PRDA 4WCYL 4I1LA 1NU1K 3C5ZC 4JG9A 4KBPA 1OP5K 3O81A 2ZYAA 1C08B 3ESUF 1GR7A 3H2QA 1EQ7A 3IDGB 3N41B 5IMOA 1NGXB 4NQEA 3P0VH 3V0AC 3L73G 1JPFA 2GHWB 3LJ3A 3KPRE 3PL6A 4AIZB 1CGUA 1G6RA 2EVJA 4MCZA 4EZJA 4RAUA 2UZYB 4YSSA 1T21B 3U36A 5IGXH 5I6XC 2D4DA 1NCGA 3DXAA 2P7JA 3MRFA 4L1DA 3U4BH 2AJYH 2ITEA 4J1UA 4I5BA 1F1DA 3QQ3B 1EDYA 2H9GB 2JP3A 1KB5L 4X80H 2AAAA 1AZVA 1J8HD 4Z7VE 2X09A 3ZE1F 3FT4A 4AYEC 1IK7A 1DR9A 2PXYD 4LOVA 2AKRB 3BD5A 1CLYL 5D7IB 4I1NB 2R2HB 2CKBH 2UVFA 1UXWA 1ZHKA 2E0PA 1NBQA 3PXJA 5FOBB 1GXEA 2NPSD 4ODTH 4KK6D 3VFNB 3UIZA 5F7KC 3BXNA 1N5AA 4K8RC 3KPQA 1P7HL 2FR4B 5LBSA 1ZOYC 4PBWD 5HDLA 1R19A 4XBMA 1GOFA 1JOIA 5D7EA 4PV8B 1OALA 4KO7A 1MCKA 4X6FA 5D7JC 4FG6D 5DUBA 3MV9A 3B2UD 1XGYH 2CLRB 4ZMTA 4CN1A 2VM9A 2LLGA 3L3IA 4K4KA 4XOCA 1FZAA 1RIUL 4HPHA 3UTQA 3A67H 3FU9A 4JGMA 2HKFH 2X44D 3QUZA 4I87A 4HP5A 3QP3A 3V7MA 3NJXA 1A6VL 4FQHA 1LGHB 2A5UA 4D3CL 4I48A 3VFSA 5BUPA 4G7RB 1ZLVH 4MCMA 3ZDXB 2HJLA 5AVVB 4GSXA 4OUUA 5GS2D 1CLYH 4GOEA 1XFPA 3NCXA 4GLRH 4XP5H 1HJBC 1MVFA 3SYPA 3CC2P 4GKNB 2B9BA 5DR5H 1OTUD 4CADA 2O5NA 4DT2A 3VFPB 4N5ED 2ZXGA 2HXAA 1GK4A 4HLZG 1KYOH 2F15A 1WUNT 5IREA 4C4KT 2LT9A 1PKQE 1LWUB 2Z7YA 4PD4H 5F1IB 1I7TA 5ITBL 4XA4A 1MEXL 3EGSA 4Y5VB 1V7ML 1S7UA 1XXDC 1QTPA 1TZOA 2P47B 3I50H 1WWWX 2AQ1A 1JHTB 5IKCB 1TJHL 3UYRL 5GS1A 4K7PL 1XZWA 3X11B 5CD5D 1BGYJ 4U6VH 2AC0A 3LDBC 2TRHA 5EU4A 4MMZB 4NPFX 2X42A 4P59H 4MS8C 3LDBB 2VMFA 2BMKA 5E70A 2DQJL 2QKSA 3QO1A 3WKML 3KQGA 1BXAA 2OSLA 3OR7B 1O5DT 5GZNA 1S72P 3SCMB 2NY6C 1P7BA 3KGTA 5BRPA 1OP4A 2YGOA 3NCYS 3VFNA 3G5ZA 2XJKA 2QJYC 3CFDB 3N42F 1G1OA 2LAAA 3BAWA 3RGVC 3UMTA 1OF0A 1HDMB 4GMSH 1MIEL 5FECA 1LE5A 3WE6A 3QZNA 2NY7L 4KK6C 3BHBA 3H7BA 4IMKA 1SLUA 1NUNB 3LNEA 1TEFA 3M6DA 1KTDB 2W91A 5C0BB 2RBLA 4OGAC 1DVUA 3JQOB 1KIUB 1MHEA 4PD4K 5LDUA 4AVIA 1A6TA 1KB9H 3F7VA 4BFBD 3QIUC 3QO0B 4JRXE 5IBTL 3RHWK 3KJ6L 4L8DB 3QUZD 4NQDB 1BBJA 1KLUB 1ZK9A 3BPOC 3ARVA 2VABB 2OMWA 4Y89A 4R90L 1PZ5B 3L70E 3PJLA 1P53A 2VXQH 4TPRH 3VXTB 1MN4A 1P84J 2EIKB 3AE8C 5BXFB 1PSKH 5DYOA 4UCFA 1ZLDA 1HQ4A 3QQNA 3FQTA 1EC5A 1WS8A 4JM2A 2EH8L 1KYFA 4U0RB 2OBGA 2BERA 3RLSA 4L4TA 1NKOA 3DBSA 5TD4A 4FABH 5ISZB 2XG5A 5C7XL 2OYHA 2C0XA 1MZYA 4PJ7E 3AB0B 1DSWA 2YPKB 2P5EB 1KGJA 2KQNA 2VXSH 5ABDE 2ZCLL 3CVHL 2CCWA 5TH2A 2ARJQ 4QJ5B 1J87A 4EXKA 1ADQH 1EEQA 3H9HA 2NTFB 4LLYB 1YEEL 5J3HD 3QGVA 4EOWL 5ESVA 1M1JC 5IVZB 3B9KB 1HWWA 3FH7A 1AGFA 4J4PC 2Q7YB 1NCWL 3ASWA 2VL4A 4IKIA 2HT4D 1UGNA 4I0CC 5CU9A 4GRWF 4FZ8L 3VSUA 1XF4B 4QXTB 1A6PA 1TQTA 4RZKA 4X9YA 1NANH 2W38A 1ESOA 1S9KE 2BS71 2I07B 2YEZA 1Q0XL 5JR1H 5TE7H 1SMAA 4OCYH 2YPLB 5H94B 1UD6A 1IKNA 5EC1A 4YXWH 1FG9C 1LO5A 2VDLL 4NM4L 4ADGA 5EC2A 3VMAA 5FEBA 3ETSA 5F1NB 1I1CA 3UTZB 2HLAB 4KMTH 3LKOB 1AI1H 1NKGA 2I32A 3B37A 3F7VB 3G5YA 1PP9E 1DTUA 3NSXA 4WFGE 5GSVB 4MVBD 3AREB 4KZDL 1AXSA 2YK1L 5DJZB 5I8OL 3OLDA 3WTSA 3U6RB 4DN3L 3I2CH 2VDQL 3T4YA 2VXVL 2GT9A 1CC3A 1CE6A 5C6TL 2OFQA 1IC7H 4QRFA 4BFKA 1M9SA 1QSFD 1ADWA 1PG7W 1RUPH 3ARPA 4GQ9L 4XVSL 2N59A 2PWEA 3D71A 1ODUA 3ARDB 3D0VA 2RHEA 1WIPA 1IGJB 4WCYH 3KM2A 5KLVD 1SF3A 3ZTJG 2MKWA 3L4ZA 4W9HC 3RJDA 3KR3L 1QBLL 3MRMB 4FLSA 4DOJA 1FGVH 3WLWC 2HJKB 4P5TA 4S11A 3VMYA 4M6OH 2ODHA 5EOQL 3VFOA 5E2VH 4ZMLA 2PCYA 5D6DA 2R44A 2F54E 3A24A 4YHNA 3QCTL 4GJTB 3QNYB 1EUTA 5D1QA 4ZT1A 1EJ6A 4MBRA 3B71A 1CDCA 2CNYA 2GSGB 5IFHH 2WSFJ 4PS4L 2VC2L 4PJDE 1QFUL 1NJ9B 1G6RH 2R0KH 5HHPB 3ERXA 1M2VB 3QWOB 4NOFA 1FVCB 2FGWL 4EE2A 3QXWA 2AJVH 2UY7B 3FBKA 2X6UA 1A7QL 5DZOA 2EDQA 2CR6A 4KZCA 4MFHA 4KT0J 4G2AA 2G0LA 3KYKL 1R0AH 3GJEA 1IGTB 3FU3A 4MXQD 3VXMB 4KDTC 4DGVL 3BMVA 4WUKL 3K81A 4WLCA 2AZAA 1W72A 3MRPB 3PUUA 4BGLA 1Y1UA 3H3PL 3AY4A 1FZKB 4KHTH 4XMLH 4BCXA 1IT9L 2J55A 2MCPH 5HGAA 2G30A 1JGUH 1WFNA 1HYRC 3VMPA 2Z0BA 4W4OC 4GO9A 1FJKA 2FATL 5I1JH 1CK0H 4POZD 5I15H 2V2WA 2CPBA 1HL4A 1QTYT 3MLXH 4PLOB 5FF6A 5KAIE 4HXAL 4U6XB 5AOMA 1I1YB 3UP6A 2Q9OA 3FF7A 4JREC 4G7QB 2F54A 5C0DA 5T1LB 5IR1A 3U1QA 3WEXA 5EFWB 2DV6A 4HFWA 4GW1A 4NXKA 1BE3D 3UPRB 3BPLC 3MA9L 3ALWA 2R3CA 3VFOB 5LO7A 3VI4B 2K45A 1MH5A 1HZHH 2MPVA 5IQ7L 1CE6B 3IKCB 5DWUL 1M90Q 1RFDH 5GGVL 4F7MA 4HS8L 3O6MH 3I75B 3QYMA 3KBEA 4LRNH 2KNCB 3WNIA 3B5NB 3V5HB 4ZFOL 3PYCA 3IN2A 1OTSD 3H2WA 2O61B 4R3SB 4Y19E 5AVUB 5CGTA 1DQIA 4K3HA 2XYBA 3HRNA 4KUCD 1A02J 4FFYA 2FL5A 4UTBL 3NPSC 4A67A 3LEVH 1IGTA 4KXZI 4APQD 1QNZL 4LK4A 2V2XA 1LE9A 1FC2D 1AMXA 3G9VA 4J27A 4ZUUA 4M5ZH 3GHGB 2H3XC 5FYKL 5IESH 2BC4B 4I3RH 4XAWH 3WO4B 3IXTB 1IJDB 4KUZL 2QR0A 1SHXA 2IO5A 2EQDA 1HCFX 1OCRB 2E8YA 4MDJA 4Z7OF 1A7OH 2DQFB 4UQAA 1M7DA 5DVPA 2XZAH 4CSPA 1SQVJ 1SEBA 5ICYB 2FFDB 3II1A 2IBZI 1S7TB 1GGTA 3EGXA 3ATFA 5JZ7C 2W0PA 2WIIA 2FT6A 3UTTD 5KN5A 5MERA 1NAKL 3CSFA 4FZEH 4QOKA 4LT7A 5TDNB 5I6KA 3RZCC 2NY0B 4G6KH 4JFED 3ARXA 1TIUA 1CI3M 5LWYH 3HI6L 1Q7YQ 2O5XL 2QVKA 1A8JH 1RVFH 1ZP0C 4LF3A 1RZKH 4GDOA 1Z5LA 2NZ9D 2AXTH 2Q3IA 3L70G 4FZEL 3RWJB 1Q9WA 3ZHDA 4ERSL 4PJ7A 3LZRA 5ID0B 1WT6A 5ABAA 4NZDA 3ZR6A 1QL1A 1HQRB 2R4RL 3CDZA 4LBEB 3EH3B 3LKQA 4KJWC 2M5AA 5EFIB 4B41A 3GSNA 2BINA 2VZVA 4PR5B 2RMNA 5D1ZA 3L72J 2CNZA 1U3YA 2ROXA 3ZDYE 3T6WA 4JZJB 3SKOA 3VFUB 4WWIA 1PU0A 4Q2ZB 1KXHA 1PMYA 4F8OA 2YLHA 4M5ZL 5FYKH 2JDIH 2QJYB 3TNUA 1KIPA 4FFVC 4L3ED 3SWKA 2D7PA 1AE6L 1G7QA 3IDIB 4AM0A 3QHFH 4X6EA 2UWEE 3GZOA 4PB9L 3ZKMC 2BFVH 2OL3B 4JDZA 2FK9A 5E5MB 1EV2E 4TUOA 5B7MA 2Z4TA 5A16A 4NO0D 1PZCA 3O8XB 1JV2A 3DK2A 1OCWL 3NAAH 4JZOB 4U1KB 2P2UA 4Y2DC 3O8XC 2Y2YA 4UM8B 3G6DL 1NPUA 4NI3A 4D8PA 3PAYA 1Z2KA 3S3JA 5HDOA 3OKMB 1DL7L 5T5NG 3EOAA 5CN3A 2YA2A 1RZ8A 4Z7QE 4ADJA 1GL2A 1JUFA 5AW3B 4OJCA 2ZJSE 1MRFL 4K71C 2P58A 4PD4E 2WC7A 2IG2H 1LDPH 4HEPG 1NGZB 1F18A 3ABZA 3L5JA 1ZXQA 3T0XA 2X0WA 4QHMA 2CHDA 3NCWA 2E74D 5EN3A 1VGEH 3TNNB 1KQSO 3D33A 5D5MA 4YJZL 4HKZB 5KJ7C 2YQBA 3FO0H 4G8FA 1URQD 3Q2NA 2D9QB 2I26N 1D6EA 1LEKB 5FS5A 1HNGA 1U30A 2D3VA 1NM9A 1WVZA 4BFJA 4TNVF 2X1XR 4D6TG 3HZMA 2BVUA 5JDJA 4A7PA 2QADD 3DX3A 4KRLB 4DPRA 3CZUB 4E2OA 9CGTA 5CU5A 3LKQB 5EFIA 3S0PA 3H42L 1F3JA 1J5IA 4IGBA 2JI3A 1RQVA 4MKMA 4RFNC 4DKDC 4DKFH 1JNJA 3G5XA 3WV0A 2D03L 2D2OA 4WV1A 1IFIA 2BHYA 1K05A 3QUYB 4P46A 1CW5A 5AB9A 3HC3L 3DGGB 3PHLA 1FH5L 1HHGA 3X1NA 4NN7C 2W1NA 1IGCL 3F7QA 1U3JA 4WUKH 4HC1L 4X50A 2ZP0T 5APTA 4HETA 1IL1A 1ZGLP 2OJZH 1NVOA 2VSCA 3SGDI 2IWKA 4ZPVA 3VGEA 2OZ4L 2VMEA 1DQDL 4TS6A 4F1ZA 1KACB 2FCBA 1JM0A 1EXIA 2AMUA 4UT9H 2ZOKB 3MA9H 3T04D 1IC5H 3MV9E 5IWLA 2XDHA 5L2KE 5CJBA 3LKNB 3GMRB 3GSNB 3LIUA 4C7NB 4X6CA 4Z7OE 1T66D 2O72A 3QI9C 2DW5A 5T1KB 4R4MA 5E8OA 2DQMA 1ZMYA 2V2TB 3VO0A 1DQKA 3QCTH 2YPLE 4QCIB 3IE4A 1U8LA 5ESQB 2FSEA 4NQTA 3IVKA 3GHPA 1BEYH 4RGOH 2D7OA 2WUCL 4AV5A 3DROA 3WFBL 3OVUB 1IT9H 3RWIA 3LH2L 3NMDA 1RU9H 4U1HA 3VWKD 3EYUH 1JDAA 1N67A 1W72H 3QHZL 4NZFA 2JELL 1X5ZA 2OJ1A 3V2NA 4NFBA 3JWNE 4DGIH 1VCBC 4YDJB 1LDPL 3DJTA 4RIRB 4HIHA 1CLCA 2BXYA 2ESVB 3EFFB 1RIHL 4DPAX 4BFOA 1DUZA 1SQBK 3NGBC 3AG2B 1IE5A 4FXGC 1SXNA 1Q94B 5EZIL 3S96A 3RIAK 2EDTA 2E56A 1JTPA 4FQIH 4EUPG 4X7SL 2FYUE 2NNFA 1TQVA 3V4PA 1G6RL 3MOBH 4OD2A 2B39A 1RK1B 4NQEE 2YMYA 1ZHBA 3BWUC 3OBAA 3GMAA 1YAZA 5KJ7A 1TKWA 1CGVA 1RSYA 1H3GA 4BZYA 2XV2A 1ASOA 2YMXH 3KVQA 1AI1L 5AOLA 4QTFA 1ZDQA 1HS6A 2BHFA 1NMCB 1BSHA 3GMPB 5A1AA 1UUNA 2JKTM 3ZIMA 3CXHH 4WSKA 4DVRH 1XGQA 2R23B 4ZUUB 2Y3NA 2COVD 4IDLA 1U8HA 4ENEC 1FFOB 3IGAA 3S3BB 4U33A 3D39D 3J2PA 3RL2A 4PV1B 2VXUL 3DX6B 3PWPB 1FHGA 3I9AA 5HVHC 3OC8A 2JQAA 3OGCA 4JFEB 2VR7A 1E4JA 1I9EA 1N10A 2X4NB 4AIOA 4Y2OB 4G8EB 3HOGA 1IFRA 4AC4A 3C6LC 4GT7A 1YEKL 4WO4A 2EIJB 4NO5B 4AK1A 2VDMH 4LOUC 4Q9QH 4UDUB 3IXAB 3PUCA 5F72S 3CSYA 1WZAA 2EAEA 3WN5C 2EDYA 1J1DB 5F7EL 1UCTA 5C0IA 5D8JL 1AKPA 4YBHA 3L73E 2DQCL 4ODUA 2MWCA 4PBXA 5DT1H 3V52L 2H26B 3RIAF 1JFHA 5AVRB 3NACL 1T1XA 3QCUL 4HPYH 5ABZA 4OSUH 1H19A 1OK8A 3PP3K 3KLLA 2ZKWA 3QXVA 1HEZA 3FULA 3OB8A 1TJIL 4RGND 5J0BA 1U4FA 1JGVL 3VD1A 1USEA 3FSWA 3VVWA 1X44A 4RRPM 4Y5YB 1G1IA 5B3JF 2CO7B 4CN6A 3HS0A 4GOFA 2IPKB 1U7JA 3LNIA 4FNRA 4OZIA 4KKAD 4DFIA 3DRTA 4OD3H 4WI6A 1NSNL 3AW5A 1QASA 3GTNA 3Q5SA 1JMZA 5CZVL 1XR8A 4NNPH 5C0CA 1USQA 5ICZB 3CL3D 2XKUA 4MNQE 3V7AG 1IEBA 2DICA 3QS2A 5FUZL 2DQHH 2ZAHA 4LEEA 2O30A 5DD5H 1X5HA 5LAPA 2FWOA 4XMXA 1O6TA 4NBZB 4FMVA 4P23D 1MWAH 4I9WD 4JQXC 4DKEL 3TYYA 1KLGB 4Y5VC 4GAGL 2YKQA 3TEUA 1CFSA 4HK3N 3MR9A 5T1MA 3ZE1B 1OWRM 5HHQA 3U48A 4OLUH 4ZTOL 2BNQE 1UZ6F 4JFEA 1D5RA 3S88L 3VFWB 5GRUH 3TNMA 2OXGA 1A4BA 3NJLA 5IQ7H 1U8OA 5FGCE 4G5ZH 3L08A 4PP2A 3S3CB 1SQVD 1FZJB 2DIBA 4DEWA 1BD2A 1VERA 2EYTB 1CICA 1FZMB 4NPJA 2E76C 1YJ9P 2DQTL 2BY2A 1E4KA 3KH3A 2WLMA 4EDXA 3SDCA 2WQVA 4BZ1L 5H2BB 1R3HA 4HKJB 4YHPA 3DKHA 1HHIB 1D5BB 4CSSA 3T2PA 3EOBA 2EYRB 2NY0C 4WWPA 4WDIB 4YUEL 5BU5A 3D09A 1BSNA 2L7EA 5T33H 1J8SA 1FYHB 1PIGA 2O1AA 3N2JA 5DDHB 3WDJA 3NN8A 2WNKA 1NGYB 2CKBB 3DI3B 1S3KH 4NXSA 2FIKA 2QDVA 4U3FE 3LZNA 3Q2VA 2XXGA 4OZIB 1N73A 5EOTA 3VU1A 4KXCA 3G5XB 1DBAL 1NLDL 3L9BA 3MODL 5H37G 2KI7B 4GXUN 4OKDA 1U8MB 3U9UA 3RFZC 1Q90D 2C9SA 1LWRA 3NTCL 2DL2A 4GRWH 5JHDE 1R0AL 4AYSA 2V8LA 4G42A 2WCSA 3L1OH 4DP4X 1ZT7B 2IFFL 2DQDL 1H15A 3X1EA 1YHQP 1SQQK 3IPFA 4YXKL 4U1IB 3WGUB 3CHSA 3BKMH 4XB3A 3S3SA 5K9JL 3HBPA 2EVGA 5J6HA 3D6GA 5HDQL 4AK2A 4NGHH 1FDLH 4KZ0A 4XVJL 3CD6P 3KWWA 2GTWA 3HC4L 2L4OA 5EULV 1I3VA 1JNNH 1EHNA 2I60H 4PW9A 1J1XL 3VRLE 3RWGB 5C08B 3EYQC 2FX8H 1QNIA 2E9JA 3CZEA 5FYLL 3FZUD 1PLGL 4DERA 3EF7A 3VJ6A 3DV4A 5CJ4A 1YPZA 3ULVH 5D2NE 4K5PA 4ZFQA 1UEMA 1X79B 4Q58C 1GCYA 4XCNA 1GW3A 1T80A 2WBKA 1CFQA 1MRCL 2IBZX 1AQ5A 1SEBB 1WO2A 3L5WA 4R4ND 2QIWA 3L75G 3C5ZD 4ZAKD 1JTHB 2XSKA 2EEAA 2CALA 2BSTB 3OQ3B 4LARL 1B88A 4C8XA 1HZKA 3F04A 4CN4A 1GHFL 1KN2H 1YC7A 2VLJA 2XWEA 2OMWB 3F12A 2Z0UA 4L4JA 3VWKA 3FQ1A 2CBOA 4CSTA 2IDQA 4OTXL 2OXHB 4UIKH 1N7SB 3U7WL 4PJDF 2LLLA 2YJLA 3MCLL 2GYSA 2UX6A 2CH8A 1KFNA 3EOBB 3BLKA 4HJGA 5EBLB 5JTWA 3GM0A 3HE6C 4PJIA 1XH0A 4ODXB 4PJGA 2ZG2A 2Y6TE 4UBDD 1U3ZA 2W9EL 3EJJX 4MQ7A 1R5WA 1AY1L 5EA0L 4DIXA 3GZKA 1C5BH 4JZJA 1ZKAA 3QDAA 1K9TA 2P8MA 3CXDL 2IV9A 4ODWA 1G0XA 4G8EA 2FXMA 1VGKB 3WXWH 1E4HA 1ADQL 1YN6A 1IILE 3RVUD 4HOMA 1ROCA 2IQ9H 2X4PA 3WIHH 1J1EC 1IBYA 3KPEA 4W93A 4KJPD 2WYIA 4JFXA 3FT4B 3WBDA 5MEQA 3L9RA 2HN7A 1MOEA 3QQDA 5KLIB 4G8IB 2WNXA 5D2NB 3MACL 3RX9A 2J1KA 4JFDA 4N2AA 3FRPB 4XZUB 4QR7A 3P4NA 1XBDA 3SBPA 4FABL 4WF7A 3RKDC 1Y0LB 4CNIB 4C4BA 3DYPA 4JPIA 1T7XA 3C5SB 3CGTA 3V6OC 1K5NA 2X89D 1HHHA 3BVWA 3E1F1 3M0DC 3NT0A 3VRIB 3FXEA 3RB7A 1MUJA 4DZBB 4PJBB 2LV4A 1RP8A 4ICWA 2ZX6A 3DO3A 4HIIA 4J3XA 2O5ZL 4FA7B 3FB7B 3L4UA 2G2NA 2A3TA 5GGUB 3TBTB 1AZCA 4MX7B 43C9A 5K9JH 4PS7A 1UKTA 2JIXA 4AQEA 3B2MA 1E6JL 3KDMB 2DMCA 3EH5B 4FQHB 4APXB 5K9QI 2VUOA 3S4SG 4A6YB 4BH7A 1D5ZB 4HVBA 1D6EB 4E5XA 2TAAA 1NAYA 2E3VA 3OC5A 1I8KB 1WZ1H 3R4RA 1CDGA 3WOVA 1B4JL 3PNWA 2ALWA 2EDDA 1N8RQ 1WBZA 1FL6A 1SQ2N 2K4AA 2L7QA 3ABGA 4OV6F 4PV8A 4XXWA 5E8NA 4ZUWA 4NUQA 1FL5A 1C5DB 2JSFA 5CIPA 5L4IA 3SKMB 5GGSB 1E28B 4TL5A 3RTQC 5I6XB 1ZT4B 5EIIG 1YN7B 3RTQB 2YZ8A 1ETJA 4NO3A 1QO3A 4WNQA 1GGIL 4MMXB 2YO2A 5GS1B 3A4FA 4XI5D 4XX1E 2HRGA 4W9IC 4NZJA 3PDGA 4YSQA 3BPNB 4XGZA 1GW0A 1P84H 4GRMB 3I50L 3VYNA 5FO9A 1SBBA 1NBYA 5SV3A 3NA9L 4NRXA 5F1SA 1AGDB 2PW1B 4L2YA 1TXKA 2BNRA 2D0HA 4BWUA 4IFFA 1QQDB 4QXGL 1H8SA 3EQ2A 3L3KB 3W1ZA 1CF8L 4B9ZA 5E94A 2J1WA 4GLRI 4BD4A 3A6OA 5AW7B 5C9JA 1S8DB 1DVQA 4QMEA 5B66E 5APUA 3IJHA 3KZ8A 2V2TA 5JW4N 4HIIB 2E76D 3V4VL 2DQIH 4JVUA 3BCFA 2WO3B 3ECBB 4RWYH 4AUWA 5CEXB 4D3CH 1AFVH 3DUSB 4PRDB 3VXOA 1BMZA 1KFAH 1OZUA 3ZE0F 1HH9B 1HH6B 2X88A 4GRLB 3KCWA 3VX0A 3ZE2E 2AJXL 2QPUA 4EI5D 3K6NA 3B8EB 1Z3RA 1T4KB 1M3JA 3W9EA 4Z23A 2FFDC 3MLTA 3FRPA 3FXDA 3VGAB 4K35A 1NCCH 4TSAH 3M86A 2EEBA 4HIHB 1G7LA 3TEXA 4D94A 1KILC 1MQKH 4XRCA 3R1GH 4OZGB 1ZANL 3L13A 4ONHB 5IK3B 2UX7A 3WUWG 4OQTL 4BQBA 1SQQE 3BP5A 4CC4C 3CSBA 3Q9PA 4FNTA 1YRKA 2WKGA 4WU5A 3X1BA 3TTYA 5BVPL 4O02B 1DX7A 5F7WC 1A1NA 1T1YA 4AEFA 5JQHC 1KQGB 3VE0B 3U1AA 4L5FH 2Z1KA 1MFBH 4WHYG 1RZ7L 1PPJD 3FSAA 1A3RL 1JPGA 3H9HB 1U8IA 1X7QA 5A7BA 2WSEH 4KI1A 3V9FA 5T5FL 5I73C 5DEFA 4CMHB 3LZOA 4JFDE 1KXQA 4WJ5B 2E6PA 4JM2C 5DHVA 1G87A 1LT9A 1QRNB 3HNVH 3KCPA 4YBQD 5DZLA 4XMTA 2PYFA 2UWEB 5I1EH 1NEUA 2G60H 3FO2A 3KPLB 5I6PA 3CFKB 3PQYA 1VQ6P 5F71A 1E42A 1RMFL 1ZVHA 2EADA 2Y07H 3DUHA 5GGSA 4N0CC 3TJPA 3E6FB 4MD4B 1F90L 3H53A 2FGZA 3CXHI 2VDML 3VFTA 1KTJA 3IFNL 3SEPA 3DC0A 1VFMA 2BP0B 2P5PA 5DS2A 1MW1A 1T04A 4BK4A 3DK0A 1MCCA 3A4DA 2VUKA 1I1AB 4L1HA 5TQ0H 5GS0H 3TIDA 1RZFH 2NQCA 3FYEB 3CCUP 2JELH 1B0GB 4YPGA 5KSAA 4XAWL 4CKVX 3BPOB 2PXYA 4G9DA 4HBCL 4S10A 2MQ3A 1DVXA 5DD6B 3L3DA 2LU3A 3OKEA 3QAQA 5JQ6H 4FFVD 4JRXB 3U9PH 4XWGH 4AY0A 4WK0B 3NZ8A 2L5GB 1JWMB 1LILA 1OD9A 2EDBA 3BZDA 5E24E 2OM5A 2JI2A 2F7RA 4KKAC 4NYLB 3P69A 1NBCA 2D3JA 1DE4B 3OX8A 2R2BB 1O7DE 5F88A 2FIRT 3VD7A 3N5AA 4WUUA 1ACZA 1MHCB 1H8NA 2HX8A 1YEHH 3RGHA 3ZGIA 3NBNA 3UAEA 3MRCB 4W9CC 1IAIL 4AL8H 4OCXH 3QUMH 3OPUA 4WEBH 1TETH 4MZIA 3IAQA 2HTKD 1Z5LB 3UROR 3ATEA 4YWGH 1YJDC 1YPZE 1DYZA 1VDGA 1PD0A 2HJLB 4YDVA 4JFXB 5MEQB 3II3A 4LBEA 3EYFA 2CWRA 5FYKU 1TVHA 4CGTA 1IO4C 1JTTA 5IMKA 3FRUB 1KILA 2GPZA 4LDLB 1J5HA 5BV7H 4JHAH 4O58L 4XRCB 1UJ3B 5CN1A 1SQXJ 2HWZL 3D18B 2FDBP 1U8KB 4KXBA 4XP6L 3L71E 2OX5A 3P1VA 1TQWA 4CC4A 2I5YL 2O4EA 4O9HH 3O45A 4AJYV 2UY7A 2BRRH 4HS6B 2IBZD 4ZOEA 1MSPA 1S9YB 3NIFE 3MV7E 4WENB 3Q1EA 5GTHH 3IKKA 3MRBA 4A7VA 1LTTC 1KCVH 1RPKA 1UM4L 2EACA 4X99A 3SJVD 3MP7B 5GGUA 4BE5A 1X22A 5IJDC 1AVAA 1AHWC 2VMCA 4YBQC 3ARED 1UOKA 3F01A 5E56A 2WO4A 2XZQH 4J3TA 3TEWA 1RJZA 1LT9C 1AHWB 2BMKB 3LZFH 4JHUA 3W39A 5DRNA 3GK8L 4EDWL 1LD9B 3DTDA 1LDSA 3KCPB 1E2ZA 5CHXA 3TH2T 4AZ8B 4FQXD 2WZPD 1KBGH 2VOTA 4FXKA 3RVTD 2FB4L 4EIUA 1FH2A 4JQIL 3Q7JA 1RZ8B 2VR5A 1JZ7A 3BYYA 5EO0A 2GTZB 2RCSL 1ID2A 1WQVT 2AVGA 1Q9LA 3MJ8A 1AR1C 3V0HA 1HZLA 4L48A 4N90D 3E6HB 1URIA 1ZLWK 5DC2A 3QFJD 1HYSC 3WELA 3IJSA 5ILTL 2HX7A 3PXHA 4QKXB 3RX5A 3FQYA 5CUSH 1UWFA 1XF3A 2VZOA 1OCWH 3IDYB 3NAAL 4JE4B 5KSAC 4Q14A 4J3WA 4KROB 4E9WA 1XAKA 5K9KA 8FABA 1N6VA 1NGXA 4NQEB 5DEJA 4HKZH 3RE0A 2YD8A 3IFOB 3C9NB 3W57A 3OKEB 1YMHB 4C46A 1VPOH 1KTRL 3O11B 4OCWL 3OMNB 5KAFE 1JWMA 4NRXB 4Q0XH 3BAEL 3SJVE 1E9OA 5B5EE 4PWEA 1A64A 2QVAA 3CV5A 4GKZB 4NPKA 4E0RA 1FHNA 2AJZB 5ADPH 3IAOA 1QUNB 4RISL 1XTCC 4UTAL 3RWHB 3WJLC 3Q5OA 5T1JA 4NN5C 1I7UB 4NZUL 3IDNA 4FTDA 2OMVB 3WDIA 3GDBA 3RDTC 5GJSH 4IYKA 4HB1A 2HFFA 5CCHC 2R1YA 2BNQA 4JFEE 3TBSB 2G9HA 4LEBA 3VTPC 1W0YT 5J6GB 1DL7H 2J25A 1DH3A 4X6CF 4BXVA 1OLZA 2ROYA 1NAFA 5C6TH 5HHXH 2FYUG 4PUBH 4A2EA 3IS0X 1VL2A 4MXQC 5A7EA 1NKRA 1U8CB 2NY5L 4JRWA 3UJJL 3LS4L 4GXVL 2IAND 4N6QA 2CHZA 3AQDA 3TBVB 1IFNA 2AABH 2W9LA 3B4SA 4IOIA 4KK5D 4XI5C 5CBOA 4NSKB 3JT2A 5ETUA 4W9KC 5J12C 3HNVL 1WCQA 2B1AL 3VNZA 1J05B 1WBXA 3KLAA 3D39A 2CXKA 3GSXB 3FN0L 3SE9L 4P2CG 1W5CE 1NCUA 4AYCA 3QUXA 3QWRA 2IOIA 3D0AA 4OLYH 5A3ID 3TURA 1E65A 3HMXL 2EDRA 1EVUA 2XKNB 3SDDD 3IU3A 3T08A 5FGBC 4WHYH 2CUIA 3GZQA 4GQQA 5IESL 2BJMH 4L8BB 4PJCB 4JN1L 1SDAB 3DETD 1MFUA 2C3WA 5IROC 1AQKL 1ZANH 2P52A 4ZTPH 1CL7I 1NOLA 4JM0A 4P2OD 2WUBL 3ROOA 4LDEB 3OHXC 4QRRE 1RZKL 4M9OA 1RIVH 4GW4A 1AZBA 3CVHH 2XKMA 2O3JA 1G9HA 1HILB 3K4ZA 3LNDA 3WENA 1MCIA 2ZOUA 3HZKA 3N40F 3K7UA 3HN3A 4WKZB 1GJUA 1ETB1 1IGJA 2WZ5A 3L81A 2WVVB 2AJXH 4OGAD 5TDNA 1JSYA 4M1DH 4OZGF 5E0QA 5GZND 1WP6A 4XVTH 2X3BA 1SYSB 2Y2WA 1S78C 3ZDZB 3WEMA 1RFDL 2Z92A 1T6AA 5ACLA 2BNQB 4U1JA 2VRSA 3D2TA 1OT4A 2FYYA 4JKWA 2HX9A 4AYID 2AP2A 2PCPA 4U1LB 1Q0YH 4YH6A 5FKAA 3L5IA 4QHNB 5I1DA 1SQBD 1RZPA 5E6YA 1YNLL 4FCAA 1TTGA 1GTFA 1CLVA 3FTWA 1VESA 4N2DA 5FYKE 4TPRL 1NBZA 4ZMPA 1Z32X 2VQ1A 4RRPA 4JFFB 1I9IL 4FFYL 2WUBH 4UTBA 3VYOA 1E9OB 5HD8D 4X98A 1OHZA 3M1BB 4KHXH 3HIZA 1X4YA 4JEGB 4N1EA 2W8CA 4Y5XC 1PYWB 4TQ8A 4N9GB 1KJVB 4DZBA 4DW2L 5IB4B 4UDTB 4Y9EA 1V3JA 3DMMA 1KIUA 1MHEB 2WINA 4NNXB 1RZFL 3FB6B 4ZMYA 4XP4L 2HFFB 2R1YB 4L8CA 3ZW3A 4DUXA 1EAJA 4M5TA 3OAKA 4GMSL 4K55A 3CWBG 5J3HC 4PGJA 5GGSY 5F7NC 1EXJA 4HS8H 4JFOA 4WEUD 3TPUB 4Z7WB 5J8OA 3ZKNC 3AS3A 3VXTA 3OAYH 4QRPB 3VG9B 4F15C 5E99L 2P9RA 3SE8H 2QSCH 4OCLC 1GL2C 4X5WB 1B3JA 4IOIB 1YECL 2NY5H 3IJEB 2KDYA 3PCYA 4ZW8A 3U83A 5I1EL 3ZE1E 4CMHC 1YNKH 3WMM0 4JFHE 4L4VE 5EU6E 5FGSA 3RFZB 2J2ZA 1SQMA 2WXKA 2DBLH 3DSNB 4R4NC 1JY3P 4QIRA 3LN9A 2YPLA 5H94A 3DVGB 1KEGL 1J1PH 3E3QE 1NCBH 4LLDA 1AQDA 4PLJC 1BAWA 2Z92B 2ITCB 4KI5F 1RLWA 1PX8A 2BEQD 1XR9A 4JRXD 2VRKA 5EUKB 3IMWA 3ZDYB 4KY1H 2AQPA 4IBUA 2G5BB 2XDJA 3OKNB 4IKLA 4X6CE 1QFWH 2Y36L 1JYWA 4DP8X 5D7KD 1UADC 3S5YA 2W65A 4X5PA 2Q7YA 2RACA 2EVFA 2VJXA 1R3KA 3ZL1A 3HB3B 2F54D 4GKOA 4HJGH 2BNRB 1BVKB 2CJTA 5DLMH 3LKNA 5FCUL 3WXVH 3QEUB 1MWAB 1B2WL 3BD4A 3GIVA 5C2UB 2J1ZA 5HDBB 2NUPB 1JF5A 2GBAA 3SO5A 1JZFA 4LHJB 4U7SA 5EC1B 3AAZA 3TWCH 4PJ8A 1N18A 1MKMA 2SPZA 3D85D 2EECA 1P7QB 2WLLB 3N40P 3P3TA 4PJBF 4TYUA 3WFEL 1U36A 5IJBC 1KOAA 3T3MB 2N1KA 4FLRA 1UOWA 1EZSA 4XAKE 2HFEA 5IB1A 4RRPG 1H6FA 3SPJA 3IJSB 1ZEAH 2AITA 4GBXB 2CRYA 3H4HA 3HCVB 3QUGA 3AREA 2ICWA 3ZZSA 5FKAB 2H6PB 5E9DB 3CXDH 1R47A 3WFHA 2HPCB 2X2HA 1E8XA 5C0ND 4EKJA 3C2AL 4RA0C 5IQ9A 1IBFA 5IB3B 1DANU 2GY7B 1QHPA 3QPXH 3THML 2UXGA 3AT0A 4ZO7A 43CAB 4YHNB 3HJEA 1FDOA 5KSUB 4PLNC 2Y22A 4LB8A 4Y1AE 4QXWA 5D71H 1TVBA 4GAYB 3QG6B 5D7KE 5ESVB 4MQXC 3ARWA 2WZAA 2D0GA 4K3DH 1J1OH 1NFAA 3GSWA 4F33B 3ULVC 1QBLH 5GRVK 5D93B 3U4BL 2Q6WB 4G6MH 2H0PA 2H32A 1BSIA 3A6BL 2LABA 2QQKH 3K6OA 4W70A 1LQSR 5C0RL 3CC1A 2XZRA 2XCMC 4W9DC 3VGHA 4F2FA 3QQ9D 3FQRB 3AE1C 4Y16A 3O3DB 2ZUWA 2VN7A 3VD9A 3UZQA 1S7RA 3F84A 4H8UA 3MX0B 3CPLA 4TUOB 3RZCB 4MNHA 4RGNE 4Z7QB 2HWZH 3T0WA 1FZKA 3TJHD 4OZ4A 5C0GA 3I2CL 1BVKA 1VF5C 2P8LB 3AQYA 4HUKB 5C0JB 4OBRA 2UWEA 5E1AB 4JQIA 3U4EA 3UMNA 3ULVL 4IRJB 4L0PB 1BJ8A 4ZUTA 2V9UA 1R1CA 3AB0C 3IK2A 2B14A 4FG2A 1BZDA 2EH8H 3D69A 4ODHH 4F57L 4J3UA 1C7SA 3GPSA 4XXCC 2H2SD 3K72B 5DTFB 5EUKA 2XIIA 4IKNA 2QQNH 1W16A 4AM0B 2WO2B 4JGJA 3B43A 4OCYL 4XN1A 3SGDH 2W59A 2BNRD 1MXGA 4HIPA 5LXVA 5DMIH 4EN2A 1DLFL 1FVDB 2MQCA 4RFEA 4Z7QF 4D0CB 5L88H 2A4EA 5BOPA 2BOCB 4XP9L 3H1IE 1FAIL 3EAKA 3GSQB 1A6AB 1Z6JT 1Y9BA 3Q2YA 1TVBB 2IAMC 3H6JA 2NUPA 4GAYA 4JFVA 4P0DA 4R0LC 3QYCA 4OVVA 1SM3L 3HE7A 4F7MB 5JPNA 2L91A 3GDCA 2BSRB 1MFDH 4EIZC 4QOKE 1T0NA 3CVIL 5DS1A 1TSRA 3FOLA 3PGFL 1LT1A 1ET8A 1NGZA 5ISZD 3RK2D 2APWA 2YPVH 1HXKA 3LZQA 4I0PD 3ZSTA 1FZGA 4WY4D 2AV1B 3Q3GA 4IIZA 3MODH 3MIWA 5F1KC 3WXWL 1URQB 3V2PA 3BQUB 2VRQA 3NCJH 3QXDB 1A9EA 2DWTA 25C8H 1S3KL 3V5KA 5EMYA 3HTKA 4WW2F 3EBHA 4Y19B 1ZLUK 3UBXG 2GCYB 1RE4A 2J20A 1FN4A 2P8PA 4ISVB 2JVUA 1E3FA 4MMXC 1V7MH 1FOSF 2DWDA 1WHPA 4M7LH 2D8KA 3EJSA 2KXPB 3KAAA 4CDHA 3P8MC 4R4LA 1BYNA 3ZKMD 1RZ7H 4PJBE 1KJMA 1IARB 1EO7A 4P2QB 1KUMA 3U7WH 2BCCG 1NCJA 3ARFC 2OR7A 5KVDH 1C8QA 4NP9A 4PVLA 4GMTL 5AAMC 4C56B 5J11B 4GUPA 4RKUJ 1A4KA 1VQPP 2PTVA 1LWHA 1H8LA 1FG2B 3UAJA 3FH5A 1TCMA 5EB9A 1SY6H 4LF3B 2HVJA 5D7JB 2OMYA 5LCVL 4XMZA 4U2YA 1RUKL 2Y5TA 4DGWC 3IR9A 2A9NH 3DSFH 5GHWH 1YNTF 4C7NA 3A6CH 3MLZL 4G7YH 5DJXB 1WIUA 4GAGH 3S96B 5E4IA 3T09A 4MDIA 5JPNB 2FBJL 3LKPA 1NDMB 5BMFL 4Z77A 3UTTA 1KT2A 2ID5A 3FOLB 2RQ8A 1NFIB 3ALPA 4AIXA 3EFDH 3F58H 4HH9B 4ZBJA 4K5OA 1XB3A 2ARJA 4O00A 5IBUB 5ITBH 2GEQA 1WRGA 4HJ0D 1AH1A 4HU8A 3ZE2F 1ZIAA 1XZ0B 2HT2D 5DUMH 4GMTH 2EEXA 3VQMA 2J71A 2EUWA 1WWBX 1XF3B 4UNIA 1R4XA 5KYUA 1EQWA 4NGHL 2IFNA 3OJVC 4WIQA 1K4DB 4X80L 5J1SC 4OI8A 5D1QB 4UB8H 2QVIA 1M42A 1C9SA 1B9ZA 5AYQA 2DL9A 1UA7A 2EIMB 1THAA 1NOHA 3EJUA 3FUEA 2DQDH 2PYED 5FOJA 1EDJA 5I2IB 4TLSA 1JI1A 3QORC 3QAZC 3QJTB 5HJ3A 3UDWA 4QHKI 5BCAA 1FLRH 1MJUH 4M5YH 3NCJL 3U46A 1X5FA 1MFCH 2Y5EA 1M57D 1SFCB 3SE8L 3KYQA 3SCMC 1CIDA 5KYXA 1WAPA 2XA8L 2GTWB 4UQIM 3WJJC 1IGFH 4Y5XB 4WWKC 1W6WA 1ZHLA 2YBRA 1SBSL 4JDVA 4ETYA 1LTAC 5F7UA 1A4KB 3HG3A 3DRQB 2CRMA 5C3LD 3NFNB 3TA4D 5LG6A 1I9RH 3CWBE 5SWQA 3CWGA 5KVFH 4URKA 4NQCE 3DX6A 4N8UA 5GS2H 2DIJA 3P40A 2K6YA 3L3GB 2F61A 3WIIL 2PO6C 2WYHA 5I8CB 1RQUA 5AYTA 2P5WD 2EH7L 2PO6B 3BUPA 3MNZB 3OLEA 1JYXA 1UGKA 4NENB 3K2MC 5E23A 3MGTB 2Q1EA 4XPFL 5E1HB 2X6VA 4GQZA 4F93B 3QZMA 2DQTH 5HI5C 2MOQA 4YSDA 2QRXA 4FP8H 4JRYE 1G84A 1B0RB 3ECWA 3EADA 5CJXA 4HZLB 5BQ7B 5AW9B 3CHQA 2P24B 4KITB 5D1XC 3KLDA 4S1RL 4AGNA 1MAML 4RSVA 2EYSB 5D1XB 3RK3E 2OCFD 3CFJB 1ND0B 4AYFB 3RK2B 2HAZA 5KKZB 2NQDA 1NCDH 3BZEA 1WD9A 4L4TD 4M7LT 3BGFC 3BUBA 4YZWA 3W37A 3O6QA 1G4RA 1INQB 1OP9A 1QBBA 4O2FA 3RUGB 4JNXA 1NAMH 5KW9L 3VXQB 3U4EB 4C54A 1MWAL 2OTWB 5DYFA 1NFIA 4L4VB 5EU6B 1EXHA 4ONOA 2NR6C 2XTSA 5CILH 3NQKA 4Z5RA 5EEZA 2VLJB 1J0ZA 4QCIA 2F53B 3A4AA 1GS8A 4TNEA 1IB5A 3WHXA 1FZMA 3CIAA 4XCEB 2CUMA 1MY5A 1NA8A 4H5SA 4OT1H 3C8VA 3D30A 2OCJA 4FJZA 1TZAA 3NIFB 1P9MA 2YQ3A 1ZLSL 3O4LD 4F7TB 5CCJA 1F0LA 2SEBB 3L4TA 1JGEA 1S9WB 2FY8A 4GW5B 1IMHC 1GMJA 3GMRA 1A4JB 2XOTA 3P02A 1PZBA 3GMMA 4JL2A 4XO5A 1I85A 3FO1B 3ZHKA 4FQ2H 4AE1A 2HP4A 1NWPA 3LIZL 2VO8A 3BFQG 3H25A 4LO9A 4UT9L 2MFNA 3HBQA 5B1CA 3WLBB 4GRWE 1HK6A 2E4FA 1KN2L 2ICEC 4YK4C 2Y3AA 4MCYB 4L4TE 1BGXL 4D7PA 1SQXD 2E7LC 1V7NL 1OGPA 4HUCA 2XWDA 1MCNA 4OFKA 3SPVA 3JC22 3MBEA 5GS3A 3LQMA 1NMAH 1BVNT 1E8WA 2JB6A 2ORBL 5AUMB 2P24A 1T7ZA 5I0VA 3WFEH 1XF2B 3SKJH 3WTWA 3AE6C 4PJCF 2PO6D 4W9ZA 2V8MA 3QCVL 3KYNB 4MB3A 5L6YL 1DE4A 1NAMA 3OX8B 2DYPB 2WNGA 3L3JB 5EEXA 2NY3B 1SLQA 1C5DA 1MZ9A 3KYOA 5ELIA 5DJTB 5CGMA 2VM3A 4LKCB 2O01J 1MCOL 3HC4H 3VYPA 3GSRB 2N7SA 2E47A 2AQ3A 4L37B 5IB2B 5JXAL 3WEOA 3RY4A 4J23A 3LEXB 3QJHA 4MHHI 3ZDZF 4MJ5A 3QI9D 2HLOA 3SQOL 2AEQH 1X5MA 1REIA 4DPBX 3VXSD 3D05A 4YLCA 3T1WA 2ZUSA 4KY1L 4K3EL 1DFBL 1CG9B 3MRLB 3ELQA 4MNQD 3L6FA 3MOBL 5T1DL 1U33A 1SJEB 4JBZA 4DNLA 2C3VA 1KN4L 5A16B 2F1BA 4X0NA 5C09E 2JCCE 1FL5B 3VVVA 5F70A 3T0DA 1K8DA 3FUKA 2HT4C 5KVGE 1XO8A 1UOLA 3G6DH 3KPMA 4Y5YA 5EOCJ 3M9QA 2WWOA 2VW4A 4R26L 1Q2NA 1SHSA 3MJ6A 5K9QG 4U3FJ 2FX9H 2OTWA 3H1KG 3CLEL 2QSCL 4WO4D 3TCLA 5HYJD 5L4JA 2VL5B 5DJ6B 3AS1A 1K5WA 3X3FH 3UTTB 4HISA 4OU3A 2BPBA 4PB9H 3F6IA 1FZOB 1ZS8A 5JMRA 3LPPA 3KLSA 5CJQH 5GSVA 4GEIA 1KCSL 3T4AC 1Q8MA 2J73A 2VDRH 5FO7A 3ZKXB 1ROWA 2YIHA 3Q2WA 2EC9T 2PWFA 4NB7A 2GUOB 3FFDA 5DO2D 2J57A 1OGTA 2IYPA 5J12B 2A74B 1NKNA 1BEYL 3V8CA 1K6QH 2A06G 2EILB 4G3YL 1F6FB 1QFWM 3QUHA 3D39E 3MRKB 4LEXL 1BIIA 1RCYA 2KZWA 2K88A 1OVRA 3V0WL 2F2HA 3VFRA 1UACL 2OP4H 4MWFA 1OOWA 2R0ZH 4ONHA 2DBLL 3AE9C 3UC0H 1FFNA 3FXIC 5G2NA 3BIAX 4FFYH 4ZD3H 4GH7B 4RFOL 1FS0E 2WTRB 1L0LG 3AADB 3IJYA 1RL1A 4PQXA 1KENH 5L4FA 2O5XH 4XN7A 4RCAA 3CSGA 2MCG1 4FC3E 1XR8B 2IPTH 4MXWH 2FYUK 1GC1L 1TSHA 3RPIA 5E99H 2JEEA 4WQOA 4JUSA 4TVUA 4P2OB 2YD6A 2Q5UA 2NXYB 4HKBB 3TIEA 1MHHB 2AK1L 5IW3A 4KQ0A 3KPRB 3AXIA 4XFJA 3UBHA 1OW8A 4LSTH 4FX5A 1L6PA 3EYVB 4MAYC 1OFCX 2YSSA 3MLWH 4R96B 2KI6A 2JKNA 2OJEA 2ERJC 4ENZA 4MA8L 1NGWB 3TFBA 3B83A 3ZIYA 3UO1L 1SQBG 2ZD0A 4UB8E 1EHKB 2WQSA 2GUVA 4WWNA 2XXMB 3UYPB 2DQHL 4HF5L 2QSIA 1IAKA 1U58B 3AMKA 3PGDA 5B39G 4EJ1C 1KPVA 4HUXA 4LKCA 4N87A 4NRZB 5FA3B 1TTRA 3MRGA 3K74B 1U91A 2APXA 3DXAE 5F7MC 4AKQA 3GMNB 1ACCA 4KPHL 1ZHNB 3WS6A 1JPGB 1L7IL 3BT0A 3CX5D 4Y4FD 5KEZA 2JTYA 5HYFA 1OXYA 2C9VA 2GUOA 3FFDB 2LVEA 3RWCB 4GAJL 4Q8BA 1NYHA 1QEWA 2N3JA 3ULVF 1ZVNA 1P5VA 2DM2A 4OQTA 3T97A 4Z7NF 1ED3A 1HTLC 4F2ME 1EHLL 3MRKA 1CGYA 3WUZA 2WITA 5GGQH 3CXFA 5DDHA 2FLMA 2R29L 3VWJD 4HV8B 4YXHH 1CO1A 1AANA 3I84A 1XGRA 4O2EB 3VFGL 3ETBJ 1HHHB 1JNHB 3CQQA 5EUOF 4Z7UA 1EDHA 1HCYA 2VLKE 5F89B 1NMBH 1PTZA 2W9DL 3DURB 4P4RA 4OVUA 1HXYB 43C9B 2JXMB 1HL5A 4UQ2B 4S1DC 4XNXH 1PX4A 3NIGB 4BZ2H 4FTVA 4KJYB 4YPGB 5HYSA 3OQRA 2R0ZL 4APXA 4MA3A 3O9WD 3X17A 1PL5A 4LCWE 5JPMC 3KHOA 3MV7A 4HZ1A 4MHHG 4NZUH 4PJ7F 1G5AA 4MD0B 1ZDSA 5D7IA 5JPMB 2QA4P 1LK3L 1XGQB 2R23A 1XSKA 4JM2B 4K94C 2SEBA 1NGWA 2FQFA 2HT3C 4UV7H 4Q6YA 3S5LG 2H0EA 1HNFA 3FN0H 3LRMA 4ISVA 5I26A 3K6SB 1AXIB 3B3BA 4Q0XL 2X05A 4ELMA 6CGTA 3DXAB 1N68A 2P48B 2AQ2A 1CR9H 5G5DB 2AXTE 4WI7A 3DWTA 4N90E 2P42B 4V1DA 1FYTB 3EOTL 4Q9CA 2DI9A 5B1AB 5TISE 3VXNA 1KTLB 1MFZA 1H3WM 1OIPA 4N0UB 4I18C 3VWKB 3JWDH 3AE4C 1GGBL 5KBDA 5G4MA 4FAAB 1T6WA 3O2VH 3B7RL 1NL0H 1ZTXH 3L3HA 3KEHA 2JI1A 4H44C 1W0VB 3GS4A 5HDRA 4L4VD 5EU6D 4OUOA 4M7ZC 2GB2A 5E2WH 5GRJH 1V55B 4O4YL 3KGRA 5T1DH 1QFUH 3TONA 2HMIC 4EAEA 4IBSA 2FR4A 3QPKA 3B9EA 4MDRA 1PNDA 1QA9B 1XL4A 5F9AC 4AJWA 4JQIH 5IK3A 2CDFA 3O6FC 4J3OD 5F7FA 1J8HE 3CDGA 2X4OA 5E2UL 4G1EA 1C8PA 3K5RA 4KKBD 5DLLA 3OKKA 1TYRA 3QULA 2V7QH 4I13B 4OJDH 3X3GL 2CUHA 2QBWA 4N8PA 2A4ZA 1FJ1B 4UNUA 1QWUA 5B66H 3PIQB 2JJVA 5D4QA 4G72B 4LCWB 4PRHE 3KR3H 4XB8A 2IVFC 4CC1A 1KCVL 4MSWA 3CCVP 1TFHA 3WLWD 4ES9A 2MTPA 5H2FH 4MYPA 2ZWLT 4X6DA 1FPTH 2ZYGA 2VJ0A 1CG9A 3MRLA 3HC0B 1I3UA 3EDDA 1M1JB 4OD1H 4N2BA 4LPXA 3BASA 2K9JB 3HHSB 2IANE 4E9XA 4Q6KA 4O9HL 1NQBA 1MVYA 2CDEB 2L3BA 3RGBA 2H32H 1ZWIA 3AEFC 1R5WB 3MZTA 4HQQL 1Y0LA 4JF7A 1Q9OB 3DVGA 4JQXA 3FJTA 2CMRL 3QT2A 4J28A 4HWBL 2F7IA 4PPTA 4RETB 1KXQE 5TDOB 1YIJP 5KAFH 4HUUB 3K2IA 3O3EA 1FH5H 4KVCH 4WW2A 3OZ9H 3BQUD 5E6IA 3ROLA 4N0YL 1DLHB 4ZD3L 5LHDA 1BD2B 1MHPL 3TT1L 5EIIB 4A63A 3II2A 3V0VA 4NQXA 3BSZL 3CLWA 2VDLH 4H0LC 4PVNA 4Z7NE 1UTDA 3NSJA 1SOKA 4PG9A 4YSAA 1T83A 3C12A 1OMIA 3FU0A 4KQ4L 1YJWP 1MNUH 1N19A 3HRPA 3OR7A 3VXUE 4D8PB 2EUXA 4UT7L 4HMCA 2FNBA 4KJQC 4Y9CA 3TOPA 1RF0C 2M3BA 2NX5B 4ZUSB 2BP8A 2Y7QB 1CFVL 3QIWD 1VQ7P 2V4LA 3LS5H 1E5UI 1TYJA 1KIQA 1YLBB 4RSYA 1F6LL 5JQ6L 5JHDB 2XU9A 3H56A 4HBCH 3L72E 3RBZA 1VADB 4JMXA 3TNNA 1OO2A 2X6AA 2KSEA 2JH2A 4IOFC 1IUZA 4N85A 2NY3C 1XMEB 2H6PA 1OSPL 5LN8A 2IXQB 2JJSA 2YUXA 5IB3A 5IQ9B 1NTZE 5D7LD 3SDAC 3EO9L 1CMOA 4XTRC 5KSAB 3A0HH 4L8BA 4PJCA 2QQLH 5IFJB 2VDMB 1NCIA 4M1CC 3HKZA 3TA3B 2XZCH 4N3YB 2XLLA 1DVYA 5A43C 5GTHE 5JW3H 2R0LL 5H37H 4E5XG 2X9WA 3W0WB 3KXFD 2WLNA 5GRZA 4RQQB 3RL0B 4W7ZA 3CMOL 5F88B 4BZ2A 2WBJA 3CFTA 4XP1H 2BNRE 3AQXA 3VXQA 1E90A 1JG9A 3BQUC 4M4RB 3GJFK 4J3OF 3UTZA 4HJSA 4M8UA 1KYOJ 4IBQA 1SLXA 3ZO9A 1N6QH 4KRMB 1J9CT 4U3FD 3HE4B 2EH7H 4HIXL 2WQRA 4PV1C 2OCCB 2X53A 8PAZA 2R7EB 4M61A 1GYWA 3TGUD 3EO0B 5GRYA 4BDVB 4S0TD 5GTIE 5DXWA 5IW6A 3P30L 2XN9A 4WI9A 1XVSA 4Z3FA 1KIRB 2VQ1B 3ZQWA 2XTJC 2ZYRA 1VFBA 2P5WA 5I8EB 3DIFB 3L70J 3EHBC 5MP6L 1S8DA 3ET9F 4AENA 1Q1PA 3LKSA 1JZIA 1A25A 4FEIA 3RI5F 4OZGA 5FGRA 4QUOA 4MJ4A 4N9GA 5ES4B 3GRWL 4WI8A 1JNHA 3L8QA 1KQFB 5KOVC 2ZWZA 5KUKA 2PMZA 5B5EH 4L9LB 4D9QE 2FO8A 1NC4B 1VADA 2R4SH 3S36L 1WBYA 1J1EB 1L2PA 2QQQA 1IZNB 4L9LC 3FSOA 3AG4B 2K37A 3DUSA 3PV6A 2BHZA 2NW3B 3UAJD 2FX8L 3CVHB 1KGCE 1KY7A 2DJSA 3ESNA 3SJVB 5JHLA 3W2DL 15C8L 3Q5PA 4IRSB 3H9SA 4GIOA 6PAZA 3I9IA 3UABA 5KTBA 2H5UA 3RBGA 4NT6A 4ABQA 5AFAA 4FGMA 4XNAA 5FDWB 1E5CA 3QEGL 3D6YA 1A6AA 2QVFB 1J12A 1QVOB 2ADJA 1THCA 4NI6A 1N5AB 5HHNB 1OTTD 4NAMA 1ZLSH 2YAHA 3L71J 5DQ9A 4RDBA 4ZOAA 5DI8B 3FO2B 4GIFA 1UG9A 2GC7C 4A37A 5B4MD 2D31A 4AQOA