5AVUB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 7.0 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avuB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avuB02
3M0AA 5AW1B 5AVZB 5AVYB 1X8YA 3L36A 3M0DA 1GTWA 1MUUA 3NMDA 5AW5B 2Q7CA 4EOTA 5APVA 3V4WA 5AW9B 3NXSA 1CI6B 2R5DA 2YO3A 1FOSF 2XU6A 2E43A 5AVRB 1OWAA 2P7JA 2W27A 5AVTB 3UIAA 5APTA 5AW6B 1SP4A 1MV8A 3NFQA 4DZOA 4RESB 2ZXEB 1H88A 3T97A 1H89A 1FOSE 2Q5UA 1A02F 3KDPB 4C7NA 2WPRA 2ZFCA 1CSBA 2C9NY 2WPQA 1YYCA 1S9KE 1GD2E 3P32A 5AW8B 4HYTB 2Z5HA 5APWA 3HE4B 4GT1A 1OXZA 3MD0A 3A5TA 3TK1A 4AUWA 2XV5A 1A02J 3LIEA 3HTKA 2P2UA 3IR9A 3NTNA 2Q3IA 3SWFA 2Z5IA 5APQA 2H7HA 3WGUB 5AW2B 5APUA 3VMXA 2R5BA 2XZRA 3P8MC 4JYCA 1HBWA 3M91A 3VMZA 4JYBA 2WTYA 3HE4A 2WWWA 3M9HA 3M06A 1J2JB 1KQLA 4AYCA 3VN0A 3A2AA 1G2CB 3M9BA 3TNUA 3KQGA 5AVSB 4XE5B 1JNMA 3B8EB 3VYIA 5AW3B 1HWTC 5AVXB 4I2LC 1GK4A 4C46A 2WT7B 4B86A 5APYA 2W6AA 1FAVA 2BASA 4AQRD 1GU5A 1HJBA 1CI6A 4RETB 4LC1A 2VRSA 2QM7A 3TNUB 3P7KA 5AW4B 3LIDA 1T2KC 5CMZA 3V4QA 5AVUB 3TYYA 1NWQA 5AW0B 2R3CA 2E42A 2C9LY 2N9BA 1NAFA 1HUCA 3HE5B 5APXA 1SLQA 1CZQA 4GKGA 2WPSA 2IPPA 4KHXA 1GU4A 2JJLA 1DH3A 1GK6A 5AVWB 1IO4A 3A3YB 3VMYA 2P67A 5AW7B 3V5BA 4M3LA 4C7NB 1H8AA 2YNYA 1MFZA 3L37A 4I6MC 3A7OA 2WT7A 2YO2A 3WGVB 3OAKA 1T2KD 3I5CA 3HE5A 2QM8A 5APSA 5AVVB 3O8ZA 1S9KD 2KP8A 3VTPC 2R32A 1JUNA 5AVQB 3L35A 1GZLA 3MGNA
chains in the Genus database with same CATH superfamily
3L7EA 5EO1A 4MRBA 4L1BA 4FLSA 3C5JA 5BVPL 1JRHI 2R29L 3R4RA 4YC2B 4WEUD 3P2DA 5FYLH 3ROLB 2WKOA 5TE6L 5GSVA 4JN2B 4D94A 5D70L 3PRJA 4TNVF 4XZUA 2HX9A 5CCHD 1FE6A 2NY4B 4F9LC 4XI5C 4BEIA 3LHPL 2BP3A 3OAWA 1NMAL 2MJWA 1UCBH 3BXNB 3ATAA 4EOWH 1MJ8H 5K39B 4APQD 4XR8C 1L3WA 3ZKMC 4UTAL 3QPQD 3FQYA 4LSVH 1SJXA 1CQKA 4U6YB 4X6CF 1NTKD 4Z7QF 3GLEA 2G0LA 3ESNA 3PAZA 2AXWA 5DJ0B 3ATFA 1B2WH 1BE3D 3QUYC 1DP0A 4WSGA 4LBEA 3F5WB 2V17H 3ASWA 3OKLA 4ODTH 4WW2A 1MEXH 4PJGB 4NKIL 4UM9A 4A66A 4PS7A 5L4JA 3HE4B 1HC1A 1IAIL 3EJYD 4JVUA 5D93C 2OQJA 2VDPH 4Z7OB 1CE1H 2H32H 1NC4D 4JY5H 4HZAA 2EKSA 3IFNH 2ITFA 2C0WA 2H7HA 4XVSH 4U6XA 3WG7B 5E08H 3MX0A 5E94B 4YK4B 3BGFC 2VLLB 1JHTA 3ARFA 4IRSA 1CG9B 1M71A 2HRGA 2ILLA 4J3WA 4R7XA 3PQYE 4Y1AE 5DC9B 1BBDH 3ULUL 4AYCA 1J1PH 4RAUB 5F7EL 2DTMH 5KVMC 4NQEB 1WD8A 3X3GH 2EACA 4N2HA 2GK0B 4MCYB 4NM4H 5DS8B 1I1CA 1HQ4A 3F8UB 1Q9WB 1EZLA 2CIKA 2E0PA 3BE1L 3HE7C 1LEKB 3D9AH 1YYMH 4LRIA 2HTKD 2I9LB 4WUKL 1WTLA 2V5SA 4D3CH 1Q9WA 3CFBA 3N85L 1H3WM 4QDGA 1K6QL 5ILTH 1BQLL 5DMKB 2XA8H 4F7PB 5CBOA 2R2HA 1UWEH 4XOEA 1JGVL 2CG9X 2AJSL 4KO5A 2CKBH 2OJEA 1OZHA 3DRQA 4KZ0A 4MAUL 2A83A 1RQUA 1EO7A 5D7IE 1RJZA 4OFYD 5FIEA 3RFZB 5EO0B 3DA0A 2QPSA 1DBBL 1QBBA 1INQA 2EQDA 3MOBL 3X3FH 2JJLA 1VADB 2OMBA 3DV4B 4KK8D 4XP5H 1CXKA 5CP3A 2K8MA 4DN4H 1KV7A 4KRLB 3KCWA 2IFMA 3QUML 4CW1B 3HZMA 1UH3A 3C60C 4PJCB 2MH4A 1AKJB 3FONA 3RJQB 3R1GH 3USSA 3K8LA 1NBYA 2Y5QA 1KBWA 2FRGP 4Y99B 2FBOJ 4JKWA 4H2AA 4NHUA 5HJGA 1DSYA 3RWDB 1E2WA 3HI6L 4C4BA 2A73B 3U2SA 1ZY9A 2Q86A 1UH4A 1ZR2A 1RZ7L 4NFCA 4B5EA 3KLSA 2PFXA 2CHDA 2LVEA 3TASA 2BOCA 2BJMH 3SODB 3HPJB 2P45B 4BGLA 1XGUB 1WP6A 4LAQH 4U1SA 3N9GL 1J1EC 4Y1SA 2NRDA 2EUXA 3GMLA 4KTDH 3S4SG 4M29A 1PU0A 3MBEB 5C08A 4G8GE 4D2NA 3FFCB 2BWQA 1P69B 3U1QA 1BXAA 5CEZE 3QAZC 3SPIA 3GMLB 3ULVH 4EZLA 4LNVA 1JD9A 1YJDL 2MTAA 1W16A 1PKQE 2Y2YA 4I4WA 1GC1H 4RRPA 5AUMB 5B39B 3N1QC 1SHXA 2NNAB 4N0CC 4OLWL 3CFMA 1E9PB 2LHAA 2ITAA 3WCYA 2Q3ZA 4GUQA 5DHMC 3C5XA 3ZDYF 5APWA 1YEWA 1TU2A 3ARRA 3J7HA 4H8QA 1LP1B 4HX1B 3RK2C 4WK0B 3ZDXB 1Q90A 3UAJD 4EIJA 4U49A 5BRZE 5JR1H 3QCVH 4GRWF 4ICWA 4JM2D 1WWBX 1I53A 3P77A 3QQDB 3V6BR 4MMYB 5CZXD 1K9MQ 3WAKA 4NENB 3T5WA 3RGBA 4IJTA 2IANB 1R75A 1MWAL 1UM5L 4UUJB 2QSVA 3V4VB 2AANA 2E9GA 2X2HA 4MA8L 2A1WL 1CTOA 2ED6A 3VFSB 1G7QB 1J2JB 2P5EB 3F58H 1S9VA 1FO0B 5AYUL 3VACA 2FGWH 3G9VA 2CSPA 3OSVA 1IJ9A 4AL8C 2NDFA 3IMWA 2Z8RA 3TN0B 3T6WA 5DMJB 3IFOA 4JJ5B 2NY1C 4XOAA 4FTVD 3BAWA 4R26L 1BZ7B 5C0BA 4CVUA 5EA0H 1P5VA 2ICWI 5FF6A 1QO3B 4OFPA 2QT6A 2W91A 2JKRM 3O8XD 3GXTA 1GOFA 3NCBB 3T8VA 3EOAB 4PN6A 3UTTA 4ZMAT 2XG5B 4H8WL 3T0EB 1QYGL 4OZIB 4ZFOA 1KZYA 3IDYB 1U6AH 3BX7C 1IEAA 3OHMB 4P23C 2HUEA 1DBJH 3FQRB 2L7UA 4LSRH 4Y4FA 5DD6B 2EYRB 3TNNA 4DP4X 1M7XA 2OYKA 2PAJA 4R4FH 4IU3A 1FRGH 4NC1C 4JEGB 1IAOB 3LKQA 3SOBL 4HLEA 1SQQD 5E1AA 5HYSG 2H0EA 1IFRA 5C6WH 2GJPA 4R4NC 3T0EC 4GODA 3ZQWA 4PJAB 4QY8A 4K55A 2P9RA 3O41A 4AGOA 2VMJA 4EI0A 1WFTA 2ATKA 1RH5B 3U1SH 1SQBJ 1VPOL 3L37A 4YZFE 3QNZA 4JKLA 4RGOH 3QORA 4P4KD 1G6RA 2F15A 4GEIA 2XJLA 1NVOA 4MCYA 1OTSC 2MQ3A 4YFLF 2AQTA 3FN0H 5A2IH 4AK1A 2AMGA 1TO5A 3H9HA 4QRBA 4R5TA 4JZOA 1LTJC 3I02B 2ZYSA 3PDOA 4GBXC 5DQDL 4EDXA 5I0DA 3QDAA 4I18B 3M0DA 3GMQA 2V4HA 3G04B 1D5BA 3EF7A 3RBZA 3IFLL 3KPSB 4DKTA 5IGXH 1X4XA 1N5AB 5T1DH 4LSDA 1ZVSB 2AZUA 2NDGA 1N0LB 1LT9B 3LQAL 1JMXA 4KJQD 1DBKL 2POHA 2Y7SA 2G4EA 2YAEA 4WGKA 1L0NG 2CO1A 3O4LE 4QAMB 5AOMA 3S48A 1RMFL 1KELH 1HOCA 3JUZA 5BV7L 1QWNA 1IV8A 1UOVA 5DD0L 5I1AA 1NIDA 1JB0J 1Q0XH 5C9JB 3H7BA 2YXQB 1ZMEC 3RJOA 3ZL4H 2IDCA 2XFXA 2DIJA 4HALA 3CXHJ 3V0JA 4M5YH 3FONB 1QQDA 4PWJA 2BC4A 5E6ID 3DO4A 3L5WB 1F45A 4HWZA 3MJ9H 4GKLA 1HIMH 2A6IB 4Y1AA 4YIQB 3QCUH 4EVNB 2AEJA 4Y1AB 1Z1WA 2XDJA 3JT0A 5CEYA 4HZLB 4O5LH 1QL1A 4M3HA 4YXHL 1MRCH 1RPUA 4GG8A 2ZAHA 2Q8BL 4ELDA 3O9WD 3A6CH 3BPOB 3O6QB 5HHOD 2OYIA 1PX3A 4GIAA 1TLMA 4XN4A 2E74D 1R3HA 2AP2A 2ALWA 1EAOA 4GLRH 5CZVL 5T1LD 4BRVA 5AYUH 4U1HA 2NYYD 3DV6B 4N2AA 5F1SA 4XBEH 1XTCC 2W80C 2CWRA 3MMEB 2XVKA 3H1HJ 5ILTL 1KTKE 1S5IL 3RL0D 2ITDB 3NAAH 3S8WA 4K3AA 1NLBH 2X12A 3BUTA 1SMAA 3EDFA 5ETUA 4GQPH 5D7IA 4AYGA 3WV0A 4M6NL 4ATTA 2CRMA 3LZRA 4QEGA 3ISRA 5E4AA 5H37A 2NY7L 4LNRB 3H54A 5MEQA 2WSPA 5GS0H 1FNLA 4BWUA 3CZLA 1MCHA 4AVIA 3NMEA 1FDIA 2HFED 1GMIA 4J28A 1DZBA 1YNLH 3GT6A 4MX7A 5D8JH 1TQCB 3EGDA 1EDHA 3KYNA 4Z77B 3L73J 1NGWB 3GZQA 5I18H 3DYMA 3U6RA 3GMAA 3ZUCA 1P0SE 2A6JB 4C56B 4HPHA 1G7QA 2P5EA 4LEOB 5C0BE 3S9OA 2WGNB 1E9OB 3FCTB 4N0UA 3CFNA 4PTTB 2WTRB 1VPOH 4XPFH 3CDFA 5IBTL 2V2WB 1UGKA 3OM3B 2FT6A 2OR9L 3GMRA 3PF2A 3QIWD 4IBZA 4JNXA 3P4MB 1JK8B 5AW9B 2F0CA 1ACXA 3NJVA 4JAMB 4L05A 4LFHG 3VXUB 1W80A 4H26B 2PRRA 2WZPA 1KXVC 1W72A 4G2AA 1NKZB 4Y4HD 1R3LB 3CFDB 2NY3C 4FQJL 1SDYA 1LO3H 3P8CD 2UXFA 4LVHC 1KB9I 4P2OD 4CILA 3UZEC 3FWLA 1MFUA 1V54B 4Y19A 3MTUE 1I8KB 1QSVA 3MREB 1UTDA 1RUPH 4U3FD 4RRPG 3RK3B 4YLCA 2XNAA 3S4RA 4JFDD 4UBDC 1LDSA 3EYQC 2DI9A 4U7MA 3BIBX 4XXWC 4B3EA 2JKIS 4H13C 2YLKA 1RJCA 1Z56A 4Q0XL 2WXQA 4QRPE 3FT2A 4Q58C 5D1ZB 3BVXA 2FWSA 3FOLB 3AE4C 4UTCA 1S5LH 4QHUB 5CF3A 1P84I 1UB6B 1F1DA 1A14L 1Z9LA 2VKWA 3WUTA 3TCLB 3BDBA 2QADD 3FH5A 3BUQA 1NCAH 3UBXG 4UT7H 1HYSD 5I18L 2BSTA 5GGUA 4EXPX 1S7QA 4BK5A 4FDWA 3ZGIA 1WISA 3RA7H 2CLRA 3NFSH 5KSUB 1PPJD 2XWTB 2IBGA 5EDXA 4Z7VE 5KSAC 1OT2A 1XZWA 3AE6C 4E41E 5I71B 1MHHA 2DLGA 2B0SL 2ZKXA 4PS4L 3I56P 4OV6F 3VXMA 2PLTA 4XWOC 1OW6A 4F91B 3OZ9L 1E6OL 2Z35B 1PP9D 3N40F 1NKRA 2LU4A 1S1CX 3I85A 3CFJB 3LZLA 4YDMA 3CJJA 5EZOH 5DJDB 1S7UB 5DVOA 3MKGA 1PLCA 3EDDA 5JA8B 3MRKA 4W81A 2FD6H 3EJJX 4CVXA 1RURL 4GAGH 5C0ND 1P5UB 4JG0H 1SQBD 1VF5D 4Y4KC 4UZGA 4YL4A 4RFEB 2BIMA 1X3DA 4L8DB 2J5LC 3SWKA 4H44C 4OCNC 1ZCRA 2QEJA 4D0DB 2WNGA 1ZA6B 5IB1B 1E9QB 3LN4A 5KBNC 4K71B 4LEXH 2YPLB 5C0DA 1Z0MA 2OR7A 2V5TA 2APFA 3KAAA 2OYIC 3L71E 2H2PC 2EIKB 5D7JA 1KMGA 1CIUA 2WN3A 4ELMB 2BZ7A 4R97B 3I75A 2J8UA 4P5KB 3AE2C 1KGYE 1DEDA 1PKQB 3U83A 1ERNA 2O5ZH 2LR4A 1YEJH 1EGJL 2N1KA 1I9RH 1P2CA 1QNZH 3PWPA 3QDMD 4RMWA 3DKHA 3L2LA 2Y2TA 1M7IA 1L0ND 3O2VH 3CDGA 5LBSL 2JK5B 3BEWB 2W83C 3HPLA 1LTIC 3WUWG 1B4RA 4KOCA 1ID5I 1UWGH 2V9TA 3CCSP 3SE9L 4QGTA 1ADQA 4NO2B 2X3AA 3GBDA 2VRAA 2RGSA 3SCMA 3ULVF 1A65A 5LNGA 1SYVA 4OCRL 2CHNA 3PFQA 4X5XB 1ZT7B 2MHAB 4LU5H 1TVBB 4JQIL 2I1JA 4X0KB 4H8VA 4F5CE 3O3EB 3Q8AA 1MVFA 1GZHA 3P3TA 5ERWA 5FPIA 5C0RH 2B9AA 2WSCJ 1CDBA 2P5EE 3K5RA 4Y1AD 2P24B 2XKSA 3I2CL 3RUGF 4LSRL 3NCYP 1VESA 2H8PA 4LSVL 5GRUH 2Q7AA 3N50A 3RGHA 5DJTB 4BGDA 5TJHA 2I60H 3BZEB 4MJID 2NNCA 4NRYA 3UAFA 1CICD 4HHAA 4HWEL 4OAWA 4ZMWA 4M6OL 1YNTB 1ZLSL 2NQDA 3PHOA 2EYTA 5C0CD 2V2WA 4OCWH 4APQA 1VPCA 5D6DA 2MCG1 1Q2NA 3GSQA 5IESH 1W8EA 3L2MA 4X5QA 4WY4B 1WWWX 2X0UA 3BAXA 2PN5A 1RUML 1UHVA 2ODIA 1PPJG 1PJWA 1FIGL 3L08A 1L0LJ 5GSRB 4NDMB 4P2CG 1XTLA 2W92A 1IC4H 1T4WA 1DLFL 2H1PH 4X6BB 2BIQA 1AZNA 5I1CH 4DK3A 1QW9A 4GG6B 4LOFA 2QSTA 4XC1L 1GS6X 3CBRA 1MW0A 4FXGA 2DKUA 2Q5BA 2L04A 3A5VA 5E0QA 1MNUH 1EXUA 4MJ6A 1BZ7A 2XRAL 5I8EB 5C0BB 4OCSH 1R19A 1OTTD 2CA3A 3WEAA 3MHVA 4Z0BH 2V7HB 5JTWA 2C9AA 2WUCL 1JZIA 1K73Q 3B5NC 2DWSA 4KI5E 4HS6A 4UU9B 2R2CA 1FFNB 5DK2B 2RACA 1RZIA 4NRZA 1YEDB 4GH7B 1C7TA 1V7NL 4X99B 3NIDF 2HRLA 3D39A 5AL0A 3PWJA 3TBTB 1IAOA 2EC9U 2P5WA 4GRWH 5JQHC 4KXDA 1CF1A 4Z18A 5LCVH 4DN3L 4HIEA 1CD8A 4BUQA 1F90H 2E4TA 2HP4A 1Y8AA 1L4AB 1R3IL 1WA2X 2FX7H 1SXBA 4I2XE 4FQ1L 2CBTA 3D2TA 3IGLA 1U8OB 1UKSA 5E51A 1F1GA 1OAUH 3MN8A 3PNRB 3Q1SL 3SBWA 1WJ3A 1I9RL 1QNZL 1M71B 2YXMA 3NGBC 1N18A 4GKNB 2OSLA 4PJAF 3MLXH 1UD2A 2IADB 4RA3A 3SDYL 3O2VL 1LK3L 1E5AA 5GIRB 3EYSH 2VKXA 3BC9A 3ZKXB 2OMUB 3RGVB 3JV6A 4N78E 4CJ1A 3DSNB 4L8DA 1B9ZA 3MJ8B 4XNXH 5GGRY 4YE0A 3VDBA 1ZS2A 4C7NA 1NCGA 3ZHLA 5GS1A 3D4ZA 1A6WL 4OD1L 4HUVA 1H0DB 4HJGB 4G5AA 2OSXA 4TSCL 1JTTA 1WCQA 2D9QB 2KH2B 3KNBB 2EO9A 4ONOA 4GOEA 4TPRL 5HDQH 3RU8L 2VH5L 3UP6A 3BRDA 2EDRA 1OXZA 4XC3L 4AQZA 3BAJA 3LH2L 3I74A 3LNDA 4GFTB 2V2XA 3FBKA 5DUBA 1FF5A 1N8ZB 1FYTE 5SV4A 5KLVE 4K5NA 9PCYA 2Y24A 3NN8B 3SDAC 1JHKL 2ICES 5GTIH 2DQDL 4IK7A 2A6DB 4JY6B 3VXSE 3WUUA 2VDKB 4NQCA 2EXWC 3LRHA 4JFWA 1CK0H 1R46A 1FFRA 5F7AA 4HJGH 1KCRH 5C9KA 1XBRA 5FYKE 1NTKJ 3C6SA 4DWHA 1IJDB 2YKLH 2VLJA 3K1KC 1P1ZB 3DHMA 3LPWA 3ZTEA 3N55A 1EXHA 4LPVA 3TV3H 5DCCA 3G6DH 5J06A 1I9EA 2GITB 3VTMA 3DV4A 4M43H 1R17A 3PDGA 4GLRI 3H25A 4OLVH 2CO3A 1INEL 2CO6A 3P4OB 2R56L 1LO5B 5GS2D 3BGMB 3U6XA 3RTQC 1QI5A 2BZDA 5C09A 4BFIA 3EH5B 1OB0A 4NUQA 3HN8A 4JQXC 1O6SB 2LOEA 1E4XL 1Z9SA 4XP6L 1MF2L 5E1HB 1UADC 4YSCA 1CQYA 5E5MA 5GGVH 5E7BA 1URQB 1JXFA 2NT1A 4AMXA 5ANME 2ZAEB 3GLZA 4R96A 4N2BA 4HCFA 1TVBA 2AERT 2QR0A 1UA6L 4PJ5E 2L3BA 1BVKA 4PAZA 1BDCA 4H0HB 2ZX9A 1NAYA 4LVOC 5MP6H 3HPJA 2D0GA 5CCGA 1XF3B 1HCFX 2JKSA 2W9EH 3CK0H 4GI8A 4TUJA 5GGSB 3G3ZA 1AYOA 2Y69B 3NZSA 5GJTL 1Q72L 3FQ1A 3GUTB 3S4SB 2WCPA 4PLKD 3L54A 1XGPB 3F12A 1IILE 3HMXA 4MD4B 4DJGA 5DZOA 5JIDA 1FP5A 5IR1B 5H37H 3TT3L 1CGYA 1P4BL 2VDMB 1GKOA 1I7RB 1E2VA 1TCRB 5BVZA 4MVBC 4ELKB 4NNPL 3NJLA 2ZCKL 4Z7WA 1V7NH 1IGIH 3U1PA 4LSTL 5H2BA 2OMNA 1OWRM 4O9BA 3ZZQA 1D2PA 1NCTA 2BHZA 2R29H 4MQXC 2QHRL 5H2BB 4BA0A 1AIFA 3KZIH 2VSKB 3B5GA 3L3KA 2NY6D 4J6RL 3MRGB 3T4AB 1LTJB 3D71A 2QQQA 5IQ7L 3QSKB 4CADA 1O0VA 4MJHA 1E5CA 4QHNA 4UQDA 4RJTA 2ZOKB 1L9QA 2FHFA 4JRFA 4L0PB 1W0VA 1OWAA 1S4XA 3QWOC 3AY4A 1JZ2A 5DZJA 2WZ6A 2EZ0D 2JB5H 4M4RB 1AVYA 3FT9A 4Z8FL 1IFGA 4LE8A 1BVOA 4B95C 1VCBC 3CN1A 4PJXF 4ZT1A 4WI9A 2F8IA 3MNVA 1P84H 4QO1B 4N3TA 1NTMD 1W5CE 3MNZA 2BVUA 4I9WD 2CCVA 1L6ZA 2AJZA 4HK0B 5EEUA 5H8DA 5E5RB 1I3RB 1A9VA 2R27A 5FXCH 3ARDB 3GSUA 3SDCB 5L7XL 1HHHA 5CO1A 1QL2A 2KS0A 4FN0A 5H35B 4C7RA 4DAGL 5E0FA 4EI5D 1Q0XL 4NO0B 1KTLA 3MBED 4WW1A 2XKMA 1UZ6E 1GL2C 4EO5A 3FT3A 4QHPA 4AIEA 5IB2B 5E6IC 3MYJA 4NO5B 1MAMH 1UB6A 3LH8A 3ZR5A 3OKDA 3NEOA 2BCKB 4TSBL 4H0LC 2ENYA 1XSOA 3UEZA 1EZVY 1FLTX 1DQKA 3RWCB 2QKIC 1MDTA 4RFOH 5H4YA 3L9RB 1V3MA 2ENJA 4F92B 1LP1A 4CMMA 2W0KA 3MZGB 5LWYH 2V2TB 1A0QL 1WRFA 4U0QB 1C5DA 5GGVL 1CU4H 1CZ8H 1W6LA 3QNYA 5ID0A 2VDNL 4KZEL 2KT6A 1EJOL 1FZCA 3AS0A 3AE9C 1MFAH 4OLYH 1M7LA 2YD7A 1QSEA 1UB5B 1XFPA 1QZNA 1HFUA 2J8OA 1CXHA 4JO4L 2DYPB 3RDTD 1YA5A 3CD6P 3RZCD 1N19A 1RJYB 4NUGL 43CAB 2VLKD 2IFNA 4MD5B 5AZUA 1JXJA 1JHLL 1JZ6A 1LP9E 1GS7A 4XVTL 2BVEA 1FHGA 2VXSL 3DXAD 3T71A 1QWHA 3C5ZB 1AACA 3DDFA 3OGCA 4K7PY 5JORA 4M6NH 1BQ5A 3DX1A 2CZNA 4F7EB 2AW2A 1BDDA 4M1CC 4OCXH 1QRNB 3NACL 1YITP 4NHUB 4WFHE 1HHJB 5CBAB 1SBSL 3K2UH 4GSQA 1IEBA 1LHZA 1JPTH 1RK0B 2WQAA 3NJXA 3S88H 1BOGA 3U59A 3Q5PA 1D9KB 2Y1YA 4QF1A 2VC2B 4KH9A 2LR2A 2GCYA 4OD3H 4WI8A 5CFAA 2PMZA 1AGCA 3B2UC 1G87A 4FQXA 1CTMA 1RIVH 1X79B 1PYWA 2B9BA 3CDCA 2JJWA 5E1AB 3LXAA 2AK4E 2KPWA 1MVUB 2KZ1B 4OZ4B 2W0FB 3TBSB 1MEXL 3NG5A 2FGWL 2G5BA 3LQAC 3FDWA 3D3VB 4MDIA 1IAIH 1SBBA 4OZ4A 2X42A 3LZOA 4Y5VC 1V3JA 2VT0A 2WGXA 1YMMB 3G9AB 3JTBA 1NBVL 4N0YH 5INCA 1S9KE 3S4SA 4HYTB 1U2CA 1RZGB 3DOHA 3MD0A 3WIIH 2CK2A 1X9QA 4HKZA 2Z9TA 3WU1A 3GTNA 3DJSA 3QCVL 2V7QH 5DUML 2EDQA 4PS4H 5CBEB 4HX1A 2BCMA 2E5TA 4KKCD 1MJ8L 3AB0C 3TLRA 3QEUA 1R5IB 4MMZC 3O3EA 5FYKL 5D7IB 5HVHB 1VQMP 1MLBA 1N3NB 5B8CB 2MWCA 4MTMA 2IFFL 1F5WA 1T7YA 2R23B 3VWKB 2O61A 4KXZI 1IBYA 2WXHA 5JOEA 3X14A 1ADQL 1RZ8B 5F7HA 4YSEA 5J11B 4UM8B 5FA3B 3UROR 5AVSB 2H8PB 2NR6A 4CUCA 1VKXA 3FZUC 2WQ8A 1F4AA 3BIAX 5KLVG 1AZVA 4R26H 2P80A 2BRRH 1VKXB 4FFVC 4HJ0D 4N0CD 3X13A 2BASA 2LW3A 5A2LH 1FHNA 4P4KC 4ZFFB 1HOEA 3GSWB 1WG3A 3D48R 4KQ0A 5D4QA 2XIIA 4LL4A 4DVRL 2QZ5A 3NZUA 1RPKA 1LO2L 3GSWA 4PD4D 1WLHA 3H56A 4O00A 1U8HA 3L9EA 4L1HA 4R0LB 3VFMB 3VXSA 5F7FA 3QYMA 4DGIH 1RCYA 5CZXC 5DT1H 1AJ7H 1CFQB 5EBMA 4FA6A 5ICZB 3VQ1C 1NLDL 1OK0A 1HNYA 1CIDA 1MRDH 43C9B 2DN7A 3KJ6L 4AL8L 4HU2A 3QORD 2VZOA 3VP9A 5GZNC 3S9DB 2KXPB 1SQQE 3L73D 1EDQA 2Z4QA 3VFWB 3T0BA 5EDSA 3QIUC 5MEOA 3F64A 4QOKD 5BZWA 3G08B 2AV1B 5SWQA 2AEFA 3VFTA 2QTVA 2X40A 3IDXH 3ULAB 2FUTA 4ZO9A 2YQ2A 2OS7A 2DJ4A 2BSRA 2YC1A 1M1JC 2ATPB 3MA9L 2PWFA 3MCKB 3RNQB 3RVXD 4F33B 3O8ZA 4RMUA 4HKJA 1JGVH 1QHOA 5EIIA 5DC4B 5I8KH 3BCCE 1E67A 2Q3EA 1HHIB 2YKLL 1ETZB 2JB6B 3X1FA 1ZTXL 2Y0EA 3LEXA 2GEEA 1C16A 1DEEB 4G9FD 3TO4C 3P2TA 1SEQH 2BSBA 4MZIA 2PP9A 4XO3A 4LSQH 4I18A 4LNRA 2LTQB 3TOPA 4DGVL 3CC2P 3TBTA 1UACH 3L1GA 4S1RL 4XCFH 1CGWA 1KENH 3PRZA 4LLAA 4KBPA 4RMTA 2QMKA 3HR6A 3TN0D 3HI6H 3VFVA 3DVFA 3MAWA 2APWA 1QSEB 1UB5A 2JTDA 1ROWA 3D34A 4ZFQA 2VR5A 3MRJA 4N2OA 4UUJA 4C56D 2YQBA 3ROOA 4MD5A 3SEPA 5KN5B 2A6KA 2VDKH 2YEVB 1RF1A 1NEUA 5C2BH 3NCFB 3N0PB 3GMMB 2GPZA 2Y06H 4U4IA 3AREB 3L3JA 1KGCE 2R7EB 2VJ0A 1IFJA 4ETQA 1VDGA 4PVMA 2APXA 2HRPL 3J07A 5DYFA 3O9WA 4DSYA 4KMTH 4P07A 4PGEB 3BWSA 5TDNB 2A74A 4AQ1C 3HRPA 1NGQL 4HWBH 2AZAA 5I8CB 5I17B 2WPGA 3O4OC 2EDXA 4U3FE 3MRDB 4MHHG 1BXXA 1HL5A 5F44A 4AK2A 3QUZC 3WTTA 4JY4B 4XE5B 3HBGA 2XBZA 4JPSA 2F53D 5DVNA 3TIEA 3UYPB 1TZIA 1EANA 3HFFA 3KR3H 3OF6D 5BO1L 4BCZA 2PO6B 1ET5A 2WV3A 1WSST 1NGXB 3Q43A 3UYPA 3GHPA 1T89C 2WSFH 5IHWA 2XTJD 4JHVA 4MB3A 2ZWKA 3CPLA 1CI6A 4FQHA 2D0HA 2UY6A 3RBXA 3DVGB 3QDJB 4TYUA 3QUYA 4NI6A 3F00A 2NUTA 1U95A 3DX2A 2ZUQB 3GB7A 2D03L 1CE6B 4HDIB 3WS6A 3OPZH 2XKNB 1NDMA 3L3GA 3U30C 1URQA 3GMOB 4BK5C 4JHZA 3GS0A 3A6OA 2P8PB 2ZXAA 3DSFH 3HHMA 4FNSA 4JHAH 3VD2A 1T5KA 1CC3A 4DEPC 1AS6A 1NDMB 1WFIA 2VDPL 1PZSA 4YGAB 2Z4TA 5CD5D 3F7YA 5LXGL 2FZ3A 2MHAA 2P5WE 4NQVA 4PD4E 1MRFH 1J5IA 3DVNA 3F65A 1L7TH 4AYFB 1U4EA 1H8AA 3F7YB 3UZQA 4J3OH 2ADJB 3O4LD 1MFZA 1S3JA 1X44A 2DMBA 2PCPB 3TF5A 1RQ5A 3LH9A 5D6DC 1PBYA 3MRNA 3RL1B 4ZUVB 1T2KD 3LZFL 1HWWA 4PG2C 4OZGF 1YPZF 2ICWJ 4MNGB 3ZOAA 5BV7C 3MSPA 1KCVH 1U3ZA 5E9DD 1T2QL 1PF3A 3IKCA 2ZXDA 4M5SA 5IW1B 4I3GA 3L6FA 2AK4A 4ICXA 1RH8A 3RUGB 1PGRB 2N0MA 2VL4A 4PRDA 3EDJA 5TPWH 4NWUL 1QRKA 1CGTA 1CYGA 3QJZA 5T33H 4KNQA 5KBDA 2WSDA 4DP0X 1T2XA 2NX5D 3P69A 5DD5H 4E5XA 1KCUL 2UZXB 2NSQA 3DX7B 4P57A 1FC1A 1CLYL 4CADB 4K7FB 5I1EH 3BP7B 3OKOB 3RVWD 2EIMB 4NQTA 1O7SA 2IYOA 5BRZB 1MG2C 3HB3C 1SXAA 1L6PA 3QPXL 3RP1A 5LAXB 3C6LD 5JPMB 4RDBA 1A6VL 1SN5A 1JY3P 2QPEB 4HS6B 1LE5A 1N73C 4UWQB 3C2AL 3T8XA 4W70A 2FLMA 5IVOA 5ECGA 4DGUA 3GSNH 3UYRL 1KJ2B 1ORSA 3PAYA 4I3RH 3U0TA 2FJSA 5L9DL 4G42A 4PJDF 4KVNL 2CE6A 3I3DA 2JTYA 3R2PA 1FNAA 1I9JH 2BSDA 1CW5A 4IDJL 3K2MC 1UVQA 5KKZC 1NH6A 2PPCA 1HWTC 1XF5B 5EOQH 3MX0B 5E94A 1IK7A 2E3VA 4Z7UA 4G43B 1TTFA 4JL2A 1NLBL 3CUPA 4OFVA 1OD7A 3I6KA 4YHOH 4BXLA 2CBOA 2DYRB 3AM8C 4YBLB 5KAQG 1ZXGA 2GAZB 3H4FA 4OGAD 5C3TA 4NJ9L 5FAAA 3O45B 2FQFA 4QHMB 5IB2A 5ELIA 3CH1A 2NYKA 3G6DL 3H1KG 5CZKA 4JG1H 3ARGD 1T2KC 5CMZA 4W1TA 1PGQA 3KHOA 4JRYE 4ZODA 2CDGA 3L73G 4JFXA 3Q5YA 3CLEH 4LLHA 2V9RA 4L3CA 5FC9A 4AZUA 1RP9A 4QJ3B 1J5HA 1JNJA 1YZZA 3PTZA 1PZBA 2P5PA 1AZBA 3KJ4B 3SDAA 4HKXB 4KTDL 1U3HD 2IMNA 5GIRA 1UT2A 4TQ8A 5C6TL 1ZLSH 4ES9A 1IGFH 1MFCL 5BJTB 1KGJA 2BCCJ 3DOIA 1AGDB 4C7NB 2A4EA 1D9KD 1YQ2A 2P47B 3FYEB 3IN0A 5HYJD 1Z9OA 1PY9A 1J1DC 1W72B 3I5CA 2IGFH 1N6QH 4JY4A 2QM8A 5HI5C 3T6QC 1YPZB 4UMGA 4BZ2H 1YEGL 3BCDA 4DQAA 2FYUK 1ZTXE 3MREA 4K9EH 1QZ1A 4ONGH 3VYNA 1IRAY 4P49A 1CFNA 4LSPL 1M1KQ 2BNQE 5AZ2L 4Y4FD 1FZKA 3DO7B 3FO9A 3MV8E 5D7KD 8CGTA 3L95B 4X9FA 1LK2A 2GSGA 1G9EA 1E90A 5JLZA 3MIWA 3UDWA 1SJEB 3LKPB 1IAII 3HC3L 5E56A 2GJ6E 5APTA 3QFJE 2UUDK 3BO8B 3U0PB 4LIQL 2AABL 5IWLA 4OSUL 4UBDD 5C09D 4PY8I 1K4DB 2HKFL 5I1GL 3C08L 3WSQL 1LP9F 1PG7H 3PWUB 2VSCA 4NUJB 2G0KA 1N64L 1K4DA 3CN2A 2JJTC 2FYUG 2WN2A 2XN9A 5SWZD 5BNXD 5DS1A 4ZOEA 5AENA 3MUJA 3U9WA 4KDWA 3VDAA 2E75C 5ANHA 3PFUA 2BNRD 3BGAA 2BDNL 4UAHA 4EBQH 1ZGLA 1SQPJ 3FU6A 2DS4A 1NTMG 1BD2A 2WM0A 4YBHA 1T0OA 2JWYA 1F90L 1BSIA 1CICC 1T2JA 1RUQH 3QG7L 4BQ6A 4DZBA 5IF0A 5DJXA 1X5XA 2A9NH 2D7OA 4N24A 2E5YA 2F19L 3WLBB 3MOQA 2KOGA 1GCYA 5EPMA 1I7RA 1PGPA 1BJ1J 1BE3J 5DJXB 1E4XI 2EYTB 2YK1H 3UYOD 2VMDA 2I25N 1Q38A 3ECUA 4MD4A 1DJIA 2Y36L 4NNXB 1OSZA 1QFUH 2WBJC 3V0HA 4GIFA 2BLFA 2YN5A 3F58L 35C8L 4ZUWB 4HBCH 4BZ1L 4Z76B 2EVHA 4AENA 1HL4A 4Z7WB 1OW0C 3C8VA 4QTIH 3ARTA 3MGOA 4X42A 3DO3A 2X2JA 2BPBA 3G5YB 4X4XA 4XAKD 4IL6H 5KLVD 3ALXA 2UZXA 3W68A 2VLME 3JTSB 4NPDA 1SY6A 2MCMA 4MNHB 1UENA 2DF3A 3QFJD 5DDHB 4XCCH 3OTTA 2OJ1A 1KBBA 1EDIA 3MGAA 3K6IA 4YAQA 3QFGA 5GRXG 4JR9H 1I9IH 5GZND 4BM7A 5IJBC 4A6YA 3L70E 1P7QB 4UZSA 4AMKL 4OZFH 4P2RD 1FZOA 5T1KA 3S7GA 2JCCE 4WJKB 5C09B 5T3ZD 5J9PA 3V5DA 1LM8V 4NUMA 3AE7C 1OCCB 1PZ3A 1TETL 3FRUA 3ZZ1A 1JVKA 2WXGA 1P6FA 1IBFA 3GSUB 3L4ZA 1QD0A 4IKIA 4OSUH 4M7ZC 5T1MB 4R96B 1MFEL 3LZFH 5IFJB 4ZQTA 4NP4H 4NO2A 4YXHH 2WVVA 1M6UA 1MFDH 2WXFA 2FEDD 3QJVB 4AOFA 3RVVD 4G6AC 2KS1A 5AW5B 3A6BH 4MFHA 1YMHB 5D7LB 3VVVA 1LNUA 3DIFB 3EF4A 1DLHB 3MJ9L 4MYPA 1L4AA 2DQMA 5GZNA 2AJXH 1E8ZA 3LOWA 4ONGL 4F1ZA 2HODA 4GG6F 4Q9CA 4NZRL 3B9KA 4EN3C 2Y1VA 3NAAL 1AY1L 3QS2A 2IBZD 1HDMA 3UBXI 4M8QA 5HYSA 5I0XA 1R3KB 2K7QA 3HMXH 1OZUA 3MFFA 4JO5A 4YSSA 1E5WA 3R06B 1G1CA 3KS0H 3CCQP 4XBGB 2DQFB 2O01J 4AUJA 4TPRH 1BZOA 3BQVA 5D1QC 4HWUA 4PGJA 3DMMD 1ZANL 1F00I 4P5TD 1LWUC 5AKTA 3FU9A 3PWLA 3RURA 3QZNA 2PXYB 3L72G 5G2NA 4PSRA 2H5UA 2XXFA 3VO0A 2IALA 4OF6A 2XQYA 3MBXH 3AT8A 1DQIA 4MDRA 3RX7A 4R7VA 5DJZA 1LTSC 4EDFA 3HNTH 3EYFB 4P59L 2VXQA 2O4EA 2GEQA 4PJHA 2IBZY 1N73B 1RK7A 1NC4A 2JSFA 3BXNA 4PGDB 1KN4L 4HGWB 2YIHA 3VN0A 2Q3AA 4O2FA 1SFCC 1N7SA 3WEXB 5EEVA 5EU5A 4JN2A 1IU1A 4XNDA 2ENSA 1DDHB 4CMHC 3EOAA 5J12C 5E2UH 2YUXA 4LIQE 1DQDL 2X38A 4KRPB 4WW2B 1L7IH 3HVNA 4L3ED 1VIWA 2VB5A 3I9PA 4PRAB 1D5XB 4U1MB 3KJ6H 1Q0YH 1SF5A 1DANU 2OCFD 5GGTH 5I74B 4POUB 1AY1H 4CKQA 2HFEB 4XMLH 1SFCA 3Q9QA 2FO1A 4QPEA 3O6QA 6FABL 4WSKA 1RI8A 3FFOA 2Y7QB 4JREB 4Q9QH 5AVUB 5LGHL 2NY4D 2WQVA 3BP5A 3M17B 4HQQH 4Q6IB 3WUZA 1BREA 2XTJB 4B60A 4DUWA 5D4IA 3L3DA 5HHME 3FWNA 4JRYD 4ZAKD 2HVBA 1FPTL 3MYJB 3DGDA 3KPMA 2EIJB 2BSEA 2KSEA 1U21A 2PYFA 2VSMB 2GJ6D 2DOCA 4IU2A 2VLRA 1JHTB 1IC4L 2AAAA 2R1XA 3QT2A 3AC0A 5EOQL 3RWJA 1UD5A 2EKJA 2G9HA 5H2FE 3I9GH 1QACA 3F12B 3O0LA 4G1EA 1MWOA 3MJWA 4J3OF 1PX8A 4L9LC 3EUUA 2W60B 4FQLH 3CLFH 1X5MA 1BEYL 1BF2A 1CT8B 3KHUA 3GRWA 4Z78B 1U8CB 2DJUA 3MRFA 3PL6C 3C09C 4XB3A 4WEBH 2B87B 2V7NA 3SBRA 5FHBH 4JPIA 1DQQA 1JM0A 4LBAA 2C1PA 5CR1A 1ASQA 3QI9B 3DETD 3X14B 4CVZA 4FMVA 1NAMA 1RZ8A 1DQQB 2W65B 4YL9A 1B2WL 3DVNB 3OD3A 5MEPA 4NPEA 5KVFL 4HUVB 2IANA 3R8BB 1VERA 5ESVB 1F18A 4C83B 2X9ZA 2LT9A 1LQBC 4AVJA 4YEEA 1JMZA 3UTQA 5E00B 5GGVY 1ZHNB 2UX7A 3MQIA 5ABDE 1KWKA 1DVFB 4HPOH 5DQ9B 1XMWA 2XJKA 1U8NA 4XC1H 1H5BB 3NFSL 3VXMD 4W4NA 4WVRA 2PPFA 3J8F7 4HT1H 5IBLD 2F6AA 1A64A 3GXIA 4QKTA 1VFAB 2FFDC 1PG7L 4RISL 3JCUH 3FN0L 3QUHA 3SDXE 2OK0H 5C0CB 4KFZC 2FYNB 1I31A 4P2OB 1PFIA 3E1RA 5DJCB 4DVBA 5A1AA 2ZP8A 4HIHB 1X9RA 3ULSB 3NJGA 1I7ZB 1KPVA 4LCUA 3TS8A 3EFOB 2FSEA 4JPWH 4NZ8A 3VX0A 1I3RA 2ZONA 3HAEG 3QA3A 3LX9A 4PJ7F 2Z64C 1U92B 2COQA 1YQ3C 4K71C 4IU3B 4ODVH 1CURA 4M93C 2H1LM 2QBWA 1FGNH 2GUOA 3REWB 4NQUA 4UNVA 3L3HA 5C97A 1O7VA 2VOTA 3TFKD 5BRZA 3JV5A 1U3YA 5EF2A 4YR6A 2PW2B 2IDBA 1D5MA 3DOSB 4WV1A 4HH9A 1PAZA 1JPFA 1S7RB 3QDME 1SFCD 2R0LH 5CILH 3IGFA 1NTKE 2DQIL 3DTXA 2A45G 5TDOB 2JDIH 4ZOCA 1N6UA 4Y4HA 5I66A 2XXCB 2R0WL 5TE4L 2P46B 1YDPA 1S2EA 2O1KA 4U2YA 1KFAH 1M7UA 1ZP0C 1P4LB 5MENA 4P2RB 1GGBH 2JJSC 5DWPA 2R2BB 1TZ8A 4P9HL 3UAEA 3CWBE 1J8HE 2ZG1A 2WP3T 4OJCA 1WWAX 3W39B 5IW3A 1BM3L 2IPUG 2FYNC 1O9ZA 3C60A 1AXTH 5DJDA 1EFQA 1OEZW 2P5ED 2VR6A 4HUMB 2PYEE 3LS5L 5AKVA 3WUWA 1C8QA 5F1OB 4Y8AA 1KLUB 1FG2A 4YNYA 4JGMA 1IZKA 3BJ91 3VFSA 3CX5J 2YO2A 1XGZA 1T3JA 4NPKA 1VAHA 3NIGB 5F97E 4Z3EA 2NY2C 5I2IB 2YARA 1E8XA 5B21A 2JXMB 1WT5C 3X3FL 5CJOL 2F54A 5E2VL 1J48A 4CRPA 5F9WC 3PWVA 3RGUA 3THMH 2IH1A 2VABA 2OX5A 1QW8A 1LWHA 1ZOYC 4RMSA 1MFTA 1FOSF 3CCMP 1TZIB 3K5SA 3TBCA 1GJWA 4X5WA 4ENZA 5LG1A 3PL6B 4RFNC 2B2XL 5DEJA 2ED8A 2JKLA 3QPXH 1IMHC 3RVTC 1WFJA 1KACB 4FKEA 2E7MA 1SQVD 4X4MA 3EJZC 5F8QC 1M90Q 4IIQA 5IK3B 3K71B 3E80A 3KPEA 5EIQA 5GGRA 2QJYB 4K5PA 3FQWA 4CAGA 1FIEA 1OPGL 5C07E 4Q0XH 4HJ1A 2AGJL 3BW9B 4PJ9B 3QDGE 4CVWA 4KUZL 2R0LL 5CILL 3UTZA 1MFNA 1FYTB 3PP3H 4MBRA 4YDNA 1MNNA 4JFSA 4ZXBD 4P3DA 4C57C 1YNKL 4PRNA 3D12B 5E8EA 5ICXB 3D25B 4X0KA 1KIQA 4NPYA 4I5BB 4KDVA 5EC2B 3O0RL 2ADGB 4PWKA 1W2EA 4AZ8A 1OP5H 4G3YH 5HVHC 1HXMB 3HUSA 1XL4A 2D8KA 4L3AA 4LVNC 3QFDA 3BH9B 4KRPC 5DWUL 4L3EA 4R83A 2L7EA 1KN2L 4OM0L 5M94B 5D7JC 3WKQA 1KQSO 4H88L 3SO3B 2ZICA 3ALPA 2VERN 2CR3A 3ASOB 4NP4L 3CI9A 4ATWA 2R8SH 2PABA 4YXLL 3IM1A 5IF0B 1RP8A 2MQGA 1HTYA 1KEMH 3HE7D 3Q5OA 1XCQB 2XTLA 1QOKA 4UT9A 3B6SA 1KJ3L 1KUMA 2XN9D 2LAGB 4XNZB 1OP4A 5DHVB 4L1DA 1RZJC 1Z2KA 3MACH 2BVTA 4P3CH 1KJVA 2XX0A 4GW4A 3BPOC 4IQHA 3JWNG 4B96A 3MRPB 1BIHA 1AQKL 1BD2E 2IMMA 1OP3H 1EZUA 5JORB 3OXSA 1KT2B 5F6HJ 3D05A 4IIZA 4LZKA 5CU5A 5F7UA 4L8BA 2O5YH 4PRIB 2BC4B 1IFDA 2VR9A 3H1KD 4E5XB 3N43F 1LWUB 1QTPA 3I50L 2EDDA 4PJGF 5GJSL 3VGFA 4ALAH 4BXSV 3AM8A 2E7LA 2WZPD 1NA8A 1ILSA 1SJHA 5ID1A 2FSEB 1T5XB 1X5ZA 4X6EB 3VXRE 4KDTA 4PBVC 5DJ6A 1HZHL 4EVNA 4MA7H 3HFML 4NGHH 1A4BA 4WV1C 5B3JE 3QS3A 3QXVA 1GGCH 2IWEA 1RU9H 4NC0B 1NSNH 2EDNA 4GBXA 2B2XH 5LAXA 3QDMA 3RB7A 5KTBA 1I8UA 3G08A 4TVPH 4DHLA 1UWXK 1WS7A 3GMNA 4Q74A 5H94A 4YAQB 5SX5K 2VDRL 4LASL 2HLOA 4ZXBB 3TBYB 1DVFD 3VGAB 1A6ZA 1FFPB 1S8DB 2HG5D 3U9PH 4DKEH 5JUEL 1MLCB 1K8DB 4J4PA 1JHKH 3AMKA 2Y7MA 4YSRA 4KMTL 6PAZA 2YEQA 4OGQB 4FLRA 2ZYRA 1ZLLA 3V4VH 1E5ZA 3B3IA 3HS0B 3RX9A 4I1PA 2FJGA 3NEXA 4FI7A 4LLQB 5T5FH 4PB0L 2X7LA 1SN2A 5I6OA 4W80A 1JZ3A 5FA4B 4X7FC 1WV7T 4WTXA 3RVUC 3OMZA 2QGCA 3P32A 2CUHA 1WFUA 3QUMH 5L4IA 3PWNB 4PGCB 5DRZB 5MI0B 2AXGA 1CXLA 1XGTB 4FYTA 1GY1A 4PTTA 4YSQA 4WWID 1RIVL 5FA3A 4LDEB 3F89A 5GS0D 4ZFZB 5HDRA 3NIDB 5H2FH 4LEOA 1M1SA 2VXVL 3ZDMA 1ED3A 2QQLL 2WWNA 2YFNA 3KE0A 4LLMB 2FYUD 1SQ2N 5CS7A 5L2KD 4ETQB 1IKFL 4JYBA 5C39A 1R3LA 2XACC 3CFDA 4N85A 2BVPB 1HKLH 4PRDB 1TR7A 3SDCC 2CM6A 4ZW3A 2BIIA 1Q72H 1KCRL 2Z31C 2IO5A 4H7VA 3VB8A 5LO7A 3AABA 3Q6GL 3T2OA 4KMQA 1KORA 1UD4A 2DW3A 1JNMA 1S7VA 1F2XK 4KK6C 2YD0A 2EJ1A 2WIMA 3I3EA 1ZT1B 2JF1A 4ZTEA 3L74D 4LEBA 2ZYDA 3LRSA 3ERXA 1FZGA 2I9TA 3LKQB 1HZKA 5CIPB 2J8UB 3TCTA 4TQEH 3V4VL 1SXSA 1XT5A 1U93A 2BMKA 3FF7A 1GGUA 1CLOH 1KB9H 5F7DA 2VYRE 3GBNL 3TBVA 4N5EC 4PJXE 3ZE0B 2QVKA 4JFHE 4XPGL 5EU4A 4B0MB 2PCYA 2O01H 3FTVA 3V9EA 1FNSH 4P3DB 4K23L 1FJPA 4NM8H 5L6YH 4PY8J 5EZLA 1ES0B 4OFQA 5AWNH 2OMWA 4HT1L 1HX0A 2B20A 2QSCL 4JFQB 4XMPH 5TK4A 1SQPD 1V05A 1HI6B 1SXZA 4FG6D 4IDLA 4TL5A 1YC8A 4UIMA 4Y5YA 4GSDH 5KSUA 1TTUA 1MW2A 4V1DD 3KPOA 2FZ3B 4W93A 5A2FA 4FQIL 1KQGB 3EW3B 2ZP0T 4C4UA 1L9PA 2BFGA 2PPEA 1WC7B 1W8NA 2QQKH 1AG0A 1JGEA 3GK8L 1GZLA 5KSVA 4UB8H 2GSIB 2QJYC 1OE2A 2HPTA 3VRJB 2E8ZA 4XN9A 3LHPH 2ZIDA 4XO8A 1NFDB 2XG4A 4XI5D 1MUUA 4XBPB 3GPSA 1AJ7L 4JFXB 1BGYD 3HW7A 4XNAA 3V7MA 2KNCA 2EICA 3FQXA 5KZCB 4ZI8A 3SDAB 4HWBA 2VDQB 4IK6A 3OJVC 2V7NB 2Y07L 3CHPA 3BUBA 3QDHA 4XXWA 5FO9A 1CTNA 1G1IA 4MXVE 4GAYA 1WBYB 4OKVB 1TTAA 3HZKA 4OW6A 1CDUA 1XVSA 4LSUL 2JB5L 2PWEA 3FSAA 4N5ED 4K5MA 4ZBJA 2ROXA 2GTWA 2OL3L 5GGQL 3P11L 4YGVA 4JY6A 1JFQL 2ITEA 3BCCJ 1U3HA 1VRSA 2VXQH 4O02H 5A16B 2HG5A 3RFZA 4HUWA 5DI8A 1JDAA 1BMGA 4YDKH 1ZVNA 1FORH 3ZYZA 3QDMB 1GL4B 1U8IA 2EDHA 2XZAH 1C08A 3VJ6B 5BXFB 1RF0A 3TSIA 2PR4L 4MMXA 3HPLB 4WHYG 5EF0A 3UBFA 4LDOB 4CW1A 3JBG7 1OAYH 2KZJA 5G5DA 3GFUA 3TEUA 1LWJA 3PWPB 2HRHA 1OFCX 3W5NA 3SDXB 4LHUA 3DVGA 3QDJA 1TQBB 1FZOB 5T1KB 3TTYA 4TUKH 2ZOOA 1PW3A 1BZDA 3U4BH 4UQ3B 4XP6H 5DZAA 2NY0C 5E23A 3ZDZE 2PTTA 2F7OA 2J4WL 4HV8B 4GUCA 1SYVB 4N0FA 4FA8A 5IMMB 1UXMA 2ARJQ 3SFEC 1KJ3H 2BZCA 2PWGA 4CL7A 3DYOA 1YG9A 4YO0A 2WYHA 4FI8A 5CCGC 1SGKA 4UNTA 5CD3A 3V0WL 1K5NB 2EDYA 3MOBH 1DE4A 3II3A 4FQLL 4M5YL 5GS0C 1IE4A 2B8OT 3CZFB 4MAZA 2R1YA 4KRPD 2IYPA 5HI3C 2WLNA 1K5WA 4PUBH 4APXA 5IQMA 5F9JB 3K2UL 4OZHE 1AO7B 2IADA 1BW8A 1YTZI 4KX7A 4PJ7E 1AD0A 3DUSB 2F5AH 1RULH 4OI7A 1CLZH 1FZMA 4GY4A 1MW1A 2C1OA 3HVDA 4ELKA 4X8GA 2ETWA 4X8JB 1NBZA 2IWFA 2VWEE 3TWCL 1T03L 4ERSH 3UAAA 4H20H 2JELL 2YD4A 2IGFL 4XT1C 2B1AH 1U8PB 3FQTA 4LHUG 4TN9A 5BUAA 1N6QL 4OGQD 4M1DH 4WY4A 3U1CA 1JOIA 3HD7D 4NBYB 5EU6E 2G60L 1WDAA 3PXJA 5FGRA 4HG4K 4G8GD 1WITA 4KQ4L 1AAJA 2WXLA 4HCGA 1RY7B 3L36A 1V3LA 5IB5B 4YSDA 3BD3A 1O9WA 1DBBH 2PUQT 4HD5A 1AFOA 1YEEL 4K3DH 2V7HA 3LQAH 1V55B 3H32B 1GZPB 2KERA 4X50A 3RVTD 3EXLA 3CC4P 3BVHA 3KH3A 1QP1A 3IPBA 1FYTD 3APCA 2K9JA 2RJMA 3T0VA 3WS3A 3KPLA 1AANA 3SKMB 3JVFC 3TYFB 2VJ8A 2V0AA 2A3TA 3PP4H 1JZGA 2JKTM 2R1WA 4N3UA 4ZS6D 2OLDA 2F1BA 1JNLH 5DA0B 3U1AA 5HHNA 4HIPA 1YUHA 1A6VH 2KLSA 1B0RA 3TZVD 5KBKA 4AQEA 5AAMA 3S3DB 3IBOA 2IXQB 3G71P 4OZGE 5L0QC 3L3DB 4JFTA 2BSCA 3U46A 1BQKA 5JNYA 3WIAA 1K04A 3FB7A 3MNWB 4GSRA 3SGDH 3TONA 5GGQH 1FGVH 4YHPB 2WZ0A 1SF3A 1N7SD 5AW2B 3QIWC 1PIGA 5IBTH 2ID5A 2N7AA 5J6HA 3UTSD 1GL2A 5E8PA 3FT4B 4PJ9A 3H55A 4AC2A 1NFDA 4Y4KD 1A4AA 2DQHL 5KVEH 4QCIB 2PR4H 5AFAA 3RGVA 4QHLB 1WWCA 1XSIA 3ESOA 5B1JC 1G7LB 1K72A 4FLQA 3SZ6A 1T1WB 2VLRB 1J0ZA 1UD6A 4NCDA 3FK3A 1NGZB 5DLML 2E8YA 4I2LC 2HVJA 5CLWA 3U2JA 3VWKD 1KIUA 1PNDA 2WQSA 1IM9D 4CC0A 4DUXA 2R23A 3UX9B 4NBZB 2R2HB 4TM9A 2FBWC 4E41A 4GBXD 1IBBA 1ZSHA 2IEPA 1JYVA 5D1QA 3KXDA 3FH7A 2CJUL 3BVNB 3UEQA 1NU1E 2FXMA 3MV8B 4J23A 2B4CL 3WJJC 1P4UA 3OJDB 3L4CA 3EYOB 1CVRA 2IDSA 2XZQL 5L9DH 1IFMA 1Q82Q 3H2QA 1AKPA 2M2DA 2YPVA 1L0YA 2F8OA 5CZRA 1LJ2A 1VADA 1BGYE 1P84K 3U7WL 1NTZJ 3FSWA 1ND0A 2C3VB 4AYSA 5BVPH 5AOIA 4HGWA 4IBLT 2CJTA 2XWCA 4L8SC 1MCOH 3RA7L 3TJPA 3M88A 4AC4A 4XMPL 2CJ3A 3OGCB 1N4XH 1BQSA 1FBIH 3GHGA 2ZCHH 1DDHA 3D4CA 4LSSH 1A4JA 2FX9L 3B2VH 4L48A 3U79A 4F7CB 2OW6A 4X5RA 2QLYA 2NY0B 2C3XA 1T1YB 4D8PA 4OZFA 1J11A 1I7ZA 1VACA 4IKKA 1BG9A 3G6JE 4UT9L 3TVMC 1KPUA 5I75C 3MV9E 1YYLL 2AJZB 1EEYA 2MFNA 2IX7C 1F1AA 4JZJB 5KYYA 3SJVB 3FT1A 4GUPB 1O6SA 3SQBB 3VI3B 5KSAB 2X05A 1BAWA 1YAZA 4JHUA 3MRLA 2D31B 2WTPA 1IFHL 4GFXA 4DW2L 1DIPA 1A5FL 1KB5L 1J1OL 1JK9A 2JKNA 4OGXL 4Y16C 4YSTA 2DICA 5IBLC 4PJAE 4Y2DD 1AD9B 3S3PA 5ES4B 1FNSL 1QPKA 1UH2A 2ATPA 3MCKA 3WL9A 2HLEB 3RNKB 3FT3B 3VD1A 1OGTA 1XF3A 2C9VA 1JGLL 2YAHA 3QQ4B 4WU5A 5DUPL 2UXGA 4XN2A 3TA3B 5G55A 5C8JB 1G1YA 1HHIA 2VR3A 3KVPA 1QGKB 4WO4A 5D1ZC 1S8DA 5FUOH 2ZUYA 3ZTDC 2PW2A 2E7BA 2LXCB 2QADB 3AJ7A 1KC5L 3DOSA 3NPSB 4MKTA 4GAJL 2BCCG 1AZUA 5L88L 2RQEA 1JJUA 1YNTA 1NBVH 2E6QA 2NNAA 4EBQL 3W2DL 4GT1A 4DP5X 2EUWA 4FL4B 3DUHA 2E9WA 4K8RH 4L76A 5DLMH 1M3JA 3GSQB 2JCCF 5BO1H 1K85A 1N3NA 1A9EB 1DVQA 3IFLH 2NQ3A 4P2RA 4DUVA 2OTUA 4FEIA 5LB1A 3KPRD 1MRFL 3DXAA 1DCLA 3KEDA 1T80A 2OMTA 4NM8L 3R8QA 3X17A 5L6YL 3M46A 1EC5A 2PO6D 3BEVB 1EGJH 2QSCH 4H1LA 4D0BA 4EQ3A 3CXHK 4ONFH 3PNWA 4NC2B 4W9JC 2HRPH 1KGIA 3PREA 4IL6X 1MDAA 1S5HA 4YEFA 2D03H 1PG7W 5BQ7B 3C1LA 2XQYG 2VM9A 3UGEA 4MCNA 3CFEA 4YJZL 1TOXA 3B1TA 3OR7A 5FOBB 2OTWA 4S2SB 4Z3IA 1VQ9P 1EEQA 1MCNA 4YX2L 2OP4H 1MQKH 1JK8A 3A23A 5K69A 3TX4A 2WQWA 4PJ7B 4PP1C 1U8MA 2YD6A 3KPLB 3CLQA 4AJVA 1LD9A 2EYSB 3QXDB 1NCDH 4H0GA 5K9JH 4WRLA 3LVEA 4TT3H 3FTYA 5TQ2H 4AQAA 3BAYA 1TZHA 5CLZA 1IGTB 2WKGA 1BFTA 2YN3A 3A6CL 3BFWA 3IMTA 1D5ZA 2R0KH 1TZOA 4FOMA 4WWPA 4P5TA 1AE6L 4F2MA 1JSYA 4GKGA 4LKXB 5F9OL 3KLHC 1FNEB 1G94A 4Q6IA 3TF7C 3RX8A 1O7DC 4BQCA 2XQYK 4G70B 4V2BA 1COBA 2DW5A 2WWKT 4IOIA 1DUYA 4E9SA 2EXWD 1YJ9P 4NLAA 4MZRA 4IRSB 4AJWA 4DIXA 2E75B 4ZMNA 4ZKUA 4G5ZL 3NCWA 1FNHA 3H1IG 2MCPL 1CL7H 4BINA 5JDJA 2JELH 3M1OA 4WGVB 4NZUL 2YMKA 1M1XA 1QVFO 1YQVH 3V0IA 4POZD 3WE6B 3ZHKA 4PJEA 3V6ZB 3CXHE 2CCWA 2ZWSA 4PJEB 1D9KC 1FZCB 4KITB 5GS1B 4FQ2L 3DPDA 1C12A 3NXSA 2HB0A 3ZRFC 4OB5H 5I73B 4JM2C 4AQ8C 3ZYOA 1GGBL 1J0KA 3KPPA 1P1VA 1PSKL 3T97B 4XCFL 3FU8A 3O8XC 4Q56A 3QUZA 4XFJA 4C56E 3H3PH 3B9EA 1A6TB 4PJDA 2IBZX 1KCLA 1T04A 2XN9E 2YZ8A 3ATEA 3E6HA 1U6AL 3H0TB 3C5ZC 1MHCB 1HVXA 2JH2A 4UINL 2C3VA 1SFHA 3MA9H 1YYCA 1QNIA 1QLEL 2EDEA 5I2IA 1NCAL 4PCSA 3TIDB 1KXVA 3B6SB 4QRAA 3E1F1 4AUWA 4U1IA 4Z3HA 1NCUA 5EHFA 5KAQF 4KK5C 5E70A 3K4AA 5EF3A 1HAWA 4MWFA 2Z31B 1YN7A 3ARWA 4NOFA 2VLRD 3TZVC 4KY2A 3NIFF 1IGCH 4HWEH 3S96A 4AMWA 1GSMA 2H32A 1E4JA 3FH8A 5EBMB 2ZWNA 3TJEL 2Q8AH 2JI3A 5ADOH 1JZFA 3IRZA 4GBXB 2XWDA 2Y1AA 2H2SD 4P4RA 1KEGL 5FGSA 3BHBA 5EEYA 1KV4A 3MRRB 5FKPA 3V5HA 2G75B 1S7XA 5DK0B 4R2GB 3IXTA 5FECA 1Y07A 3A0HE 3PE9A 3E2HB 1NKGA 1EA9C 2EIEA 3TYGH 1AH1A 1K8DA 4G5ZH 4H40A 4YBLC 2AEQL 3WJMB 2YKOA 1GU5A 3SCMD 1K3IA 3LIUA 1QPPA 1ZLEA 2UZYB 3JWOC 3TBYA 1BD2D 3L3OC 4JQVC 1YMMA 3RIAK 2O1AA 4MVBD 4PJ8C 4MD0A 4Y0GA 2X87A 2CKBL 1XF5A 1B6DA 2DWDB 5J0BA 3VFUA 1AYRA 1IFNA 1FZBA 25C8H 1IGJA 4TLFA 5TQ2L 5BOPA 4IBQA 4GSXA 2N01B 1GGIH 4S1DC 5HSFA 5FOJA 1I7UA 5CP7B 5FHAH 3ZR6A 1H19A 3IDIB 5KSBB 3D09A 5LBVA 3INUL 2HT4D 4M9OA 2YMYA 4PJ6A 3GD1C 3FXDA 4WFFE 3OVUB 2HT3D 4OD2A 3GS4A 2QJKC 3KPTA 5D7EA 2WT7A 2CUMA 3DK2A 4I77L 4OI9A 1GL2D 2D7NA 1OPGH 2HN7A 1NGWA 5FDWB 2PP8A 1VZIA 4LLVA 5C0IB 4CDGC 3O8XB 1PDKB 4N8VB 5KYUA 3U6RB 2Q1KA 4NCC2 4ZPTA 3MLVL 5DS2A 3OB0H 4N8VG 4LVNB 1YY8A 1N64H 2HN7B 4AGLA 5C0IA 4KXZH 3WIFB 1TXKA 1ZV5A 5K5GB 2PETA 3T2LA 3HAEA 2DBLL 4WLCA 5E5LA 2YKKA 1D2OA 1BGXH 5GXBB 3B5NA 1HWGB 1KT2A 2VDLH 3R4DA 4LEXL 1E3XA 1N8OE 3AT9A 4Q6YA 3BZFB 2Q87A 1ZS8A 1BZQK 2NT0A 2A9MH 1OGPA 4RAHA 1DEBA 4P23B 4A55A 5JMOC 1KF9B 3L3IA 3F7VB 1OCOB 1BCCJ 1OSEA 3ZGHA 2FD6L 1JL8A 1FE8L 4FTDA 4EE2A 1IGTA 2CK3H 2AJVL 4XGZA 4E36A 3D69A 4JO1H 2IZ1A 4TULH 3QUYD 5IB3B 3VFTB 5SWQB 4UZUA 3FO1A 1M57B 1OB1B 3TJEH 4JM4L 2ZSVB 1CSBA 1ZT1A 3CHRA 4PJIA 1IT9H 3BD4A 4NFDA 3SDAD 3OKKA 1EXUB 1ZHLA 3WBDA 1HK6A 3O2WH 4M7KL 4OQTL 4U3HA 1IFPA 4FEMA 1U8KB 1I3GH 3AS2A 2K4AA 1T5WB 1VFBA 1LL1A 1BX2A 3UPAA 4J27A 2H26B 3L8QA 4P3CL 1S3RA 4S11A 3SKMA 4E9VA 1PKOA 1R3JA 4WFHD 3HS9A 2KUBA 1L9TA 4HKJB 1RQVA 3IKKA 32C2A 4DEPB 2H6PA 3QUZD 1FLRL 3WY4A 3PHLA 1CJYA 4A7PA 1DHKA 5HHNB 1R8EA 2ZUSA 5IOKA 3BAKA 3QRGL 1F6LL 2MOQA 1BP3B 5CKGA 3NSYA 1X22A 5ID0B 2QV4A 1BGYJ 3I6KB 3ZYIA 4OT1L 4JFDA 1F4YL 1TU3F 3RTQB 5JHDB 1XAUA 3GTTA 3H8NA 1KFNA 4P46D 3QEQA 2VR4A 1MI5B 1OSPH 2D7PA 3C60B 4IFMA 5CSZA 4F8PA 1OAYL 1NFDF 3AZUA 3OKEA 4M6OH 5EU6D 5E8NB 1UFUA 4L4VD 2GA1A 1NAKH 5CLYA 4LDCA 4ZYKB 1MWAH 1UM5H 3U4KA 4X9BA 3K5BA 2VL5B 3FFCD 2MCAA 3A4EA 3A6BL 4PJFE 1NAFA 1QRNE 4OKVA 5ALBL 3K7UA 3GMMA 4LLUB 4BWNA 5I8CA 1GU4A 2LAAA 1Y6NR 5E2TH 5KSBF 5KJ7D 4URTB 4DAGH 3WHE1 5KSAD 3C8HA 3TIEB 1XH3A 2QADC 3LJ3A 1KLFA 4PU2A 5CMAA 1LMKA 1KG0B 4WUUD 2XN0A 4KZCA 5I1HL 2ZCKH 3HE5A 4OUUA 3INOA 4FQCH 3IE4A 4KQ3H 1X5FA 2ZVNB 4OWFA 1USEA 5IESL 4L0YA 2BMKB 4XCYB 1PKQA 2H3XC 3ZMNA 3WY3A 1GRWA 1YMME 5GRWA 1Y9BA 1AKJA 1UXSB 1RIHH 4GT7A 4BZYA 4FP8L 2KLVA 2VDNB 1BSNA 3IGAA 4ZMTA 4XCYA 1DQDH 8PAZA 4Z7VB 4PSPA 2W8ZA 3FU0A 2JK5A 4H8PA 5E8OA 1WPCA 5K59F 4N90D 3QXWA 2DEXX 3HIZA 3GEWB 4K35A 2DQGL 2Z31D 6FABH 1JVOA 4NUJA 3MNDA 4KTEL 2FFDB 5J1AA 1NGMB 2R51A 4XOBA 5AWNL 5ITBL 2CMRL 3S36H 3X2QB 3QWQB 1A6AB 4OZGA 2HT4C 2LE9A 3CC5A 1OTUC 5DU7A 4KX9A 1SHSA 2H0PA 1FL3B 1UT1A 1RHHA 2WVRA 3ZIMA 2BP8A 3GRBA 4ZMLA 5CEXA 1A6AA 1U58B 4K3DL 3STBA 3ULUE 1DFBH 1MVYA 4RMBA 4F7MA 5HXMA 2FNBA 5KVGE 4Z9KB 1AD0B 1BFSA 4PRPD 3MRNB 5FM8A 1T21B 2AXFB 3RL1A 3QZWB 5DO2C 2JJVA 4NN7B 3CZGA 4OLVL 4BBWA 4A7GF 4B3VA 1V3KA 2R5BA 1AHMA 2YAMA 3IJ8A 4YFEA 1DJHA 3MGTB 2J2ZA 3CIQA 5KBLA 3TEWA 1D7FA 2BVOA 1EZVG 3H1HD 5BS0A 4K23H 4XNXL 5C2UB 2TSBA 4ENED 3BFOA 4QUOA 4JDEA 2CJSA 4L4TE 1BVZA 3ILPA 4OU3A 3K4DA 3H85A 3H3BC 2G3MA 4PRHE 2AVGA 2OMTB 3FUKA 5I28A 4N25A 1G9NL 4B97A 5CJXC 3MV7B 1OAUL 2YD2A 3RBSA 4HFWA 5GHWH 5B4MD 3ROLA 3VX1A 5IIEB 1LQSR 5JA9A 1FA4A 2R0ZH 5IB3A 5DD3L 4A37A 2Z7WA 1BAGA 3VCLB 2IPKA 4Q8BA 1Q4NX 3QIWB 5JQIB 5BQ7A 3LNIA 1GYVA 2BOBA 3TV3L 4A6YH 1AR1C 4S1DD 2DIBA 3T0AA 4ANXA 4M43L 3QIBA 2OAAA 2E74C 1U9KA 3CXHD 1R5VA 2P26A 1LEIA 2ROYA 5BW7A 2QZQA 3N85H 4H4NA 1SEBB 3LPOA 4JFFE 3QISA 1G9MC 3VQ2C 2TRHA 1UJ3C 1MH5A 4PP1D 3L72J 1SLWA 1ACCA 1EAPB 4PWGA 4PR5A 5L2KA 3FN9A 2R1WB 2F74A 4HIEB 4WKZA 4L9LB 1KC8Q 3WNJA 1LILA 5FO7B 1FGNL 1JPGB 2XCMC 3F05A 4B9ZA 4W9GC 3RAJL 3CHXA 4J6RH 3KPMB 5I1DB 3MHZA 1EIBA 4PREA 4PJAA 2MPAH 2OR9H 4NQDD 1LP9B 1U8QB 2RCSL 2VRQA 1FSKB 3OL2A 1U2YA 5ADOL 3GHGC 4Y19D 4G83A 4NT6B 4Q6IC 2R5DA 4RBPK 2SODB 3GMPB 4WDIA 4NXKA 3FUEA 4J6IA 4PJ9D 5F9JA 3TO4A 3AU1B 3AADB 1NSNL 4OFKA 1FVDB 3L1FA 3GKZA 4F2EA 5I19L 4FZ8L 2V9QA 1IGIL 1WO2A 3FTSA 4GO6B 4XN8A 3AE8C 2J56A 2OMUA 1QX1A 1F97A 4ZZKA 1THAA 3ARBC 2DMGA 2HJLA 3EH4B 1I1YA 2WUBL 3GM0A 3MNMA 3QEGH 4FTVA 2YOCA 1XR9B 4LSUH 1LEKA 3SCMC 2O5YL 2ORBL 4UQ2A 3GXPA 1YHQP 3OJMB 3NTCL 5F0PB 1J5OL 2VMEA 2BK8A 2BIPA 3SY0A 3VB9A 4YMPA 4LB8A 3APDA 3OAUL 3QJHB 3IAQA 4JB9H 3SWFA 4J4PC 2Q6WB 1Z9NA 1MCPL 2J6WA 1HOCB 4LL9A 1H3GA 1BQHG 5JOPD 4JFFD 4BRJA 1G5AA 3L4UA 4AMKH 5I16A 5K5YA 2FWLB 1N2RB 4KO9A 2CO6B 3HTLX 1LWRA 1MNUL 4N68A 3FB6B 4JFHD 3TGUE 4LSTH 5SX5H 3D4GA 1TQUA 2H1XA 4K9JA 4QI3A 1G1OA 3O9WC 1JTOA 1OK8A 5DJCA 3FHQA 5ESQA 2LABA 1HSBB 2Y6SD 1U3NA 3N91A 1HHJA 2CRIA 2BHUA 2XOTA 1GK4A 4UB6E 2FB4H 3HE6C 3BGMA 1SHWA 4KHTH 4PS8A 1Q1JL 4GNKB 2X4UA 5FWRA 2HMIC 2EH8L 1M6OB 3GSRA 1AOZA 4J5VA 1OVUA 4OZIF 3L74E 4AQEB 5DMIL 3S5LG 2J88H 4M8RA 1JZDC 4KHXH 4QXGL 5A2AA 3OQRA 4BFRA 4LGRB 2NY1D 3CAFA 3A67H 3CXDL 1OLLA 1TKWB 2I69A 4WU7B 5D7KE 1DLHA 4PJHF 2DI7A 3MBEA 4U2ZA 4WUUB 3B43A 1IEHA 1GL2B 4ZAKC 2AGJH 1SLQA 2IPTH 1BDYA 3FU7A 3NIFE 3QH3B 4Q14A 3FJTA 2GC7C 3P9MB 2NZ1A 4F9LA 2P8LB 4EN3A 4IOFD 1NTMJ 1RULL 2ITCB 3VSVA 2P42B 1ZHBB 5D2NC 4ZW6A 2XT1B 4YHZL 4QNPF 2YGVA 1OE3A 4PD4K 1U8CA 1KSRA 5J3HD 2XNDH 3GUFA 4HXAL 4U1KB 4WNQB 3U4EB 4PJBE 2V5RA 1VZGA 1EFXA 1DJSA 2ZCZA 2B1AL 2D9CA 3CFBB 1UWFA 3M7OA 2X5PA 3SO5A 3BEVA 5GS3A 4KOBA 2OXHB 5IZ7A 4JG0L 5A2BA 1A2YB 1HYSC 3FO0H 4MXWH 5JZ7C 3E1ZA 4Y19E 3T4AA 2HKFH 1JN6A 1PEZA 4FMKA 2FEJA 3UDWC 4AENB 2B88A 1CICB 2X4TA 4PGBA 1E4XH 2XIDA 4FQPA 3TN0A 3B37A 1II4E 4J1UA 4IS6A 3QIBC 1A7NL 5KS9E 1F41A 2F1AA 2WIIB 3W9DA 1XIWC 1NOFA 2IDFA 4G8AC 4QHNB 3ZKSD 2APTA 1IM3A 5EFIA 4MNQB 3GSOA 1WRGA 1DQLH 3FCUB 3QXDA 1X4ZA 1OF2A 3TNMB 1HS6A 2WPRA 4NN5C 1I1FA 1A3ZA 4GDOA 3V4LA 3KR3L 1IM9B 2WLKA 4HK0A 5DVPA 4P2OA 4N2DA 3BWUC 1QAWA 5IVZA 1TUPA 2WBJB 5DD6A 3IEAA 4OFYA 5D7HA 3VFMA 4XNYL 3VXSB 2VLJE 1SQVG 5HPMA 4XPBH 4F2MB 2GJ6A 1A4CA 1X6LA 2YRPA 4LQFH 5HVFB 2W6BA 1CDIA 5JW4R 5B38G 1R1CA 4IBVA 3V5KA 5FO7A 1RSYA 2G4GA 5BZWB 4DP9X 4HF5L 1R33A 4IFDK 3CXDH 2F8VA 4ISVB 1M8OB 4R4BA 2G3XA 4DW2H 1FNEA 1FZJB 1D5MB 3UTTE 4YS4A 5DTFA 5E8PB 1MY7A 4DNLA 3HI1B 1EDJA 1X7TA 5DURD 4BKTC 4MBOA 4LDLB 4NQDA 5ANMB 1IAIM 3TA4D 2E9JA 1LTAC 3DURB 4XBGA 3QQ3A 4KAQH 1HE8A 3VI4E 1SVFA 4X80H 2NY6C 1SQVK 3IDMB 3L5IA 3MRFB 4ONHA 4M8QB 1R3KA 3MFFB 2CPSA 5DT1L 2VNCA 4HG4J 4C54A 3RK2D 1BVLA 4QXUL 1MRDL 4K7PX 3ESMA 3RWIB 1NFAA 3LZQA 5BUPA 3PCYA 4J39A 2WVUA 3CFJA 2DD8H 4I13B 3TT1H 1HEHC 4BSJA 1FG9C 3H1ID 3NN8A 4R8WH 3NOIA 1SYSB 1K3ZA 4EMZA 1KYFA 3H1IJ 5E8NA 1PD0A 2A83B 4K7PH 2NSXA 3C5JB 2FEEI 2ICEA 5LXGH 3I9IA 1Z3RA 3BRTB 3M8OH 4GKSA 1A1MA 1GC1L 2YMTA 5I1LB 4J8RB 1T0PB 4KK9C 3JV0A 1W2KT 2IG2H 4HWNA 2APVA 2OTKE 1FZAA 3DJ9A 4M1GL 1E27B 5J1TC 3H7BB 2IZ0A 4I8DA 3TVMD 3DMMB 1JGUL 2ZUVA 3KBPA 4X6DB 2WLJA 1JY2P 2Q3XA 1GZPA 1OWWA 2H1PL 3EJPA 1BPVA 3BN9C 4QF1B 4DTGL 4URKA 4JE0A 3Q8CA 1O7DE 4JFEB 4M9PA 5AVYB 4QRQA 3WFHB 1NEZA 1TT6A 4E9WA 5GZOC 2ZUTA 4XMTA 3PJSK 4LCWD 5KG9B 2BXZA 4WIQA 4MB5A 3MRLB 1JO5A 3GIVB 3C75A 2Z93B 5D72L 4ZTOH 3MXWH 5CXPA 3JWDH 5HHXL 2JV6A 3QUKB 3FNKA 4LOUD 3WL9B 1DUYB 4QY8B 2WMMA 2HT2C 5E1IA 4UOZA 4EPSA 3CVCA 4J3UA 4WV1B 2Y5EA 2ZG2A 4PG2A 1IKFH 1IC5L 3AAZB 4KVCH 2Z7YA 3S6CA 4AI7A 2FL5B 3D3VA 4MDIB 3QNFA 3QJXA 4Z7VA 2D7TL 3QNXA 5IREA 2FJFB 4NKDA 4NXSA 1UZ8A 4OLEA 4KAQL 2IBZG 3L5XL 3CMGA 3V6ZA 1QRND 1FO0H 4K07A 1G7LA 5C3LD 3WTUA 1P4LA 4WSJA 3ESUF 4OIFA 5MENB 3N41F 1GIGH 3VU2A 1TCRA 2Q9OA 5HGAA 2XKUA 4WK4B 1A7PH 3ZL2A 3OMIB 5KVEL 3NA9L 5E8DL 4Z5RA 4GW5B 4G7VH 3JWOL 1G9NC 1CBJA 3ARGC 4M6ML 5IHZB 1L0NE 5JPMC 3PWPE 4OCXL 3WNPA 5F9OH 1S5LX 5I19H 4X98A 2WWMC 4X2UA 3V4VA 5EEXA 4PTUB 2GABA 1CICA 3N06B 4KQ4H 1T6AA 3O8XA 4JCWA 1MZ9A 2BNRE 4JDTL 5HJDA 2J57A 4QOKA 1ED3B 4LLMA 5F7LB 4L1TA 2WT7B 4ZFFA 4E0RA 3JC22 2F54E 4U6HA 3E9UA 2ATAA 1EZVD 3H1HG 3EFDH 3BQUB 4ODUB 4UILH 3RIKA 1B2YA 3ZT6A 4FJZA 4X6FB 4MS8C 1FBMA 3L71G 2PW1B 3GO1L 3C12A 4HS8H 5K9KB 2EDFA 2IV9A 4O9HL 4PJ7A 4YHMH 2J8HA 4MA3B 2K37A 4F7CA 2X09A 4PJEF 2ZT9D 5HGHA 3OWEA 3U30B 4GYBA 4MB1A 1DJZA 5ICZA 4L4TB 4QRRA 1NGQH 3MV7D 4IGBA 3V7AG 4OV5B 2J1YA 4IOIH 2O6CA 4F15B 4WUUE 4IBWA 2D7TH 1HUCA 5CGYD 2XN2A 1EJOH 5EU6B 3WNOA 1KPVB 4X4KA 3VAEA 1DUZB 5AB2A 1BFVL 2P48B 2P80D 1PLBA 4ZS7L 43C9A 1KGXA 5DEGB 1XGUA 2PCXA 2W38A 2D2OA 4OGYL 1SQXJ 3C9NA 4X6CA 1PG7X 1AD9A 3BVUA 3ZTJH 3W0WB 3LW5H 2R69L 4RFNB 5FYKU 3AEGC 2KP8A 1NTDA 4Z0XA 5C1MB 1N7ML 1KB5H 2BSRB 1DVZA 3GYRA 1QBAA 1N59B 2KKQA 3DURA 4I4WB 5AUMA 1J1EB 4JO8A 2AXTH 2DAVA 1QBML 2OL3B 3CMOH 4H1LG 5DF0A 4Y2OA 5KJ4A 1R0AL 2P1JA 3O3AA 1S72P 5D9SA 3WNLA 3FRPA 2O93L 1NQBA 1U8LB 1B4JL 3MRBA 2KQNA 1E4KA 4L8SA 2OL3A 2ZUQC 5EUOB 5B1CA 1C12B 3ABVC 2W0LA 3FTGB 2X7LB 4IRJC 4XN1A 3NFQA 1H88A 3JSSA 3CFCH 1FOSE 5IMKB 4PLKC 4DVRH 4NKQB 5G4NA 4JFPA 2BINA 3ZE0F 4WFFD 1QUNB 1UCTA 3EAKA 5JW5B 3AG3B 3VXUD 4YDVB 2G2RA 3H0TA 1MHCA 5D8JL 5FDWA 4DP8X 3DSFL 4QLRA 1P9MA 3QUXB 3I6SA 4PJBA 5CD5C 3H1HE 1IO4C 3QR2A 4L2LA 2GB2A 4HPOL 5IB1A 3KWXA 4BK4A 5CR8A 4GJTB 3AMLA 1UXLA 2A74B 4XWOD 2EVIA 4RFEA 1SQVJ 4KKPA 5ITBH 1KY6A 2AK1H 3K8KA 2OYLA 5EIIG 3N40P 3ECVA 3VMZA 5DFTA 4NPFX 4PHXA 5CINH 4QJ5B 1IEBB 1RK0A 3CBKB 3NEEA 3UTPD 2J5LB 3B9AA 1Z5YD 5F3BB 4QRUB 3K2IA 3M9BA 3MLRH 3V6OC 4HUWB 5DI8B 3NZ8A 5I26A 2EVJA 3ABKB 1I1RA 2K1MA 1BAFL 3QG6A 1JOCA 5CZVH 2HLFD 3WOVA 4F3FA 5JYLA 1RY3A 5E4IA 3IS1X 3ELQA 5TFSH 1KIRA 4K3JH 3H6PA 1NPNA 2A99A 3KL5A 1QSFA 1OAQL 3L95A 1A8JH 2P1YA 3IT8D 1FNFA 1SQQG 5KJ7C 2ZYAA 2QSIA 1H0TA 1SM3L 2K78A 3MLSH 5JQ6H 1UM6L 4NOBA 2AQNA 4N2GA 4UQ3A 3T65A 3IU3B 5I71C 1NWQA 3EBGA 4NWTH 3E38A 1VEMA 5JHAA 5FK9A 4P9ML 1MCBA 1K4CB 4FAAB 1BVKB 4TXVB 1MQKL 4MJ5A 5FHAL 4ZUSA 4IHOB 2P24A 4ZFOL 1MFMA 3THML 2JIXB 1UA7A 2XQBL 3SOTA 3VXMB 2FBRA 3WMQA 5E6SB 3OB0K 3OBAA 5IHUH 1CF8H 1Z32X 2H2SC 3CPUA 4MAYD 2OYPA 2HWZL 2X6BA 5GISH 3V2PA 1KENL 2YGNA 3TEXA 4C83A 3MRIB 3UZQB 5DSCB 5FO8B 1X5GA 2QPFA 4H13B 1OCRB 3RL0B 3QIUB 3MRIA 2X1XR 4ZOAA 2DLIA 2ITCA 4YOKA 1XF4B 4PMFA 5EBLA 3C8KB 2G3ZA 4XXDB 3MBXL 3GG2A 4PW3A 1WGVA 2VC2H 1J5CA 1E30A 5J1SC 4D7PA 1WTGT 4NUPA 1KILD 2E59A 4JRXE 4KK9D 3I6GA 5CN3A 3C8DA 2BW4A 2FBJL 2DQCH 5DJAB 3K6OA 2GY7B 1SP4A 4RESB 1CDGA 4IGBB 4EI2A 1V7ML 1UWEL 2RAMA 1Z3GL 2H3KA 4HKZH 2ZOUA 4Y19B 4Q52A 2ADIB 1UFGA 3MV7A 3IMSA 3VVWA 4KRNA 1T5XA 3OX8B 5CEZD 4IRZL 3U0WH 3D9AL 1J18A 3MLXL 5IG7B 2L0DA 4Z7VF 5JO5B 5T1DL 5LGKA 2B77A 5E6ZA 4ZFGL 1A3LL 2WSSH 1NL0H 3JTTA 3N1GC 4TRPH 4JQXA 4GG6A 1C5CH 4HH9B 2ZQKA 1JPFB 3TBWA 4NN6B 2WXOA 3NA9H 5E8DH 1JVLA 4YDLB 3V4PL 5F8RC 2B59B 3LKOA 4XNUH 5ALCL 2EECA 2VZSA 3CZUB 4NKOA 3ES6A 4M6MH 2H45A 2P58A 2FYUE 5IBUB 4R5XA 4MMZB 4WQOA 1ES0A 3EZ8A 5IBUG 1AS7A 5HYQA 1KTMA 4GOSA 2P5WB 4MCZA 1BSHA 5I76A 3LNFA 3BMVA 3EJTA 4I0PC 3EJRA 1HU8A 4K3HA 4U6XB 1AGEB 1PJ9A 1QR1A 2MSPA 4OB5L 5I76B 3VH8G 1SQVE 1EFXD 3FZUD 2AVFA 4JRLA 1X5KA 1P9MC 1HAUA 2ZCHL 4LSSL 1HZHH 1KXQE 4P06A 2Q8AL 3CFKA 4AM0Q 4M5TA 3O6LH 3EBAA 5DS8A 2WW8A 3X1BA 4L3EE 4EUPA 2DQTH 4PRPB 1IARB 1HH6B 3OLGA 2FGZA 2VZUA 3A4DA 3JWDL 3QORC 2NZ2A 3P0VL 3W56A 4ZNEA 2W9LA 5I1EL 1CZQA 2XFGB 3WFEL 1OW0A 5D1QB 1MCKA 3C9IA 5JIHA 2E86A 1MFEH 2QDVA 3VMOA 5K9OB 3BUYB