5AVUB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 7.0 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avuB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avuB02
2P2UA 1HBWA 5AVXB 1S9KD 2YO3A 5AVRB 1MFZA 1X8YA 3NTNA 3MD0A 1NWQA 1HWTC 2R32A 1HJBA 2WT7B 3IR9A 3M0AA 3P8MC 1GK6A 3LIEA 3MGNA 5AVVB 2W27A 4EOTA 4LC1A 1FAVA 3HE5A 5AW9B 5AVZB 3OAKA 2WPQA 2C9LY 4C7NB 1KQLA 1CZQA 1GK4A 4HYTB 2P7JA 2Q3IA 3TNUB 3HE4A 5AW5B 3M0DA 3HTKA 5AVYB 2BASA 3WGVB 3V5BA 2Z5HA 1GU5A 1H89A 1A02F 1GD2E 1YYCA 1SP4A 5AVQB 2R3CA 5AW6B 1SLQA 2WTYA 1FOSE 1S9KE 3TYYA 3V4QA 3M9BA 3VMYA 3NXSA 2N9BA 4AUWA 3P7KA 4DZOA 1FOSF 2WPSA 1HUCA 2H7HA 3M06A 3NMDA 3V4WA 4JYCA 2YO2A 4B86A 1GTWA 3A3YB 4C46A 3A5TA 3VMXA 1OWAA 3B8EB 4C7NA 3LIDA 1GZLA 2YNYA 5AW3B 5APSA 2ZFCA 5CMZA 3TNUA 1DH3A 2XZRA 1MV8A 4GT1A 1H88A 1H8AA 3VTPC 1A02J 3L35A 5APXA 5AW7B 2VRSA 5APUA 2E42A 1T2KC 2Q5UA 4GKGA 1G2CB 1J2JB 3NFQA 5APYA 3M9HA 3L37A 2WT7A 1CSBA 2E43A 2R5BA 2Z5IA 2KP8A 2WWWA 5AVSB 5AW4B 1CI6B 2IPPA 2C9NY 3VYIA 3HE5B 3KDPB 2QM7A 1T2KD 3A2AA 5AW8B 2QM8A 2P67A 1NAFA 2WPRA 2XV5A 4AYCA 3VN0A 3HE4B 4RESB 5AVTB 5AVWB 3L36A 2W6AA 3UIAA 3TK1A 1OXZA 5APQA 1GU4A 4I6MC 4JYBA 4AQRD 1CI6A 3WGUB 3M91A 5AVUB 4XE5B 3KQGA 2R5DA 1JUNA 5APWA 4M3LA 3A7OA 2Q7CA 1MUUA 2JJLA 2XU6A 4KHXA 2ZXEB 3I5CA 3P32A 5APTA 3T97A 5AW2B 1JNMA 4RETB 3VMZA 5APVA 1IO4A 5AW1B 3O8ZA 3SWFA 5AW0B 4I2LC
chains in the Genus database with same CATH superfamily
1S7QA 4Q56A 1LK2B 3VXUB 5L88L 4JRXB 2K4AA 3SSUA 3JCUH 2ZKHL 3CCJP 3QO1B 3MGTB 5LBVA 2WT7B 1XQ4A 2UZPA 4TSBL 1REIA 1E6JH 1Q0YH 1QAWA 4DCKA 1UUNA 2XTJE 1Q9KA 1BWMA 2WSDA 3GD1C 1LT9C 5AVZB 3QDGD 1JUFA 2VN5A 3HRNA 1DUYA 1AY1L 3L45A 3OJDB 4XP1H 5JMRA 2XX1A 2AJZA 1TNMA 3LXCA 3L72G 4MZ2A 4U3CA 5TE7H 2J25A 3T09A 3QW9A 2ZJSH 5EN2B 1NTZJ 4OFVA 3D4ZA 4YDLB 3F7KA 4YFLF 3QIBA 2WTYA 3FTVA 5DJ6B 1I1RA 3V4QA 4X7SH 4XX1E 1MVYA 2AEPL 4PJBF 4XBEH 4CKVX 5FOBB 1EANA 1EGJA 2H6OA 4NKDA 3GJFK 3B8EB 1T7YA 1QW8A 4QRPD 4YX2H 4QOKB 4RWYL 4GB9A 4TNWK 4LRNL 4TN9A 1Q0EA 4H25B 4XN7A 5KN5B 1GCFA 4NBYB 3N41F 4ORGB 4PJFE 2AANA 3SDXA 5BRQA 3VXRE 2VRSA 3QQ4A 4P9MH 2YD7A 5BV7B 5IM7A 4XXDA 4Q6YA 1A8ZA 4JVUA 3POHA 4AYEC 4NRXB 5DEGB 4C4UA 5DRWB 5KOVC 3LV3A 3CN1A 3FB7A 1T1YB 5EU5A 3CFTA 4MLIA 3NFNA 1NEZG 5BS0D 4Y19B 1NMAH 3IM1A 3STLA 4EUPH 5HHOA 3VA6A 2ITEA 1EDKA 3TBVB 4N8PA 3JV4A 1Q0YL 1VACA 2G9HA 3O6FB 5CKGA 4GMSL 4JY5H 3GUFA 3QPXL 4XRCA 4AVHA 1OZHA 1OLZA 3H9SA 1BOGB 5F1SA 1UVQA 3WV0A 3DHPA 4N2MA 2FXOA 1LD9A 3G6DL 4E42A 2XV5A 4EF3A 4M6NH 4LHJB 3FSWA 2BVOB 2QJYB 3RK3B 4AQ1C 1VGKA 3CLEH 4U1SB 4U6TA 3UIAA 1EBPA 1OSPH 1Z9PA 1H15B 4WV1A 3MRQB 4Y9EA 3LNHA 3CPLA 2QR0B 1XGQB 2VZVA 4KKCD 1LE9B 3ETBJ 5DD0H 5GS0L 1Y8AA 1GH7A 4LCIL 4B3VA 6CGTA 4XPFL 3T0ED 3MRFA 3PP4L 3KYOA 1HINL 2E7LA 3MLVH 3ES6A 4WCYL 2FH8A 1NLDH 1P1VA 1K85A 5FCUH 5L4JA 1ROWA 3OHXC 2XG5A 3HMWH 3BPOC 4XX5A 3CD6P 4GAGH 3V6ZB 2ZXEB 4KJQD 4U1KB 4FFVC 4HLZG 4Q4EA 5E2JA 4OAWB 5EBWA 1F90L 4NM8H 4O02H 5JIKA 3RWJA 3UBGA 5LG6A 2ZT9B 3A0OA 5T1DH 2I9LA 5ANMA 2FL5B 3D51A 5ID0A 3LN4B 3RI5F 1NTZE 4P9ML 2J44A 3FH5A 4NPYB 4PV1D 5IBUG 1IC7L 5IIEA 4G82A 4X6DA 1AC6A 2W80C 4DPCX 1JPFA 1HWTC 4PJ6A 3L95B 3TBTB 1S7TA 5GS1B 3L71D 4U1HB 3PG2A 1Q8MA 5CMAB 4LCUA 1Q9OB 2CJTA 3SE6A 1B4TA 5ALCH 3CC1A 4X8JA 2VJ8A 2O26U 1HNGA 2OS7A 2VLMD 3EADA 4E9XA 5EB9A 4A68A 3E6HB 1NJ9A 1T0MA 2E7BA 4JY5L 3P3RA 1EPFA 2XA3A 2DWDB 2P42B 2HSIA 2BEQD 1NAML 2E6PA 1MFMA 4P5MB 1BCIA 3B5HA 3KW8A 4F3FB 1EEYB 3OW2O 4L4TD 4R7XA 2Z31C 1IVLA 2PWEA 5ICUA 4RH4A 1W8OA 1OMIA 1W8NA 2CJUL 3BWUF 4IHOA 2ATAA 1FHGA 1L4AD 3FFDA 4PGEB 3KGRA 5SWZD 1IE4A 2BHZA 1X0TA 2MQ3A 2AEJA 2H32A 1XV8A 2IQ9H 2H8PD 2RH0A 3CDGA 4GIFA 3ILPA 3PNWB 4TLKA 1S8DB 1T5KA 4B86A 2MCPH 4K7FB 1EJ6A 4L3EA 3K6NA 4P2OC 1NWPA 4XPTL 5JHDE 4ZUSB 4KXBA 1QRKA 2WXLA 3HZMB 3U6XA 3MNMA 2GBTA 4P5TC 3SDCA 3ZO9A 4WFFE 3VNYA 2N0KA 3I55P 1XGZA 4JG5A 1NCIA 2H41A 5APUA 2BCCJ 4WTZG 4B97A 1BMWA 2YKPA 2IH8A 3KL5A 4PP1C 1FZBA 4YVUA 4AGLA 2X4RA 4AQ8C 4AYID 4ZMQA 2BSED 4I18A 3BUPA 4IQHA 1R9FA 3QEQE 4M6OH 4X99A 5KYNA 1VQ7P 5LGJB 3D08A 3FCTA 2FZ3A 1G1KA 1ZK5A 2DQIH 2ZUXA 4LSSH 3GBML 3M45A 4Z7AA 2LW3A 4W9CC 5TDNB 3C60B 5HYSG 1MCFA 2NY4B 3C8DA 3CFEA 3DUHA 3NJFA 2YJLA 4TLUA 5ALCL 5G4NA 3FSVA 1QLRB 1O7SA 2EZ0C 5AW8B 1AXSB 2ZX5A 1UXWB 2Q7YB 4GEJA 1J5CA 4ZXBB 5DD1H 5BVPH 5B66H 4FZEL 3RL0D 1XGRB 1E9OA 5I8CA 4IOSD 1TKWA 4E9LA 3RLSA 5AG9A 3WUZA 3GI8H 3F7PC 4OFYD 4MJ5B 5E0QA 4BRYA 4FLOA 4GEIA 5DZLA 4AQRD 5IFHH 5IMMA 1E3ZA 1SQVD 4G8GE 3E2HC 1UHVA 2WVSA 4OUUB 5DSCA 1XZ0A 3WHXA 4ZPTB 5L6YL 2ITCA 2HFGH 2IQ9L 4W70A 1A7RL 1SQPD 1ZWIB 3MLYH 2H4EA 4URTB 3B5TA 1VERA 1JI2A 1IGFH 1LO3L 4XN8A 5E2UH 2JIXD 1BQLH 4BSVB 4QJ4B 1UD4A 2JXMB 3QEGH 4RISH 3SSGA 4BFJA 1CDIA 4X5XA 1ZTMA 3P4NB 4D9RE 2EDLA 5D7HA 3OLGA 4CVZA 4IYKA 2IAMC 2VUYA 3WHE1 4ELDA 1JPEA 2ZX8A 1HHJA 4PYHA 1LGVA 3TJEL 1NEPA 2A4EA 3PREA 4KJYA 4NQDB 3H2QA 3TV3H 1KCWA 3LPGA 2WSKA 5HI5C 3FQXB 3MU3A 4JRLA 3PHAA 1BD2B 3BSHA 4AL8C 4LXFA 4Y4HD 4WHTB 4PD4D 2X6UA 1F6AA 3PGFL 2X70A 2EIBA 4JM4L 1FAVA 3GDCA 4A2FA 2VAJA 4CN6A 3S4SA 2ZSWA 3OXRB 4HISA 1WFTA 4AJYV 5LKNA 5BW7C 1N5YH 1WQVT 5EEWA 2NR6A 3ZGHA 1RE3A 2OW6A 3CVBA 1FZCC 3IGAB 2HB0A 4NGHH 4F5CA 2BCCE 1GU5A 2POHA 4DOJA 2D2CD 5DZAA 5EA0L 3B1TA 3V6FB 4QJ5B 4HOWA 4FABH 3O9WC 4F93B 1YHQP 1H0DB 4HS3B 3QZOA 1TZAA 3GI8L 2O5ZL 4FMKA 1I9IH 4TM9A 3UYRH 5FGBC 1SEQH 3VOPA 2BIIA 2YXFA 4IL6H 1IGIH 4QPEA 2OMZB 2VMCA 3CMEP 2GK0B 2H1LM 5D7IB 1XXFC 3DXAD 3PABB 3EDFA 4Q6IA 1I7UB 1NCAH 4XO4A 3JV6A 1KT2A 4I13B 3SQBB 3ZKMD 3Q6FA 3V0JA 3LW5J 3TH3T 5L2JA 5CJ5A 1AFOA 1OW7A 4X6BA 4HS8H 2O5NA 3VG9C 1SQVK 3NJGA 4L1DA 3SJVA 1GS8A 3AB0C 5LGKA 2VN7A 3QQ9C 1I9RL 1SQPK 1KELL 4JMNA 4DOHB 4P9HC 1A4JB 2R2HB 3VDBA 1HL8A 2OA9A 4M1CD 4NQXA 3MV7A 1TF4A 4H8HA 3SCMC 2UWEB 4EN3C 5KSAB 1N2RA 2ARJB 4LVOC 3US0A 3ZBMA 4GS7C 1SXBA 4KI5F 2BNUA 3FBQA 4U0QB 3AGWA 3WTVA 2N9YB 5CGTA 1CGXA 1DBBL 3C6SA 3V6OE 4ELMB 1CT8A 3VD9A 1NFDA 1G1JA 5CJ4A 1GZPB 4NGHL 1A3ZA 2EIZB 4LLYA 1ZLDA 4A55A 4DJGA 3BLBA 4FABL 4XGZB 1YEWA 2NT0A 4H44D 4JKLA 5TPWH 1KGIA 2VW7A 4PD4K 2HYMA 2WXRA 3WN5A 3UYRL 1A6ZB 2BRQA 3A47A 1SEQL 5D71H 5KTBA 3BH9B 1C5BL 1JN6A 2AQ3A 2FEDD 2RQ8A 2WBJA 1F97A 2H2SC 3SQRA 3A22A 3BGAA 4HLZH 4RBPH 4YDVB 2OTUA 4KZCA 3S5ZA 3W57A 5CCGA 4C4BA 5KZCB 2R2BA 4PJHE 3DO7B 2AJ3A 1CBJA 4JPIB 2IZ1A 1XGTA 1N6QH 1QUNA 1K5NA 3T0XA 4IOIA 1G7HB 1G7LB 3CX5H 2XQYK 2NZIA 1DDTA 3QJFA 2KZBA 3CXDH 3IJYB 3R1GL 1DANT 3W11C 2YC1B 3U7AA 3DIVA 1OWRM 3GHEH 5I8EB 2IMNA 2AJUH 3TO4C 3BEWB 4MJ2A 4KHXH 4NAQA 4JM2B 1WIPA 3R7QA 3FFCB 2PF6A 5JQIB 4MZ3A 2OKMA 4P57B 3RVTC 1YNKH 4AC4A 5A2KH 2I25N 3S3CB 3RZCC 4YK4C 1OVVA 1RL1A 2M1KA 4L4VB 4KNTA 5C0BB 2Z34A 1NO4A 1FDIA 1TSHA 2R9HC 3ZDXE 4KXCA 3UCRA 5IBTH 2P28B 3QQNA 2JB6A 3FYEB 4FQJL 3EGXB 3EJCA 3VVWA 3WXWH 1TQCC 5TPWL 2WW8A 3VCLB 3FU7A 1IBGH 4OZHA 1OP3K 4GUQA 1VQNP 1CL7I 2BZDA 2X6MA 5J13C 3GHPA 4ZFOB 1Z9NA 3F5WB 2VJXA 2DQUH 4AZUA 3FYIB 3MODH 4R7NA 3S3BB 2ZUTA 43CAA 3MRPA 1H3PL 3C8HA 1D5BB 1TETH 4FE9A 2CO7A 4JFTA 3O45A 2IBGA 4G1EB 4MD4A 4MB3A 2C3HA 2PP8A 4GYBA 5CZXD 4G9FB 3BE1H 3VI4F 1NUGA 1U8QA 1HSBA 3MLUL 2AMGA 4JN2B 3RRQA 2UYLA 1NGWA 2WB1A 1A1NB 3DV6A 2N01B 1J1OH 1CI6B 4GRMB 4ZX4A 5LAXB 2APXA 2WSSH 4WGWB 1GHFL 3L75G 3ZTJG 3ARGC 1TJXA 2PNDA 4QXGL 4XN5A 4UNUA 1EV2E 5LDUA 1KFMA 3CIQA 2IBZE 1HC1A 1M2OA 1TCMA 1F0LA 3UTPE 5I1KL 2E59A 2NY6D 1WD8A 2WYIA 3ECQA 4ZOBA 1MNUL 2VDLL 4UILH 2P45B 3B5NB 1A3QA 2BXZA 3NCYS 1NAKL 4IRJC 4S1RL 1G9MH 3MA9H 4Y9CA 5IBTL 3WOVA 4DJMA 3HRZB 2NYYC 2VB5A 2PKDA 2L7QA 3L9EA 4UM9D 5IY5B 5DJ2A 5HHOD 1L6PA 1TT6A 2CBMA 3UTTB 3LEYH 3NJKA 1G7JA 3PGDB 4JO2L 1J1EC 3R2PA 3AG2B 1DSYA 3H9SD 4MJHA 4RQQB 5IB2A 3KPNA 3LRGA 3GMNB 5SX4I 2V2WA 1MFBH 2C3GA 2IANE 1P4BL 3I84A 3NUKA 3Q5OA 5TDOA 3SKMB 1CDYA 3ZE0B 4PQXA 1I9EA 3GMMA 3R06B 3E6FB 5F70A 4LU5L 3B8YA 3RWFA 1R5VA 1UB5B 3P8MC 3C6LA 4P46C 3AS1A 4XBGB 4XNZC 1FRGH 3ARBC 4LMQE 3C8KB 3RWHB 4OFDA 1O7VA 1A8JH 1BVKA 1R33A 1XCTB 4B9JA 2EXYD 2WBKA 1NCCL 4A6YL 2GJZB 4PJ5A 6FABL 1KB5B 4J4PC 4GI9A 1AQMA 3HNSL 3IGUA 3HR5A 4E9QA 2ZUVA 4M6ML 1W72B 3NRPA 4NQTA 1D9KC 3D0VA 3FCGA 3KD4A 1XGYL 2J7LA 4BZ2A 1RFDL 1PZ2A 1UWXH 1PIFA 2Q20A 3H1HG 1CVSC 5KVFL 3S0PA 5LB1A 3ECBA 1LTTC 1OTSC 1MW1A 2C4FT 3MA9L 3M06A 2F9BT 1DFBL 2BWQA 3GIVB 1UD5A 2IGTA 3J07A 1IFRA 3BP5B 4NO0A 2MOQA 5LN8A 5CP7A 3AE9C 4CDGC 5C3LD 1HCZA 4Z7VA 1BVZA 2RQEA 4ZX6A 2XDHA 5JOFB 4O4YH 5C0EA 5FYJE 1MW2A 3HB3D 1G9NH 4ZFQA 3B2UC 3CZJA 3C09B 4OLWH 4Q2ZA 3BW9B 4XVOA 1TENA 3MUHL 5PCYA 3NJJA 2OYLA 1KGJA 4EIBA 4BXVA 1EO7A 1PKQB 3P4MB 2ZUWA 5I66A 3MGTA 2WT7A 3OM3B 3TP4A 3MC0A 4WUUE 5FKAB 1AZBA 1YTZT 3SE3A 2VKWA 5GZNA 4G42A 4HJTA 1OZUA 4KKNA 3L9YA 2DJMA 3CIAA 3GKWL 4LIQE 4ZI8A 1WFIA 2NSMA 4PRIA 2CUIA 3UJIH 3NJHA 5KAQF 3LSOB 1HILB 4GPVA 5HGBB 1Q9WB 2XKNA 3QA3B 1WBYA 3FB5A 1TOXA 1IBZA 5J1AA 5DJ6A 4XMUA 2VM3A 5CILL 5D2LA 2OMBA 4NKQB 4MHHG 2OLDA 5IQMA 4RFNC 5FOBA 3ZL4L 1IJNA 1Z5HA 1ZRTD 1D5XB 3EW3B 3QWRA 2CBQA 4FCHA 1DLHB 3A0HE 2FYUG 2VSCA 3OV6A 1JGUH 4PVLA 4BUGA 3CXHH 3QFJB 4W9JC 1U8LB 4H25A 5KN5A 1X9UA 5BO0D 2FR4B 1B2WL 3CQFA 5AB0A 3W68A 1BBDH 1JF5A 1LO4H 3OR7B 1MRFL 3KPOB 2XI9A 4LQFH 1G9NL 2NY1C 4OLWL 5DEGA 5D70L 3CCSP 3IEAA 2XFXB 1T1YA 4RMVA 3N85L 3GSNL 4YDKH 1XB6A 1IFDA 2MPVA 1DVSA 4MCYB 1GL2A 5I28A 4HULB 3HUSC 4BYHA 3O6FA 3UPRB 2DL9A 3ZIYA 3EWKA 2CDGA 3GBEA 2GSGB 1P1ZB 2I07A 1IGJB 3DARA 1SOXA 4X8GA 1QBMH 4KUCF 3N9GL 3O6KH 1BBJA 2C9LY 3D39E 1PBYA 3D18A 4HYTB 5DK3A 1TTUA 4JZOB 4D8PB 1KJ2B 1XR8A 1DUZB 2CGRL 4AQEB 5AB9A 1P84D 4P59L 4U1SA 2GIMA 2YD1A 3EZ8A 4WY7H 3X3GH 1QO3A 3GO1H 2QR0A 2QMKA 4MNQE 2JJTC 3VWKC 2QZQA 4LARH 5C08E 1JMMA 5HHMB 1EZSA 3VM7A 4AG4H 1FPTH 1RZJC 1FYHB 4I7ZC 3ZJAA 1PS3A 2CBPA 3CCHA 2YZ1A 4I9WE 4M03A 5CZVL 3ARXA 2A74A 4BXSV 1QVOB 4AWJC 4ETQB 3K7UA 3BHBA 1YEDA 4OAWA 5ICZA 1WFMA 1A02J 3DJSA 2PUQT 3U25A 2FL5A 2NR6D 1V3KA 2I5YH 3LN4A 3WY1A 4NN7C 2XZQH 3AXHA 4OZGB 4PJIE 1JFHA 4HC1A 3SBRA 1JXKA 1LNUB 3DUUB 3GMRA 1CICC 4NPYA 3RX5A 3SOBH 1EZVX 2BVPA 2OBGA 5CLTA 2Z4TA 3L95A 4WO4A 1QEWB 3TL5A 4JFEE 3F5HA 2CK0H 3HE6A 1WRFA 4PY7B 3TBCA 3WXVH 4MDJA 1OAYL 4YBQC 3DTXA 2EVJA 2B87A 1IEAA 3DVNB 1FC2C 4KO9A 3WFDL 2IADB 4S11A 3LW5H 3VUAA 2PGDA 2DWDA 3A2AA 2VRAA 4UBDD 4ZNCA 4PREA 2H45A 4FQ1H 1PX4A 1MXDA 4UT9H 1L9TA 3LZRA 3WLWC 2F58L 2RACA 4BKSC 3NA9H 4G7RB 4PGEA 2QJDA 1PG7X 2WWKT 1YY8A 4K71B 3MV11 3UG3A 2EVIA 5DYOB 1T7VA 4ZMPA 3TT3H 2ORBH 1FN4A 3IF1A 3OG4B 4OCYL 2KLTA 1RQVA 3HBQA 1S8DA 4JFZH 4K7FA 1RZQA 1UWGH 2VIRA 4ZMYA 2Q8AH 2DQMA 3TZVC 5JW4Q 1E9PB 4NI6A 2X1XR 5B3SB 4W9GC 1JYWA 4KFMA 2EIEA 4HUWB 3APMA 3QI9B 1SMAA 4FLQA 3QDAA 1NOHA 3PWPB 3AE6C 1HZHH 1RPKA 5I1IL 2P47B 2PCYA 2ROYA 1ASPA 5D5MB 2V7QH 4BRJA 4U1JA 5APVA 5AW1B 1YMHB 2EEAA 2NY5H 4NQVA 1YN6B 4ZTOH 2WCGA 3TPUB 2CUAA 3LEVH 1FQ9C 3QFDB 1SOSA 3TN0C 4AKOA 3PRZA 5I6LA 4U1GC 1QABA 5C07B 4OF8A 2YPLB 3DYMA 1OGAE 1MJJB 3PL6B 5TDNA 5A2BA 3C60A 3WXVL 1IC2A 2G75B 3L70G 3U4KA 4WBAA 2A1WH 3MV9E 1SLUA 1MJ7L 3Q1EA 4YIQB 5GJSL 4RAVB 3NPSC 4DIXA 2HG0A 5BZZA 5B4MC 2DAVA 1UXWA 5IB1B 1ILUA 5KBPA 2R3SA 3M1OA 3K8LA 5E1QA 3H1KJ 1Q1JL 4G70B 3ZTNL 4UT9L 1NTDA 1X5HA 4YC2C 1L6XA 2DWSA 4UNVA 5CO1A 3SDXF 4CAGA 3QUYB 3I2CH 4RKUJ 3VWJD 2YKLH 4XAKE 5GGRB 3L4YA 5IVZB 4MAYC 4BK5A 1C8PA 1Q9LB 3L4XA 4HUNB 3WD5H 2NLJB 2Q9OA 4D0BB 4LCWB 1JVOA 3CLFH 4RIRB 3AE5C 1CGTA 1JK8B 4YSSA 4HCFA 4AMKL 1CI5A 3T08A 4BSVA 3L3OC 3NCFB 1F2XK 2RA1A 3EHBC 5T5FA 2KT6A 2C34A 3L2NA 1S5LH 2QKIB 1NFKA 3ASOB 2BY1A 3T65A 3HNVH 4U6YB 1HCFX 2NY5L 4JJ5B 4KKLD 1D6VH 1BLNA 5E9NA 3FQXA 3DVGA 1PAZA 1TMQA 2V3DA 4NLAA 5IK3A 5C6TL 2PTUA 1BD2A 1NU1D 2BMKA 2IFGA 2X0UA 4WHTA 4NOFA 3CL3D 1AGEA 3MBWB 2YPVL 2OR9L 4M48H 2NSXA 2A1WL 3GEFA 5DUML 3OB0H 3D0LB 4IOFC 5I1JL 2WWMC 1N2DC 4J1UB 1EMTL 1NC2A 3WTSA 2IDBA 1MLBB 3IGAA 1OSZB 1PX3A 2C9SA 5DZNA 5BU5A 1NEUA 4V11A 3AT8A 3ELQA 3V6FA 3NDZE 4PGBB 2ENSA 4I77L 1VDGA 2OULB 4Y1AE 3N2JA 2HVBA 5CGYC 3U9PH 1KN2H 3NBNA 1KCRH 1T1ZB 1UT2A 4FMFA 5EO9B 3KWVA 4IDJH 3N0AA 2BCKA 1ONQB 1P5VA 3MACH 5IMOA 1HEHC 4NN6B 5C0DB 4JVWA 5KSBE 5FYJH 3V0FA 1B0WA 3NESA 4X6DF 4XMWA 3EOAB 4MVBC 3PABA 4GSDL 1S2EA 2JKLA 3SQBA 3CWBG 1JWMA 4RMTA 4HX1B 3VMZA 3OKDB 4HJUA 1OK0A 5H4YA 1A3RH 2ZOTA 5FUCE 2OZ4H 1X9VA 5AW0B 3F85A 2FLBT 1R3JA 1XF1A 1P6WA 3IDIA 1QOKA 3T6ZA 4ZMZA 1M57D 1H8LA 2Y3AA 1ZJBA 3Q2VA 4MYWB 1E5ZA 3ZMRA 4AEHH 3KL0A 3BZFB 2IPKB 5I15H 1RZGB 3HUJE 1JWUB 3PAVA 5KJ7C 2J88H 4FFZL 1A0QL 5EU4A 2PYEB 4LLWB 5ABAA 4Q9QH 4JPZB 3OKLB 5AVYB 3DETD 1G7MA 1KFGA 4ZQTA 2M3EA 1GZPA 2B2XH 4IBVA 1RUAL 1YYMH 2XIDA 4RNRB 5E1GA 1M71B 4Y8AA 3U59A 5CF3A 5SWSE 1IQDB 3S5YA 1NU1K 1SBBA 1KF9B 4NM4L 1KN2L 3DGGA 1SFCC 4PJ8B 3GPSA 4GBXA 4FP8H 2EYRB 4LCVA 5I1AB 1RSFA 2Z8RA 4D3CL 3INUH 3KCPB 2X4OA 3BH9A 2D2OA 4JQIH 2AXTE 4ODVL 4CGTA 4ZMVA 1FNHA 1AQ5A 2AJXL 4PJEE 4CA4A 3DO7A 4Z7OB 2V8MA 4JPIA 4JW3A 4FNPA 1Z5LA 3FNKA 4LEXL 4YFEA 1EIBA 3WE6B 1GAFL 3EYOA 1IJDB 1AGFB 3PJSA 2VDPL 1CWVA 1R3HA 3IFOB 3NG5A 2OYHC 1SJHA 3CDZA 4Q52A 3L71J 3CZUB 1NPUA 3KHUA 2BVUA 3EJSA 5D7LA 5CLYA 4OD3H 5D1ZC 5IESH 1E27B 5F3BB 2H2PC 4PHZA 1WWBX 1W91A 2CLVB 3OC5A 3PWLB 4FNUA 4F7EB 4DTGH 3IFNH 1T2KD 5D7JC 5E1HB 4FNTA 4HIEA 2BHUA 3NEXA 2VLLA 1LTAC 1KIUB 3Q1SL 4YBLB 4L4VA 4M43H 4TQPA 3VI3B 1HGZA 1MFCH 2YHGA 1KCBA 3L3JB 2BM3A 3MLZH 2B2XL 3E1ZA 3VXUD 2LXCB 1RUPH 3KPQB 4JRXD 4MZIA 4TSCH 3GRWA 4G5AA 2XBDA 2Z6FA 3F83A 3EGXA 4UB6E 4JKMA 5I8OL 2W0LA 1H8SA 3FUNA 4WJG3 3RIFK 5BS0E 1I1CA 1MVUB 4TUKH 1N67A 3RL2B 4LCCC 5ELIA 2EEDA 4LRIC 2FYYA 1SHWA 3NRFA 2Y2WA 2JJLA 3KJ4B 4ZFOA 1DN2A 3F5WA 3NCBB 5FO9B 1MFEH 1WC7B 4Z7QE 2A45G 2VRQA 3B3IB 3BAKA 5F0LB 4U1MA 4WGVB 4OUOA 4HKZA 4HT1H 4IKKA 3K6SB 4LSUL 2E7DA 2YD0A 4Z78A 4G9FA 2VR9A 1IGCL 3H9HB 3CFMA 3ASWA 3X3FH 1GOFA 1G7IB 4WI4A 4GXVH 4UAOC 4XCCH 1E4KA 5BJTB 1X44A 1U3HC 4K3EH 2PWHA 3CBKB 4BUHA 2MKLC 2GEEA 5LAXA 4POYA 3QXUA 3QWRD 4QOKD 3DYOA 3CH8A 4TNVF 2WPQA 2CRIA 3G5VA 4GQZA 1A6AB 1Q4NX 4TLFA 1BZQK 1DVFA 2CKBA 2H6PB 4P2RA 3F7RA 3T0VA 4AT6B 4PJXB 1IEHA 4O9HL 2VYRE 1ITCA 1MHPH 4EZMA 3F7VA 2Z35A 2WOYA 4NT6A 4OZIE 4PWIA 5FIEA 2VLRE 3B5NA 3V5HB 1ZSDB 5F7HA 5LWYH 3IDXH 4YXWH 4AUUA 3T0DA 4L9LB 5DZVA 3RVUD 2F8IA 3QAQA 3Q6GH 2F19L 1SQVJ 4Y19D 4DZOA 2P26A 4GY4A 1E67A 5E2WL 2MNJB 1KC8Q 3FQTA 4K9EL 3UTTA 1SQPJ 3O6FD 2RTTA 2WY3B 3ZT5A 1WJ3A 3PGDA 5E2VL 1DP0A 4TUKL 1ZLVK 1PPJG 2VLME 3DMMC 4HIIB 2IGFH 4XTRD 4OLZH 2R23B 5EEZA 3U1AA 3V0WH 1MFEL 2C9VA 3V5DB 3RK3D 4U3FD 2A73A 2WNXA 4L4TE 3UZVA 5EOTB 4L8DA 2X5PA 2IDQA 4I48B 4HU8A 1N73A 1BQUA 4GUCA 3QJHA 4OI9A 4KNQA 3NPZB 3S36X 5KS9E 5SWZE 3E6FA 5E70A 5J6HB 1A02N 2LU4A 4OFPA 4LHUB 2C9UA 1DN0B 1UB5A 4Y2OB 1AO7A 1LT9B 1NFDF 4GXVL 3KYAA 4H20L 2HRPH 4MMZA 3U0WL 4K3EL 4N5UA 4JGMA 2X28A 4FKKA 4PD4J 1DDHB 1LL1A 2GBUA 1XCTA 3ZHLA 2YA2A 2CCLA 2VAAA 4AJVA 1X9LA 4LKXB 1GTNA 1NPNA 4ZUVB 3S35H 2AJSH 5DHVH 4OJAA 1L6ZA 1W72A 4DVRH 1EJFA 2WAQA 2DL2A 2ZT9D 2J6EL 2AV7B 1U30A 4OKVB 1MHPL 2VDQH 4HPOL 5DMGD 3AM8A 1JGLH 1IGYB 4IRZH 1T21B 3KLHD 5KYWB 1AD0A 3C9NB 5LWYL 5H2BB 2CNYA 3MXWH 4EDXB 4E9TA 5GGVL 3UAJC 3GIVA 4U3HA 4X6CB 3BP5A 4Y2DC 4U3XA 3RK2C 3OF6D 4WW1A 2E75B 3HAEH 3L4CA 3SDAA 1J10A 3AUVA 1C1EL 5I6KA 3D69B 3C5SA 2G2NA 5FXCH 1FCGA 1JDAA 3V79C 4KKRA 4ODUA 3N91A 4RETB 1I53A 3BW9A 2F74B 3UBFA 3K1KC 4JLRB 3CHQA 5DA4A 3NIFF 4UOW1 1PKQA 3P4MA 4MAUH 4L3CB 3VD0A 4JL1A 4J3WA 1FZOB 4KZEH 1E79H 3BLKA 2ZVOB 4K73A 2HRLA 2XHNA 2R29H 2ZCHL 3DVFA 1SQPE 4HWBA 4NFCA 4M7KH 1LO2H 1S78C 1G9HA 4PFEA 3WBDA 1T2QH 1R3IH 1NJIQ 4AQ1B 3LSOA 4DZBB 2ZIDA 3MV8B 2ARJQ 2AJSL 5A6IA 5I1DB 3DURA 1YNLL 4OZHF 4XHJC 3QA3A 4GW4A 4N0FA 1PMYA 3R0NA 1JL8A 2VDQL 1YMMB 2BHYA 1K2DB 2X05A 2ICWI 3TESA 1H3UA 2ICWB 3OHXB 3GJFH 3BPOB 4R5XA 1PNDA 1PYWA 5I18L 3C60D 1G0YR 2NY4D 1U8LA 3M86A 1G1YA 4PD4E 4YDIL 3G3ZA 1CLVA 2FR4A 3P0VL 4JE4B 4GKZB 2A4CA 3LMJL 5IVXB 1CE1L 2P5EB 5EUOB 2Y7QB 4UU9B 3TJHD 3L35A 3COOA 1LNQA 3GSWA 4ZXBD 2XSKA 4Z3EA 1QHOA 3OKOB 5AW7B 3N1FC 2WCSA 4K8RH 4JCLA 4FQHB 3IDJA 1R34A 3TGUG 4EE2A 1C08B 2GJ6B 3QDMB 4PJAE 2DBJA 3GXIA 4OF7A 2YD8A 3Q7JA 2B1HH 4W6YB 1L0YA 1G7PA 3UPRA 3H3KA 5ECGA 4KZEL 2GSGA 4R0LC 2Y1VA 2BP0B 5HSFA 1FWXA 3PP3K 4EQ2A 3CCEP 2ZKXA 2CO4A 2Z31B 4P4KC 1KJ3H 1LO2L 2Z4QB 1LWHA 4Y5YA 1KJ2A 4AQEA 1DUZA 3CCRP 2RB8A 2Y22A 1FFPB 2DLGA 3CE1A 1NAFA 2TSAA 3NCJL 3P2TA 1EEZA 1XF2A 2N1KA 4Y2LA 5HGDB 3WLBB 4JZJB 4TT3H 1JGVH 4PLJC 2XWXA 1LILA 4B5EA 3DX7B 1O5PA 2HTKC 5EF0A 2WGNB 3Q3GB 4Q4IA 2OMXB 4Q9BA 1JYXA 4NQDD 3EFDH 1HYSC 1URQA 1BP3B 5HHVL 5KAQG 3SWYA 4HGWB 4N0YH 3FONB 4ORZC 3UGXA 5C7XH 2XN2A 3SYQA 2DMHA 2ZYDA 3L5XL 3HZVB 4YHML 5LVEA 1QVOA 1N64L 4NRZB 4ETQA 5JXEC 1RJZB 4JFOB 4BE5A 3IAOA 3BSZH 5D6CA 4QI3A 2A45H 4QT5B 5T1KB 5KVEH 5GS3A 3X11B 4E5XB 4JFWA 3BUIA 4KRPC 3IJHA 2RBLA 3ARDA 3DUUA 3KPPB 4MKMA 5I1EH 1F4XL 2L4OA 2LLNA 2P2UA 2X9YA 3EYUH 4K8RL 2XBZA 1SQBD 1QEWA 4B9CA 3L3GB 5KBKA 3LKQA 3T6QC 1RH5B 5KLVD 2EH8L 2A6JB 5LXGH 5E94B 4G6AD 3EBHA 4HCRL 4H40A 2QPFA 1N0LA 2QQKL 3DUSB 4HHAA 5IG7B 4F2ME 2CK3H 2ZWZA 4QKXB 4Y4KC 4LF3A 3CK0L 2VXUH 1HWHB 1UYWL 3MPCA 1HF9A 1TCRB 3VP8A 1E9QA 1NBCA 2CRYA 4X80H 5GGQH 4APQC 1KPRB 1Z5YD 3PPEA 4WVZA 1NTKG 2YGNA 4Z3JA 2DQGH 4D0CA 1MCBA 3TA3C 2QPUA 1J5HA 4MMXC 5DYOA 4U6VH 2UVFA 1DO5A 1JGVL 1P69B 4PRNB 3QQDB 4KMTL 4YGAB 5FUCC 3RGUA 5CHNB 2J1YA 3VYPA 4R4FH 5LBSA 3JWNG 3M9QA 2W65A 3RBGA 2LGNA 3OQRA 4WEBH 2A5UA 3O2WL 4WNQA 4J39A 3GG2A 1RZIA 3HE7C 1NCWH 1A66A 5KSAD 2BP3A 2H0PA 4LLDA 4FADA 4UOZA 4NC1C 1NGZB 1LP9A 2XRAH 3IPFA 3L81A 3PWPA 1YEGH 5FA4B 4J2XA 4M8UA 4S0TD 2Z93B 2BNRA 1E50A 1B3IA 2JNZA 3H1IG 3ATAA 2IAMB 2EDXA 3B7UX 3BSZL 3HKFA 1WCQA 4I0PA 3EGSA 1ORSA 5KVEL 1S3RA 5CUSH 3FUKA 5HDOA 3QFDA 3P0YL 2WZPA 4KH2A 4DERA 5JZ7D 3B9KC 5HJDA 2YPLA 3TBWA 5FUOL 3EYUL 3PL6A 4V33A 2FATL 5DK0A 5CEYA 1YITP 5ACLA 3HC3H 4RAVA 5D2LF 3BUYA 2YUWA 3U9WA 3RNQB 1FAKT 1S7UB 4JHWH 1FZCB 3HD7C 4FJ6A 2VXUL 1BMZA 3EO9L 3C2AL 3QUML 2XWJB 4LEOA 1IMHC 5L4FA 1NGYA 4OQTA 3CBJB 5KZCD 3QAZB 1OAZL 3O9WB 2SEBB 4W81A 5JW5B 4QCIA 4OFKA 1QRNB 4HHGA 5FS5A 3AQXA 2DQGL 4HJGA 4UZGA 1SQBK 1JCVA 5KLVK 3OBAA 2J8UB 3T3PE 5IVZA 4M9PA 2AHIA 1AHKA 5IUCA 2H43A 1N8ZB 2WUCH 2YAPA 1KQGB 3F12A 5GHWH 2WMPB 3GWJA 4I87A 2L8AA 4TL5A 5ESQB 3NACL 3QXAA 4R4FL 4NWUL 3FT2A 5AKTA 3BDYL 1OW8A 4JM2D 1FDOA 3CSTA 3FFCD 2YAEA 2GBAA 2HKHH 3WL9A 1VGEH 1JM0A 1U6AH 1VIWA 3FF8A 1BREA 4W9KC 3IPEA 4YXHL 1FUNA 2CIKB 2QKIA 3NSYA 2FBJH 3BPCB 3VG9B 4L4VD 1KTDB 1IFMA 1RY7B 4U6YA 1Z0NA 1ZEAH 5C0BD 3TIEA 1FZGA 2H0EA 2A77H 3AB0B 4JPQA 1SQXG 2LT9A 4DGUA 1L9QA 2D7MA 4JANB 3CHPA 4KO6A 2VDRB 4OCWL 4NNXA 4XMLH 4NZTH 1SFHA 3SCMB 4EN3B 4PJDE 3MBWA 3IR9A 3JTTA 2A6DA 1SY6L 1DHKA 4YWGH 4LVOB 1FZMA 3G5YB 1NIFA 2SODB 4GS7B 1VQMP 4AW7A 3D0LA 3ZSTA 1A4CA 4J1UA 2W9DH 4W93A 2VR8A 2WLJA 3MRNB 4JHWL 1VHPA 3ABLB 3HC2A 4L8CB 4C83B 4YOKA 5F71A 2BSTB 1WLHA 3L3KB 1T7ZA 1T3UA 4FQXA 1T1ZA 1F3RB 3KLSA 5EO9A 4B9PA 3KYNB 4B41A 4N86A 3DIDA 1OCWL 2IALB 4AVIA 3KPSB 3UAFA 5K9KB 4LFHG 4Q6KA 2I1KA 5GHWL 4B50A 4OGYL 2E5TA 3CBRA 2V7NA 4N2IA 1NCOA 4Y99C 3EOAA 4WKXA 3A67H 4JPKL 1UQSB 4CMMB 2YNYA 3I02B 3LNEA 4UB8H 1JK9B 3KZIH 2W6JH 4A7GA 2AGJL 5BOJA 3FO1B 3CFJB 3CZLA 3ARSA 2NZ9D 5E4AA 3B6SB 4XVJL 2X1WL 2X6AA 2WWKO 5ESAA 1C16A 1N7SC 2GKIA 1BVNT 1S46A 1ZEAL 1J2JB 4KX8A 2A77L 4F7KA 3L1GA 1TTFA 2APTA 4HJ0C 4Q14A 1M90Q 3TO4B 4YN3A 2EE9A 2Y2YA 1HIMH 4MA8H 3FO0H 4F58H 2GY7B 4XMLL 4NZTL 3BZFA 3Q8FA 5IBLD 2IPKA 4GAAA 5IWLA 1GVIA 1JWUA 2L04A 3L5IA 4KAQL 5BNXD 1QR1A 4M1DL 3RZCB 4YK4B 3ZHDA 4YHOH 2ITAA 3AS3A 2PYEA 1BZDA 4LLWA 1FYTB 2L7JA 3MJ9L 1BF8A 2K88A 2HPOA 3GMPA 1INEH 1SQQD 4BGDA 1OW0C 1M71A 4HSCX 1RUMH 3GBNL 3GGWB 4C8XA 4WWOA 1BZ9A 3TU6A 1TQCB 1H5BA 1HOCA 4PJ8A 3H4FA 3U1PA 1KTKE 1D7BA 2EYRA 5KVGE 3QRFM 1UA6H 1XTLA 5KVFE 2XTJB 5H8DA 4Y5VC 1U3JA 2ESVB 5J13B 2XN9B 1FFRA 2NNXA 5DLLA 3BDBA 3SOTA 1LTXA 2BINA 3RE0A 3A67L 4XMPH 5J5EA 3ULVD 1MREH 3FWLA 5AW2B 3UOAB 3OPUA 3FQRA 5ID1B 2B20A 7FABH 2I69A 3HG0A 2PCPA 4OGAC 2EKSB 3GSRA 4G43B 4JHBA 1V7NH 3IFOA 5I73C 3S4RA 4YHZH 4GG6A 3F84A 3MRKB 1ZHNB 3OX8B 2P48B 5TJWK 2M83A 1IAII 2VUOA 1ZRTE 2ZWKA 2CR6A 4N9GA 3L17A 1XCQB 1HIML 1E27A 3ARGB 2CLVA 4CMHC 4F7EA 1MI5A 3V4PB 3ZZLA 3PHQA 5JTWA 3KH3A 4KK8D 5IROC 1JY3O 2PR4L 1KIUA 2XZCH 4PJFB 1ZLWH 3UDWA 2Y07L 1QMUA 5AW5B 2CCWA 4UV4L 3VI3A 3VXRB 3GMQA 5BUAA 2P3YA 2O5XL 1MWAH 3F6LA 1A7NH 2DOCA 3MBEC 4IRJB 3NFPB 2CG9X 1WK0A 3EJTA 2QMJA 5E6ZA 1P4UA 2YIUC 3K71A 3RTQA 4KKAD 5ETUB 3LNFA 1NDGB 4MQ7B 4IJ3C 3RBSA 3S5LA 4HLJA 3P11H 5DO2C 1MVUA 3KW7A 1OP3H 2EH7L 3ZVVA 3RL2A 2Z3FA 1IAIM 5F9WC 4N0UE 1J1EB 3U6XS 1PY0A 1F86A 3QZLA 4F7TA 4W80A 1WC7A 3HG1A 2CXKA 2ZFCA 1RMFH 3VACA 3B3IA 3F3HA 5FYLL 3RBZA 1SQQK 4OGQC 1PZDA 2AQ2A 1WFJA 4ZFZB 3K6SA 5TDPB 1MREL 4G9DA 3CC7P 3APNA 2FT7A 3WFHA 2X38A 4P3WA 3VRJB 2ALWA 1X4YA 1SYSA 5KW9L 1AA0A 4EXPX 1KXVA 3H9HA 1G7IA 2O6PA 4GO6B 1I9JH 4P46B 4EIZC 2WSFJ 1YI2P 4XNZB 4W9HC 1RPUA 3ARBB 3CVCA 5BJTA 1VQPP 5ABDE 4MDRA 3P4OB 2J1ZA 3LZNA 4YXKL 4JMXA 1KCUL 3WFBL 3QFJD 3UIYA 4O2CB 4PI2A 2DTMH 2FRGP 5CEZL 1A6AA 4O51A 2WXMA 4KNSA 5DGQA 4RMWA 1M05A 2H6PA 5D72L 4AT6A 3PWUA 4PJXA 2CPCA 3VGDA 2NY2B 1TO5A 1EZUA 3WI9A 1ADQL 1F3DH 3CUPB 3M46A 5DJAA 4WK4B 5IF0A 2FNWA 3K4DA 1L4IA 1RZKL 3IBEA 3BVUA 3V5HA 2F7PA 4D0DA 2NT1A 1MWAL 2RCSL 5AKSA 3HI5H 4NI3A 3JYBA 5CCHA 4Y4FC 1BQHB 3BZEB 1J0IA 2FIRT 3CSGA 5CD5D 2XKUA 1CXIA 2WYTA 4P5KB 5EEUA 5GGSB 1SMOA 1FJPA 1MSPA 4X5PA 5EORL 4G3YL 2ENPA 3MAWA 3SY0B 1AIFB 1S7RB 5DHMC 2ERJC 5DQDL 2BH0A 2EYSB 3C08L 2UXVA 2CIIB 3F7YB 4KY1L 3WNPA 4ZUTB 5LG1A 4K07A 1RMFL 1T0OA 4I48A 1EERB 1RERA 3WU1A 4OB5H 4N5ED 3EBAA 1T0NB 4LHUA 5HHMD 5EPMA 3SKNA 1GGIL 5ADOH 2N1TC 5JOPD 5K39B 2MH4A 4MBOA 2JCCE 3SPJA 3PDDA 4A2HA 1NU1J 5H2FE 5FHAL 4E0RB 1U8OB 1BWWA 1NANI 4GQ9H 1ETJA 1VCBC 2NY0B 3IBOA 3MNVB 3KDMA 3NIGE 4NLHA 4LKXA 4L5FH 3S4SG 4TTDC 5ICXB 3TYFA 1IKNA 2A9DA 2YMOA 2PW2A 1ZT1B 1JERA 2ZXDA 4HFUL 3ARFA 4NWTH 4YLCA 2R1YA 4HKBA 3BUDA 3KYQA 1HVVA 2YXVA 4OKVA 1U7JA 2MPAL 4ODHL 5J6GB 4PBWD 5F7BA 5E8OA 1KXTA 4RFNB 5EZOH 3LN5B 1SP4A 5DXWA 1LTIC 4XPAH 2FX7L 1MCWW 4X6CA 1U4FA 1FL5A 2A9ML 4OD1L 3RDTA 4L8BB 2QL1A 2G5UA 2IQAA 4AH2A 4PU2A 3W39B 1BECA 2PO6A 4R8WL 5IV2B 1XGUB 3ULUF 2XDJA 1WA1X 2X9XA 4UOQA 2NY1B 1PP9G 4CSTA 1TTGA 3O8XA 4PJGA 5EHFA 1YPZB 3AWEA 1M2VA 4OF6A 5E1IA 3DGCR 3JSSA 4JN1H 2XY1A 4IMLB 3VFGH 5DC2A 4L3CA 1LMIA 1T4KA 1T2XA 5E08H 1T03L 3HUSB 2IFNA 5KAIH 1FZOA 4OB5L 4GSUA 4Y2NA 1OCOB 4G8GB 3CSYA 2A06D 4HK0B 2KP8A 3E80A 2YFOA 3VGAC 4ELKA 1MIEL 3M17A 2VMFA 5E4OA 5GRUL 3L16A 1QFOA 1E0OB 3QI9D 1ZGLP 1J11A 5E23A 1DQDH 3PWPD 5HPOA 2E46A 4PJ7A 5KOMC 4PG2C 7PAZA 1PZQA 1L0PA 4WI5A 3VWKB 2DBLH 3P1VA 3RWCB 2XPZA 1YJDH 4JUTA 3NCCB 3FH7A 1R19A 2W0FA 3ZZ1A 4JO8A 2JF1A 4I7ZB 3APDA 4OGZA 2KBGA 4YZWA 5FECB 4K55A 2VE6B 5C07D 2NQ3A 2ICWA 2XQBH 2YPLD 3CG8A 2CCVA 3PL6D 4F1SA 4IBUA 1EGJL 1NU1E 4YSTA 4PHXA 2JQZA 1OPOA 1KMGA 4AMWA 3KQGA 2YMTA 5EFWB 3LQAL 4GKZA 2IAAC 3BVWA 3QG7H 1HWGB 5DVKA 2P5EA 2YRZA 5EUOA 4NN7B 3I85A 2EVFA 4OI7A 4DGVH 1CICB 3RVVD 4XNBA 1M56B 5C0IB 4KFZC 3RJDA 4EVNB 3TJPA 1DBAL 4UT7H 5CJXC 3OLDA 4HEME 3QXDB 1C08A 2KB7P 3QDMA 3QUYD 1GGUA 4X7FC 1J0HA 3BMVA 2VXTL 5DS8A 1F4WL 1T04B 5E08L 4FAAB 2DWYA 2BDNH 4Z23A 4WWPA 2KS0A 3GINA 2R7EA 4J3OD 3S8GB 2D3LA 2BP0A 4LCWD 4R84A 5LAPA 1HS6A 4OLYH 4Z76A 2OYOA 3ABVC 4LC1A 1QP1A 2Z31A 3MUUA 1JWSA 2Z4QA 5AOZA 1S3KH 3MRHB 2VDKL 3RVWD 1CO1A 5BXFA 3SY6A 3PHOA 5GGUA 2A0LC 1OE3A 4JZJA 4K3DL 1PZUB 4F7PB 3DX7A 1UTDA 1H89A 1F8TL 2OMXA 4TLTA 3W5MA 3M8OH 1JZ7A 5D1QE 1I8MA 4DW2H 4GKNA 4HGWA 3B7SA 3GSUB 3RKDC 3TZVB 4HVBA 1HWWA 2K6YA 3ZE0F 2XQBL 3U9UA 1ZTXL 1INDH 3HZVA 2QJKC 3EUDA 4AEFA 2H0JA 2YBRB 2LOEA 1PY9A 5DVNA 2AQ1A 1EBAA 3KXFA 3BATA 4QT5A 3QG7L 2GUSA 4BFRA 1KLUB 4UDTB 1JE6A 3ROOB 4JRYE 1MEXH 1OAKL 3BKYL 3B56A 1BDYA 3CVHB 4PRBB 4U1GB 4EI5A 4R90H 1GJUA 4PJCA 2PP6A 4H0LB 5KANG 2HT2D 3L1OH 3ULVF 4XWOC 2YR3A 4HUVB 1ZPLA 4IFMA 4RFEB 1P7KB 4FRWA 4APXB 5B1KA 5IQ7H 1BDCA 3BC9A 3NPSB 1KFAH 5IG7A 1U8NB 2Z0UA 4EIUA 3DYPA 2PETA 2VDMB 4UUJA 4AKPA 5EO0B 2ISDA 2QTVA 3PLYA 5IHUH 3DHUA 3RWEB 4D6TG 1U3YA 5FO7A 2YJQA 3N44B 1XWVA 3VTTA 2HFEB 1KPRA 1PTZA 4H2CA 5IB3A 2V5SA 3GS7A 3X1FA 4YC2B 1KG0B 2VC2H 3L4UA 3I6KB 5FK9B 3NTCL 4PJHB 2RAMA 1T89C 4MAYB 1MFVA 3QQDA 2ZOOA 1KXQE 3OWRA 1T6VN 2JJSA 5EBLA 4S1SH 5DJCA 4N6RA 5CHNA 4I6MC 1JYNA 2YD6A 1AZUA 1OQXA 4YPCA 2BS8A 2EEBA 3ISYA 4GMTH 3ZY7A 5GZOC 3M91A 3CJJA 1INDL 3BRTB 3GB7B 3L3OB 1X9QA 1NGZA 1PZCA 4IIQC 3RGHA 3DX6A 1P84H 2M0BA 2Y9ZA 1VKXA 3CU1A 4DP1X 3AEAC 1HKFA 3BUBA 4PWFA 3EJYD 4KWUA 5DQ9A 2QLVB 4N2HA 2XWCA 1TVHB 3QCTH 2ICEA 4U3FJ 3SODB 4DEPB 1MEXL 4WWKC 3VE0A 3U0PA 3GMAA 4Y16B 1MRCH 4R26H 4ZUUA 3T6XA 4JRXE 4FG2A 5FGSA 3RIKA 4LPUA 2NYKA 1M7DA 2FX9H 1JHLL 3DDFA 3WIFA 2R4SL 2ICCA 4PLNC 1KFAL 4XO9A 3RNQA 1PPIA 1S7UA 3FPYA 1FZCA 15C8L 4KV5E 4OU3A 4TUJA 4FS0A 3SDDC 1KLGA 4IM8A 5LGHH 2ADJB 3V52H 3AREB 4OGXH 1CZQA 2W60B 2MTPA 2SEBA 1QTPA 2KKQA 1SVCP 2K3RA 1JHKL 5F89A 4WY4B 4KO5A 3H0TA 2O6CA 2KH2B 5B38B 1E43A 1K6QH 2GYSA 5L0QB 3IJSA 3CQQA 4YZFF 3TH2T 1BZ8A 1SLQA 1N8ZA 1NIEA 4BJLA 4LASL 3UPCA 5KJRH 2WMPA 4J5VA 3NXSA 5I75C 4HKJA 1CGVA 2W9EH 3GSOB 3V4VB 5GSVA 3IDNB 1MZ9A 4CJ1A 5JQ6L 1P4LB 2OYKA 1TJIL 4QOKE 3L4ZA 4ODWB 1UM5L 2JJUA 1HH6A 4G8IB 4WI7A 5JXAL 4WRLA 4EZJA 2FHBA 2IBZI 5F3FA 5CNHA 5MEOB 1CBVH 4PUBH 3EO0B 2V5TA 4G7VH 2YQ3A 1DFXA 4ILDA 4M93C 1MZYA 2EE6A 3IKCA 3AE1C 4FXTA 5ACZB 1N26A 2OL3L 2CJSA 1HHGA 4PMEA 3V0IA 5TQ0H 3RY6C 1UC6A 4DGIL 4QWWD 2FX9L 1RIUH 5DRXA 3IAQA 1I85C 2BSRB 4KQ4H 3VXSE 3VYIA 3RG1C 3P69A 1OARL 2OAAA 4LEBA 4HS6A 4OGXL 4B96A 4YFDB 4Z5RB 4ISVB 2WSFH 2IANB 3T4YA 2NY7L 3RK3E 4U3FE 3ATEA 1MCCA 1J5OL 1SFCB 1CR9L 1DZBA 3UC0L 2ED6A 1IM3B 2IALA 4F20A 3AEFC 2J20A 2OP4H 1HHIB 3EBGA 3A6CL 3I75B 4WI2A 4WNSA 1QQDA 4ZYKB 5KUMA 2B4CL 4JHAH 4PS4L 1I1AC 4RVBA 1UACL 2GABA 3L2MA 4LMQI 4RMUA 5I1CH 1S9KC 4CW1B 1G9NC 1UJ3C 2Z7YA 1ND0B 2AQQA 4OJFH 1ZA3A 5CLXA 1UEMA 1LTGC 5T8IA 1H3WM 2XU6A 2D7NA 2XOTA 3FO1A 3IRPX 1BX2B 3CCLP 5FV2A 3V4UL 2DM3A 1RVFL 4YE4L 4L1BA 4IOIH 1TJMA 4NKOB 1LWUC 2RD0A 3QQXA 4PG9A 3B2PA 4KDVA 4WJKB 5GXBB 1EZVG 2Z64C 4PTTA 2OYHB 1CBVL 4PUBL 2R2EB 3RUGA 3WAKA 2KZWA 4KPHH 3PWJB 4CN4A 1E8ZA 5D1ZB 5GS0D 1LTJA 1X5XA 4DESA 3J2PA 1JY3N 1Z9OA 2I24N 4NAJA 5D7JB 1TJHL 3T4AC 4I88A 2VLJB 3QORC 1YQ4C 1AFVL 1HNFA 2OXHB 3JWOL 5BQ7B 1RIUL 1NOLA 2PW1B 2QQLL 5D4HA 3Q9QA 4KDTA 2XPGB 3VJ6A 1CCZA 5EOCH 3MUJA 4KQ4L 2O6EA 1PVHA 1RI8A 3L70E 1O9ZA 2DW5A 4KTDH 4N8CL 4R97B 4EKXA 2P58A 4YSQA 5BO1H 1LP9F 1NUDA 1A6TA 4MNHB 1YYCA 5D5MF 3MFGB 3K74B 2YA1A 1P6AB 4IFFA 1CLOH 2XVBA 4LHUD 2WINA 4LCCB 1EAOA 2OMNA 4WUUB 1G6RB 5DWPA 2VSKB 3QUKB 3TSIA 1FVDA 2I9TB 2AK1H 2R1XB 3GQFA 4WSKA 3E7JA 1OAQH 4W4OC 4JQ0D 4PV9A 1F11B 2CK2A 1OOWA 2F54B 1K8DB 3H7BA 3EQ2A 3CFIC 1KIQA 3RWDA 4G43A 1ED3B 2J4WH 2N3JA 4OZFB 2UXTA 4BK4A 1Y1DA 4UAOB 1BQKA 1KTRL 5IR1B 1U3HB 1PEWA 4HH8A 3TVMB 3OX8A 2EO1A 1SQBJ 1BZ7B 2UZXA 5KLVJ 1F4AA 3VXTB 5CINH 2X4SA 4YPJA 3P73A 4KPHL 3KPLB 2EVGA 1P7QA 4X9FA 5B1JA 3O3BA 3WIIH 4YSPA 3EOTL 3FT4A 1EDYA 3LZFL 5HD8C 4ONFH 4IL6X 4DAGL 3E7KA 3FU3A 4PJFA 1QUPA 4Y7OC 1BGYD 5GTIE 4ZQKA 4ZT1A 3VXRA 5EOCL 2P67A 1AVAA 3KHQA 4N20A 2C3VA 5AEAA 3NFPA 4J3BA 3FAXA 1SVBA 3HI1B 3O2DH 5T1LA 2J1XA 3H32B 2G8YA 2GAZB 5ETUA 4RRPM 1GGBH 3V0GA 1NDGA 5DJUB 4UQ3A 1XR9B 2EDNA 1CLOL 3NDYE 1RK1A 1XSJA 2WZAA 1OK8A 1BE3D 5D2NE 1HXKA 1B0RA 1WZ1L 2XWTB 4FYSA 5DVLA 1DSFL 1GXEA 4QRSA 4KHXA 5KVDE 1NOAA 3MV8D 4IBWA 4HIXH 5MP6H 4P23A 4DFIA 4XP4H 1DJZA 4XPBH 1IL1B 3V55A 1C7TA 4JGUA 1YMMD 5D7KE 3HHRB 1Q38A 2D3VA 2IIJA 3P4OA 1WAEA 4XXCC 1N6UA 1DSWA 2ZYRA 4FFVD 3S2CA 3GRBA 5CGBA 3WIIL 3OKEB 3TEZA 5A43C 2X4QA 4YHIB 1CFNB 4ONFL 2YEVB 1W8EA 3MNZA 3I56P 1PLCA 4N8VA 1K8IA 4X7DC 3DX8A 4B3EA 4PJ0E 1ACYH 1GS6X 3M07A 2Q3AA 2EDBA 4A7GF 1TYRA 3ZHFA 1BQHA 4Y1TA 2VZTA 4M7LL 2GJ6D 4Y2DB 3QDMD 1SQBE 4GO8A 2E74C 4P5KA 4JFEB 1OLLA 4WVRA 4L0YA 5LCVA 4LB8A 5KTEL 2WXIA 3FB8B 5AOLA 1ZLVH 5C6WH 4PTUA 4NQSA 5EZPA 3BMWA 1FP5A 4PGZA 2FHFA 4JY4A 1X5MA 2BS9A 1TXKA 2NY5C 4XMKL 2Z31D 3TLRA 5F6HJ 4FG6C 4ZUTA 1NMCC 1UEYA 1H8AA 1CFQB 1A2YA 4PGDA 5LNEA 4HIXL 2LE9A 1AZZC 5JUEH 4EZLA 1T0NA 5J12C 4CC4A 4FA7B 3CN0A 3HN8A 1Q0XH 1D2PA 2RJMA 4M7LT 4XXWC 1DE4B 3V5KB 2FX8H 4WQOA 4P2OD 1KFNA 2NDGA 2J21A 4JDTL 1DEEA 1KMIZ 4WTQA 2F0CA 4G2AA 1UGKA 5DJDB 3U4EB 5JHDA 4P5TD 1VFBB 4I9XA 3KJ6H 2GW5A 3S96A 3WUWB 3H6JA 2UWEE 4GFXA 3KDPB 1A64A 4PP1D 4Q8BA 5T1KD 3WNOA 4H2AA 1QFWL 3M1BB 5B1CA 5J6GA 1R6VA 3T1FA 4BZ2L 1U4EA 1JZDC 4ELME 5EU3A 5KLVG 4ICWA 1E8XA 4R9HA 1PG7W 3QEQA 1K4CB 1ACYL 4RZCB 5APQA 2XA8H 2XBTA 3RGVC 2NCEA 1NBVH 4BFIA 1HHKB 2CM5A 2MHAB 1NC4A 2JDIH 1RJLB 3QG6A 3IFPB 4LGRB 4LOEA 4QXUL 4ZAKC 2F1AA 1N7MH 2EZ0D 1OT1A 2IYPA 3D4YA 3MV9B 4GUPB 1FDLH 3W39A 4GG6F 1NTMG 5GISL 4CL7A 4KGJA 1WFNA 5DD5H 5DZ9A 3CFKB 3FTYA 3NSDA 5E8PA 1BSHA 4ERSL 4X9YA 2HODA 4HBCH 5AAWA 5BV7H 5I1HH 2UZIH 1EUTA 4GKLA 2VXQH 1QX1A 1HH9A 5AL8A 3TO2B 1AJ7H 1ETB1 4IMLA 4YXLL 4G6KL 4UIKH 1JZHA 4GXFA 3MHVA 4JDZB 2K1AA 3K8MA 3NH7L 5EIIA 4G8GA 1B4LA 2GCYB 4HHWA 4R0LB 3VI3F 1R8EA 3GLDA 3QUXC 2HUEA 1BYPA 5JNYA 2FX8L 3BIBX 5FA3B 3ZDYF 4P4KB 5E9AA 3L73D 3MX0A 2OMUB 5B7MA 35C8L 2V8LA 3BCCD 3ZTDC 3L74G 3O3DA 4BFNA 4QYAA 3FWNA 4HSAC 3FFCE 3KJ6L 3HC0B 1WV7T 1JZIA 4CBPA 3LJ3A 2IAMD 2DKMA 2V6HA 5F3HB 2VJ0A 2KDGA 3EG9B 2BOBB 1SQQJ 4XMZA 2TRHA 5HI5D 2AEFA 4W9DC 2COQA 1FHNA 3NJIA 5FECA 2VE6A 1RF1B 2I7SA 2RFXA 1HXMB 5KEZA 1ZVYA 4IMKC 3EFFA 4M5SA 4UQEA 1OB1A 3FF7A 4KROC 1CTNA 4XC3H 4HJJH 3OMNB 4Y7MA 3VXMA 1FIEA 3SE4A 2ROXA 4JO3L 3INOA 2V7HB 1SS1A 1MFAH 3QNXA 1FVEB 3B34A 1FNEA 2K9YA 3QHFH 2IYOA 3FZUC 5BVZA 4HC1H 1OP5K 4ANWA 3O9WD 5I1HL 4P9HL 2YARA 5IHLB 2A9BA 3II1A 1QRND 2P8LB 3FXDA 1ZGLB 1G84A 5L9DL 1MCNA 4PJXF 4HMEA 3GXUB 4FFWC 4LLMB 4QRRE 3O41A 3W0WD 5JW3H 3T0BA 5BOPA 2C9PA 2D31A 5HDRA 3RU8H 2Z1PA 2EKJA 1NDMB 3Q01A 3M7FB 1FI8C 2BVYA 4BH7B 3T2NH 3EH4B 3PP3H 5KSBB 4APQB 1CIDA 3X12A 3FL7A 4ZW8A 1JCKA 5DEFB 2VITA 2IV9A 3QSKB 2JI2A 5DJ0B 3TA3B 2BC4A 4MMXB 4UOJA 2DH3A 2FWSA 4XCFL 2Q5BA 1FO0B 2HTLC 3UH8A 4DP5X 3VRLE 4BQ8A 4JG1L 1VCAA 1OP4A 1PG7L 4DKAA 3ABMB 4NFDA 1ZGLM 3NGBC 3QQ9D 1AHWB 3WTUA 1YA5A 4ZG1A 3GSUA 4CVXA 3KYKL 4KO7A 5KKZC 1JXJA 2O4EA 3HE7B 4QHMA 3SCMD 4EN3D 1M1XA 4LL1A 1AGCB 2VZ1A 2ZWLT 3FQNB 1YY9C 4HJJL 3RB5A 1E40A 2WIIA 3HUJB 3ZZQA 4RMSA 5MHSD 1HL4A 1EAPB 2FH6A 3KBHE 3FT1A 4OF0A 4PB0H 2QGDA 2VABB 3AY4C 5KBMA 2LU3A 2YMXL 3V6OA 3ZPDA 3CVHA 2AV1B 4QJ3B 4DUXA 1TTRA 3CFNA 3IDGB 3FU5A 1NINA 3B9KB 4F27A 4EOWH 1I8IA 1SQQE 5DWUH 4Z3FA 1QATA 2O72A 2VDNB 3RIAF 4APXA 3SDYH 4JPSA 4RZKA 2V0AA 4O2EB 4C56B 4L3FA 3UMNA 1CJYA 4QD2E 5FWQA 5SWSB 2MCG1 3MRCB 3KPSD 3VD1A 2FD6H 1U8NA 1MUJA 2A99A 1DZ0A 1V55B 2MTAA 2H2SD 3HD7B 1X5ZA 3REVB 2QV2A 3TBSA 3MIWA 1KBGH 3M6DA 3T2NL 2VKXA 1NCDH 1WS7A 5HPMA 4X6CF 4LPXA 3I74A 1LP1B 3FSAA 5E5LA 2Y5TA 1KG0A 3I6KA 1USDA 5FK9A 4PJHA 4BZYA 3BIKA 2G3AA 5E0FA 1I4FA 4K9EC 3W11D 1ZVSA 3I6GB 2OXGA 2UY7B 3NABL 3VW3H 1A9BA 3JSVC 5F9JA 1HKLH 4HIQA 4PJGF 3LXBA 1L9RA 3TO4D 1RIHL 1Y6KR 1YHPA 1TO4A 4NJAH 2N9BA 1R3KB 2WK2A 4XVSH 1TZ8A 2WN2A 3NZ8B 1WUZA 4HPYL 4PV8A 5KVDH 3RQ3A 3RVTD 5E51A 1KILE 2H3NB 3RZCD 1FIGL 1MCKA 2UXFA 3QEUB 2P49B 1FYTD 1QLEL 1ZOXA 2R9HD 1OZTG 4PB0L 2FBWC 4JKPL 1J05A 5LQBH 3FRPB 4Y16A 4B7LA 2PCFB 4ZO8A 4PJ7F 2EP6A 2ZOWA 2LVCA 4A2EA 2N4IA 2W90A 2YAFA 4EI6B 3SDYL 2AQRA 2Q8BH 2OMWB 1MQKH 5TF0A 2XTJD 1H6TA 1MF2H 2ESVD 4MNGB 2XN9D 1UH4A 3WEAA 1AZCA 2VXVL 5B21A 5J1SC 3U7WH 3AREA 4H88L 5DD6B 3VFTA 1X79B 2IDUA 4BIKA 1VZIA 1ES0B 1FORH 3NCWA 5E95B 4LQ1A 1CURA 1WAAE 5TJHA 2CU9A 3G6JE 4WY4A 3Q5RA 4JAMA 4JDEA 4QHUB 1M1JC 5LXVA 2VQ1B 3CFQA 3IFLL 3QIUC 5F21B 2G2RA 5B38A 1IFGA 3IGKA 3NIDF 3QUZC 5EUOF 4QYOA 3IMVA 5FHBL 3WIHL 2W6BA 4MMYA 3BWUC 4XPGH 1JBJA 3OTTA 5DDHA 4ODSH 3GSOA 1AC0A 4Y99B 2Q76B 3O3UN 3OLEA 2QFRA 5M7QA 2N7SA 3KLAA 3PGCA 3DECA 1QGKB 4F15C 4TUOB 4XVSL 3VGHA 3ARGD 4WUKH 3GSVA 3SKJL 3G6AA 3QFJE 2WOBA 3A7OA 1WFOA 5FOJA 2WLNA 4NNPL 3BH4A 2V17H 2UY6B 3NA4A 3H2WA 5BOZG 5T5FL 1N7SB 5MEOA 5ABZA 3AU1B 1D7FA 1IIKA 2AKRB 4XP5H 4LPYA 4OZIB 2KI7B 3EO0A 3Q2CA 2EE2A 4IRJD 4V2CB 3RGBA 1F1DA 4JDVA 2VLRB 2NYYD 4YLQT 5GRVL 2GTWA 3A6BH 3W1ZA 1LDSA 5HDBE 2B5IB 4ZMDA 4ZODA 2NX5D 3G08B 1MPAH 2Q87A 1T20B 3IE9A 3DKHA 3OQ3B 4NUGL 2MRYA 1BVLB 4PEEA 1EHXA 3QRLA 3EJPA 4UIMA 1EFXB 5D2NC 1OXYA 4MCZA 1PIGA 3PHSA 4Z5RA 4K2UL 4JFDE 4AGOA 2IANA 4DN3H 5IW6B 5CEZE 3NK3A 4L4TB 5I23A 2BVQB 4L76A 5K93A 5IEHB 4DSYA 1RF0A 1PFOA 3D52A 4IKJA 4P46D 1K4DB 3KWUA 1HHIA 4AIEA 5KS9B 4Y5VB 1FOSE 3ARBD 5HHME 2NDFA 1O6TA 5F7NC 2Q6WA 3BSGA 4PBDA 4PJCF 5CWSB 5JOPE 4UTAA 4CW1A 3TURA 1A7QL 4O2FA 4J4PD 1ND0A 4NO2B 3IE4A 1D9KD 1P5UA 1JD9A 2GUOB 4N2LA 1BX2A 1QSFB 4QHPA 3W2DL 4UNTA 1QBLH 1XB8A 3VTPC 3JWNE 4NKOA 5I76A 4GAJL 4LSRL 3ZDZF 3IN0A 2IV8A 5I73B 3FS9A 3BQUC 4OZGE 1GZHC 2A6IA 3IMWA 3MLTB 3WTWA 3GXTA 2R2EA 5CCKL 1NAMB 1GDTA 1OTSD 2CLZA 3PWJA 4XNUH 5DT1H 2EDJA 4OIIH 3VM5A 5IJDC 4CMHB 3M1CA 4DP9X 1AVOA 2DICA 5I2IB 5HDLA 2ED8A 2E9GA 1OE1A 2IDCA 4KK6C 4N87A 4HIJB 5JIMA 3GIZL 2X2IA 1ZR4A 2BSSB 1LEGB 3CVDA 3UADA 3U46B 4PRPE 1IBFA 2ZP9A 2XPGA 5GRYA 3B2UD 3DSNB 3D71A 1MJ8H 2HG5B 3RVXC 3MBEB 3WTYA 3IXAA 1CZ8H 3RURA 1KB9I 1BZOA 3ZRSA 4ADGA 2YIUB 4AKQA 1EAQA 3RL0B 5KSVB 2OZNA 3GRWH 1SM3L 3K6IA 3APFA 2YUXA 3MOBH 4MNHA 3UBXI 5FYKU 2YOAA 4IJ3B 3UBXB 1ZT7B 3WMQA 1S5LX 4H0IA 2DEYX 3FJTA 3BX7C 4MLSA 3SGDI 1CD9B 4WUUA 3FCSA 5F9WB 1XO8A 4POUB 3NCYP 4XNMB 2A06E 1JCDA 1CL7H 3L7FA 2NY0D 4Z77B 4GQQA 3RPIB 2DQEH 5E00B 1QTYT 3GW6A 4OGQB 3W9EA 3KPRE 4K8RC 5F6IC 2ATKB 2L0DA 4X9IA 2WQAA 1VSCA 4HKZH 4NUJA 4RJTA 1IBDA 4NJ9L 3QULB 2JIXB 5JYLA 4YHLH 2JH2A 3BIAX 4WFGE 2JWYA 1KV4A 1JRHI 4RRPA 3UZEC 4WJ5B 5ISZD 3VFSB 4GI6A 3TVMA 1BM3L 1CGSH 2WO2B 1FBMA 2HT4C 3VXTA 2AQTA 3VRIB 1DQLH 3ULUL 1J1PL 5C07E 1C7SA 4ENZA 3E1IA 1NWQA 4ZTPL 3X17A 1YAIA 3K4AA 5HHQB 1R24B 4J8QA 4XT1C 4Z3HA 1DLFH 1KYOD 1A7OL 2X7LB 4YEEA 5DLMH 4PD4I 3KGUA 2CKBH 4XNYL 1IQWH 1NGPL 2AXGB 2QGCA 1NKRA 3BN9D 3EH5B 1FBIH 3TC9A 5LHDA 1F6LL 1RZJL 2NY1D 2H26A 1RU9H 3QS3A 4KI5C 3WY3A 3HI1A 1ZHLB 1Z9MA 4Y4FB 3ROLA 2BZ7A 4H5SB 1UFUA 4WDIA 2KLUA 3CXFA 3H32A 2GAZA 1U8KB 4KTEL 3I6LD 3CN4A 5EU6B 3GRWL 4LDEB 4CNIB 4P4RA 5F1IA 4PJAB 2VT0A 1TIUA 3VGEA 4WU5B 1R5IB 5DFVC 3AECC 2YKOA 4Q97A 1Q90A 1IGTB 3LD8C 1S9XB 1L0LG 2Z4EA 2ERJB 3T8MA 4LCWE 1DBJH 4NKMB 2WXKA 3DJ9A 1I8LA 3D39A 3WS3B 3FHAA 4J3VA 4KK9D 5SX4H 3RA7L 2BFVH 2Y9RT 1PZ5B 3RPKA 3MROA 4TNGA 5AWNL 3AE7C 1AGDA 2FJGB 3VWKD 1WMKA 2BNQB 2IPUK 1WA0X 2VH5H 4TXVB 5C92A 4UMGA 4HPHA 4MNQA 1WD9A 3W9DB 4JHUA 1JZ5A 5C0CA 2QGBA 5C08A 2WIMA 3S36L 2GIYA 5IT2L 1BIIA 2FUQA 3H9ZA 4ODXB 4M62L 3U82B 2C9AA 1KB5H 5CLWA 4Q9RH 2J8OA 3ULVH 1CLZH 1DLFL 1PSKL 2B59B 1W72H 3N1QC 1HDMB 4KX9A 1GW0A 2CKBL 3F7QA 4WENB 1X7QA 2Z1KA 4ANKA 3FX0A 4M8QB 4MTMA 1NUFA 1CICD 1P0SE 1OF2B 4PJIA 1JNHB 1QLFA 1UZ6F 1YDPB 2VSMB 3T8XA 1MKMA 1UASA 3ZSSA 1PAMA 1H9VA 3FU6A 4Y2DA 3LEXA 4YBQD 1WG3A 3CDYA 4JFEA 5GJTH 3STBA 4L8SC 2YUZA 1FC2D 4OBSA 1NA8A 4U05A 1KYOK 5JIIA 1EDLA 3PFUA 4UV7H 3WEXA 1Q72H 2JKJA 3RUGF 3B5GA 4PP2B 2DYPA 2FWLB 4KZDH 3WLWD 3II2A 4IS6A 1ZTXE 3KVQA 2LABA 2JKXA 4FTVE 3EYQC 5C0AE 2Y7SA 2DY2A 1EVUA 4JG9A 4AYDC 3MCLL 4XNXL 3L4TA 3OKKA 2VH5L 1PDKA 1AZNA 1KBBA 1SQ2N 43C9A 1HBWA 1DE4A 1SHMA 2IOMA 3V5KA 1BJ1J 5AVRB 3C5ZA 2ZF8A 3TZVD 2XKSA 3VGAB 5ITFA 1N59B 4L2LA 3JT2A 3MUY1 1TTCA 4X4YA 5HI4D 3D0AA 1ZVHA 1VFBA 5A40E 2E76C 3WUWA 2X09A 4FXGC 2KL6A 2HH0L 1CLZL 1MHEB 2GI0A 5E6IC 3UIZA 3BESR 3M1BA 3QYMA 2CDFA 4OSUL 3SYAA 3TN0D 5MENA 1I1FB 2OQJA 3GM0A 4H0LD 1RQUA 1K4CA 3PXLA 2J8HA 4RZCA 3LDBC 4HKXA 3ABKB 1DJIA 2DQCH 1OGAA 3FB6A 3VH8A 2WHVA 1RJLA 3LKSB 1FS0E 1CK0L 1WBXB 1S6NA 2Q2EB 4BWWA 5A7BA 3GHGC 5TK4A 3MV9A 4GUPA 1CDCA 4OH2A 4Z1MH 3GHBL 5B4MD 3X1GA 1XBRA 1SJEA 4FZ8H 2GSMB 4OM1H 1CGYA 3OGOE 5K5YA 1J1XH 2XXCB 2GTZB 1KNOB 4AIZB 5B3JE 2HFED 1WT5A 3LKNA 2DJSA 3FO9A 4KZDL 1PLAA 4L3EE 5B1AB 5G55A 1UWEH 3DLQR 2GJRA 3TO2A 1JNNH 5APXA 4KVPA 2CSPA 2ADIA 1VQLP 4LKCB 4PJFF 4MAYD 5GGTL 3ZE2E 2GCYA 4DEWA 4K94H 1FNFA 4QO1A 3T3PB 3VSVA 5MEQB 3BO8B 4MJIB 3QYCA 5K5GB 4TSAH 2P5WB 3EDDA 4KUZH 1MJUL 2IG2L 1MFNA 3O2VL 3S34H 3BAEH 3IRCA 3D34A 4HWBL 4PRAB 3D25B 3TF5A 1HHHB 1KJ2H 3EJRA 3QHZL 3MRMA 4J6RL 5H4ZA 2ZAHA 3HAEA 1KILC 4G1MB 1B0GA 1Y07A 4GRLA 4RMQA 4LP4A 2BOBA 3D2UB 1CLYL 1FL3A 2DI9A 2WWOA 4DN4L 2FDBP 3RFZC 1RF1A 1JPSH 1HXMA 3NJXA 3GF8A 4K3GA 4ONHA 5ALBL 5IW3A 3WMSA 2ZAEB 2AFNA 3IDMA 4MA7H 2DQFB 3UXFA 2QJKB 3LS5H 2C1PA 3AY2A 4ZD3L 1I3RB 1Y1UA 2YKQA 4IOFD 1UFGA 2WWMD 3ZQ9A 5T3XD 3OKNB 5DJXB 1FVEA 5IBUB 4NQQA 2ZE0A 4OM1L 2MMXA 3JVGA 3NRQA 5I0YA 3VXNB 1IC4L 3S35X 3UTZB 2J1WA 4WY4D 1RZFH 5CGYD 3ARYA 1ZGLA 1LHZA 4Y1AA 4P3DB 1AQKL 3O4OC 5JPMB 3CZFA 1LTBC 5KYYA 2GHWB 4HGMA 3ENEA 4OCNC 1EX0A 4AE1A 3BDXA 2MJZA 4TQ8A 3P30H 4F7MA 3QNYB 5A6LA 3EYSL 2BIQA 4D94A 5J9PB 1LGHB 4MVBD 1NSNH 4XI5C 1GGYA 1M1SA 4IW4C 5KSBA 2EUZA 3KPMA 5DR5L 4TVPD 3T8VA 1USZA 2JVUA 4TYUA 5I30H 3GJFA 5AW9B 2KYVA 5E4EC 3KPTA 2ATPB 3CVIH 4MMXA 4LNRA 4UQBA 1FO0A 1BGYJ 2PWFA 3DOIA 1VENA 3U4BL 1T3JA 1EJ8A 3WGVB 3B9DA 1QR4A 4M56A 2GC7C 4GG8B 4NQED 1AHWA 4N2CA 3IETB 2ZXXA 3S5LG 4F5CE 5LBSH 1NKOA 4XC1H 5AYUH 1SLVA 2KZKA 4M61A 2K3HA 1OB0A 2NZ1A 4IIQB 1I8KA 2RMZA 1XHHA 3IRZA 2O61B 5KJ7D 2NNAB 1BE3J 2O01J 3V4WA 1SDDA 4YSAA 1Z9SB 1EAPA 4C7NA 1OPGH 3P8CE 1E30A 4EXKA 4N2AA 4AQAA 1EFQA 1MLCA 1MCOH 4WWKB 1MHHB 4JY6B 1E5UI 3WAJA 1XH3B 5ERWB 2OX5A 4NC2B 5HYSB 4KHTL 4A6YB 1SFCD 4O2EA 1IKOP 1FC1A 4UB0H 5T3ZL 1IM3D 2AK4B 1U8IA 3MRCA 4KTYA 1RH8A 2OYIC 1S9WB 1HQ4A 3REVA 3U1SL 3SDDB 3ETBF 3PDOA 1NSNL 2WO4A 1IAKB 1RZKC 1KEGL 1YTZI 1LP1A 4HUCA 1ZXGA 2FB4H 2KYIA 3MJ8A 4MSWA 4CVWA 2ADYA 4PJEA 1KJMA 3EF7A 4V1DB 1OSEA 3PCYA 3VFVB 4EPSA 1CIUA 2VO5A 3JUZA 3I6GA 4XCYA 1VLXA 2B1AH 3IVKA 3ZQXA 1JGEB 4JG0H 3JWNC 4OT1H 1XMEB 2A6KB 3DSFL 4Z7NB 4KXZI 5I75B 5IB4B 3AEEC 4J3OH 1ZN5A 5BQDA 4MCNA 2FJFB 2XZZA 1OT4A 3NJNA 1NFDE 1E2ZA 3BWAA 5D1ZD 3D3VB 1VPOH 4AJ0A 4CSSA 2H2PD 2J55A 2FFDC 4JFXB 1V54B 3G9AB 5D7JD 4MS8C 4MX7A 4PIRF 2VLJD 4QRPA 4OCXH 3BEVB 5E1AA 1N70A 2QSTA 3I9AA 1CXFA 1BGYE 2XWBA 2XZAL 4M93B 1JTHB 1RULH 2PCFA 5GTHE 3S98A 4S1QL 1W2KT 4LHUG 3BYYA 1U57A 4I2LC 3WJJC 1DTUA 1XGPA 4NQCE 5KLIC 3OA7A 4FGMA 5BS0A 1L0ND 4WUUD 3KLLA 1X5LA 3SGKA 3B2VH 1IFHH 1GGCL 2AXFB 3MGNA 2HKFH 1BE3E 1MDTA 4MQXD 4BGLA 3LOWA 2WNGA 1ZANH 5F7FA 2WVTA 1FLRH 1ES0A 3L9RB 3HZYA 4OQTL 4MBRA 4Z95H 2NPSC 2F54D 3EO1B 3RHWK 1ZV2A 3MV8E 3BKJH 4AZ8B 3AITA 4M02A 3ESMA 1ILSA 4FEIA 4AYSA 4NN5C 4HV8B 4Z7UA 4BH8B 4ZMNA 3WFEH 3CSPA 5IMLA 4BZ1L 1U3HD 1QFUH 5IOPB 3FHEA 5EZJA 1YMME 1I1AB 1UCBL 4JG0L 4LEEA 4OT1L 4TRPH 4DCQB 2YXWA 2HPCA 2BP8A 3L7EB 4AM0A 1ZV9A 2F61A 3WU2E 1UJ3B 3QDJE 3T0EA 4YQXH 1NCBL 2Y0DA 2WPSA 3CHXA 3GSNB 4PJ9C 4U2ZA 3LVEA 5K33A 5E99H 4BQ6A 2DPKA 4FQQB 3QE5A 3IYLW 2E3VA 3K80A 1ASQA 3QIWB 2FE0A 4HXAL 3HNTH 1ECZA 2JCWA 3GXPA 5ECJE 2OQQA 4OZIA 1SQMA 4XOBA 1MAMH 5AZ2H 2XVGA 5E8DH 1RULL 5EUKA 2D7TH 2R1WB 2A9CA 2OJZL 2ZYHA 3WS6A 3I50H 2AI0H 2AP2A 2E0PA 1AYRA 3CH1B 1BFOB 2GJ6E 4HAFA 1EDQA 4QHNB 4HF5L 3T4AB 1C12B 1HXYA 2QADC 4XH2B 4ABQA 1T20A 3DMMD 1H3GA 5DUBA 3H1LJ 1BVLA 3L73J 2H1PH 1ZAGA 3MO1A 3QIBC 3H4HA 3BCCJ 1FZJB 4I2XB 1PCSA 5I17B 4FTDA 1M7IA 1I7RB 4L2YA 1T22A 3OAWA 4L4TA 3AAZB 5IEHA 2E56A 4Q89A 4QHKI 2V4HA 2J73A 3AUWB 2QPSA 2HJKB 3OKMB 1L4AA 2A38A 5KS9A 5SWZA 3MLSL 1E4WH 3WFEL 1D5ZB 1UH2A 4L37A 1L0NK 5CZRA 5A2JH 2H8PA 5F7EL 3QCUH 2QG4A 2MKVA 2G2PA 4ZO9A 2XWRA 2Y6SC 4ONGH 3J7HA 2W9LA 5LBGA 1KN4L 4I9WD 1MCPH 1OL0A 4XN1A 5ES4B 1DCLA 2HJLB 5IFAL 1EDHA 2CHNA 3ZYOA 2DYRB 3VFPB 1TDQA 3N44F 2XNDH 3D6YA 3VFRA 1NKNA 2ZF9A 1H0TA 2QSVA 2BSEA 3PIQB 3UAJD 4KU1A 1IT9H 1W9XA 1F58H 4PJHF 4ZJ9A 2BSCA 4Y2DD 1HL5A 3RK2D 4JFED 4LGSB 2YBGA 3HN5A 2BSSA 3BD3A 2FT8A 1HJBA 3MUGB 4S2SB 5KG9B 1B4JH 3U46A 1BPLB 5CEXB 3PYCA 4WV1C 3NZSA 5IQ9A 2PCXA 2Y72A 4PVMA 1MFDH 1A9EA 4XN2A 4OCSL 2I8DA 5D9SA 1U91B 4XA4A 3HFMH 4ZPVA 3D85B 2GK2A 5DI8B 2JSFA 2NQCA 2E7LC 3TXAA 4IOSA 4MFHA 5AL0A 1P4IL 3QB7C 3V5BA 5FFGA 3TIDA 3DX9A 5BPPA 4CU6A 3MLWL 4D9QD 2IZ0A 2R4RH 4AGMA 3FQUA 2CMRL 4OFYA 4CSZA 5TH2A 4ZMAT 2IGLA 3A5VA 4TKWA 3ZDXF 4AEIL 1S78D 2ZOKA 4LVHC 4Z77A 2ZNWA 4HIHB 3H1LE 4QRQA 4A2GA 3L73E 3BI9X 2C7FA 4KRMB 3ZR5A 1W0VB 2CJ3A 4KK5C 3BCCE 4XHJD 3ZMNA 4U6HA 4UQ9A 1JCCA 3FCUB 1GZLA 2R15A 5FO8A 2JIXA 3GZQA 3NCXA 3FGAD 3D50A 2RR3A 1YIJP 3BJLA 1UURA 1PQZB 4Z7VE 2Y69B 1S5HB 4WJ5A 3GBDA 1A6WH 4YHPB 3VFSA 3B8SA 4PSPA 2Z92A 5I1GH 3DVIA 1QPKA 3FTXA 5GPRA 5EZIH 3VFMA 1GPOH 3CZKA 3MCKA 2KLVA 4QNPE 4WI8A 2DF3A 1F58L 2QDWA 1R24A 5HHNB 4A66A 3K5RA 3WO4C 1SVFA 5CJOL 4X5WA 3WUVA 4Y4HA 3MV9D 5FYKL 5AVSB 1VQ4P 2WZ0A 1OAXL 1I7ZA 2VLKD 4GKSA 3MREA 3U0TA 2X4UA 1PFIA 3FH8A 4LSVH 2LU7A 1T6WA 3NOIA 1AMYA 3CZNA 3GDBA 3H3PH 4NFBA 3STZB 4JO1H 3E8VA 3PAZA 3Q8EA