5AVUB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 7.0 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avuB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avuB02
3O8ZA 4C7NA 3TNUB 2WWWA 5APVA 3B8EB 2W6AA 5APWA 5APXA 5AW4B 5AVYB 2W27A 2H7HA 1A02J 1OWAA 2QM7A 5APSA 2R5BA 1G2CB 2WT7B 1J2JB 5AVTB 5AW3B 2WPRA 1SP4A 3VMXA 5AW2B 2C9NY 2BASA 3HTKA 5AW1B 1MUUA 3NXSA 3V5BA 1CSBA 2QM8A 1FOSF 2KP8A 2Q7CA 4GKGA 5APQA 1T2KD 1HWTC 3NTNA 3P8MC 5AVUB 5AW6B 2E42A 5AVVB 1JUNA 1NAFA 3UIAA 4RETB 3HE4A 2P67A 4KHXA 2XZRA 5AVZB 3SWFA 3L35A 3P32A 2R32A 1MV8A 3LIEA 1GTWA 3NMDA 2WTYA 3L37A 1GK4A 3LIDA 1HJBA 4EOTA 1CI6B 2YNYA 3WGUB 5AVXB 2E43A 3VTPC 3HE5A 5AVRB 5AW5B 2XV5A 5AW8B 4AUWA 4XE5B 1GU4A 1HUCA 5APYA 3M91A 2YO3A 5AW7B 2R5DA 4GT1A 4HYTB 3M0AA 3TYYA 3V4QA 4JYBA 2WPQA 1DH3A 3M06A 2WT7A 3A7OA 5AVWB 1GD2E 1KQLA 3A5TA 2Z5IA 1SLQA 1A02F 4LC1A 4I6MC 1YYCA 3V4WA 4I2LC 4DZOA 1S9KD 1X8YA 4RESB 4C7NB 3IR9A 3M9BA 1HBWA 5AW0B 3L36A 3T97A 3A2AA 2XU6A 2Q3IA 2WPSA 3OAKA 3TNUA 2P2UA 2YO2A 1IO4A 2Q5UA 3I5CA 3TK1A 2VRSA 1GU5A 3P7KA 3VMYA 5CMZA 5APTA 4AQRD 3WGVB 1CI6A 2JJLA 1H88A 1T2KC 1H8AA 5AVSB 4AYCA 1GK6A 1FOSE 5AVQB 5APUA 1JNMA 5AW9B 2ZXEB 3VN0A 3HE4B 3A3YB 3MD0A 4B86A 1FAVA 3MGNA 3KQGA 1CZQA 1GZLA 3M9HA 2P7JA 4M3LA 1MFZA 3M0DA 4C46A 3VMZA 2R3CA 2C9LY 2Z5HA 3KDPB 3NFQA 1H89A 2IPPA 3VYIA 2N9BA 1S9KE 2ZFCA 3HE5B 1OXZA 1NWQA 4JYCA
chains in the Genus database with same CATH superfamily
2D3VA 1TZIA 4M43L 2V37A 5APVA 3BHBB 1U8JA 2WAQA 2MOQA 4WHTA 4FS0A 4UNIA 3U2JA 2XN9A 3HI1A 4WY4D 3RL0g 1MQ8A 3DV6A 4DUWA 5HY9B 1G7HA 4MJ2A 1AGEB 1D5XB 2XRAH 3CDZB 2WSDA 4N6QA 4XBGB 4HD5A 4PJIF 1CICD 1M2VB 2VAAB 1R9FA 3GNML 3Q48A 1KYOE 2JP3A 1P7BA 5EULV 1K5NA 2VXSL 3W5MA 5ABAA 1H6EA 3U1PA 5TDOB 3ILQC 3T9WA 3U6XS 1Q9KB 5A1AA 3E8UL 1E5ZA 3C09B 3P30H 3QO1B 5EIIB 1CFQA 1ONQB 2R2EA 4LEXH 3P11H 3WE1A 1DVYA 2VXTL 1PS3A 1RZGA 2HRLA 2L7UA 4Q7DA 1PGJA 1EAPA 5GGTA 3MRDB 2EDTA 1BF8A 4FG0A 4APXB 3VFOA 3UAJA 3JV0A 1AIZA 3ZL2A 4JB9H 2YSSA 1KPVB 4JRYB 3ZDYB 1HJBA 4AVIA 1BCIA 2A6IA 1TEGA 2E27L 4JDVA 4PW3A 5EOCH 5JPNB 2GUOA 4Q0XL 3UPRB 4NO3B 4XNXL 3QDME 3QEQB 3PV6A 1P69B 3T8XB 3PQYA 4LESA 4K5MA 1WP6A 3CUPB 3L3OC 2VL5A 3ARXA 3H1JE 3BD5A 2QELA 2VSMB 2IFFL 4P49A 1ZP0C 4UTCA 43CAB 3ULUD 3P9WB 1VKXA 4Y4HB 5EV7A 1YJDH 3MV7B 2P58A 3VH8B 3FBKA 4TTDD 4HK0A 1WGOA 2RKLA 1FYHB 1I1AC 3V4WA 1HVXA 2A83B 2BOCA 2DD8H 3LAFA 4PV9B 5DD5H 3ARQA 5HHQB 4D9LH 5FCUL 1HBWA 4XP9H 5MERB 3QFDB 1I1YA 5SX5K 2YD0A 1S8DA 1T2QH 4ZUVA 2HAZA 1MFBH 2E9WA 3OMAB 1CF8L 5CN1A 5E8OA 5BRZB 3TEWA 4KK5C 4WNQA 4CU7A 1AS8A 1KF9B 3MLRH 1LD9B 2DKUA 2V9RA 3BP7A 3EWKA 5C09D 1CI6A 3KS0H 2E5YA 3NVQA 4JFFA 2BCCD 1NHLA 2ZJSE 2VDKL 5KS9A 3TVMB 1A1NB 4NS0A 3BDXA 1GXEA 2X88A 3CFJA 1JNMA 2AQTA 5CEXB 3MD0A 1BJ1H 2XNDH 1OGTB 3VXTB 1Q82Q 1JCDA 2OXHB 3MRIA 5JA8B 4FA7B 1NC4B 2C7UB 5KSUB 1HXMA 3VP8A 5I24A 2VXVL 1T1ZB 5AG9A 4YHIA 1FZJB 5B3NA 1WSST 1I8AA 3GINA 1EO8L 2APSA 4K94H 3EAKA 3DRQA 1LTIC 2HT3C 2Y69B 2XVBA 5T3ZL 3OA7A 2K9JB 4UV7H 2CUMA 3DOIA 2D9CA 2OGUA 3SBRA 4PS8A 3U7YH 5KUKA 4NUQA 1E28A 2R9HC 4WWKB 3MU3A 2WIIA 3GMPA 5B21A 4B96A 1JHTB 4FYTA 5D1QE 3AXHA 3FT4A 5FO8A 1KJMB 4ZAKC 3CPWO 5FV1L 2BCCG 4X0KA 2YD8A 1T5WA 2JJVA 1SDYA 4ZUSB 2NYZA 4JF7A 4UQIM 3C6SB 2W83C 1JGLH 1RIVL 5IMOB 1X6NA 3L9RA 2I60H 5F8QC 4GKGA 2H32B 2QKIA 2XXMB 5HGGS 4TUJA 4NM8L 1WUNT 3FTGA 1C9SA 5IB1A 4G42A 3VXRE 5EORH 3L35A 1J1EC 2K1MA 2YBRB 4KUZL 3VVWA 2J8HA 2R0LL 3MRHB 1BE3E 3D1MC 1BXUA 1MRDL 2YMXL 2C9UA 3FCSB 1Q1JL 4GQZA 2VDOH 1W72L 1R8EA 5F0JB 1LL1A 2D7TL 3QO0A 3KYAA 3UTQB 4LP4A 5KZCD 2Y0EA 4GP8B 4RRPG 5FECB 5I8OL 1IAOA 3D2UD 4L0PB 1DFBL 3JZYA 3L54A 4E9WA 1NKZB 2X3CA 1XH3A 3MBED 3AREB 5IQ9A 1GMEA 1SYSA 1MF2H 1UHVA 4LLUA 4X9HA 4JVUA 2E9JA 1Y9BA 2VDMB 3QARA 3WHXB 5JIPA 3MX0A 3D0LA 3GM8A 3ATAA 1S5LX 3EJPA 3GMNB 4FXLA 2J2ZB 5CFHA 5C7XH 2EABA 3S2AA 1AQDA 1FNAA 5FDWA 2KLUA 3MUGB 3RJOA 1KLGB 1IM9B 5F7NC 1DL7L 1ED3B 1F8TH 2AXHA 1R3HA 3V0VB 4NO2B 3AM8A 1UQSB 1V3MA 3L72D 1OOWA 2IBBA 3ABKB 2OL3B 3D69A 4EE2A 4PJIB 3PWNA 4XPGH 1SDAB 2WO4A 1ACYH 2EYRA 3WOVA 1O0VA 2FEEL 3BO8B 3PDOA 5AWNH 2GABA 4AEEA 2UY6B 1BWMA 3FFCB 3N0AA 3B7SA 3RL2B 4FNLL 1PD0A 3T65B 1X4YA 5IJBC 1G9HA 2WKLA 5L2KE 4HKJA 1C5DB 2HLFD 4X83A 3K4AA 3R1GL 5CBNA 2EDFA 3MOBL 3MRLB 2QTVA 4A2GA 1GW4A 2P80D 1RK1A 3P4MA 3EJQA 3IDIA 5E1GA 3CQFA 3OVUB 4HU8A 25C8H 1HEZA 3CZFA 1HESA 4YC2C 1JXGA 1NTZJ 1KLUB 1J05B 2D7MA 1NGZB 1PG7X 3NCFB 5LO7A 2R44A 3L72G 1OAYH 2AJXL 4CKQA 4YHYB 1OALA 1S9YB 3PPEA 4NRXA 3I3BA 4NAJA 1NWQA 4P4KA 4PTTA 1R75A 2AAAA 2BW4A 2OMVA 1J1XL 1CZ8L 2UYLB 4QRSA 4XMPH 2QHLA 2IPKB 3RFZC 2AK4D 5CUSH 2CE6A 4LCCB 5L0QB 3W2DH 4OH8B 4RMBA 1FBIL 2Q6WB 2OR9H 2FXMA 1YHQP 4AK2A 3C5JB 4G7YL 4AQ8A 4DZBA 3I9GL 4HC1A 1OT2A 3FRUA 4KZEL 1J5CA 1TTBA 4HGKC 2J5WA 1ZGLB 1X4XA 3G4SP 1ZDSA 3P0YL 5CNHA 4I0PC 1HDMB 3VFGL 2HX7A 1RF1C 4TUUA 1JBJA 5DWPA 1T5KA 4LIQH 1GAFH 4JKWA 5JHAA 2MOVA 4NQDB 5IJCC 4M5SA 4DF9A 5J3HD 1NDTA 2Z3FA 3HMXL 2YS4A 1KJVA 5DHMC 3IE9A 2AANA 3GSOA 4DW2H 4LAQH 2AC0A 4DP7X 2ZSVA 3RU8L 2N7SA 2FZ3B 5IVXB 3RGVA 1KTLB 2ZICA 4IW4C 2FGWL 4P2YA 2QQLH 32C2B 4NKOB 2TSAA 1G7JA 3NCJH 3IU3A 2ENJA 3IETA 3SSUA 5DVPA 5BOZG 5C39A 4Z78B 3U6XA 2YD3A 2VC2H 3K8KA 3MJ8B 4YZWA 3HKFA 4CC0A 5GRWA 3WXVH 4AM0Q 3A0OA 3P3YA 4V2CB 4ODXA 2N1TA 4GSQA 4GYBA 5H2BB 4J3VA 3LEYL 1S5HB 5TISH 2ZT9D 5DUJA 2R69H 3NACL 3T4AA 4BKTC 4FFYH 2BIPA 4HWNA 2M5AA 5AW0B 3RK2B 2EEBA 1CE6A 4OFQA 4F7MA 2F0CA 3Q5PA 1EZSA 1N3NA 2ENQA 4OCYH 4GP5B 3MREB 3T0VA 3P0VH 3T04D 2DEXX 1GMIA 1XGYH 4JCLA 2D0FA 4PY7A 4U1HA 4TVPL 5CGBA 3JVGA 1KYOD 1G87A 2BP0A 1U58B 2ODIA 2C3WA 1BXAA 2C1PA 4WTXA 4AKPA 3Q06A 1U8OA 4PVMA 4U6VH 5TQ0H 3ASWA 1ADQA 1E40A 1XZ0B 1A6ZA 3CX5D 4PRDB 5HDQL 1TU2A 3T3MB 3NIGE 2OMXA 1E30A 2Y36L 3OJDA 3WIAA 1UA6H 3LZFH 2IDTA 4YHZL 2CRZA 3U2IA 5HI5D 4P2OA 2KZWA 2X0WA 1N0XH 5HHPA 1WHOA 3S3PA 1H5BA 4NN7B 3SBWA 5C0FA 1SQPE 3C6LB 5ELIA 1N59A 4J28A 3BVUA 3V6OC 4NQXA 4XNZC 2H3NA 3FGAD 2NZ9C 2ILLA 3QDMD 2O4EA 2IOMA 3PGFL 2UZXA 5FUOL 4Y2DC 5I1GH 3HA0A 1FNGA 4HFUL 3TESA 4UDUA 3V10A 4X4YA 3H1JD 1JPTL 1J1PH 3JTSA 4NC1C 4NZRH 4BQBA 5I2IB 4A2DA 2D31A 1JB0J 1XMEB 3PIQB 1WA2X 4JMNA 1KGJA 2D3NA 3D06A 2YD4A 3PHSA 1XXFC 2WCGA 3IM1A 1DEEG 5CKGA 3UTSA 4U1SA 3GHBH 1U21A 1BYOA 5AVVB 1YJDC 5H35B 2KDGA 5CILL 1VF5C 4YXLH 3EJTA 2QJPB 4I88A 4RJTA 3NJNA 2FYUJ 5HJ3A 2ICWI 4BHUI 3IS1X 3O0RH 1KGYE 2JK5B 3GJEB 2F58L 4QHMA 4AM0B 2BY0A 3N44F 1VCBC 4I1NB 2X4PB 2BHZA 5I16A 2XZAH 5J57B 3TZVA 1D7DA 1BZ9B 1OGSA 4X6BA 2Q20A 3TWCH 3U1SH 4KXZH 1RZKL 1NPNA 3KAAA 1RE3C 3PHOB 5BS0E 3H1JG 2XZQL 2HJKA 3C6EA 2DBLL 4L3EB 3G6EP 5E00B 4BH8B 1J48A 4CMHB 3TYYA 4UV4H 3SYCA 3D5OF 1SHWA 2X53A 3QWNA 1KIQB 3F89A 3MXWL 4U0RB 5IJKC 1A1MB 4GRLA 4I48A 4F58L 2BMKB 2IWKA 4G6KH 2V7QJ 1AGFA 1X8YA 4ODHL 1NANI 1U9KA 3BVNA 4XNQB 1WZKA 5B38A 1KUMA 2Y5EA 5IR1B 1E7VA 3T97A 1DDTA 3A2AA 4AZ8A 5J4MA 3QAZC 3A6BH 2EDRA 1SQXE 2CRYA 5HDWA 1HHJA 4Z0XA 5D1QD 4HUMB 3DX4A 4K94C 4PY8J 4ZMTA 5GHWH 5CGYC 4AG4H 4XMVA 4YN3A 1SBSL 1E4WH 3RAJL 1EFXA 3LKPB 1T0NB 4K71B 4BH7B 2B77A 2O61B 1MCJA 4N8CH 4YSTA 2EXWC 4N3UA 2A38A 2WNKA 4Z7WA 5E8NA 1T2KC 4K2UL 3DXAA 4YWGL 1PZSA 4WO0A 5B7EA 1N6VA 4I8DA 2F19L 2NY2D 4NWUH 5D7SL 4CKVX 4IL6X 3SKNB 3HE4B 1F4YL 1EEYB 2VW4A 3VXRD 4IIZA 4ONHA 4ABVA 2IH8A 2KXPB 3M0DA 4JQ0D 1BE3D 2WLKA 3TJPA 7CGTA 1MFDH 1LK3L 1XIWA 4W81A 4R5VA 1NINA 1OD9A 2XKNB 4ETQB 1KN4L 3BCDA 3ATDA 2G2PA 1OE3A 4JYCA 3SWYA 5TJHA 5K5GB 3ULUF 3WG7B 3ZDXE 3CC5A 3U1CA 3RDTD 3VU2A 3K6SA 3FX0A 2CHXA 1MOEA 1QVOB 2QGCA 5DJ2B 3HD7B 2G60H 5J6GA 4PIRF 4NO0A 3BN9D 4WW2F 5C8JA 1JPGA 1R3JA 1OX3A 2UZYB 3JV6A 4N0UE 2NPLX 4OFPA 4UYQA 3T3PE 3L71E 4KFMA 3FQNB 1AI1L 4LVEA 2NT0A 4RX4D 3SPVB 1CURA 5ESAA 2QPUA 3Q2LA 4RMTA 3NRFA 2ZCHL 2R2HB 5AB9A 4RETB 1BE3G 3W5NA 2WN2A 4UTAL 1AY1L 3X2QB 4I1LA 1RF0A 1UKQA 3ZQ9A 2I24N 2OYKA 2D3LA 2KS0A 3HE6C 4W9HC 2ATPA 3QB7C 3D6YA 5L2KD 1R3LA 3REVA 3VNYA 1XGRB 5HTSA 3UL4A 4UU9B 3NRPA 1ZSHA 4OTXH 5FYKU 3D18B 3VWJA 2YMOA 4N90E 3BCCJ 2WV3A 2WMPB 3CX5I 4MAUH 4O58H 4U1KA 4PJFF 2OZ4L 1USZA 2C9RA 3OJVC 3FQUA 2CR6A 4K4KA 1KQLA 3O6FD 1HZKA 2I9LA 5KSVA 1EO5A 3ESMA 1BV8A 3DHUA 2GK2A 3QUMB 4QYOB 4S1DD 4XVUD 3W1ZA 3JSVC 5C08E 1DQVA 1UOLA 5DDHB 4AMWA 4BZ1A 1KFAH 4TS6A 5ESVB 1NTKE 2LHAA 5IVOA 2BOBB 4JN1H 4MZ2A 3H32B 2YQ2A 5IB3A 1A3RH 2Z64C 1X5HA 4ABUA 1ILSA 1PX3A 1CIUA 3HI5L 5DHXB 3HMWH 5DJYA 4U3CA 4P23D 3OZ9L 5KJ7E 3CVHB 4DGWC 5EFIA 2CUHA 4TYUA 4FG2A 3G08B 5BJTB 5C86A 4Z1MH 1AO7E 2FWUA 2F5BH 3GDCA 4OW6A 4D8PA 3LW5J 3A5VA 5D7HA 1Q0XL 2JJTA 2D2CC 4P4RB 3B2UD 1KCWA 3N44B 3EBGA 4H25A 3TNNB 5CLWA 4OIIH 5D5MA 4G59C 1IEBA 2F8VA 2FO4B 1HWHB 2EE3A 4AL8L 4CW1B 5CZKA 3F83A 5AUMA 4Z77A 3MP7B 2APTA 4ZYKA 4WI5A 4WY4B 1G2CB 2DQCL 1HI6B 2I1KA 4P5TC 1A7NH 4CJ1A 2W0FA 4YSPA 1CICB 5KJRL 5E5MA 4LF3B 3LQZA 4IRZL 1EV2E 4D0DA 4JFDE 5ENWA 4PJXE 2O72A 4EUPA 2YD2A 3M46A 5AAWA 2NSMA 3HFML 2VE6A 2FJFA 1NCNA 4ZFOB 2I7OA 5EEVA 4LCWE 4F2MA 2DIEA 1LXMA 1LP9E 1FC1A 2C4XA 3UTZA 5KTBA 1U8KA 2EIMB 5A2CA 3GMOB 5MENA 3L08A 2EXTA 4OAWB 1GR7A 4ODUB 2EUZA 1KGXA 2ZP8A 3RWHB 2RN0A 1CC3A 1JDAA 4W6YB 3X3GL 1TJIL 3QQ4B 4JG5A 1MHPL 3FCGA 2VRQA 3U4EB 2HKAA 1HINH 4NT6A 4C55A 3PL6C 4GO8A 3P73A 1LTJC 4EBQH 1GZPA 4L2LA 3G04B 1W0WA 2Q7AA 1U3ZA 2J55A 1V05A 1NBVL 3E3QC 3QZWB 4DEPC 2WD0A 3BCFA 5F1NB 4ABWA 2XPGA 1ND0B 1UWYA 3OLGA 2G9KA 1D6EB 4GKLA 4UT9A 2M3EA 1E50A 1M71B 1Y18A 3HAEA 5B22A 1UENA 2FSEA 5KSBB 3MHZA 3A5TA 1N26A 3ZE1E 3CXHH 4RWHA 2Y0SA 1T1XB 4WW1A 1QUPA 3MCKB 3R0NA 1KB9H 4FKKA 2F5AL 3BRDA 4HBQA 1AFVH 3JVGC 1QFPA 3MR9A 3QUYA 1TQTA 2R59A 3HNSL 3L2MA 4I3GA 2B1AL 1JRHI 4G80B 5H2FH 5J8OA 3CJJA 2GW5A 2K9FB 4JFYB 1XB6A 3VI4E 1FGNL 4TV3A 4WW2B 3KLSA 4PV8B 2J43A 4FNRA 3WUWG 4OGXL 1OP5H 2FLBT 4NQVB 1GJUA 3IMVA 3BFOA 5HDBF 2H26A 4DVBB 3F04A 4J4PC 4G1EB 3IFLH 4PG9B 2ED8A 5DMGC 2ZP9A 1JNHA 3K74B 5ALCL 1HINL 4GRWH 5C09B 5FA4A 4AEFA 2DJ4A 3UG3A 3ZHFA 5K69A 1M6OB 4DN4L 2QVIA 4PR5B 3FN3A 3DIDA 2J6EA 2MHAB 5CEZH 4LSVH 3O6MH 1UKSA 5J1AB 3WS3B 1RQ5A 3C5ZD 4PVLA 1X9QA 2O5YL 12E8H 3QNZB 1S78C 3CSYA 4S1QL 3DO7A 4DN3H 3F7YB 3ES6A 5JMOC 1SQPG 4PVBA 3PLNA 3BGFC 4G6JH 5DQDL 3KWWA 2IG2H 4U7SA 4OCXL 3PJNA 1IAMA 2ZUXA 1T89C 4AXWA 4EYYQ 2YD6A 1SZNA 2HKFH 3OM3B 3ZR6A 3NESA 1JTHA 1KD1Q 1K4CA 3TO4D 3FB6A 1QLEL 3RWDA 4L4JA 3S88H 2ZUUA 2NX5A 3U1QA 4JMXA 5LCVL 4R5TA 2EACA 1I8UA 3M88A 3QPXH 1JGEB 1DBBH 4IFFA 2IAMD 2UXFA 2Y6SD 5KYXB 4M1GH 2Q7YB 3TIDA 3WIFA 1U3NA 4WV1C 2Z4TA 2EYTA 3U9PH 5FYJH 4PH8A 4A2EA 4B3VA 1NFAA 2A0LD 3MYJB 3VP9A 3KPQB 3MOAL 4XNUH 4LEBA 3FONB 2OARA 1SQQK 1F4XH 2ZAGA 3ZYIA 4H13D 2EECA 1MJ7L 4OKDA 2AJVL 4MKTA 1E79H 2BZDA 2CIIA 2VMDA 2XHNA 3NJGA 4LSVL 4A6YA 4F7KA 2P7TB 1KGUA 1A9EB 3M7FB 1HT6A 3AQYA 3EG9B 3HZMA 4FNTA 4GW5A 4F7EB 3KPTA 5AAMC 3L81A 2FX8L 2JKSA 1WRGA 4X99A 2ENSA 4MQ7A 3TJEL 2D3JA 2A7BA 5KZCB 1EMTH 4IOIB 5TF1H 3D2UB 1CLZL 2J58A 2PO6A 4MYWB 3P9MB 4IBQA 3VQMA 3M91A 3ZTNL 4Z3FA 2EIEA 3Q2YA 2QPFA 2A2QT 3MBEB 3Q6GH 4WGWB 3M0AA 4ATTA 4P9ML 5GS1B 4JPIB 2PWGA 3K1DA 3N1MC 3P4NA 5KANG 4XCCH 2R1XA 4U6HA 5I1HH 5DQJB 1A3ZA 3ATBA 4WI8A 5IW1A 1KQSO 2V17L 3GUFA 3OAUL 2IYOA 3H1LJ 4OZ4B 4O02H 2E7LA 3HBQA 1SQXG 4W6WB 3FH7A 3EOAB 1RZJL 3GFUA 3A6OA 3QIBC 1TQBC 1AAJA 3A4EA 4FL4B 4M62L 4P5MA 1OB0A 5KLIB 4KK9C 3GBNL 2EQDA 3H6JA 1R3IL 3LXBA 1L0LJ 3BAEL 3EBIA 1YQVH 4NQEE 2O6DA 4FG6C 1BYNA 3EHBD 4GLRH 4Z7IA 5CZXC 4HIPA 4X8CA 3F6LA 2EDXA 3L71D 5F7HA 1URQA 1LYQA 5T5FA 2CHNA 1GK6A 2AF2A 1EEQA 2MJZA 1AC6A 3ABGA 5F89A 1D2PA 4ERSH 3GHGB 1NH6A 3INUL 1IFHH 4ZPVB 5GGSA 3UZVA 5CBAB 5I18H 3LZRA 3H9YA 3JWOL 3IRCA 4PGEB 3UP1A 4G6AD 3IFOB 4WI3A 1U8CA 1K8IA 5AOJA 4H0GA 4Q2ZB 3L7FA 2ORBL 2N9BA 2VLJA 3TGXA 3F7RA 4GAJL 1ZAGA 2HN7A 3HE5B 3JT0A 4PREA 2YPLA 4KNSA 2FCBA 3LEXB 1CR9L 2ODHA 3QC6X 1BZ7A 1TKWA 4OUUB 3CFQA 4PJ7E 3WMSA 3QWOB 4N90D 2AK4B 4KXDA 1CDJA 5TTRA 4ZFZA 3ZT5A 3EZ8A 4M1CC 5B5EE 2AJYL 4UOW1 3EDEA 3F3HA 2RMZA 4WGVB 2ZWKA 3TBTB 1XBDA 4F9PA 5FB8B 3L71G 1GYWA 2R4SH 3EW3B 5AW1B 2C9VA 4UBDD 1YQ3C 2CALA 3VWKA 3QWQB 2CQVA 4R4BA 1KJ2A 3RUGA 3VNZA 1IAIM 3GZPA 2HFED 1DQJA 1K72A 2A9ML 3KYQA 4GW1B 3SOBH 4J1UA 1B88A 1TJHH 4PJBA 5DRWB 4HH9A 3UBGA 3VXMA 3VRLF 3BVTA 5JHLL 3HC3H 2YN3A 5HDBB 4MB1A 1E2VA 2QHRH 1MZZA 4HBCL 5B1BB 1U30A 3JQOB 3GBEA 3JWDL 4BQ8A 3KJ4C 3CMAP 2QBWA 3LS4H 5HSFA 4ORGA 3NT0A 3SDAC 1BFOA 1NKOA 4UT7L 1BG1A 4XP6H 3H9HB 1BAFL 4EI2A 1S72P 2FL5A 5KJ7D 2ZKWA 2LU7A 3D25B 3WD5L 5CBEB 1JY3O 2A06D 2CHDA 3DA0A 4PRHE 1J10A 3Q6FA 4XE5B 1WFOA 3OF6A 4HGWB 2Q3EA 5DD0L 2VB5A 3MUY1 4QXUL 3EJZD 1ORSB 5FYKD 3FSVA 2CO7B 1HJ0A 3OB8A 3SKOB 3TDKA 5C2BL 2G75A 4YGAB 5K39B 1ZDQA 4PJAA 2AXTE 4LQFH 1QTYT 2LU5A 2X4RB 5C7ZA 1TMCB 2C3GA 4PSPA 4M5YH 4WU7A 5J0BA 2OTJP 3FT9A 3C75A 1JP5A 2ZT9B 2EC8A 2DN7A 3QIUC 4IMLA 1DYZA 1KGWA 4KKLC 3UIZA 2MSPA 1PBYA 3BDYL 2R1YA 1T66D 2UZPA 4BWUA 3KR3H 4BM7A 5A6IA 4QWWD 4IBLT 4NRYA 1IGFH 3BZEA 4MMZA 3UZQB 1PU0A 1ZGLP 4JDZB 3ALPA 3N0PB 5JOEA 3QEHB 2VDNH 2IADB 3QI9D 5BRPA 2ZX5A 2A06G 5TFSH 2VUYA 1NGWA 3DVIA 5DHYA 4PG2A 1UACH 5F3HA 4D3CH 2J71A 2P5WA 1WT5A 1ZT4B 5T1DH 5GRVK 4QT5A 2J4WL 4LCWD 2BK8A 4F7TA 2C3VA 4G1MA 3RTQC 5T3ZE 1FO0L 2J1ZA 2MPAH 4KZ0A 1QI4A 2ICWA 3R06A 5DJ8A 1YIJP 2L04A 5IHBA 4BV1A 4OF8A 1MY7A 1O6SB 1X9UA 2W65B 3NFSH 1VIWA 5IWLA 4YHNB 1WC7B 4WBAA 2ZWZA 3QJFA 3A0HE 2VUKA 3DROB 4L4VA 2IANA 3PABA 3RKPA 1G4MA 1WCQA 3ARTA 1E8ZA 2JKRM 3K71B 1FYTD 1S7TA 4L8SB 2ZYSA 1Z5LA 5JYMA 3QDMB 3MA9L 3NGBB 1ZLWH 1GHFL 1IBGL 1MCFA 4H8VA 2IXQA 3HOGA 4Q9RL 3VTAA 4C56A 3DOSB 4KQ4H 3CLWA 1E27B 3LRHA 4TUKL 4UQAA 5B4MD 5IEHA 2VDNL 4DPCX 1HHHB 1H8SA 2GPZA 4IRJC 4Z7UE 2K4AA 5CHNB 4HVBA 3PNWB 5DS8B 3D50A 3SY0A 2OQJA 5J12B 1HL9A 1VACA 7TAAA 1SQVK 3FUIA 3DUHA 4AIOA 4UTBL 1FS0E 4DO4A 1RZQA 4DCQB 4H8QA 3EYFA 3Q3GB 2EIZA 4JCWA 4A7GF 2W8ZA 1OTSD 4FLRA 1UD8A 2WTYA 1USEA 1PD1A 1TQCB 2OMUA 3Q5SA 4L2YA 4R7XA 1X5YA 2E6QA 3CFKA 2Z7YA 3KPSE 1SXNA 4EVNA 4ONGH 4UAOB 1QMUA 4TSCH 4OCNC 1XDTT 1PJ9A 4QRQB 2XACC 4UQ3A 3L5WB 3PWJB 3ZYOA 4UB0L 3OGOE 4JYBA 4C4UA 1QHQA 4XRCB 1PX4A 4AH2B 4G7VH 4JANB 1EUTA 3QIWC 1GMJA 1DJHA 4LPTA 1WBYA 2VIRA 3MLUL 2D73A 5GGRA 5IHWA 5AD0A 4Z9KB 4OIBA 3VU1A 1YEIH 3BVDB 5GPRA 2K8MA 3I9PA 4XN4A 2MEJB 1JK9B 1XGPB 1JHKL 1Z0NA 4IEFB 2N7BA 1FZOB 4GXVH 4M8QB 2ICEC 1U42A 3V0IA 3X13A 2IZ1A 3VXSA 3O3EA 2IYPA 1R24A 2PXYA 1IK9A 2FK9A 4LEOB 1OT4A 4YSEA 3BP6A 5D1QB 1VQ9P 2P43B 3HUSA 1N6UA 1FH5H 2X28A 2GJJA 5I1DA 1ZGLM 5C0BD 2ZG2A 4Q6YA 4JBZA 2ZAEB 4XPTL 4ZMLA 3NH7L 3UMNA 3V6ZB 1JXKA 4XCYA 1GW0A 1C5BH 3TFKC 3VN0A 5L4JA 4XCEA 1WEJH 2FWOA 2WOBA 2Z8WC 1EEUA 2NY2B 2Q2LA 5JORB 1HTLC 1J5OH 2Y5TB 1WA0X 3PWVB 4Y9GA 2JJWA 3VXRB 3GBML 3NSDA 3D09A 2Q6QA 3GLEA 1OIOA 2FO8A 3FU3A 2JR8A 5BPPA 3NIGF 3UGXA 5FFOA 2R29L 4C7NA 3ARGC 4CSPA 5IJDC 2H47C 4IU3A 2O93L 1V8HA 2W6AA 4LLWB 1QRKA 5AVYB 3GIZL 3V4VL 2ADIA 3B7RL 3MO1A 3BVHA 1HTYA 4N5UA 4WLCA 2HFGH 2WXIA 3UBHA 3PWLB 3RDTB 3FC8A 4M7JL 3I2CH 1NFIB 1CFTB 3GSQA 3M17A 1YN6B 2CBQA 2OYPA 2EH8L 3F7VB 4FDWA 2E75D 2FX9H 4KXAA 2IQAA 5IQNA 4J3BA 2Q86B 3VYOA 1HL4A 2QTEA 4GUPA 1IILE 1WCBB 3MHVA 1F3DJ 3OAYK 1AZBA 2J12B 3L3IB 3QRFM 2YOCA 3ZT7A 4MDIA 4L9LB 3O3BB 1HK6A 1DZBA 4MA1B 4K0OA 4H44C 5EZOH 1EBAA 3TFBA 2X4SA 3WDIA 3MRBA 3MV8E 4ZOBA 1NTZE 3OKDB 7PCYA 2RMNA 1GOGA 1UWEL 2J44A 3QT2A 5IIEA 1PYWB 2ALWA 1SNRA 4JS7A 2OX5A 1B4LA 3HHRB 5CP3H 3NZ8A 5EZIL 5A2LH 5TDPA 3UDWC 2DQEH 2MTPA 2VUOA 1NAMA 4LLMA 4TULH 5FFLA 5L2KB 3NA9L 2AGJH 5IREA 3BEWB 1SN2A 1SM3L 2WUCL 5A40E 2C3XA 5K9KB 5I8EA 1G6VK 4NNXB 4FFVD 5AOKA 2GJPA 4YLQT 2DIAA 4PS7A 1ML0A 2JCCE 4NCC2 4LT7A 1D7BA 1OAUL 1D9KC 3C2AL 3AQDA 3HPLA 4C58B 5JIDA 4TVPE 2H6UA 4HJ1A 5E8DH 3X12B 5B1AB 3O6FB 3DVGA 4XXCA 5EOQH 3GPSA 4HFWB 2X2YA 3BEVB 3AQXA 3N2JA 4E9LA 2AEQH 4LRIA 3WY3A 4NSKB 2VLKA 4UQEA 4BSWB 1EZVI 2A5UA 4JFEE 4BGLA 2ZE0A 2G2RB 3GLDA 5F1IA 1K8AQ 1U93A 2LVEA 1CJYA 2OI9B 4NHCL 5B1KA 1GL2D 1FAKT 3I75A 3KWXA 3TBYA 4DQOL 5L4FA 3QHZL 2W90A 1KQFB 3PLYA 4U3XA 3V4PB 3CMEP 1RU9L 4D8OA 1YRKA 2Z31D 4L4TE 4R7DA 4NFBA 3X1GA 1TZGH 4X4MA 4OLXH 1C8PA 1ADWA 1QFWH 4P23B 3CK0H 2J88L 4UDTB 3MV9E 1IO4C 4N6RA 3MNMA 3A3YB 3FTZA 5ID1A 1M1XA 3SDCC 3WKNA 4E41E 3EO0B 1DBKL 2IDFA 5ANME 2OPCA 4H40A 2ERJC 3Q8EA 4ODBD 4UOW0 2BERA 3LXUX 1KV7A 3NABL 2ZYAA 3JWNE 3K72A 1U8NA 3RILA 1XF2A 3I50L 1B2WH 1CD8A 3WNLA 3S4SG 3WHE1 2DL9A 1FVCA 2GSGA 3GO1L 2X9XA 4PWJA 1DHKA 1NCBH 2Q8BH 3NCCB 2GJ6A 2B39A 2GITB 5B66H 2N0MA 2ZXAA 5D2NA 3MRPB 5E6YA 2DI9A 2HZHA 3CZNA 3ZMNA 2ZXXA 3MI6A 5K59F 5EUOE 1A1OB 4BZ2H 1XB3A 4GRMA 1Q0YL 2V7NB 4NUGH 1OGAA 2Y7SA 1F86A 1XTMA 4FTVA 5IEKB 4YBQD 1NGYB 3WFEH 3CFTA 1NBYA 2F1AA 3HR5B 1AXSA 4JO8A 5AB0A 4KRPD 4PJDA 1N7SC 1D5BA 1PGQA 4HLZH 4YSCA 5C0EA 4F24A 1JWSB 1W9XA 2E5TA 2WQVA 2X70A 1SVZA 2B0SH 5CJBA 1PLBA 5DRZB 5I1LB 1EXUA 1U8LB 1GCFA 1QUNB 1KPUB 3SGJC 4LKCB 2Z92A 2GCYA 4IBZA 1QFUH 4PJGE 2VDRL 3O2VH 1PP9J 4W70A 1WZMA 3C8HA 1VB9A 4LLVB 5AVXB 3KW8A 1N68A 3ZVVA 4DK6A 1PPJD 1MVUA 4G83A 2JKJA 1TNNA 4LLQB 3WUWB 1DLHB 3PREA 2ZKHH 4WTWA 2FKWB 5CGMA 4JLRA 4LLDA 4P2RD 2ADFL 3HVDA 4K73A 3VRIB 5T3ZD 4N2MA 4MKMA 4U1IB 1LE9A 3MJ9L 2G3ZA 3X17A 1ZVNA 3NIGB 4WSKA 1IGML 3RIKA 4R4ND 4PP2B 4I2XA 4KKAC 5E70A 3RB5A 5C0AA 3GIVA 1SHXA 3VFPB 4JZOB 1HZHL 5E6SB 3TWYA 3WLWC 2OTUB 1PL5A 2GJZA 2W0LA 2F6AA 3GKZA 3KYOB 3LN9A 5I74B 4YHML 4JG0L 3SGEI 3KWVA 5SWZE 3QRGL 3UXFA 3B9AA 3ILDA 1KSRA 4N2NA 4LSUH 4JREB 2OTWB 4NXKA 1MWAB 3LKQA 4OF0A 2VKWA 4WFFE 4HPYH 3T5WA 1O9WA 5IHZB 1QSFA 1SQMA 4ZPTB 3VACA 1ORQB 3ZGHA 2FYUE 2GB2A 3GRWH 1MEXL 1A6WL 5KVGH 1IGTA 1RXLA 5G4NA 3SKJH 3LKNB 3O2VL 3MRNA 4NLHA 4AJVA 5SWQA 1I7UB 4M56A 4NAMA 3PP4H 5GIRB 1FL5A 3CN0A 1AJ7H 3FAXA 1SFCC 1F4AA 3F8UB 4M7KH 5D9SA 3FULA 3SWKA 5HHXH 3FK3A 4UMSA 1E5UI 4LPCA 3FW6A 3TN0C 4OF6A 3FMGL 1YEEH 5CIPH 1F42A 9CGTA 4JM2D 4XP5H 4HJJH 1VFBA 3C5ZB 5JW4N 5L7XH 4FYQA 4MAYD 3NFQA 4KTDL 3CDYA 1QX8A 3S37L 3KPSD 4HWBA 3BSZH 1XEUA 4ODVL 3RWGA 5JQ6L 2Q3XA 3PJLA 1A4KA 5D2LE 3SPCA 2I8DA 1SJMA 5DTFB 4KWUA 3UO8B 2LW3A 1RUKL 4DKFH 3FCTB 1D3CA 3V0WH 3RRQA 3TO4B 1FZMA 4N85A 1A02J 4UNTA 5E4EB 4FULA 1KTBA 4L9DA 2QGEA 4EZJA 4PP1D 1MCBA 1WRFA 5JXAH 1TJGH 3B83A 2IAMB 1A6AA 5ICXA 1MW3A 4X6FA 4ASWA 2DL2A 2EADA 4ZUUB 4JN2A 1NMCC 2ZX7A 2DWXA 1BQLL 2ITAA 1VGKB 1NL0L 1XO8A 3OKLB 4YPGB 3K2MC 2KI7B 4K35A 2VABB 4WI6A 5DK3A 4HIHA 4JG1L 1KN7A 3CU7A 1DVXA 2X4UB 3RY6C 4M7KL 2CKBH 3A4FA 4WF7A 1JGDA 4JY6B 2HTLD 2DQTH 1ZLSH 2NLJB 1LEIB 2RCSL 2X3AA 5E4AA 2YKOA 4H13B 4IKJA 4I1PA 2GYSA 4OJFL 4KMTL 3K0YA 4F20A 5F3BB 1OAKH 3TH4T 4JHZA 4HJ0C 3FQTB 4G9FE 3HZKB 3HZYA 4BFOA 3V79C 1CI3M 4LSQH 5G5DA 3J07A 1MI5A 3FB5B 5IK3A 2ISDA 3MDJA 4XN5A 5GGTL 4FX5A 2Q76B 1VENA 4N8VG 2N4IA 2BS71 4M3HA 1I8KA 1GA2A 2ITDA 4MXVE 2V9UA 2XU9A 2ITCA 4FI7A 3S6CA 2C0WA 1ZK5A 3VDBA 1K85A 2UXGA 3Q01A 2AS5M 3T0EA 2VTFA 3CX5K 3WTYA 2XQYK 2WXGA 2DM3A 3CFNA 4I0CC 3I9AA 1SJEB 4GG6A 2GUVA 1U0QA 2L8AA 4NQQA 4GMSH 1MDTA 3D34A 4WWPA 3ZE1F 1HQ4A 2IO5A 1QPPA 3EYVB 2BXZA 2OMBA 4RAHA 2Q87A 3EXJA 2EDHA 3BP5B 3IAPA 2IBZI 3DX8B 1S5LH 4YO0B 7FABL 2L3BA 2BWDA 3GRGA 1QNZH 2XFGB 1XSOA 5JXEC 4HISA 4ZSOA 4ENZA 4YHLL 5C07A 4XBGA 1PKQE 2XNAA 3DBXB 3EHBB 5LQBL 4K8RL 5DGQA 3U0PB 3X11A 4R7NA 1MFCL 4N0UB 4PYGA 5LN8A 1CGUA 2FYVA 2XC8A 3ROOA 1C08A 3TEZA 3BCCE 5E2UL 1WTLA 3TU6A 1D7CA 1D5IH 3QO1A 4L05A 3G6JF 2WLLA 4N5EC 1JOIA 2BZ7A 3MV8D 2HVKB 5F7EH 1NTZD 2WZAA 3O11B 4FLSA 1P5UB 3TT1H 2Q3AA 1BQHA 1X5ZA 1UVQA 3MRDA 1YVLA 1QBLL 5DHVA 3UEZA 3QPKA 1KJ3H 1I8IB 4XO8A 3I9IA 2XTLA 1IEHA 4NN6B 4ESKA 1JFQH 1PQZA 2I5YL 2JSFA 4MJID 1OOAA 2YUZA 5EF1A 4NKIH 4OLYL 4FXGC 4RFEB 1PY0A 1J2JB 2K70A 3QEQA 4I87A 5KW9H 4KVCL 1HHIA 1PG7H 2PWHA 1IC2A 3AEBC 4TVPD 1KG0A 2EIDA 5HVHB 3RYMA 3B5NA 2R39A 4FZ8H 1QRNA 2QFPA 3QCUL 1KFNA 3IFPB 1KPRB 4FJ6A 4NRZB 4AKOA 3CVBA 2PCYA 5D7LE 3P3TA 3VH8A 3VJ6B 3U30C 4LGRB 5K5YA 2E42A 2HFEB 2HVBA 1NZRA 2XG5B 4TQEL 1DVQA 4KOCA 5H4YA 1NTZG 3QA3B 2A83A 1BPVA 4KDTC 4P3CL 3D9AH 4G9DA 3EGDA 4B9IA 3NMDA 2OJZH 3FUMA 5F7EL 1GRWA 2WVVB 5TF0A 1KQGB 4HDIA 4YDMA 4R2GD 4KJQC 1UURA 5I28A 1S3KH 3K1KC 4L4TD 2O5XL 1XCQB 4M7LL 1M7LA 4B3EA 3ZTCC 5EBMB 2VLRA 4Z5RA 1JXDA 2YGPA 4UIKL 3S9OA 1MRFL 2OKMA 1FORL 1XFPA 3FCBA 2W6BA 5E7FA 3U7AA 1NCAL 1IAIH 4JVPA 2JEEA 3MV9D 3UYPA 3AAZB 2XG4A 1S1CX 4MQXD 2VSCA 3GKWL 4HAGA 4BFIB 4NQUA 5B39B 1HYSD 3MBXH 1MFEH 2NY4C 3LIZH 4TSBL 2EVIA 1J9RA 1RJLB 4QRTA 5D6CB 5K9JL 3TH2T 4E9QA 5DT1L 1JI2A 4PWIA 1OGTA 3VXTA 3QJVB 1M1JB 3HLAB 1D5ZB 3DBSA 2FT8A 2NUTA 1NC4A 2GTWA 5I1JL 3NFNB 4M8UA 4V33A 2QSQA 1MQKH 1HH9B 2PCPB 3S8FB 1FZJA 3MJ7B 4PJCE 3TIEA 4RZCA 2LVCA 2Z91A 1SEQL 4FJZA 5FW6A 4HLEA 4WY7L 3QUKB 5ABZA 5GISL 1PD6A 1DANT 1KTJA 1JPST 1L9QA 1MHHB 1Q0EA 1SMAA 4K5OA 3GTVA 5T5NG 1JD9A 1IC7H 3WI9A 3WHE0 2M1KA 1ZPUA 2X42A 3GMAA 1A25A 2OP4H 3QI9B 5DEFB 3TBCA 5SWSA 3RTLA 3CBRA 5IROC 4RFNB 3MZTA 3QNYB 4PEEA 5JNYA 4L1SA 4J5VA 4OLUH 1FLRH 3HNTH 2B8OT 1WIUA 5ILTH 4YHOH 5H2FE 3JWNG 4LCWB 3RFRA 1OP3K 4QKTA 1DN0B 3MCG1 1LP9B 3MBXL 5D2NC 5CJXA 5E94A 3EYQC 3CHOA 4POYA 1J18A 1XTCC 3D85A 4QRRA 1G0DA 2WUBL 4XPBH 3R0MA 3W9DA 3U6RA 1OF2A 4WWOA 5DK2A 2E74D 5CCHD 3FCSA 4NPYB 1A8JH 4WWID 5HHVH 5KKZB 1P7KA 1TNMA 1G5AA 2NCMA 2Q8AL 4GRWE 5IHUH 3JUYA 3O2DA 2H32H 1FYTB 4LRNH 3AROA 5DJ6A 2K6WA 1I3GL 2X1XR 2NRGA 4G72B 4ONFH 1HHKB 2AZAA 4MBOA 3RI5F 4D9RE 4PJ7F 5DZPA 4PRIA 3FTVA 2D7PA 2HG0A 2F74B 1T04A 3ZE1B 3RX9A 1LEGB 3BZDA 4MTMA 4XAWH 4OD1L 4GBXA 5SWZD 2FHBA 4G8GD 4HQQH 1HXYA 3NJMA 1E8WA 1WE5A 1FIEA 3MUGA 4UQCA 1RAMA 4N9GB 1V3JA 4HC1L 4ZXBC 1CD1A 1Y8AA 2VAJA 5AVZB 2CXGA 2P49B 4WFFD 1UQSA 3LRKA 3M1OA 5F7FA 3TBWA 1QEWA 3L4VA 3QYCA 3O8XD 1LT9A 3VGGA 1N0LA 2FYUD 3ULSA 4MNGE 4PJ8C 3B3IB 1Z9NA 2L4OA 2WZ6A 4UM8B 1ZVHA 4PWEA 4ZS6C 2VDMH 4L23A 3FH8A 4JFQA 1X5JA 4LHUD 2QRXA 3PFQA 3RL2A 4B6ZA 2C9SA 4DAGH 5EF3A 4BSJA 4IU2B 1I9JH 3OD3A 3G6JB 1ACCA 3QUHA 4LEEA 3FB8A 5CJQL 1B0GA 3ZHLA 2OL3H 5D6DA 3WSQH 4PGDB 3ZKMD 4IGBD 4RIRB 4WEBL 3C8KB 1BD2A 4OLVL 3K8MA 5F9WB 3ZX1A 1EDHA 2EUWA 5INDA 3VGAB 5DZNA 3VTTA 3OHXA 4FNQA 4X4KA 3CDFA 1JGVH 4CU6A 3LCYA 3Q9PA 3QNXA 2J8UF 1OW7A 2PP7A 2DI7A 2OSLB 3QZBA 3H1HJ 1IM3D 1CIDA 1CU4H 2A1WH 2HWZL 1QAWA 2FYUG 2EDLA 2V5SA 2JKTM 3RBZA 3HB3D 3LKRB 3A67H 1YECH 3KLKA 2K3HA 5F2FA 3UX9B 3NAAL 1L9PA 1QW9A 4LHUG 2YLHA 3IAQA 2DQGL 4NB7A 1JPFA 2Z35A 5D1ZD 1WFJA 1I3RB 3DX6A 4MHHI 5AZEL 1OTTC 3KZ8A 2BVUA 2FYNC 5CR8A 2ROYA 3QIBD 5E95B 4AY0A 3HHSB 5C0BB 2FBJH 4L8CA 1XV8A 5ERWB 3NZSA 4CDHA 3GBLA 1ZGLA 2BSBA 1R3KA 1BFVH 2P44B 3IJHB 4NYLA 3F58H 5BQ7B 1B2YA 4QXVA 3HNVL 2P7JA 1T1YB 2Z1KA 1J9SA 4Z7VF 4M6AA 3C2SA 4FC3E 5CLYA 1ADQL 3QHTC 5EPMB 4I7ZB 3BMVA 4NERA 5E6ZA 3H1LE 3U4AA 4NKQB 3C87A 4G9FD 3EYOA 4U3SB 3EXLA 1EHKB 2KYVA 5EU7C 2E0PA 3Q0HA 4KK6D 5DJ0B 1A6VH 3PGCA 4IL6H 5L4MA 1M05B 1MCRA 1P1VA 4U1GC 4OF3A 1RSFA 2A74A 4CMMB 4PD4J 3B9KA 3SKUD 32C2A 1KILE 2NNAB 2O1AA 2YKLL 5IP4A 2OK0H 4XB8A 3GI8H 1U8QB 5KVDH 1L0LE 2LLLA 2X4OA 4BRYB 1G9NH 1KLFA 4B97A 1ZV2A 1T21A 3CWBJ 5EO9A 1P53A 1DVUA 1HWGB 1NCCL 1UB5A 3EGSB 2MKVA 1G1KA 4AQ1C 5EOTB 4QHKI 1EK3A 3Q1SH 3L5HA 5C1MB 2E75B 3S5ZA 1KCSH 4MDJA 4YBLC 5F7BA 2IH1B 4PRBB 1U2CA 1HAUA 1H3UA 2VYRE 1SS1A 2VNCA 1CVRA 1I9EA 1FFOB 4TQHA 2NQCA 4YHPA 5SX4I 3ZMRA 5C9JA 4OGAD 4Y5VB 5FHBH 1CD9B 3QJTB 4RAVB 2P28B 3DX2A 2QMKA 4Z7UF 2KLSA 4CU8A 3UC0H 1AP2A 1JNNL 2OR8A 4GSDL 4Y8AA 3BQUC 2HR3A 3V8CA 5HI3D 1BOYA 4PMFA 3BPNB 3DX7A 3OTTA 2UV3A 1FZCB 3WGUB 1H3PH 1RF1B 2B1HH 5BUGA 3AE9C 2QGDA 4JM2F 2X12A 3H54A 1Q72H 5D55A 3BZ4A 3WN5A 3BCCD 5TH2B 4R84A 4KI5C 3K6OA 1QSEE 4WHYH 3SDXE 3B2XA 4TOYL 5CD5D 2FTAA 3ESNA 1HH6A 4PRDA 4N2IA 1W80A 4O4YH 3SO3B 5LGKA 4X9YA 1NTMJ 3UJJL 4ZX4A 2C8NA 1M7IB 4GEIA 1LDPL 3FO2B 1PGPA 3V5HA 1JMBA 1QZ1A 1Q9OB 2A6JB 4M9OA 3KPLA 3L9YA 3WE6A 4ENEC 1AHWB 3ARDA 3BGMB 2PGDA 2WXJA 3C9NB 3HBPA 4FQCH 3S4SB 4ZDHA 2R56H 2XU6A 1PZ5B 2KS1A 3TLRA 1XWVA 4TSAH 4OZIE 3A24A 4PJ7B 3T2NH 4F1ZA 5MEPB 5IESH 2DQJH 3AJ7A 2CBMA 2ZXDA 5JUEL 3OPZL 1GL2B 1H15B 4OGQD 3C09C 4HCIA 4E9VA 4WTZA 4E42B 3G5ZA 4MX7A 2BSRB 2TAAA 3SCMA 1ANUA 1NTDA 3DECA 4KX8A 2Z31B 1T80A 3BCCG 2VJXA 1QSZA 2C9QA 3HC0A 4NBXB 5EZJB 1BEYL 3TA3D 5D7LD 1IKFL 3BH8A 1Q72L 1SFDA 1MCCA 4OZFB 4XGZA 5EF2A 4F37F 3V9EA 2VMFA 4Y5YB 1WZ1L 4C57C 4WDIB 1QVGO 3DI2B 2AXGB 1MFZA 1UXWB 1ZS2A 2OCJA 2QADD 3KPRE 4K7PX 1YN7B 5H35A 4Y9EA 5JPNC 3D0AA 4IBYA 1D2OA 1V7NL 2DYSB 5E6IA 2Y7QA 2MNJB 1YMHA 1FQ9C 2XJKA 4X98B 2DRUA 2HCZX 5IQ7H 3MUDC 4B9JA 4K9JA 5A43C 2NSQA 2FX7H 1VQ5P 3RWIB 3D0VA 4P2QE 4JDEB 2PW2B 4XTRD 4ISVA 5APXA 2WTRB 3PRJA 1A2YB 2W92A 3CG8A 5C0JB 4YQXL 1OVRA 4Y4HC 4PJHE 4J8RB 4R4FH 4N1CA 1FRGH 1MCIA 5KSAA 5HGAA 5AALA 5DEZA 1IKOP 2EKSB 4S1SL 1OV8A 2H3XC 4DFIA 4NZUL 5L8JB 1HU8A 4FQ1H 4JJ5B 2JJSA 2X6AA 2Q7CA 1E6JL 1SQBJ 3PGDB 2AMUA 3TF4A 2A45H 4KRPB 4YDNA 4G7RB 1HKLL 3GEWB 4WJG3 3VI3A 5EEYA 4HZLA 4F2FA 2VDKB 4ODTH 2UWEA 4W7YA 4O9HH 1BBDL 3OC8A 3LIEA 1FSKB 1S7XA 2PF6A 4WCYH 1VPOH 4IRJD 3FTWA 1XGTB 1G1IA 2MCPH 3KL0A 4KDVA 3TVMC 4Y2OA 3P8CE 5HDLA 4ZMVA 3N9GL 5JPMA 3MGTA 5AOIA 1U8MB 1XT5A 2DB8A 5GRZA 4EN3D 5IM7B 3CFEA 1JZ7A 3MRRB 3AT8A 4HH2A 4XPFL 1T20A 1GKOA 2LFGA 4Z7VB 4GJTB 3M86A 2DYPA 1QLED 3RB7A 5CP7A 4BUHA 2WNWA 2IIJA 3LJ3A 4FGMA 1DH3A 4P2RB 4PJ9A 2H9GA 3DMMD 3WO4C 4EMZA 2RIKA 1FL6B 2G3AA 4QD2E 3QUXA 4NFDA 5L8RJ 1QI3A 2BY3A 4FQXD 1NEZG 4OFYD 1ZJBA 4HLJA 4H4NA 2FR4B 3QDJE 3NSCA 1M7DB 4NO5A 3V0AC 4JFHD 5C0GB 1AV1A 4XB7A 5I8KL 3W11D 1OQXA 3P40A 1RUAH 5ADOL 1OAXL 4WWKC 3CE1A 4U33A 5AYUL 3AU1A 4UQ2A 1CXKA 2VISA 4ETQA 1LO5A 1PY9A 5CR1A 1BQ5A 3ISYA 1Y1UA 2V9TA 1BMZA 1OL0A 2BDNH 2BJMH 2CIKA 5CCGC 3FUDA 1N5YH 3KCWA 4UZSA 4W9LC 5EHFA 3P4OA 2J20A 3V7MA 1COBA 5J6SA 1T03L 2OA9A 1SYVB 3VG0L 2CA4A 1RPQA 2GAZB 1ZLVK 3WFZA 4ALAH 1GU5A 4U7KA 3VGHA 4D9RD 1DDHB 5I1AB 4BZ1L 1QVOA 5DJ2A 1UM6L 5EDXA 15C8H 1ODUA 2AJ3B 2ESVD 1W72B 4DGIL 1T22A 1G7QA 4H20L 4AYCA 5EMYA 1AR1D 2WBJA 3QG6B 4Z7UB 1DVTA 5D7IA 2YK1H 1WS8A 5CLZA 1TLMA 1VQ4P 3FF7A 1MH5B 1NLDH 4NXSA 3ZPDA 5AB1A 2BCKB 1EJOH 5CJOL 5FIEA 1LDSA 2H2SC 1BGXL 2R2HA 3RBSA 4DVRH 5I15L 4JM2B 5EN2B 4OSUL 4R90H 5J6HB 3GHPA 1AD9A 3AREC 3KH4A 4MAYB 1GPOH 3U2SB 2EYSA 5MEND 2IAAC 3KPSB 2D8KA 3SE4A 4BEIA 4LARH 4JQVC 1TZHB 4BA8A 3T0AA 4X6DE 3PDGA 5FOJA 3A21A 3PWUB 4IKIA 3QW9A 1L0NJ 2KZIA 1OW0A 3GJFA 5DD1L 2A4CA 2BJML 4HUKB 2AEIT 3CLFH 3SE9L 2DOCA 3MNZA 4WI2A 2XZCH 1KV3A 3GSVA 4N8VB 1B9ZA 5BMFH 1NGPL 2GSIA 3GZKA 2XY1A 2KKQA 5D1XE 3P54A 1I85C 3QFJA 4FKEA 5HD8D 3BSGA 4XNAA 1LWUA 3OR6A 4J8QA 1VQ6P 3SQBA 3QUMA 4J6RL 1E8YA 2DH2A 1NIBA 4DSYA 2R7EB 4OLEA 5FW8A 5TE6H 2BP8B 3LEVH 3F5WA 5D7EA 1NLBL 2AQ2A 4HX1A 4PRPE 4QHNB 5FK9B 2WZPA 4MMYB 1ETZB 3UAEA 3BRFA 4MWFB 4LL9A 1MCOL 1Z6JT 2PP8A 5C0CE 3ZL1A 3WKML 5IVZB 1GGCH 1CDYA 4L3FA 1BZDA 2JFCA 3E7JA 1GPOL 1C12B 4JFZH 3QUMH 3HI6L 2HT2D 1TOXA 2CUAA 3FSOA 4CJ0A 5ISZA 4UINL 1NSNH 4WU5B 3HPJB 5HXMA 2B5IB 4JGJA 4YHYC 3DJ9A 5BJTA 4YMPA 1BVNT 3W0WA 1JY2N 4MNHB 3H1LD 3A6CL 1VAHA 1T0MB 2XQBH 5FGBC 3X1FA 4P4RA 3WUTA 1PW3A 4YK4B 4UT9L 4FLOA 4LB8A 4LCCC 4GMTL 5L0QC 4JZJA 1MFMA 2C9PA 1YPZE 3CVHH 1MREH 4HIEB 4TVUA 1P0SE 4MMXB 1KILD 4OFKA 1RFDH 4QXGL 1MFUA 1UFUA 4NCC1 1EERB 5F7YC 3TT3H 3BESR 1L0LD 3WUUA 3MLYL 2W9EL 5H94B 4OF7A 4EKJA 3VMYA 2YRBA 1C1EL 4YXHL 4BKLB 4ZK8A 5DA4A 4U1MB 4Q4IA 3NEOA 1CXIA 4U6XA 1N73B 1YY8B 1G9NC 1Z9OA 2H3KA 3MLZH 5D96C 4FFTA 5KYUB 1WZLA 3M9HA 4P5SA 1NSNL 3H1LG 2CAKA 1KXVC 1GGBH 1XGUB 1JY3P 2TRHA 1EHNA 3IKCB 3QS3A 1DCEA 2XXFA 4B5ZA 3RX5A 3VFNA 1F4WL 3MV8B 5DD6B 2F68X 1CFVH 5IFAL 1GYAA 3QBTB 1U3HD 2A73B 1XF4A 2R83A 1UIIA 2BHUA 1V3LA 3OKOA 1F97A 2J6EL 4JRFA 1U7JA 1A64A 4MZ3A 3V95A 3C5SB 1CL7H 4QTHB 4GXFA 1JWMA 2NTFB 4M4RB 1L0LG 3MRJA 3LD8B 2OCCB 1W6WA 3NCBB 5CCKL 1KBKA 1QSED 4MJIB 2PYFA 1NMAL 3PFUA 1EXGA 2OYIA 1FVEA 3BKMH 2NY7H 3MCLL 2JCCB 5DRXA 2WMMA 1ND0A 2P24A 3KXFE 1BAWA 1T7VA 5FGCE 3MBWB 5JR1H 4MCZA 4N0CC 5CS7A 2F7PA 3RK2C 5KSBA 1JCCA 2BVOB 4GW4B 3LZLA 2ZX8A 2EO7A 2YXWA 3DK0A 5F1OB 5TQ2L 5HBBA 3MYZA 3PG2A 5E99L 3KLHC 1I8LA 3C60D 5IMKA 1AGCB 1YNLH 4H2AA 5ACZB 1S9VB 1NCOA 2BHYA 1ZHNB 2YEZB 2IDSA 3EH1A 3ZOAA 4HIXL 4P05A 5EBGA 4NEHB 4R2GB 3O6LH 4L4TB 3OAYH 3ULUH 1E42A 1WBZB 4JO4H 2KC0A 4A6YL 3BGAA 3WN6A 2P45B 5BVJA 1LMKA 3B6SA 4XCNA 3NFPA 1BSNA 1UG9A 1MCNA 3ALXA 5C09A 3MV9B 1UT9A 5LWYL 1E4JA 1G7PB 1MFAH 1RZ8A 3GXNA 1IGJA 3MGOB 4NN7C 4RWYH 3KPRD 4DPBX 3AMLA 2ITEA 5ANMB 3C6LC 3I74A 3MRGA 4HEMA 5GRXG 2Z1PA 1SDDB 3D3VE 4MXVF 2VZOA 1R5SA 3ZTDC 3F12B 4HWZB 4YAQA 3REWA 3VFVB 3WEOA 3PTZA 1KBGH 3RY5A 2HLAA 3GWJA 1ZWIA 4P2QD 5CZRA 2EDOA 3HZVA 3ZTEA 3N41F 3WUVA 4TNVF 5DVLA 4KKAD 4KKBD 3BAWA 5E1IA 1A4JB 3GMQA 1NC2D 2X87A 1FFNA 3FUNA 1J0KA 4WJ5B 3IU4H 1PP9E 3PE9A 1OP9A 4RRPA 4IKLA 2DLFH 5CMZA 1FZKA 2R0KH 4JO2L 1JGEA 4S2SB 4TRPL 1QBMH 4DP0X 5HYQA 2LR4A 1BXVA 2X4TB 5DYOA 5B1JA 5GRUL 2YPVH 2ZXQA 4HULB 2QJPC 3VFUA 2R0ZH 1V7MH 2W07A 5K93A 5DEGA 4F8NA 3MYJA 1S7UA 3K6FA 3ULVL 4ZMYA 3RVXD 1AYOA 4ZTOL 1DO6A 1CLOL 4NUMA 5T5FL 4KNQA 1DJWA 4IOFD 3K4ZA 1UIXA 1OM3L 1XCTB 1A7RL 2YFNA 5KVGE 1S9KE 4LOFA 1OXZA 1RZIB 3GF3A 2M83A 2P7TA 2XN9E 2WYHA 2E74B 4CMHC 1M9WA 4N0FA 4M8VA 2BSSB 1ZOYC 3F62A 4K5NA 5EO1B 1RUQH 1OCWH 1YEFH 2JB5H 3RURA 5GTHH 1A7OL 1RIHL 4LCYB 4X6EB 3D2UA 2QE7H 1MAML 4L8DA 4W93A 1AXTL 5KG9B 4CVUA 3W57A 2AKRA 4GY4A 3US1A 2G9HB 3MTUE 4RMRA 3LIUA 3QDJD 4I9WE 3MIWA 1FHNA 4LDEB 3VB9A 4EZLA 1JF1B 1RVFH 3IAOA 2R23B 4OV5B 5AVUB 5GGRY 4IBVA 2YWZA 5SWZB 3MACH 4G8GB 5C0IB 3T1FB 4IOIH 4U6YA 1U8PA 2W0KA 4NQSB 2YMYA 1LTBC 3QJZA 5E08L 4AEIL 4WTQA 1KJ2L 3DGCR 4K71C 1XF3A 4RMWA 5ECGA 1XQ4A 5GGVH 3LKOA 3RI5K 4QRBA 3O8XB 3T8MA 4O51B 1K6QL 4ZMPA 1T1WB 4M6NL 2IALA 3PQYE 4AWJC 4LHUB 3DETD 3O4LD 5FHAL 3MLVH 4ALAC 4UT6A 2ICWJ 1ET7A 1INDH 3EO1A 3L48A 2YXRB 2Y2TA 4BQ9A 1SEBA 1KCUL 1YEGH 1S3JA 3Q9QA 2C4FU 2F2HA 1JOCA 3LV3B 4M1DL 4XHJC 1LNQA 35C8H 3FN9A 1DVFD 1EHAA 4IGBB 4JY5H 4RQQA 2G5BB 3GM0A 4OLWH 3TBVB 2RALA 4L8BA 3RL0D 3N1GC 3VD7A 1EHLH 1MPAL 3GJFK 4JW3A 4IIQB 5AZUA 4I18B 3W37A 3T4YB 5JIKA 1ETJA 3HD7C 1DQQB 3P69A 2P8MA 1AQKL 1IM3B 2PTTB 2VN4A 2HTKD 4HD9A 4J3SA 4MLIA 4W9DC 3HB3B 4XO5A 4CVZA 4DQAA 5J13B 2QQNL 3EO9L 5KS9E 3V9FA 3V52H 5I0ZA 1L6ZA 1RHHB 4PJCF 5TPWH 2X4NB 2IGFL 4ZQKA 1KCKA 2HG5D 5BZDB 5DMKB 4PB0L 2OYHA 2E47A 5D1XD 3A0BE 5D1ZB 4CVXA 4ZI8A 1KENL 1CFBA 3QIBB 3MLTA 5E5UB 4Y19A 2AEFA 4P3DB 2VDPL 1J0ZA 1NANH 3L3HB 1NCIA 1Q90A 3C08L 3TPUA 5GZOC 2JO1A 5JHDD 3KQGA 5T1JA 1E9QA 1LGVA 2D9QB 4WENB 1TQSA 2GI0A 3P3SA 4X8JB 5TDNA 2NR6A 2KI6A 4YDJB 3U36B 5DJXA 1GIGL 4HOXA 1CLYH 3FQYA 2DQIL 4GXUM 1S5LE 1A7BA 2Z0UA 4JY5L 4I89A 4O2CB 4PRPD 2BVYA 5EIQA 4MSWA 1BA9A 4G9FB 5C0CD 1N70A 3T6QC 3KMDA 1GGIL 4KI5E 3LNHA 4XXWA 5C71A 2H2PD 3UOAB 4MD0B 2YXFA 1VZHA 2ZCLH 3KPPB 4GSUA 2YRZA 4S0SD 4F5CA 1R1CA 2HMIC 3GSRA 1PSKL 2JE8A 1UUSA 1NOAA 3NPZB 4LLAA 3CIAA 5DSCA 3UTPE 5IFJB 3G6DH 1OT1A 4PTUA 4C4BA 1ORSA 5F7DA 5F9OH 4AGOA 1EFQA 4KGLA 2O30A 3ROLA 5TPWL 4DWHA 2I9TB 3OWEA 3CZKA 2ZQKA 3BVWA 3S5LA 5T1KD 4H88L 3RIAF 1ZSDA 4LOUC 3KVQA 1OCOB 1AZUA 4BD4A 5T1MA 4RMUA 1Q94B 3LH9A 3FCUB 4HS3A 1MV8A 4WI9A 5DJCB 2C3HA 1BLNB 1RJYB 4RLDA 1HSBB 4EOTA 3EGXB 3L95B 1IQDB 4IS6A 4KHTH 1YG9A 4AW4A 4JDZA 5D70L 5JIQA 5D8JL 3QEHA 5GGUA 2E3VA 2IADA 2GIYA 3II2A 3K80A 1ECZA 4Y5XA 3ZT6A 1WFTA 3KVDD 1PZAA 4FQQB 4YE4H 3II1A 2QT6A 3D4ZA 1B0RA 3WY2A 4F8QA 1JDCA 1K3ZA 3U0TB 1CT8B 1NOLA 2PR4H 3TYGH 2OQQA 4ASVA 1GD2E 1SHMA 3UTTA 4M5ZH 4K7FA 4I9XA 1PX8A 3QWRD 4KXCA 1CK0L 2RGSA 1DEEA 1P2CB 4XWOD 5GS0L 3CX5J 1DQTA 5IB2A 1QLFA 3ZDWA 2EC9U 3IR9A 2HJLB 3FN0L 3O3AB 3O9WD 3QNFA 1RIUH 1KYOH 4HPOL 2I7SA 3MKKA 3MV7E 4WY4C 3FAWA 4K5LA 4YHNA 4AQEB 5BXFB 3DKHA 3G5XA 4L74A 5KVMC 2AEPH 4B9CA 2WPSA 3DROA 3G3ZA 3L1GA 1CICC 1LO2H 5DO8A 4F15B 4KHXH 4OGYL 3CX5H 3I5CA 1NCTA 4JO1H 3D33A 5DFVD 4N6JA 3Q1MA 3QQXA 5JW5B 3JSSA 3G6AA 5TGBA 4OGQB 2PP9A 3U7WL 4P46D 1OPOA 5I5IA 2WKGA 2LR2A 3GG2A 2DQHH 3DOSA 5BRZE 5C0RH 4MVBD 5CN2A 3TA3B 1CDUA 2VZTA 3H2QA 1AC0A 5D7LB 4UQDA 2YC1A 1TVBB 4CGUB 3NDZE 4BFKA 1CGVA 1FH2A 2CBOA 3E80A 1URZA 1MCLA 4AQAB 1F11B 4QO1A 2PW1B 1LO4H 1U8HA 2W60B 4BRJA 3X3FH 2QADB 3FJTA 3IJSB 3UBXA 5KLVJ 4TNGA 1BX2B 4KOBA 3NTCH 1Q4NX 1XH0A 5FKPB 3N42F 5DZJA 1LWJA 1RPUA 2QKSA 1KXTA 1LO3L 4ZTPH 4YXKL 1IGIL 4F37K 2QZQA 4GAGH 2HSIA 3C12A 4KZDH 3CXDL 4TPRL 4UUJA 4M29A 3ULUC 2BEQD 1UJ3A 4M4PA 3MNVB 2GBTA 2KNCB 4TTDC 3I55P 2LXBA 3F5HA 2FJHB 4JO1L 3UZEC 4OGZA 4KRNA 5GJSH 4XH2B 2G3XA 4X0NA 2VQ1A 3M8OH 1BM3H 2OW6A 1X6LA 2JTDA 1FOSF 3STBA 4DGUA 1SMOA 2HRPH 4YUEH 4Y4KD 1ZHKB 3CPLB 3KVPA 2JB6A 1TSHA 3P8MC 4WW2C 2J1WA 4J3UA 5CCGE 4MD4B 1UASA 1NEZB 2GK0A 4MDRA 3CWGA 5E2VH 1JN6B 4AENB 3CCHA 1H3VA 4IDJL 4PJCB 1NCDH 2RBLA 2EDJA 2FFDB 3IMUA 2NY5L 2ITFA 3NJIA 2MKLC 2G8YA 2KUBA 2ZOLB 1PP9D 2CM6A 2ZOKA 4FEIA 2FLRT 4M8QA 4OU3A 4QTFA 2QEXP 3MROA 4IRJB 4JQIA 2EEAA 1BW8A 4J6IA 2N7AA 3I6GB 2IH3A 2EKJA 2OBGA 4HLZG 4R96B 3QXWA 2FDBP 3CFBA 2Y3NA 4HUXB 5T1LA 4EN3B 5GXBB 2X0UA 5KBPA 1I7ZA 2Z93B 3IFNH 5HGHB 3VGBA 1LEKA 3ZXAC 1Y0LB 3UO1L 4ZTPL 4NZTL 2W9LA 3BYTA 4OD2B 1JD7A 1QLEB 5D7JD 2N1TE 5ITFB 5HYSA 3QH3B 4RGMB 3L7EB 5F71A 3BE1H 5BW7C 2FD6H 1NAML 2AXFA 2XFXA 3R18A 5GZNA 4OZGA 3DMMB 4KH9A 3S36L 4D6TJ 3MJWA 5J7CC 1ZS8B 1YC8A 1YA5A 4FFZH 4PJEF 4FQXB 1S9KD 1PZUB 1T4KB 3CCEP 2XN9D 3FYEB 4UB8E 2N01B 4PBVC 1INEL 1TXKA 4A2HA 4AEHH 5IB4B 4GIFA 5KYYA 4GI8A 1IBYA 4MCMA 4V1DE 1JV5B 3EH4B 4Y89A 3K6DA 1PP9G 4B9YA 3P9LA 5DFWH 2BIQA 1YYMH 4XC1L 2AP2A 1IK7A 1EDIA 1EZUA 1YNTF 2BHFA 4XP1L 1TQVA 4I9WD 3FFCE 3DX9B 4NWTH 4DERA 1FE8H 3RPIB 3STZA 3VA6A 1ID5I 2ESVB 3EFDH 1BJMA 3FO0H 5F7LB 5AW9B 1THAA 3HRNA 3SGKA 4B9PA 2XWTB 1AR1B 3KPOB 4OZHF 1DBML 1K5WA 3JV4B 3UAJD 1WCBA 5JIMA 3O6QB 1JRHH 4M61B 3IWVA 3BT2H 4N26A 5FO9B 1KXQE 2RQEA 3JVFC 3SPGA 1UM4L 5MP6H 4LCVA 4N86A 4FFZL 1EWHA 3GMRA 3MJ6A 4K5PA 3PQYD 2FJGB 4BA0A 3MBEC 3ML9A 2XY2A 1PYWA 5L8LB 2V2WA 3H1HE 5GS1C 3L74J 4H8WH 1TETH 3GLZA 4LE8A 1I9RH 2YIUB 5I73B 5CM1A 4K9EL 4A38A 4FABH 1YEWA 3BPOB 1C16A 2WCPA 3EBHA 1GZHC 3USSA 3B71A 1UD6A 5IBTH 3UTSE 3V0DA 5JLZA 2PCFB 4HGMA 3V2PA 3FDWA 3G5VB 3TBSB 2BLFA 2WLIA 3JTTA 4PJHF 1U2YA 3JC22 3L3DB 4FL4C 4K8RD 3L1OH 4AGLA 2NY0D 1ILUA 5KLIC 2FQFA 2FATL 4ANXA 3KBPA 2XXGA 5DJUB 2BSED 4GO6B 1G5GA 1SXSA 4HJGB 5B8CA 3AACA 3MRQB 4QDGA 3QEGH 2PMZA 3ALWA 2D7QA 2GT9B 3CVIH 2QPDB 4KV5F 1AA0A 1MKMA 3VG9B 1NGXB 4PB9L 2H1PL 5HHNA 4AC4A 5HJDA 2HLFC 5IW3A 3ZKSD 5KVDE 2KLRA 1IFPA 3QRBA 2NXZD 2TRYA 3P2DA 4PS4L 3CV5A 4GAYA 1NH4A 1OAZH 3MOQA 3B5TA 4WFHD 3GHGC 2UY7B 2EDDA 1WWWX 1EAQA 3D30A 5BVPH 5GS2D 3WEMA 3H3PH 2EE2A 4P23A 6PCYA 4LSTL 3SDDA 2WB7A 4O5LL 5EU3A 3SZKC 3CWBE 5E1AB 1T6VN 1AD0A 4WUKL 4MD5A 1OPGL 2MPVA 4XN8A 2GFBA 4NUJB 2BH0A 4J2XA 2FT6A 4JL1A 3WJLC 3V4PH 2ARJQ 2MNWA 4RESB 1QLRB 3QWOC 3O3UN 4AJ0A 1YZZA 5I9QB 3WTWA 2Z7ZA 4XVJH 4X7SL 4PGBB 1YYLH 1JV2B 3EJYD 1P1ZA 1GYCA 1O7DC 2AK1L 5I1CH 4E68A 1DQLL 1N2DC 5EFWB 1KILB 2QA4P 1YDPA 3QZLA 5I17A 3K5BA 4Z7WE 4HIIA 2FYYB 1DVZA 5HHMD 1N6QL 2XVKA 1E8XA 2V7NA 2VXQA 2ZUYA 1R5VB 3BZFA 3WL9A 4HF5H 4RSVA 1NFDF 3FO9B 2O01N 1NGYA 2SPZA 2WSCH 2CLRA 4PRAB 5J3HC 1RZFL 2KH2B 4Y4FA 3ML8A 5E8PB 4FNUA 3C8DA 1CLCA 5CEYA 3BPCA 1G9ML 3H3PL 1BZEA 1U8LA 3IDXH 1UJTA 2SEBB 4LCUB 2OYLA 5D71H 1ZTMA 2FIRT 2YA2A 4XWGH 4P57B 3KPNA 1U3HB 2KQMA 1SN5A 4G5ZH 2FYUK 2COVD 1CGXA 1ECYA 1A9BB 1JUFB 4JKKA 1OSPH 1I31A 4R0LA 2E8ZA 2YUVA 4PBDA 4PJEB 4P9HL 1ZIBA 1GJWA 3DIFB 2JIXD 2VJ0A 3I6SA 1ODAA 1QSEB 4HWBL 3SDXB 4A7SA 1P5VB 3QORA 1WWBX 4X6DF 1CYWA 2ZT9C 3FQ2A 2YKQA 4M5TA 4ZW5A 1GVIA 3IJEB 5A7EA 4PP2A 3VFRB 3EFFB 3V4UL 5LJYH 3G9RA 1RJZA 1TCMA 1IBZA 3RNKA 4FLQA 4IDLA 3KYOA 3HN8A 3H9SA 3BJ91 3OR7B 3D39A 3KJ6L 1VQ7P 2I25N 1YNTB 3ZR5A 4OZIB 3VQ2C 5KN5B 3GSWB 1FO0B 1BXXA 5L6YH 1BEXA 1X7SA 3C60B 5I19H 1UEYA 4JPWH 1ORQA 3RVWD 2MKWA 3CMOL 5KOVC 4OZHB 4Q97A 1CXHA 5DI8A 5FM8A 3LH2H 4MB5A 2B20A 2VN6A 4HEPG 2ZYDA 4NKDA 1IV8A 1E4XL 1OM9A 4NN5B 4RNRA 4GT1A 1B4RA 2C5DC 3BWSA 1URIA 2WLNA 5HI5C 2IC2A 5H37A 1XD0A 1MWAH 5IMMB 2ZUVA 3ATFA 1DSFL 3N40P 1EGJA 5EZLB 4Q6IA 2LOEA 4D0BA 3KPRB 4P4KD 1K8DA 2IPTL 2Q1EA 2QSIA 1UWXK 2DLGA 4L8SC 4JBSA 4AC2A 3BKCL 2AQ3A 3S3BB 3DVNB 3NGBC 2VDNB 4U1NA 2NYKA 3FRPG 3Q8AA 3QEUA 2BNQA 1T5XB 4X5XB 3T6VA 4P2QB 4M48L 2E6JA 2JKNA 1TTGA 1BVKB 3LKSB 4XNYH 5DTFA 3DGGB 2XA8L 2GIMA 1TUPA 1RUMH 4PWKA 4WQOA 4XCFL 1N8OE 1N8ZA 2VXUH 3BKYH 4PJHB 3TO4A 1NC2B 5MEOB 1NU1J 5F9JB 1PAZA 5BS0A 4HUVB 4W1TA 3LRMA 5J12C 4JAMA 4NPKA 4ELKA 3MFFB 1KELH 2G2NA 3CLEH 4NJAH 1CGWA 4LVOB 4XVTH 4FXKA 5KAQG 5IFHH 2Y06H 4HCRH 4BFJA 4ZUUA 4NFCA 2OS7A 2CMRH 1CBVL 5DK0B 1II4E 4TNVK 2JF1A 3AECC 3CZEA 3BRGC 5FOBB 1TQCC 1JF5A 3RGVD 3ZE0F 3HG5A 2HPCB 1ZANL 1FNLA 4PI2A 5D5ME 2E46A 2PN5A 3W9EA 2GJRA 3FXEA 1S7QB 3FU7A 4YXDC 4UAOC 1FG9C 3QUZA 1TCRB 3ORJA 1KCRL 3V6FB 2GUSA 3UJTH 1WYJA 3H0TB 3HZKA 4JHAH 3DSNA 4JR9H 4F91B 2Z8VC 3F85A 5EO0A 3MQIA 1FFTB 2A9NH 5I1EH 1OTUD 2N1TD 1MJUL 4XNYL 3HN3A 1SMDA 2WP3O 4Y1SA 4G8EA 1AS6A 4YIQB 2YUXA 3VD5A 4HB1A 4X6CF 3K2UH 2GKIA 2DWEA 4LOEA 3VE0B 1FIGH 4XXDB 3CH1B 5IBLD 3VD4A 3FQRA 1NA8A 2X1OA 4LPWA 3CLEL 3QDJB 3RJQB 4BYHA 2BIMA 2X4QB 4YZFE 5MENE 5CSGA 1WFIA 2WLJA 4V1DD 2VDQL 2EE9A 5FX3A 1IGCL 5CU9A 5D1QC 5I1KL 3U9UA 2A77L 1XF1A 2R32A 2HODA 4QHLA 3U4KA 3KPMB 5M7QA 3BVXA 4HUUA 3M9QA 4NIYE 1N5AA 1X0TA 4PJ6A 3GSNA 2P8PA 4MCYB 2BFVH 3ARFA 5IV2A 2HVJB 3N85L 3HRZB 4IK6A 2VITB 1YUKB 1UCBL 3S7GA 3W56A 5BUAA 3GT6A 1MLBB 3FT3A 3MCYA 4NKMB 2NY2C 2XV3A 3L2LA 2X1PA 1NBZB 2E6PA 1JZ6A 1KB5H 3O4LB 2H5UA 3Q8FA 4N2OA 4L3CB 2NPSA 3EOBB 4P2OD 1G0YR 3RX8A 1HL5A 3OZLA 2DF3A 1BREA 3AFLA 5A16B 1ZHLA 3V4VB 5FO7A 4EI5A 1ETA1 2BXYA 1BM7A 4FERA 4X80L 2AEMA 4YGVB 1DVFB 3SQOL 4XNDA 3COOA 1BQRA 4R97C 2NY1D 4M8RA 5TE4H 3ZL4H 3NA4A 4L37A 2DKMA 2BWIA 3G9AB 3RL0B 2GTZB 1KIRB 3NZHL 4OQTH 1QWUA 3H1HD 1E5AA 1L4AA 3RDTC 3VVVA 4BDVA 2VW6A 1G6RA 3EQ2A 1GY2A 2NW2B 1SQVE 3ARBC 3IPBA 4X6DB 1DQDH 4GIAA 2F7QA 3BN9C 4OM0L 2B87A 1PDKB 3RWFA 4H8WC 3QJOA 1SY6A 2X6BA 3SKMB 3U1AA 3L73J 5F96L 2FRGP 3GEFA 4QF1A 3UTSD 5ITBL 1FDOA 4L9LC 4FZEL 2HG5B 3BT0A 4MA1C 1SOXA 5D1XB 1DEBA 1ZW0A 1UWGH 1CXEA 2BWQA 2Y1YA 1M4KA 4XP4L 4BIKA 1EZVY 3SD2A 5IY5B 1W91A 1KB5L 3GGWB 3GI9L 3PHQB 5BO1L 5JHDB 4H26B 1IIIA 3VM5A 1IT9L 1ZLVH 5F7UA 4Z95L 3GMLA 5C08A 4AITA 4BFBD 3H42H 2BC4A 3TZVD 2DW3A 3A4DA 4QRAA 5FYLL 3H1HG 1WA1X 4UILL 1YQ2A 2NX5E 5KEZA 3QULB 4PRPB 1B4JL 2J56A 3VFSA 2GQHA 4QLWA 1XMWA 1L6PA 4S1RL 4PD4D 5C0CB 1XR9B 4H1LB 4Z1PA 2H6PB 4FQ2L 3PWPA 3VXNB 4QJ5B 3NK4A 4HV8A 4U1LB 4GRLD 3LX9A 4MQTB 2WPRA 1SP4A 5GTIH 3E6HA 3O6FC 5LBSH 4AMXA 3CWBD 3AAZA 1JZ4A 3WTUA 4OD3L 3FQXB 4S1DC 1TJMA 4XVUC 3U48A 1NJ9A 5EU4A 1AO7A 4YEEA 2C1OB 1RJLA 3L3KA 4IBWA 1E4HA 5FEBA 1WD8A 1AR2A 3KYMB 1D5ZA 1FJ1B 2C0XA 1TO5A 2OI9C 5T1KB 4QCIA 1KEMH 3G5WA 2P1YA 1F58L 4FXGB 4Q9QL 3NFNA 5INCA 2YGOA 4NUPA 1QR1A 1EFXD 3LSOB 1RD6A 5ECJE 4BINA 5KYNA 3WFHA 1R33A 1A7PL 3L3OA 1PIGA 3MRKA 5DF0A 3H42L 3DXAD 4P23C 3FFDA 3ETTA 5FYKH 3AW5A 5LAPA 1KYFA 3BUYA 4HXAL 3RIAK 2WWMD 1JZ2A 1SHSA 2G3MA 1I1AA 4FN0A 1R5WB 5D72H 2Z9TA 5IGXH 1M3IA 2CJ3A 3CWBG 1KFMA 1NFDA 3V6IA 1ZV5A 4JFDA 3B2UC 1XIWD 3N43F 4PJXA 4FQJH 5FLVA 1QQDB 2F7OA 2YRLA 3OJAB 3WNPA 4DJGA 1NTMD 1U91B 3GUTA 1HOCA 1A02F 1LK2B 1R5IB 1DN0A 3MUZ1 1CGSL 5C6WH 3IRZA 3KNBA 1I3UA 4FKHA 4BUGA 3OKMA 1KULA 4G43B 3S34H 3O9WB 2DKSA 1KWGA 2CGRH 2XICA 2K3RA 4X6CB 3BAJA 4NO0D 5EU5B 2WINB 1WLHA 3EYUL 3FU8A 4XBPA 4ZZKA 3RWCA 2DYRB 2WLHA 4NBZB 2UVFA 3GRBA 2QG4A 4OUOA 4JM0A 4W9GC 4Z7QF 5ALBL 5DJZB 1ROCA 2WSFH 4IRSC 3FXIC 3NIFF 2VDRB 3JUZA 4H8PA 1G1JA 2EH7H 4P46B 1NDGB 4NHUB 3L5XL 4DTGL 5KS9F 2UZIL 1MRCH 1Z9SB 3KCPA 2XV6B 1RULL 4B86A 1VFMA 3UAAA 2F61A 4G11A 1RE4C 2W0PA 3NN8B 4HKZB 1NTMG 4EDXA 5DUBB 4HUWA 1JK8A 3IKKA 2VLJE 1L2PA 5D93B 5C0ND 3WTTA 1U4EA 2E76D 2CDFA 5LGJB 1XR8A 4XNMA 2YPLE 2R8SL 2PPDA 4LNRB 2DPKA 2H1LM 3VI4A 4ZAKA 3HUJA 4QRUB 1VADA 3VWJD 4DGVH 1JNJA 2XZZA 5D4HA 1ZA6A 3I3DA 5KOMC 1EJ8A 4CNIA 4LLYB 3IDYB 2CR3A 2BP5M 4XMKL 5H8DA 4IU2A 1OWAA 3L3JB 1BBJA 4K7PH 1FV1A 1UYWL 3WFCL 2VLLA 3RA7L 3HS9A 4TUOA 3DYOA 5L2JB 3O41B 4PJFE 3RUGE 5PAZA 6FABH 5ADPH 1S7RB 1TZAA 2BSTB 3JV5A 3UROR 3DUSA 4JREC 3KH3A 1A5FL 1PLGL 3C8KA 1SQBD 1D6VH 1YTZI 4CPGA 2V7HA 3VXME 5IMLA 3DHMA 1XD1A 4Y4KB 3ZLQC 1A6UH 2I07B 5EIVA 1CBJA 1DSWA 4OLZH 3VW3H 3FKUS 3EOYG 1U8IA 4ZD3L 3VYPA 4XNBA 4W7ZA 5GTHE 3DJZA 1YEJH 1I7RA 3IGFA 5J9PA 3ARWA 4K3DL 4TNWF 4U0QB 2W9DH 1AE6L 3O3DA 4PGCB 1AGDA 1X5KA 3WFDL 1XEDA 2B59B 4XZUA 1X7TA 4KXZI 1MHCB 3GSXB 3FF8A 3T77A 1H0DA 3C5ZC 3DURB 4YHKH 3L13A 4YSDA 5DWUL 4JHWH 3B2MA 1YEKL 1CTMA 1CFNA 5D7JB 3IJHA 5AZ2H 1SQBG 1RZ7L 4JY4A 4AVKA 1DJGA 5LVEA 2AV1A 2BNUA 4JQXC 1YYCA 1P4IL 2JI3A 4QHUA 4U1JB 1TZIB 2DI8A 2CO4A 4LOVA 1U8JB 1EDLA 3CDGA 2DLIA 4WHTB 5E4EC 2XN9B 3RK3D 3V55A 3HI1B 3UJIH 5K9QG 1A0QH 2NYYD 3C9IA 1G7HB 1KMIZ 4PD4I 1PEZA 1DLFH 1FNFA 2W1NA 3B8SA 5EWIL 2IAMC 2WZ7A 1H6TA 2Y6SC 1NCJA 4IK7A 2BRQA 4CMMA 1Q38A 5F93C 3IGAA