5AVUB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 7.0 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avuB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avuB02
1JNMA 2E43A 4AYCA 5AW0B 3T97A 3SWFA 2Z5HA 5AVXB 1NWQA 2VRSA 3HE4B 1GD2E 4DZOA 5AVVB 1CSBA 1GU5A 2WPQA 5AW8B 3MD0A 5AVWB 1KQLA 4KHXA 2YO2A 2E42A 2C9LY 1H88A 3VN0A 1FOSE 3P7KA 2BASA 3V5BA 2R5BA 2JJLA 4C7NA 4B86A 2WT7B 3L35A 1T2KC 5AW6B 3TNUB 5AVSB 2YO3A 2W6AA 3UIAA 1CI6A 1IO4A 3WGUB 1GU4A 2R3CA 1H8AA 1S9KE 3VYIA 3NXSA 3TYYA 1SLQA 5AW2B 1GZLA 5APYA 2P7JA 1DH3A 3VMZA 3A2AA 2R32A 2XU6A 4JYCA 3HE5A 5AVRB 4I6MC 5AW3B 3M91A 5CMZA 3OAKA 4RESB 3L36A 4C7NB 2YNYA 5AW5B 5AVUB 2C9NY 3M0AA 5APVA 2H7HA 1HUCA 5APQA 1OXZA 4EOTA 1CI6B 1J2JB 1JUNA 3KQGA 4M3LA 4XE5B 1MFZA 3HTKA 4HYTB 3M0DA 3A3YB 3NMDA 5AW7B 1GK4A 2ZXEB 2R5DA 3VMXA 1X8YA 3A5TA 3HE5B 1HJBA 5AW9B 3V4WA 1S9KD 2WTYA 1A02F 2WWWA 1H89A 2QM7A 1CZQA 3HE4A 2WPSA 5AW1B 3TNUA 2Q7CA 3VTPC 2XZRA 2Q5UA 1A02J 2XV5A 1NAFA 1GK6A 1G2CB 3TK1A 4RETB 1HBWA 2KP8A 3I5CA 1FAVA 2Q3IA 2QM8A 4AQRD 3NTNA 1GTWA 3L37A 1OWAA 5AVYB 3A7OA 2ZFCA 3KDPB 3LIEA 3P8MC 5AVZB 3MGNA 3M06A 3WGVB 3NFQA 3V4QA 5APSA 5AVQB 4I2LC 4JYBA 5APUA 3M9BA 3O8ZA 2P67A 3P32A 1HWTC 5APTA 1MV8A 4AUWA 5AVTB 2WPRA 3VMYA 1MUUA 5APXA 5APWA 3IR9A 1FOSF 2P2UA 2N9BA 5AW4B 2W27A 3B8EB 3LIDA 3M9HA 1SP4A 2Z5IA 4C46A 1T2KD 4LC1A 2IPPA 4GKGA 2WT7A 4GT1A 1YYCA
chains in the Genus database with same CATH superfamily
1KPRB 3T0VA 1QD0A 4PREB 3C5SB 2NY3D 1DO5A 1OM3L 4UZSA 4OM0H 4X98B 3GJFB 4PJHB 2BSEA 3QDJA 3UYOD 4BKLB 3BZEA 4AM0B 2MPAL 4BFRA 5JW5A 4JS7A 5HDWA 2JCCE 3TA4D 1AS8A 4P23C 2X70B 2EIEA 1FNGA 3QXVA 2VYRE 2L91A 4KI5D 5DS8B 1QR1A 3I50L 1NPJA 3RWFA 3OV6A 1GR7A 3NJFA 4JFDA 3OAZK 5BRZD 3QIWD 5BXFB 4L29A 3TEUA 1SQVK 1XR9A 2IAMB 3OMNB 2DWDA 4IOSA 2VITB 1DQIA 4WWKC 3U0WH 1ZHNA 4ZFFA 1NVOA 2ZP0T 3F7YA 3B83A 5I74C 2Z6FA 3PNWA 3UG4A 4FYTA 2P47B 4LSQH 1SXNA 1ZHKA 1JF1A 1P5VB 1NKNA 1UKTA 1U8LA 2P44B 2WKOF 4H8HA 3ZE2B 4DT0A 3N3EA 5GS2D 5IMMB 4PJEB 5DUML 2F53D 1G9MH 1BZ7A 3ZRCC 3FMGL 5AOMA 1XCTB 3GK8L 4ZMPA 4N25A 4PG9A 3Q8EA 1NCWH 1J2JB 2WSCH 2A6IA 3D4CA 1UT9A 4Q0XL 5E8NA 4GJTB 5I2IA 2Q3ZA 1NLBL 3QH3B 1VQ7P 4B3VA 5GSVB 4B9CA 4YDLC 1TNNA 1T0OA 2LHAA 3LN5A 3VFVB 3WFZA 2OSWA 2XZRA 1N4XH 3ARRA 3KJ6H 1JPSH 2BXZA 4WY4B 1YEFH 4P5TC 3V5KB 1IKNA 3VDBA 2HLAB 3RUGE 1QVOA 3B4NA 1FZKB 1JF6A 5CEZE 1J86A 4OCSH 1JZGA 4DOJA 3Q1SL 2AEJA 1JMMA 4C56B 2HYMA 2CO1A 3P9MB 1AO7B 1KILB 4X99B 1YUKB 2AXTH 4GW4B 1VFAB 4FFYA 4PJ5A 1F4WH 4P4KD 3NIFF 3ARGB 3LSOB 1BG1A 4LMQE 5IFAH 2LVEA 4TVPD 1RQUA 2ITDA 4PUBH 3DX9B 3D69B 3TFKC 1P5UA 4A2HA 2Q86A 5BOJA 3A47A 4Y16C 2EIBA 3GGWB 4NT6A 4IU3B 2ZUYA 3SGDH 2A5UA 3QNXA 4GW1A 2JCWA 2PAJA 4X8JA 3WHXA 4ZNEE 5ETUA 5AW4B 2FBJL 3WNOA 2DD8L 2Q10A 3FL7A 5E5LA 4AG4H 3OGCA 2Q1KA 3SEPA 4Y1TA 4A2DA 2CU9A 2UXGA 3VD3A 5BVJB 3VH8A 4WHCA 4ZMNA 5JPNB 4QCIB 2R4RH 5EWIL 2PETA 1X7TA 4N0UE 4Z78A 1XF4A 3VYOA 3OL2A 3I74A 4JKMA 3ZRFC 4DP0X 5D96B 3RL0C 1ML0A 4FA6A 1VEMA 3B7UX 3CHQA 2H3XC 2IANA 3OKMB 1U91B 3EBHA 3MN8A 3L73G 1FH5H 1GCFA 5ANMA 4WHYG 1JGLH 5JNYA 1U92A 3Q7JA 3TA3C 2HRPH 2A74A 2WKLA 1JOCA 4NQCD 5C09B 3TCLB 2HX7A 2FIKB 4KROC 1H0TA 2EINB 3O11A 4MZIA 2NY7H 4GKZA 4NFCA 1FZCC 1URQC 5DZNA 4HD9A 4JFUA 3GXPA 4YR6B 1MHPL 3RVUD 3ZE1B 2W9DL 2FYYA 4XMLH 4IFMA 1BSIA 1MJ8L 2GUYA 2VLLA 3PUUA 4OVVA 2ZWLT 1AVAA 2BY2A 4WI9A 3TVMA 1AR1D 4OD3H 1NMAH 1VQ4P 4JW3A 5DD6B 5IB5B 1YNTB 4XAWL 5JZ7C 2F54B 3MV9A 4D0DA 2YMOA 2BDNH 5I1EL 3B1TA 4CADA 5JHDD 3I9AA 1R3JA 4NHCL 2E75C 2R9HD 1QUNA 3JWDH 1UADC 3C8VA 2OX5B 1LO4H 4XE0A 4L9DA 3VB9A 4OV5A 4RZKA 3TH4T 3EGSB 2YMTA 4WNJA 5I6NA 5KTBA 2RR3A 1VB9A 1UZ6F 2XV0A 3B8SA 3J8F7 5FM8A 4B53A 1MCQA 3GSRB 4GO9A 3SE3C 1SYSB 1WWAX 2YMXL 3B9KA 3MMEA 2DQUL 3WIFA 1QRND 3I56P 2F15A 5FHBL 2WSEJ 3IDXL 3HMXL 3P3RA 3MNZB 4RAUA 4A7VA 3OJDA 4AMKH 4CGTA 1OGAB 1BDDA 3R1GH 5F7LB 4ANWA 2LU5A 4M8UA 1HKLH 1X5YA 2ZE0A 3OMIB 5D55A 1ED3A 2X9YA 4AJYV 1BFVL 4L4TD 3UBXI 2PCXA 1ZTXL 4AQRD 1ZSDA 5BNXD 3ULVD 1XGYL 5EBLB 1JNHA 4LL4A 4OKVA 2CHXA 3DROB 1ES0B 2R4SL 4JE4B 2J6EA 1JFHA 5LGHL 5DUPH 2DBLL 1C5CL 2WN2A 5I9QB 2WSFH 1NINA 3K0YA 5C0RL 1PJWA 2P67A 2VDMH 4DESA 1RJYA 1SDDB 3P32A 1UOLA 12E8H 2NCEA 5DHVB 3X1NA 4PRDB 2MNWA 3WFHA 4KK5C 3DIVA 5T1MB 3QDME 2ZXCA 3LPPA 3FU7A 1I7ZB 4OF7A 4IS6A 4KJYB 5GGTA 1HF9A 2DW3A 1MJJB 1CE6A 1OAKH 5FOBB 2ICWB 5E1IA 5EZIL 5CBEA 5JPMA 2J43A 1IAOA 1MFEH 3VD1A 5JW3L 5B4MC 1KENL 5ALBH 2X4TA 1SVZA 1S3RA 1JCKA 4WJG3 3H9ZA 4AGNA 3FUKA 4Z5RA 2LLLA 3G08B 4O02L 1MW3A 2OJEA 4HV8B 4R7DA 1RZJH 2FECL 2LGNA 1FJPA 1V05A 1QBMH 2EIZA 1F4AA 3CH8A 4JHWL 3RHWK 5IW6A 1ZR2A 1CFQA 2Z7YA 4EN3A 4LK4A 4JCWA 1EHLH 1HINL 2VAAB 2BHZA 3LZOA 1W6WA 4I3SH 5F44A 4N68A 4ZMDA 5B3SB 1RP8A 1VCBC 3HUSC 3W67A 3VRIA 1VQLP 3FRPB 4FCHA 4P9ML 1WA0X 5F96L 3CCJP 3IMSA 2A6DA 5C2BL 2GITB 5CJQL 5JUEH 3WS3B 4N3YB 3DHUA 4FEIA 3VO0A 5I1CH 4NP4L 2ITCB 1FS0E 1NQBA 4PV1D 2PCPB 4Z0XA 3MUY1 2APXA 5HHQA 3AM8C 1GJWA 4DP6X 3H2QA 4YGVA 5ID0B 4GP4B 2H6PB 1A4KA 5IUSA 4K8RD 4EDFA 3HUJB 2BWQA 2CH8A 3HZ3A 5C0BA 4FFZA 1OL0A 2WLHA 1Y7VA 4OZFH 1OTSC 2COVD 1UM6H 2R8SL 4CN6A 4ODWA 4AEFA 3H1HD 4A6YH 1FAKT 3ELAT 5AYUH 2DEWX 1U8NB 1KTRL 4HUXA 2CK3H 3FO1B 3VFOB 2CGYA 1JRHI 2WIMA 2ZYSA 1YJNP 4FTVB 2MCMA 3K72B 4OM0L 3DRQA 3ECBA 1IGCL 3CX5D 3D3VD 2JB6B 5F97E 3WDHA 1QLED 5JHDA 4HWBL 4WTXA 1OP3K 2H88C 1HI6A 1V5JA 4GRWH 5L2KA 1XGTB 4Z7NE 1F18A 5B39B 4W9CC 4F7PB 2KYIA 5IMKA 2VDNB 1IBFA 3F7LA 1EX0A 4G8EB 4L3CA 2DQTL 1E4KC 4FG2A 4BCXA 3OAUH 1LK2B 4NRYB 3ATBA 1I85C 2BNRE 4G7QB 4WQOA 4XI5C 3BQUD 3QQ3A 3U0WL 1ZN5A 2ZYGA 4H25B 5FS5A 1WZKA 3IFLH 2DWEB 2EDJA 2VSKB 2VISB 3K6FA 4PJGA 4DT2A 4LSQL 4ZMTA 3T0EC 4G6MH 2IGFL 5L8JB 1UM5H 2HH0H 4KXCA 3VSUA 1RSFA 3OJVC 2EVIA 3APCA 3EUUA 1ZRTE 5B1CA 4DGYL 4DVRL 3L72J 4MMYB 4DQOH 4PJ6A 1ERNA 3WLBB 1G9ML 3UPRA 5HDBE 3TNNB 3FRUB 4M6NH 4HBCH 2ZWSA 1IFIA 1NCWL 4N0CC 3E3QE 3HG1B 4H8UA 2DI7A 4G8FB 3ZZSA 2TRHA 5KVEH 4PBVC 1OB1A 4I2XB 4HPYL 1DSFH 3JV4A 3T3MF 2XWDA 2BCCJ 2YD7A 5KBMA 1IBYA 2JIXB 3V2QA 1NAMH 4MHHI 4K3JH 1H3VA 1AHWB 2VRSA 4GUPB 3VX0A 3L7FA 5EZOH 2HFFA 5DFVD 5E9DD 1IAII 1NBZB 1ZS8B 5KAFE 1PMYA 3KJ6L 5DEZA 3AE4C 1JPSL 3FYIB 4L37B 4MMZC 5BZDB 2UY7B 3W68A 4C8XA 1YEFL 5DJ8A 3ARBB 4JO4H 2P8PA 4WB4A 4JO5A 3U4EA 3QT2A 2PPCA 4B86A 4X4KA 4E9SA 2AMGA 4OCSL 4ZW8A 4ZFOA 4DK6A 3AT8A 4W80A 4PJGF 2B59A 4N85A 1SY6L 3QJFB 4XRCA 4ZMZA 1H8AA 5KANI 1WFNA 5LGJA 3T0DA 4GP8B 3H1KD 4PLNC 4PUBL 2PCFB 2C9XA 4FYSA 4ZSOB 2KLVA 4X0KA 3S2CA 2D2CC 5J12C 5E0FA 5IM7A 3PDOB 4HJJH 1WCBB 4ZG1A 3PJSK 1U4EA 4HUWB 4P49A 3V5HA 1E28B 2NT0A 3PDGA 2C9NY 4ODVH 3ZR6A 3RTQB 1XTCC 1XGUB 2YUWA 3MRBA 1QZ1A 1D5XB 3Q6GH 1IFMA 2XLLA 1TQBC 2WBXA 1FL5B 4P5SA 1SLXA 4DP1X 3VD2A 1X7QB 5AAWA 2LTQC 1S9WA 3QFGA 3UXFA 4N78E 2R4RL 3BKYH 3WMQA 4H26B 1LEIA 5HY9A 3MJ7A 1WF5A 2IADA 3E8UH 5EIIB 4N1HB 2QADD 5DMKA 2X4PB 1V3LA 1GL2D 3QFJB 4J4PA 3PHOB 4KK9D 4JZOA 2C0WA 4K3DH 4ORZC 3FCTB 4GH7B 1D6VH 1FH5L 1RPKA 1T7VA 5GGSA 3N1PC 1JGLL 5EOCH 5HYSB 3W9DA 2V2TA 3K80A 3ZDYF 1V7NH 3MLXH 3ZYZA 3N06B 2Q3IA 5EFIA 1IE5A 2NY7L 5DT1H 4PS4H 1TJHH 3WY1A 3WXWH 3KVPA 1VDFA 3KDPB 1NBYA 4MQ7A 4UTBA 2YD1A 15C8H 2KLRA 4FQCH 2PXYB 4OCRH 4C57C 4XN5A 4IW4C 3QUXA 1BIIB 4HBQA 1AGBB 3V4UH 4OD3L 1NMAL 3SKNB 4FCAA 2R59A 3N0PB 2XTJD 1QABA 2W59A 1ZANH 4W9EC 5IROA 3VXUA 2CUMA 1G7MA 2ESVA 2BDNL 3ARVA 3GXNA 3L3IA 2HODA 4NHUB 2Q7YB 4B0MM 3TM6A 1BGXH 1A2YA 1Q9LB 3LEXB 3TCXA 3SSGA 3HD7A 4AOFA 3FT4A 4RGMC 5IBTH 1PEZA 3JWDL 2EDQA 3F7QA 1NWOA 2IX7C 2QSQA 3FAWA 4XXWA 3LQMA 2Z4EA 1FHNA 1TG8A 2EACA 4YHMH 1LO4L 4R8WH 3FOMB 3X12A 3IVKA 3FU8A 2HX8A 5CU9A 9PCYA 4HW6A 4K07A 1JNMA 2IQ9H 3PWPA 4ALAL 4EQ3A 2O01J 2VR7A 1I1AA 2XACC 3GIVA 4XFJA 2EECA 3FONA 3UBFA 4AMKL 1E5ZA 3TV3H 3BIBX 1JK8A 2B8OT 3C5JA 1WWBX 2C3VB 1TJMA 1HKLL 1NCJA 2J3SA 1D9KA 1AY1H 2VR3A 7PCYA 2UVEA 4NQSA 2IBZY 5HGAB 4C55A 1LTIC 3DVNB 4U6XB 5IIEB 3V4PB 4FQLL 1ONQA 3RQ3A 3IMTA 4PD4J 2M1KA 3P9LB 3RK2B 4FNLH 2H0JA 2YZ8A 4OZ4A 4F24A 3AT0A 4HH9B 2P80D 3HS0C 1UG9A 3L6FB 5DUPL 1S9KE 4OZIF 3CWBJ 2VDML 3CC7P 4QO1B 4A2FA 3LNHA 1Q7YQ 4JFED 1XWVA 5EU7E 4AE0A 3KHQA 5I1DB 1NC2B 4YSDA 1E67A 5IOKA 2B7DT 4HUUA 3U6XA 4X4XB 3BUBA 4ELMB 5I5IA 2Z4QA 1N73A 2H5UA 5B3JE 1QSED 3MV01 1KCKA 4D3CH 3GTTA 4U1HA 4X5RA 5I76B 2A4ZA 3Q2LA 2B77A 4ZS7H 1OAKL 5J9PB 1OVZA 3K4AA 2R15A 4XPHL 1BVNT 3SGEI 1ZVHA 3RGVB 1I1FA 2HPOA 1N0LA 4Q8BA 3VU1A 1AS7A 3KPLB 1JZEA 2R0WH 4KXZH 1JHTB 3DDGA 3FSOA 3QDAA 1C7SA 1R24B 2RQEA 2UZXA 4JGNA 4D7BA 2NYZA 3M07A 4PCTA 4I0PC 1BCCJ 1QBML 5F3HB 3D71A 1J5IA 4L4VA 5IB3A 4QLRA 5IESL 5TE4H 5IW1B 4U1SA 4I3SL 3F8UB 3VFRB 4C83A 4ETQB 1YA5A 3BZ5A 2B87A 1XX9C 3S3CB 4KNSA 5T3ZD 3CZNA 5JUEL 3EBAA 5IQ9B 4G42B 5I1CL 2QLYA 1XF2B 5K9KB 4AKPA 2BPBA 1CXKA 2ZF8A 4EZJA 1Q1JH 2J6EH 4W9KC 1G7LA 3ABZA 2BCMA 1VQ8P 1DVSA 5IVOA 4Z76B 4DAGH 2X1QA 3H54A 2QIWA 1XV8A 4HK3J 4NJAH 5D7JB 3C9IA 3FQUB 1X6LA 3LKSA 2MTAA 5D7LA 3DBXB 1J5CA 4X0NA 3RL0g 4HK0A 4JKPL 4A66A 4A6YL 1X5AA 3ABGA 2KZKA 5AYUL 3DSFH 3QDGE 1IC0A 1VEPA 5FGBA 5GGTH 3SE6A 1SXCA 4IEFA 5EC2A 1R5VA 1EEZA 1WO2A 3PREA 1UKSA 3BRVB 1ZA3B 2DQ6A 5CSGA 4E9QA 1C16B 2WBJB 1DQTA 2VM9A 4NO0B 4IRSD 3D06A 1BD2A 2BOBB 2CDEA 1U2YA 3QUZA 1CFNB 4HU8A 3PLNA 2DIAA 1FNEA 5DZPA 3O2DL 3GUTA 3DYPA 4RX4A 3BCFA 5E4EC 1MUJA 3K5BA 4ZKUA 1KYOK 2GJPA 3KHUA 3G5WA 4F9LA 4GQQA 1OAZL 3S37H 5TJHA 4AKQA 1J1DB 5ITFA 5F1IA 3CFJA 4ZW5A 2FSDA 4MAYA 3ILDA 4P2OA 4MJID 3IFLL 3VVVA 4R83A 4U1JA 4YBQC 1HESA 4BK5A 4HIJB 2FFDA 1UM5L 2HH0L 1CU4H 2WVUA 4QYOA 5GGRB 2YD4A 3L75J 4HAGA 3DVIA 5E94B 4AQ1B 3QO1B 1A6AA 5L8LB 2RALA 3OAKA 5CINH 2HLFC 4DVBA 2DM3A 4AQAB 4M7LL 3M0AA 4M6NL 1VACA 5I73B 5APQA 2NR6A 4DH2A 5C97A 2VUKA 4JM4H 1VRSA 3PNRB 3UYPB 5KVEL 1OD7A 1WIPA 5KN5B 5KLVJ 2I5YL 2XFXA 4EI6B 3T1FB 1DSFL 1AZNA 4XBMA 1OP5H 5C08E 1R4XA 1M1KQ 2QSIA 3REVA 4BELD 1NAML 3QIBD 4K3JL 3EBGA 3T2PA 3W81A 5EZOL 4Y5XA 1CICC 4ODTH 2VLJA 2BNQB 1NDGB 1EUTA 3EYQC 2D73A 3EO1A 2YKQA 2ARWA 4JO4L 1O7SA 3VI4E 1BYOA 4N90D 1DEEB 3R0MA 5FKAB 4Z7QE 2PYEA 3SPHA 4HH8A 3UAJC 3OR6A 5B21A 3LPFA 3GF7A 2MCG1 4HZ1A 1D5BA 3D0VB 4HUCA 3V4QA 1M57B 4ATWA 1Q9WA 2J21A 2VQUA 3IEAA 4GQZA 3ROOB 4JFHE 3SB3A 2VN6A 1MW1A 3Q13A 1DQQA 2B14A 1SN0A 1MQ8A 4DGIL 4XWOD 2I9LB 2Y5TA 3AE9C 4K7FB 2HB0A 5JOPE 4HJJL 5D72L 4PW4A 1MUUA 3N43F 4MXVE 4EDXA 3RZWA 3VH8G 5JA9A 1JB0J 3FU0A 3QHTC 1EO5A 1HYRC 1FG2A 4ODVL 3TIEB 5K1VA 3ZK0A 1NBVH 1MAKA 1J5OH 1TCRA 3VG9B 3Q6GL 4XOEA 1NFDF 3CFKA 1T1ZB 3JTSB 2R2HB 3HG4A 4N8PA 1XIWB 4P5MB 4H8PA 1UXSB 3P0YH 4YHIA 2Z8WC 4J3BA 4AE1A 4OCXH 3WKPA 3W38A 5KAFH 5E56A 1CF1A 3BKYL 3NJLA 3TZVD 1EAQA 4NUGH 1IBHA 3DUSA 3D2UA 3E8UL 2CO4A 3CH1A 3O8XA 2QHRH 3X2QB 4K3DL 2AQ1A 2C9RA 1D6VL 2LR2A 2NQDA 3GF8A 2FJHA 3NT0A 5E2UH 3IMBA 5EOCL 1QTYT 1UB5A 5INDA 5D1ZB 3U7YL 4G9FA 1V7NL 4MX7B 2OMVA 1IQDA 3MLXL 4LCYA 2FWSA 5EU4B 1EZVI 4KRPC 2EDYA 4LCUB 4PWEA 4BFIA 1UWGH 3FOLB 4AGQA 2VN3A 1TJHL 4PS4L 3CBKB 4WW2B 4XCNA 4WFGE 2C4FT 4O9HH 2IDBA 1YY9C 4OCRL 3ARDA 1T20B 1JZFA 1KIPB 5EBGA 4ZQTA 1BYNA 3V4UL 4E42B 4KU1A 5AW2B 4HS8H 3KLHD 3ABKB 2X1PA 3MJGX 1DH3A 3MHVA 4FFYL 5I1JH 2ATKB 1DN0B 5AVRB 2VR5A 4Y4KC 5TDPB 1DBMH 1Z9PA 2NXZB 2VE6B 3ILEA 1X9RA 4Z7VB 1O5DT 1MHCA 5TGBB 1T8ZA 1F3JA 3VWKC 5DQ9A 3FNKA 1CTNA 2XXFA 1Z66A 4YHML 4R8WL 5H8DA 4QF1B 3VXPB 5GJSL 1L0XA 1RAMA 3MA9H 1RZ8B 1GW3A 4Y7MA 3V0EA 5LNGA 5AOIA 2AVFA 1HAWA 3D0LB 2BCCD 2HN7B 3WNLA 2IQ9L 2E76B 1QX8A 1OZUA 1X8YA 1HK6A 3Q01A 1FYTA 5KUMA 4MJ5A 2K9YA 4N2HA 5A6IA 5AYTA 3RIFF 3L5HA 1OO2A 2YUVA 3JWDC 3SBWA 4XZUA 3CSPA 3VXOA 5A2BA 3CFIC 3TV3L 4P2QA 5IEHA 2VCOA 2MQ3A 1L9RA 4G6AD 4KH2A 2W60B 1AY1L 4RISH 4GIFA 5JW4N 2IXQA 3D05A 3BVWA 4GAGH 5CFAA 5I0VA 5BRZE 1LDPH 4Y1SA 1L0QA 2ZUTA 3SJVE 4PPTA 2F53A 2AK4E 1SMAA 2WYTA 4KJQD 4OLVL 5D2LE 4ALAC 1ZIBA 3SO3B 2P43B 1H8SA 5FA4A 3TC9A 3FQXA 1Q38A 2UVFA 2FD6H 3Q1EA 2OI9C 2VJ8A 1AKJA 4WBAA 1DBAH 4UTBH 1YN6B 2Y0CA 4D7PA 1FFOA 4PJFA 5I8KH 3MJ8A 4KRNA 3UAFA 4AEEA 3P4NB 2X28A 1UURA 3L3JB 3SDAD 3L95A 1QSFB 1CTOA 4A2MA 3H2PA 3MRRB 4L1SA 4N22A 2Q8AL 4YSSA 3GS7A 5F6HJ 5C0CD 5I1LB 4ZS7L 5D7IA 3FSWA 3BVXA 3QUYC 2VXUH 4IK7A 5CKGA 1R34A 3TYGH 2OZ4A 3EH2A 2FT6A 3PCYA 5DK2A 2DKUA 1NUDA 3O2VH 3RDTB 3WO4B 4ETYA 2WMPB 3JVGC 2R0WL 5DUBA 3BP5A 5A7BA 2W80C 1JG9A 1FL6A 1G0XA 3B9EA 4QPEA 3KXDA 3P4OA 4R7NA 5FX3A 4AV5A 3MD0A 4YBLC 4EVNB 3VSTA 4XC3H 3O41A 4QHUB 3QJZA 2M5AB 3GSXB 4XX5A 5TE4L 3T6ZA 1F8TH 3LNDA 2B08A 3WKYA 2VZVA 4KDVA 4X8XA 1WAAA 1HJCA 3V4LA 1IARB 4E5XA 4DCQA 1TO4A 2V37A 1YNKH 3DXAD 4PJFF 1KMGA 1CLOH 3IJHB 3QIUC 3Q1MA 5KKZB 1VIWA 3GSQB 3F5WA 3QZNA 4K7PX 1PJ9A 4MNQA 3U9UA 3PL6A 1Q1JL 2J6EL 2OMWA 4X6DB 3VXMB 1AQ8A 3H1JD 3MOAH 1Y47A 4X6CB 1DQLH 2GJZB 4JFSA 4WUKL 3EJZD 4FJYA 1N3NA 1XO8A 1OD9A 5D7IF 4J3SA 4KQ3L 4C7NB 2A73B 5I23A 5J3HC 5C8JB 1UD8A 1N68A 3GEWB 5I24A 4L8SB 1DJHA 3SPIA 1JL8A 4ZOAA 3BSGA 3UTQA 2AJZB 1Z5YD 4P3DB 4NQCA 5GGTL 1MVFA 2Z92B 2EUXA 4IOIB 4EI5C 3I75B 5G5DA 2BNUA 3K8MA 4UAOC 2FXOA 3BH9B 5E6ZA 2GSIA 5EZJB 5F93C 2OFQA 4OUUA 4R0LA 1FNSL 2YSTA 3GMQA 2DI9A 3ZKQD 1CZQA 5BOZG 1WAAF 4HKJB 2QPSA 5KJ7E 3HW7A 1JZ4A 2XBTA 4RRPM 5C6PB 2OL3A 4OLWH 4P46C 4IGBC 4HZLB 2P3YA 1J05B 4GKSA 3UMTA 4KO9A 3IMRA 4PD4D 1B9ZA 2QQLH 4QRPB 3NGBC 5KBKA 1ZMYA 2A06G 1KYOH 4Y4HD 3ZX1A 1IV8A 4D9QD 5AVZB 3KYNB 3Q06A 1Z32X 4OJFH 3K74B 1R5LA 4JQ0D 1JVOA 1Q9KA 3L08A 1U8QA 5CP7B 5J1SC 2VDOH 2QQKH 4RRPG 1JD9A 4CU8A 2G9HA 4DERA 4HSCX 1MCCA 4ASWA 4LVEA 3VP8A 1I1CA 4R97B 3BCCG 2G0LA 4HHAA 4XO5A 3SDCD 4AVKA 5IK3A 3TOPA 3GRBA 3N85H 4JM4L 3NIGF 1SS1A 1U3NA 4FFZL 4F3FA 1PCSA 1ADWA 1ZRUA 2KI6A 2ICWJ 4WENB 3WUWG 1UGNA 4L9LC 2X87A 3TIDA 1CN4A 3ULAB 2ZCKH 1J1XH 5BZWB 2GT9B 4K71C 5FCUL 2MPVA 3LQZA 2D9CA 5DYOA 3FUJA 3J7HA 3BPLC 3B6SB 3IU3A 1J0IA 1QRNE 1MH5A 2HT3D 1JWSB 5ISZD 1N9PA 3W3BA 4LNRA 2HMIC 3GBEA 4ODTL 1HEZA 1T5XA 1K6QH 2ZCHH 3V6OE 2R0LH 3FB7B 1BCCD 4LPWA 4HALA 4L73A 2NSXA 1LO0H 3ZDXB 4MVBC 1G7QB 4N6RA 1BVOA 3UX9B 3MIWA 2OMYB 2XDJA 5LKNA 3IF4A 1E4XH 7PAZA 1NCNA 1RIVH 4XMKH 1X4YA 5L4MA 4D9LH 4KXAA 1J8HB 4U7MA 1E9OA 3HG3A 3VXTB 3TS8A 3QPXL 2PWFA 2ZUQC 2BVOA 2NTFB 4X7SH 2Q7NA 5IF0A 1PKQA 4F91B 2XTLA 3LW5J 2DQHH 3HVDA 5F6IC 1F58H 2NZ2A 5KBLA 3WU1A 4U3FJ 3QQXA 3RVXD 1W80A 3WJLA 2VLKE 1G1OA 3F58H 3GPSA 1MLCA 3T5WA 3HR5B 2ZSWA 1KJVB 1UEMA 1O9ZA 1NBVL 3TCTA 3APNA 4CNIB 1J5OL 2Y1AA 4Z1MH 3HRNA 4YK4B 3CWBG 1F6AB 3F6JA 3P0YL 4WUUD 3ULVF 3GZPA 1YG9A 5J7CC 1KBGH 4OCXL 1AMXA 1JY3P 3M86A 4ODXB 4ZS6C 1J0YA 3HZKB 2GY5A 4LIQE 4KZ0A 3RNKA 2IDSA 2H0EA 2DBJA 4H13D 3PHLA 1TCMA 1DZ0A 1JWUB 2ED8A 1T22B 2OMZB 2QHRL 43CAA 1NDMB 1E27B 4RNRB 3LIZA 4GUCA 1JTOA 4ZTOH 5AZUA 1C8PA 5E2UL 1HC1A 1MCFA 1XGPB 3OKEA 2GJ6D 4KBPA 4LHQB 4AYGA 3WNPA 2XQBH 3C6SA 5HGBA 4Z3JA 1SQXJ 3CXHJ 2WNXA 4RETB 3VVWA 2XQYA 1QPXA 4QEGA 2QMJA 1UWGL 1IGJB 1P7QD 3OX8B 2EEBA 4MAUH 2RKLA 4O9HL 3D12B 3WG7B 4ZFOL 3U83A 2RB8A 3IDYB 2H1LM 4K7PH 1KPUA 4DPBX 5GIRB 1M90Q 4HS8L 3K91A 4NNYA 2EUZA 4JO3L 3L4ZA 3G9AB 5I1JL 3L75D 1IKNC 1DBML 4P5RA 4FFWD 4F92B 3OG6B 3PFQA 3D3VA 1R3LB 3UTSB 2K4AA 2X4QA 4PJ7A 5LAXB 3V7AG 2YRZA 2CO7A 5DJ0A 3VFPB 1KXQE 5KBNC 4RGND 2WQXA 3AE7C 3KR3H 4NJ9H 3MA9L 4A67A 4DETA 1CI5A 3W0WB 4KV5F 3SFDC 2IPUK 1I4FB 2E8ZA 1YLBB 4PJ9D 4GY4A 2DQJH 3ULSA 1TR7A 4MYPA 2NLJA 5CMAB 5L0QC 1P5UC 3CX5E 1S7UA 1JGDB 3E1RA 2DYPA 4L05A 1T6AA 3BQUA 5FYKE 5IHUH 3LJ3A 1QLRA 3DMMD 1KQLA 2HVJB 2PWHA 2X0WA 3E8VA 4JLRA 1GS6X 4JFFD 4RISL 4WDIB 2YAPA 3KPQB 2G30A 1AVYA 1RUQH 4M61A 4ODUA 1F42A 3L3DA 3OJ2C 1LDPL 4AJVA 1S5LX 1TTFA 2YXFA 1JUFB 3TEZA 4ZNCA 3TPUA 5KYYA 4NKOA 1S7TA 4X9FA 4MKMA 3GI8H 3VP9A 2FD6L 3GHEL 4GFXA 4QRRB 4PW9A 2CUAA 4O51B 4UTBL 4BCYA 4F33A 3T3PB 1AJ7H 1EO7A 1U2HA 4QHNB 4X6FA 5SX4I 1THCA 2B1HH 2FTAA 3GXUB 4JPKH 4PJ7F 5CD5D 2A74C 2WNWA 2E74B 1ZLUK 4S2SB 2IDUA 5DA4A 1B0GB 1E2ZA 4V1DB 4MCYB 3JSVC 1B0RA 5AVUB 1TF4A 2AP2A 3CQPA 4DEUA 3CX5K 1UCTA 3EH5B 1J7VR 2VXUL 5KAIH 1NOHA 5I15H 4J27A 3TYGL 5A6LA 1E5BA 3O2VL 1SEBB 3TVMC 1UOWA 3WOVA 4A63A 1M42A 2W9LA 3KWTA 3K1KC 4JFZH 1ZLEA 5FF6A 3NCCB 1KV7A 3NJXA 2MQ0A 2VLRB 3E7KA 2WXRA 3GJEB 4HJSA 5DJZB 1LE5B 1OF0A 4IBLT 5FDWA 2FNBA 3EOAB 4F2MB 5IB4B 3TYFB 1RJLB 4PRBB 5ITBH 1S7WA 4N3TA 4XCFH 5CIPA 1G7PA 1K9MQ 2X7LA 2RACA 3D51A 1OW0A 1T3JA 1HBWA 1F8TL 32C2B 1L9NA 3VX1A 4XMXA 4ZYKB 3TBBA 2DJ4A 2AJ3B 3RU8L 3GSNH 2J2ZA 4AW4A 5MERA 1BQHB 2E7MA 2XA3A 3E6FB 2TSBA 3F04A 4NAMA 1YNKL 2VC2B 3H8NA 3LKQB 1JD7A 1MCHA 2Z7UA 1CLOL 3T2NH 5GS2H 1PF3A 4IIZA 2IAMD 3GMRB 3MV8E 3HCVA 1LE9B 1FVDA 1QFHA 2YGQA 2UWEE 3B9KC 5GS0D 2G3NA 5GTIE 4S0SD 3MBED 4TRPH 5G55A 3RVWC 4U7SA 3MOAL 1IZKA 5H35B 2VDPL 3FYEB 4OIIH 1T66D 2J72A 1I8AA 3AAZA 4WFHD 1ETZA 3HZVA 2OXGB 3DJSA 3QAQA 4IU2B 3UTZA 3FO9A 4TUKL 3TESA 1IJNA 4HEMA 2QKIB 2AEIT 4F7CB 5BJTA 3H1LG 1PZSA 4H0IA 2BVTA 4JFYB 4IL6E 1N5AB 2DB8A 1IT9L 2KI7B 3KLSA 1J8RA 1KIRA 2YEVB 3WJMB 3DETD 4LCCB 1JZ6A 1IBZA 5D6DC 3ARFA 2PP9A 4QRAA 5DD5H 2PKDA 2QT6A 2OKMA 2OZ4H 3MRNB 4Y88A 3ABVC 1MY7A 4NUJB 3FUMA 1L9QA 1VENA 3QAZC 2D0FA 2V7HA 3HB3C 4UILH 4KTYA 4OLWL 3U82B 1J1PL 3NOIA 4FG6D 4KI1A 4C47A 4YZWA 2LLNA 2DQIL 4KX7A 2VABA 2AITA 4PSPA 4HC1H 5JPMC 4TVPH 3L70J 2QQLL 2HPCB 4POZD 1HL9A 2BMKA 1SJEA 4ODBD 2GTWB 4I88A 2A0LD 4LEEA 4OJFL 4J8RA 5F7EL 4ZXBA 2OCCB 3Q6FA 3NXSA 3RA7L 3ARYA 2H8PB 2VDOL 3ARGD 2QQKL 4G5AA 2QGBA 4XGZB 4ZX5A 4NX0A 2UXTA 4M03A 4EN3C 3MR9A 1I8KB 1DVFC 2OP4L 2FZ3B 3QDHA 4ACTA 4K55A 2ERJB 3N85L 5IB2A 2Z1KA 2X0VA 3X1EA 1BFSA 4Z0BH 1KFAH 3MO1A 2OTKE 5I17A 3P40A 1A4AA 2C3WA 3WHE1 1SN2A 1UGKA 1IEHA 4APQB 4EBQH 3C1LA 1WC7B 5KVFE 2WXFA 3BP4A 2IO5A 4Y2DA 4OH8B 4R5VA 1N10A 2FLRT 4ENZA 5K5YA 3N55A 4V2CB 1GHFH 1ZHLB 4J3XA 1K85A 1RIHH 2CALA 3S3SA 2ZCHL 2R0LL 2X4OB 3QZWB 4TQEH 5C07A 1USEA 2WPSA 2Q5UA 3EO0A 4G5ZH 4R7LA 1VADA 1NTZG 3I6GA 3TO4B 2V7QH 1E4XL 3GQFA 3B5NC 5C09D 4NUPA 2RJMA 1HSBA 4XMKL 3MRLB 3RFZB 4D9LL 1AD0B 2FAUA 3ZL4H 1JGEA 3BC9A 2OV0A 4Q6IB 2AGJH 3CFUA 1L7TL 4X7SL 2J5UA 4PRIB 2QBWA 3NIDF 2EE9A 4IRZH 5EO1A 4P57A 1PQZA 2EYRB 5C71A 1F58L 2E0PA 3WCYA 3L9BA 1WBXB 5ILTH 1IQWH 4PWGA 2FNWA 3SY6A 5AVTB 3DX8A 5ADPH 4DNLA 1DJXA 1KQFB 5BCAA 2QJPC 1NMCB 2OYMA 5FAAA 3VXQB 1I8MA 4M93C 2F68X 1NAMB 5FO7A 2JCCB 3F89A 1GRWA 1JZ8A 2ZKMX 5C9JB 4YSAA 1IJDB 4C46A 1R75A 2DIEA 4ZDHB 3SKMA 4L75A 3EYOB 3L9RB 1HSAA 4JFOA 2X42A 4K5OA 4JREB 3NCYP 1EJFA 1SF5A 4WEMB 2N7SA 2G3XA 4S1QH 5DURB 4NM8H 1DN2A 1E8ZA 4ZPVA 4ZTOL 2EYSB 5JXAH 3STZB 3ULVH 4KKLD 3SGKA 4BSJA 1DJSA 3AZUA 3F83A 3H9SE 4BFBD 1H3XA 3OKDA 3WU2E 1OGAD 3NP3A 4W9DC 2QVFB 1MKFA 2P24B 1WZ1L 3D5OF 2GYSA 4ERSL 4WKZA 3OPZL 2N0MA 4UYPA 4YIQB 3JXAA 5C6WH 4X9YA 1A6TA 1KCSH 4MAUL 5DC0A 5G4MA 3N42F 4W68A 4NKIH 5A40E 4H1LA 3X14B 3GRWA 1OHQA 4K7PL 3V0HA 4BWUA 1EEQA 2XPZA 3NCYS 3FQNB 4QXUH 5ICZB 3LKOB 4RJTA 1IM3D 5IKCB 5INCA 3FGAD 1SDYA 3A0BE 4HKZH 2NX5A 2QDVA 3K71B 1TTCA 3EG9A 3T2QA 4Q4IA 2J1XA 4IRSA 3UO1L 3QQDA 1A64A 3DVGB 4WI0A 1VGEH 2BVQA 1ZV9A 1JN6A 2HG5D 1EXUA 1HUCA 1MW2A 3MTRA 3PAZA 1CI6B 1VESA 2FYUJ 1EDKA 1PGOA 1DUYA 4FS0A 1N8ZA 1F90H 4NJ9L 3RUGB 3QZOA 2L7QA 5D8JH 4L8BB 1NTKJ 2Y5QA 3QNYA 3WTUA 4Y5VB 2DQJL 3VMXA 4IOFD 1M7IB 5DRNA 5HHVH 1W0VB 4L48A 5IHUL 4PSRA 1SRDA 4U1MB 1SBSL 1QFOA 4XBPA 3HZMA 1HCYA 4O5LH 4JQIH 1OXYA 4X4YA 5CD3B 3RURA 5FO8A 3HRZB 4LAQH 5DVKA 3SGJA 1WGVA 3TNMA 1J1EC 2ZCLH 1HNYA 3BZDA 3T4AA 2NDFA 4EQ2A 5CGBA 1KMIZ 3M1OA 2WKGA 4HG4J 1HQ4B 5HI5D 5AAWC 3ZGHA 4HMCA 1YEKH 2W07A 4K8RH 4OIAA 3ROLB 4MJIE 5A3ID 1HIMH 3NCBB 1S7SA 4GXVH 4LSUH 1N19A 4G2AA 3VG0H 5IG7A 1U6AH 1TQVA 2YS4A 3E1F1 5E8PA 4KTGA 4J4PC 2IANE 3H53A 1UZ6E 2DEXX 4QRTA 4YHOL 2AJVH 2KS1A 1P0SE 4YHKL 5ID1B 2X10A 4JPKL 2B16A 2B1HL 2Y7MA 2Z31D 3FFDB 4N0UB 3MRGA 4IKLA 2ODHA 3HJEA 3QEHB 4BZYA 1AH1A 1ZLUH 3B5GA 4HQQL 4RAVB 2LOEA 3E2HC 1A1OA 1ZSHA 4ELDA 2PO6B 1VF5B 1A14H 1FRGH 1RZIB 3CPUA 3MLYH 3QUXC 4K5PA 1LTBC 4U05A 2CD0A 3UMNA 4AI7A 4D2NA 3RWCB 2WZ6A 3RWDA 2MRYA 4FQIH 4CVZA 4M1CD 4IRJA 4I1NB 5IROC 3AEEC 1HTYA 2WLLB 3NJJA 3F6LA 4X50A 2V7NB 4KK8C 3PHQB 1XGRA 2I1KA 1S9VA 1NUFA 3QEQA 4E5XG 3HD7C 4TF4A 5ITBL 3QRFM 4XCFL 3CXHD 3HC0A 1LT1A 2XXCB 3BRTB 4XXWC 1KJMA 4AV0A 1FG9C 2YEZA 4FQ1L 2YXWA 1KFGA 3HI6H 2DLHA 3C75A 1BPLB 3NN8A 4R3SA 3T2NL 5BZZA 3NA4A 4GLRI 4PM1A 3ZKXB 4K3AA 3NJMA 1B4JH 5LJYH 3HE7B 1I1AC 5K9JH 2DJMA 2KNCB 3BISA 4XN7A 4U6VH 4OIIL 2IC2A 3AG4B 6FABH 1OM9A 3VFUB 5E8DH 4MYWB 4K0OA 2YOCA 1D9KC 2X2UA 5HJ3B 1KTDA 2R3SA 5CCJA 2P5WD 5DSCA 4YSRA 1OAXH 4WVRA 3PWJA 2AQ2A 4FF9A 2GPZA 3IDJB 3FH5A 1JY2O 3TH2T 3KPSD 4O2EB 3HG1D 2JK5A 2WPVB 3QWQB 4HZAA 4PJXE 2Y1YA 4P2AA 1GXEA 3V6BR 1T4KB 2DS4A 3EGXA 3UTTB 3FN0H 1A9BB 4LO9A 4U3FG 1SOQA 3DPBB 2OZ4L 3BGMA 2R5DA 4KO5A 5AB0A 2JIXD 2XWZA 3ARWA 3S3PA 3KW8A 3UIYA 4HSQA 4GW5A 3PLYA 5EUKA 4LBEB 5TE7H 2VDLH 4EI2A 5F7DB 1N73C 3HVNA 4PR5A 1SVBA 5ESAA 5FV2A 4EUPB 1MF2H 1PY9A 4I18B 2XV5A 3ARBD 4KK6D 4TN9A 1LTXA 1UZ8A 1MZ9A 3C5XA 3QE5A 4F58H 3QDMB 4TVPL 4DWHA 3EKCA 3CLFH 3A6BH 1Y6MR 1KDJA 2OQJB 2D7MA 3B7SA 3DHMA 3EJRA 1PPJD 1ZLVH 2ZXAA 4HWEH 1WLHA 3MYJB 4I5BA 3US0A 3DO3A 1JPEA 43C9B 5I16A 4HOWA 5KG9A 1U93A 5E00A 4JFQB 3K6SA 4DUWA 1M1JA 4UQAA 4NRZA 4OGYH 2FR4A 3QFDB 5DQJB 3L72E 4RGOH 4WTWA 5HJDA 4JY4A 3ZUCA 3TWCH 2BH0A 1HH9B 5B1AB 4BGDA 2EVFA 4FQXB 5MEOA 3AQXA 2G2RB 2BRRH 1NPUA 4XAKE 3KS0H 5HDOA 1Z5LB 5FYLH 3V4VH 3O9WA 4N9GB 4Z0BL 1KFAL 5KSUB 2W27A 2VDQH 1LT9B 5M94B 2V2XB 2EIDA 2QA4P 2RGSA 3NQKA 5GRZA 4EBQL 2F9BT 5EO0A 3B43A 3OKKB 5T1KB 1U8MB 4GSRA 2KIKA 2FEJA 1KC5H 3O3BB 4E9WA 1PZ3A 1GHFL 5IVXA 1RIHL 5I1HH 4XVUC 1PDKB 3QHZH 3QFJD 5EU5B 4TQEL 4XN8A 4Q89A 4U1IB 4PJ0E 4HKXA 3LHAA 3IWUA 1JXFA 2HJFA 1GGIH 5CXPA 2WUCL 1W91A 2C1OB 2NW2A 1FBIL 3QORB 5DMGC 3BW9B 3CSYA 3QO0B 1DD4A 4FXKA 3S0PA 3U9WA 2OL3L 5C39A 2H3NB 2KUTA 3FWLA 4MCMA 5FB8B 4U3SA 1LO5A 1F86A 4KGJA 1XEUA 4GMSH 4LQFH 2EE3A 2PXYD 3GLDA 5IVZB 1WBZA 4WIQA 4XNZC 5F0JB 3QR1A 2D03H 4XMPH 1GW0A 1YAZA 4PJBA 5F0MB 4GG8A 2LE9A 3RE0A 3QUZC 5ILTL 3WFCH 1IQWL 1BIHA 3L13A 3VA2C 5L2KE 3HZYA 3MLRL 4DZBB 5ADPL 1S1CX 2NY1B 3C5ZB 1IM9D 2ENJA 2KZWA 5AD0A 4D0BA 2WXKA 3M1CA 1QA9A 1K3ZA 5IV2B 4PJ8B 3EIFA 1IX2A 2CR0A 2N1KA 5IVXF 3IN6A 4Z7NB 4FNUA 1QFWH 4P2OC 4P3CH 4PJGE 1CYGA 1YAIA 3RWGB 4C54A 4WKXA 2YIUB 1BVKB 1S78D 2A06E 2B1OA 4BK5C 2FFDC 1S7QA 3FQRB 4Q9RH 1DBBH 2XQYG 4DEWA 4S1QL 3DXAA 4NM8L 1OZHA 2DQFA 2BNRB 1HILA 5JXAL 2WTYA 3ULVL 3I3BA 2AV1B 4DTGL 1L0LG 3DNKA 1H3WM 3DJZA 3KJ4C 3LS5H 4DFHA 2CHNA 1V3JA 3WLWC 1MFDL 2NR6C 3DX4A 4MFHA 3SCMB 1KZUB 4HGWB 1JZIA 2I60H 3BCCE 1KCSL 2VL5A 2Y7SA 4BWNA 3MRJB 4WFED 4ZMXA 2AKRB 2QQNH 3MU3A 3H7BB 5HDBB 4NKIL 2ZFCA 1BQRA 2GG1A 5FFOA 3P30L 5FUCE 3LIEA 2ZKHH 4PYHA 5LUMA 4ASVA 3Q05A 4QXUL 3HLAA 3WYRA 3CDZA 1MVYA 4PV9B 5J13B 4AT6A 4Q14A 5FW8A 3ZZLA 4IBTA 3PJSB 2YD3A 2KYVA 4N4YB 4YHNA 1H15A 4OW6A 4NDMA 3T77A 2ZXWB 5FK9B 4BRYB 1GZHA 4D6TJ 4HLEA 3QUKA 3L4UA 5AAMA 3IDIB 5D1QA 3DGGA 2WO2B 2GSGB 5CN3A 2CRYA 5D8JL 5H94A 3CZGA 4MD5B 5AG9A 4MRBA 2M0BA 3HG0A 4Y7OC 4WFFE 3HPJB 1MHHA 3FH8A 5IJVB 5A7EA 3BRGC 2J20A 5HHVL 3MA7A 1E8XA 2BERA 3LOWA 4X6BA 2CMRH 2L3BA 2HJKB 5T3ZH 5KVGL 5DRXB 2ZYDA 1NUGA 1MRDH 3D08A 4JQIL 4M9OA 4O5LL 4R84A 4YHPA 2JJSA 1AE6H 1UQSA 3W39A 4CC0A 4DCKA 2YD0A 4LAQL 4XN9A 2GFBA 4BH8A 4C59B 3B1UA 1OWWA 4JDZA 1TENA 2R5BA 1MI5E 3AROA 3GDCA 2ISDA 5HHOA 2P5ED 3PGDB 4PRPA 2DWSA 1O0VA 1JFQH 3SDCA 1YEKL 4WZ9A 4K8RL 3NJGA 1JV2A 4A7QA 2D9QB 1KG0B 4GXVL 3CWBE 4LSUL 2CBOA 4N2MA 3PGCB 4XNYH 3CV5A 3VG0L 1GIGL 3O8XC 2EDFA 2MHAB 4U3CA 3S4SB 1FVCA 4H1LH 1XT5A 3EGDA 2AJVL 1T5KA 2IH3B 3BH8A 3FFCA 3GRWH 3U6XS 1S9XB 3O45A 1ZOXA 3BPOC 3S8WA 5ESQA 3L70G 3OLDA 4S1DC 5ISZA 3V0VB 4N0RA 3L74D 4E41A 4RESB 2CRZA 4NNPH 5D7JD 1NGZB 3A22A 2FH6A 3TFBA 2YPLA 4C4KO 5T3XE 4G6FB 4L5FL 5F7UA 2J88H 2IIJA 4GT0A 1KNOA 1X5FA 2ZUVA 1E3XA 2RAMA 5KTEL 5EZPA 1DLHA 2BY0A 2WSEH 1RZGA 1U8HB 1A14L 3EHBB 3MLYL 4HYTB 2R2BB 5BS0D 4G7YL 2FECI 4FQIL 2ZXEB 3VXUE 2OMTA 4PD4K 5J1AB 1DD3A 2HTLC 2QPEB 3BHBB 4LHUA 2C7UB 3GMAA 3NZ8A 3QWOB 3MRCB 2FWLB 4KNUA 1YYMH 1QNZH 4NO0D 3NZSA 4UB8H 1F4YH 4TUOB 2LAGB 4QYAA 1MXDA 3RNQB 4E0RA 5C9KA 1WK0A 5FGRA 3BIKB 4C4KT 1W0WB 3IJEA 1O6SA 4OI9A 3ATEA 3B56A 3HI6L 3IU4H 5D1XA 1XH3A 3BSZA 4YMPA 2O4EA 1ZDSA 4LRNH 4JRYE 2K78A 3TBTB 2M3BA 1DJGA 3QIWC 4QHLA 1B4JL 4QKXB 2OR8A 1EDJA 3ES6B 2CJSA 3D39E 1BCIA 2ZXDA 4LLYB 3SBWC 2Z7ZA 6CGTA 3AWFA 5DZAA 1EVTC 4U6VL 2ARJQ 1I7UB 1RJZA 5E8DL 5AYQA 4QRSA 4KZEH 3ZZ1A 5E1AA 3UCRA 4DKFH 4R96B 1OAXL 3VJ6A 1QAWA 4B9FA 1GGYA 1OCWL 4WUUE 5E95B 1RZKL 2GJ6A 5GGSY 3ZHFA 1T2XA 3U2SA 2OGUA 3RZCB 3GMNA 4HCGA 2FYUD 1JPFA 1PY0A 1UD5A 2AQNA 3QXAB 5ADOH 3MZWB 4FG0A 4OFQA 1NFKA 1IL1B 3FN0L 2NZ9D 1AD9A 1P7QA 1U8OA 1NTKD 3BAEH 1FJ1A 2PYFB 2WZPD 4M56A 4UM8B 3FCUB 3S9OA 5TE7L 1I9RH 5DS1A 3TN0D 3QARA 2VDLL 3BD3A 1AGCA 2H1PL 3QG6A 3BGFC 1SFCB 2QDWA 1X0TA 3GSUA 5JOFA 5T33H 3R8BB 2BNQD 1BSHA 1UWEH 3TP4A 4A7TA 1MF2L 1IK9A 4TNGA 4DEPC 5EO9B 1Q9OA 1HN1A 1N6QH 1YPZE 3ESMA 5IHZA 2Y7LA 2YAOA 5EU6E 3T8VA 4F58L 4PLOB 3T9WA 4P0DA 1CDHA 4NPYB 1A21A 2YBRB 3A6BL 1RCYA 4WW1B 5ICXA 2HJLB 4NRXA 1I7RB 3CMGA 5C0FA 2IV9A 1SJHB 2NNXA 4M48H 4EJ1C 1Z56A 1M6OA 3KPNA 4JGJA 4PP1D 3TBWB 3H1ZA 3L75E 1BJ1H 1T7ZA 2EO7A 4OGYL 2MOQA 4RGOL 1FZOB 4P4KC 1JZ5A 4H8WH 3V9CA 4EN2A 5D5ME 3TWCL 2ZAHA 5B1JA 2DIBA 4H0LC 4L0PB 3NJNA 4F93B 2BRRL 1BXUA 4M7ZB 4BH7A 3CX2A 2PP8A 3L5WB 5FYLL 5KLVE 2I7SA 3PXJA 4NZUH 2P8MB 3V4VL 2I85A 2W65A 2DJUA 2VDQL 4KOBA 3OBAA 4FZEL 1MWAA 2GC7C 4H0HB 5IJCC 1CD1B 2IBGA 2F08A 1EXGA 3V0DA 4AMXA 1KC5L 1T0NA 2XWJA 4PV8A 1EEYA 1EJOH 2YZ1A 3F12A 5AUMB 4ZMVA 4MAZA 4YZFE 5I1HL 3DIFA 3AJ7A 1WRGA 5D4JA 3QHZL 3GTVA 4M6ML 2J71A 4JFFE 4NN5C 5ABAA 5KSAB 3COOA 1GGIL 1FQ9C 3IRPX 1KV4A 5HYFA 5D1ZD 3IAGC 4MD4B 3HAEH 5GZNA 4FFTA 4P2RD 2N1TD 1GAFH 5I1GL 1AYOA 1NANH 1D5RA 1TZIB 3H1LE 4GMSL 4LQFL 5C0AA 1MZZA 1BJMA 2K3TA 1HHHA 5CEYB 3MNVA 2QZ5A 1DVUA 4IBQA 4KKBD 4CMHB 2F8XC 4R0LC 3QDGB 3UZQB 1EFXB 5KLVK 1GPOH 2UZIH 1IFPA 3SGDI 3WFCL 1AR1C 4JPVH 1KPRA 5T1LD 1VFBB 1P1ZA 1KN2H 4F7KA 3UTPE 5CEXA 2DQGH 2IALA 3QHFH 4PREA 2NXZD 3C5SA 4DF9A 1TQUA 4X98A 3CVHH 4PJHA 1N8RQ 3GHBL 4BKLA 1IGYB 2CZNA 3HPLB 3NK3A 1L4AD 4OGQC 4UT6H 1LEKB 2R9HC 4I3RH 1PL3A 5DTFA 2CAKA 2X70A 2V5MA 2Z93B 3CXDH 4P3CL 1SQQG 1BOYA 4YXHH 5J4MA 2Y0SA 1UWFA 2AABH 2GB2A 5DS8A 4LSRH 4PJ0H 3F2LA 1DBBL 4YHYC 2E76D 4LP5A 2E47A 2DV6A 2M8XA 5HPOA 3A4AA 2RN0A 2P7TB 4MDJA 3U79A 5BXFA 3BESR 3NSYA 5I6XC 2IAMA 5C0DB 1Z9NA 2A9ML 2VITA 2HT4D 4C58B 3V8CA 3KYKL 3LS5L 4NLHA 4JGMA 1CXFA 4XMVA 5ERWB 4FGMA 2X88A 3ATFA 3RGHA 3R4RA 4HAKA 4F9PA 2I60L 4AWJC 3NYKA 5IBUG 2QQNL 5IMMA 1SJVA 5F70A 1K8IB 4DN4H 2I1JA 4Z3EA 3ULVC 1XCTA 1LO2H 2CDGA 2ZKHL 3DDFA 2FEDD 5IEKB 3UABA 2VLJE 1CD8A 3L4WA 3N6YA 4LPVA 5C86A 3UZVB 4NZFA 5C08B 1JPST 3QH3A 4PJHF 4PJCE 1NC4D 5GSVA 3X3GH 3NCJH 3VFVA 2DMGA 1X5KA 3KBPA 1QSFD 3CIQA 3C60B 4AQOA 2V17L 1SQ2N 1U42A 4L2YA 3GJFK 5IHWA 3BP7B 1SQMA 1NTZE 4IBZA 4WY4A 3G5XA 3V5KA 3VI4B 2HLAA 3A23A 4A7SA 1L6ZA 4ZODA 4U1KA 4C56A 1EZVX 3I6LD 3P9MA 3T4YB 1AO7A 4B9ZA 1KILA 4X99A 2CMRL 5T3ZL 3ZE2F 1IAIM 2QJYC 1DVZA 1VFAA 1ZWIB 2Z91B 4GW4A 5D4IA 3WJLC 1A6ZA 3SODB 1VL2A 1MRDL 3ZHKA 3OKOA 1AE6L 1OGPA 3ARGA 3LSOA 2QKSA 1O75A 3DX9A 3MLVH 4Q6YA 1PZBA 2UY6A 4J3OF 4LB8A 5A2JH 3ZZQA 1BZOA 3GGWA 5HP5A 4IU3A 4P8QA 4BQ8A 4TKWA 2LU7A 4MHHG 2O5ZL 4XNYL 2C9VA 3BRDA 1UD4A 3LRGA 3PXHA 4OFYD 2J8OA 3T2LA 4F80A 1KCRH 2V8MA 5AENA 1YCSA 4AEHH 3GRWL 2F58H 2CIKB 2CKBB 3VXMD 4G9FE 3EFFB 5JPNA 2IFMA 3CSBA 4QCIA 1JNJA 2FHBA 1BREA 4K8RC 1VQPP 3C6LD 3D8MA 5EUOE 5J11C 2J88L 2O01H 3HKFA 3OKMA 1U91A 2WJ5A 1V27A 2NY4B 3I6KA 4N2FA 2EC9U 3WEBA 2WLIB 4HETA 3QG7H 4O2CB 1S7RB 5KANG 1NEZG 1EO8L 5C09A 3TCLA 1CPUA 2FIKA 2MH4A 1KGCD 3FHEA 2QEXP 4K7PY 3SDDB 3NA9L 5D70H 4AYCA 5DZOA 2ATPB 4PBXA 4JO1H 1YYML 1QNZL 4PD4H 5D4QA 4LOUD 1F4YL 3II2A 4F2EA 3VNZA 3QVAA 5TDNB 2VZ3A 1HZHH 5DD6A 5IB5A 5E08H 3MRPB 3RBXA 2F54A 1MAMH 5E2WH 3L71J 3G6JE 4QRPD 5ALCH 4OD1L 1X5GA 5I0DA 3ARPA 1UA6H 4AYMC 1R6VA 4FULA 1JY3O 2G3ZA 1B0IA 2XNAB 4ZAKD 3QULB 4P2QE 3KAAA 1I1YB 2OX5A 1FE6A 3BQUC 3CFQA 3ELQA 2F5AH 3B2PA 1RF0A 5EN2B 3IN2A 3CTTA 4UINH 4DO5A 5C92A 2NY3B 3PXLA 4KZEL 3GINA 5KS9A 1X5JA 3GI9H 1NH4A 2CHWA 3IJYB 3GSRA 4OLZH 4AH2B 1SYSA 3KEHA 4PHZA 4LLUB 5FFGA 4R4MA 1F6LL 2XVKA 3NH7H 1CW5A 3MNZA 4B60A 2NY5H 2BO0A 2X3CA 1MFAH 2XHNA 1OGAA 1WFJA 1JZ3A 5E4OA 2L7UA 5BRZB 3ZE1F 4F8PA 2WXJA 4D0CA 3PWNB 1JXJA 3BAEL 3JWOH 4PJFE 4YDIH 3SJVB 1YITP 5D2LB 5F8QC 4JCLA 4YNYB 5EBLA 1I9RL 2B0SH 3PHAA 3CDFA 3DROA 2ZF9A 2VWEC 4XVJH 2KZIA 1ES0A 2C0XA 1YNTF 5CBAB 1RZKC 2DF3A 3IT8D 2DMCA 4K5NA 3SPVB 5T33L 2WP3O 5DFVC 1UWEL 3GSNB 4BZ1A 5D7IE 2KS0A 2BSTB 4U6TA 1N6QL 1EQ7A 1FN4B 5DHVA 3VYPA 5FYJD 3AB0B 2LV4A 4PRDA 3ZKNC 3AQZA 2YEQA 4XVOA 5T1MA 3ZL1A 3AE2C 3O6MH 1J8HD 2ALAA 4KJYA 2X53A 3VUAA 4M48L 1RZ7H 1CT8B 5E23A 3HNTH 2CJTA 5FOBA 4KKAD 5H37A 2D2OA 4BKSC 1GZQB 2AQRA 4H8WL 2G75B 1QVGO 2YAFA 3JT0A 4NFBA 4XCEB 1OW0C 2WP3T 4KJPD 1MCPH 3JV6B 3G08A 2E86A 3L1FA 3RLSA 4HV8A 2DEYX 2EXYC 1PAZA 2A83B 4NZUL 1WD9A 3KWXA 2JI2A 3VCLB 5KEZA 4WWOA 3TBSB 1EGJH 2O1KA 2O72A 1CBVH 4OH2A 4YJZL 3WY4A 4HF5L 1EJOL 1X79B 3FRPA 5KVDE 4N8CL 1HH0A 2QR0B 4NXKA 2GITA 4PRAB 4G8AC 3WS3A 4MQXC 3HE6D 3N50A 5EULV 1PTZA 2QADC 4N0FB 3UJJH 1IEBB 1GTFA 1GL2C 3FKUS 4KK9C 4I7ZB 1AZRA 1NH6A 1NGQH 1WWWX 3EFOB 4K23H 2N56A 2PCPA 4WGKA 5B1KA 4AGLA 1HVVA 5F3BB 5ID0A 2F8IA 2H6PA 1R19A 5KJRH 2W8ZA 3AWEA 4P5KB 1Z9SA 2HRHA 1KB9D 2ZKXA 5FPIA 4MASA 1G1JA 4QIRA 5I30H 3HUJA 4LLWB 1CB4A 3ARFC 4I1PA 4NPEA 1UASA 4OLYH 4R2GB 1S5HB 4PJDE 1FUNA 3WGUB 2YPKB 1BDCA 1S5LE 1AXSB 1GPOL 2R29A 4XP9H 3L81A 4U3FE 2EDXA 1OQOA 4JPVL 4LBAA 4ZFGH 4JJHA 3FO1A 4W9HC 3VFOA 1RQVA 2DQGL 2XTJC 1IFNA 1EAPA 3M8OH 4I77H 3QHFL 5GRUH 3CZSA 4FTVA 1THAA 3K72A 3U1QA 3A24A 5BU5A 5HYIA 1VA9A 1D2OA 2JB6A 3TGXA 3LH2L 3UTSD 4ORGB 3WXVH 3K2KA 4U49A 1UOVA 3ZTNH 3CXDL 1F3DJ 4N24A 3KQGA 4XX1G 1XGTA 4ZXBC 3W0WD 5IB1B 5B39A 2AABL 5K39B 1B6DA 2ITFA 4F7PA 1RK1B 2GC4C 3H1JG 1MWAH 4G8EA 1U9KA 3WHE0 1R46A 1ULVA 2VN5A 4PVNA 1X7SA 2Y7NA 4UNIA 1LK2A 4HSAC 4NRYA 2NPSA 1ID5I 2L4OA 5C0GB 3FUDA 3FH7A 1ZPLA 3OA7A 1SQXE 3FBKA 4H25A 4UB6E 2DWEA 3HUJF 3KBHE 4JZNB 2V4LA 1FIGL 5DFTA 3BZFB 4XMUA 2MFNA 5DWPA 5B38B 3VQLA 4TPRH 5CBNA 3DOIA 3VE0B 3LRSB 2GEEA 4LP8A 4MMYA 4P23A 3WLBA 2ZT9D 4Y2DC 4DN4L 3ZDZE 3TNNA 1LO2L 3QI9D 4MA1C 3HG1A 2KSJA 1MJ7L 3CC5B 3DV6B 3NJKA 4KMLB 4G8FA 4QRRD 4QXTB 3UGUA 3S8FB 2GSMB 1JPGB 4I2XA 5I6PA 3F01A 3L1EA 5EOQL 5E6IB 1DQDH 1K5WA 2CKNA 2JFCA 4OIBA 1BXXA 3QQ4B 3N04A 2JIXA 4B95C 1QRNB 5CZVH 4I4WB 3NCJL 1AHWA 2E74D 2HVKB 5EB9A 4QMAA 2EDKA 4Z77B 5CJBA 3KPSE 4N2AA 4IYKA 1R1CA 5BZDA 2I7OA 1F0LA 1N12A 2WXHA 3ARBA 3K2MC 3IXTB 5FKPB 2G5BB 3GJFH 3WTTA 1SQXK 3CXHK 2Y2TA 3H1IG 5F9JB 4PTTA 1QW8A 3V5DA 4KUZH 1DFBH 2VLRD 1Z3RA 4Z3IA 1NWQA 3QWRD 1ZOYC 2GVYA 4LKCB 2Q0ZX 1N7SD 1UJ3B 1HH6B 4DO4A 3MRHB 3KWWB 4CC1A 1MCLA 3WD5L 2J6WA 2PCFA 2R0ZL 3MLVL 1H88A 4CMMB 5GS0H 4M5SA 3IYLW 3WIAA 2VLKB 3PDOA 1TZHB 1WCBA 1XGZA 4HKZB 4HUWA 2XOTA 1KT2A 3DUUB 2FB4L 4HHGA 2DQMA 3RTQA 5LCVA 1XGUA 4X5LA 1D5XA 1KCRL 1NM4A 4FMKA 3GBMH 2F58L 2BC4B 5DEGB 2DTML 1X7QA 3IMUA 3WFBH 1I9JH 1WMKA 2WVTA 4JFXA 1FC1A 4H26A 2CRMA 3AT9A 5EIIA 2YAEA 2JB5H 2X4PA 1OHZA 1YDPB 5ANHA 3H6AA 3L4XA 2R23B 3FX0A 2I27N 3FTZA 1AMYA 3PHOA 4LHUG 3FCTA 5CJOH 3SYOA 5GTHH 2OTWB 4KXZI 5HYSA 4U0RB 2VQ4A 1AQ5A 3QG7L 2CRIA 3VWJD 3L9YA 3L54A 1PG7X 4FC3E 4M3LA 5F9DC 4HB1A 2BZ7A 4K9EH 4IBUA 3UIZA 4FL4C 5AW7B 2K1AA 1BAFH 1L0NG 1LEGB 3MACL 2C1PB 3V52H 2IQAB 4JO1L 5AW9B 4PV1B 1GZPB 2VSDA 1O7DC 5LO7A 1LYQA 1RUPH 5GSRB 2FL5B 4IRSC 1BIIA 1AGBA 3L3OC 4JDTH 1XL4A 3SKNA 1HZHL 5E08L 1BJ8A 1R47A 1G2CB 1MAML 4X7DC 5E2WL 3E1ZA 2Q7YA 4NHUA 4FXTA 2ZXGA 1UJTA 3MLTB 4K15A 5IUCA 1I7TB 1Q9LA 5ALCL 4YC2B 2X4NB 2B3RA 1MFMA 4IDJH 3KVQA 2P5PA 2VDRH 4KVCH 1KTCA 1TPXB 1UA6L 2D31A 4YSUA 4Z8FH 1GCYA 2DH2A 3K0WA 1BLNB 2PCYA 1CZ8H 3B8YA 2F5AL 2XG5B 4HJGA 5CNHA 2VNCA 2H8PD 4UINL 2E9WA 3AACA 5I75C 3GI9L 2GABA 1EZVG 3O81A 4OLZL 2ZOOA 4I48B 1CK0H 1QLEB 4OLEA 2LAAA 4IJTA 2NYKA 4F8LA 5CHXA 1BFOB 4Y4FB 3NH7L 5CCGA 5A43C 1YMMD 5B5EH 2C3VA 5B22A 1RK7A 1X6NA 2HA1A 3ULUE 3PP5A 5GGQH 4WHDA 3FQWB 2J25A 5HGAA 1NIEA 3VD7A 3CZKA 3DVNA 4U6XA 4YDIL 3V4PA 4APQD 5AFAA 5IIEA 4LCWD 1U3HD 3P9LA 3GKZA 3A21A 3RIAF 3QQNA 5F89B 3UC2A 2YIHA 4HH9A 4XVJL 3DK0A 3L6FA 4X9GA 3DK2A 1F5WA 4DZ8B 1I9EA 1YEHH 4QO1A 3S96B 1OEZW 2AEOA 2JDIH 3PJLA 4DKEH 1H6UA 3ALPA 5F2FA 5KOMC 2WWMC 3BAJA 3A0OA 4RFNB 5DC9B 3L70E 5I1DA 5KOVC 3TO4D 2C7FA 2FQFA 2ZAIA 1NC2A 3DGCR 3LB6D 4OGXL 4PCSA 4TOYH 4X4XA 4JN1H 2VH5H 2WANA 4ELMA 5CS7A 1MNNA 1CDIA 3LPWA 3HBPA 4OFPA 4ZX4A 1GY2A 4F7EB 5I76A 1RZ7L 1K72A 1AGFB 1PPIA 3HNTL 3BSZL 4IRJC 5J9PA 4M8VA 3P8CE 4G9DB 1A65A 3K81A 3RGVA 2K7QA 1CLZH 3DVFA 4DO6A 5E9DB 3KPLA 2JWAA 3FF7A 1LD9B 1JHTA 5CSZB 1ZCRA 5E1QA 1JTHB 1MCPL 3P77B 1S8DB 3CMAP 1AV1A 1KGWA 4F20A 5IMLB 1WFUA 4LGDE 4U1GC 5F3HA 4BE5A 3A4EA 1ZT1B 1LP9E 1AS6A 2VKWA 3CNKA 3BPNC 3FHAA 3EYUH 4S0TD 3S5LA 3ATDA 1N6UA 4HUKB 3U30B 5IW1A 4H8WC 1QEWB 1SOSA 5DJUB 1QBBA 1M2VB 2ZUSA 3VFRA 3NMDA 4TSAH 4YBHA 2B5IC 1A9VA 3CPLA 3R19A 5DURD 3GIZL 4G42A 5IQ9A 4BWTA 3MV8B 1S46A 1DJIA 1XF2A 2UWEB 4NSKA 2AFNA 4X6EB 5AZ2H 1BF8A 5KYUB 2H43A 4ELMF 4CA4A 1ITCA 4ELKB 2ROXA 3QQ9D 1T80A 4GMTL 3QNZB 4BQ9A 1AVOA 4Z76A 1Y8AA 1G6VK 1LWUB 2RFXB 1IC2A 2XU9A 5I30L 5D7JA 5DHVH 1KBVA 1LGHB 1NTMJ 3ZYJA 4EOWL 2O26U 3EDDA 3FQUA 5DD0H 4E68A 3DBXA 4H40A 4OLYL 4XP6H 4ONFH 3CMEP 2B3IA 2J57A 2C3GA 1IIIA 2Y25A 3NFQA 1EAJA 2CR6A 5GPRA 3TDKA 3GB7B 4XP9L 1V55B 1RK0B 5D7HA 3RVVD 1UTDA 2CO6B 5GISL 2ZXQA 3KPTA 3V4VB 2IF7A 3M8OL 5GRUL 1I3RA 2VDQB 3NPSC 4I77L 4PGEB 5SX5K 4DJMA 3T8XB 2JI1A 1ZA3A 2YD6A 3JYBA 3MBWB 4LOEA 1C16A 2WBJA 4FLSA 4NO0A 1GSKA 3CSFA 2CBMA 4FYRA 2BOBA 1AP2B 1B2WH 2EYTB 1BGYG 2FH8A 3QRLA 2WITA 1CFNA 4FMFA 4L1LA 3S36H 4NPFX 4NWUH 5BS0E 4B5EA 4K94C 1PG7H 1VAHA 5HI3D 2ZICA 2G4EA 3GEFA 2E9JA 3CC4P 5T5FA 5FLUA 1GGTA 2LXCB 5CEZD 1M4KA 3MUUA 4APXB 1MWAL 3NPZB 1GGBH 2GAZB 2Y7QB 4XO9A 5GGUB 3EADA 3P73A 2YK1H 3UG5A 3NIDE 2QGDA 3WI9A 1MDAA 3HE4B 1IFRA 3ML8A 1FWXA 4FQHB 4KWUA 2O6DA 4OFVA 3X1GA 4XB3A 5GGRA 3LZLA 4FHJA 3S4RA 4G6AC 3ZQ9A 2BEZF 3O9WC 3BPCB 4J3OG 4JQVA 5E94A 3BAYA 1LJ2A 1K73Q 1U8JB 2YWYA 3QO1A 4TPRL 3LW5H 1TZGH 3FZUC 4Y19D 5E7BA 1MFCH 2N3JA 1X5ZA 1FZBA 2ADJB 4AQAA 1M56B 1E8WA 4BCZA 4KJQC 4XP1H 2BS9A 3OMZA 3WMSA 3FPXA 3UYPA 2IYOA 2F19H 2P58A 4PGDB 3QJQB 1NCBH 1PU0A 5KN5A 4EI6A 1EUUA 1DQDL 3T1FA 1MHEB 1MJUH 4QNPE 4CSZA 1CLYL 2WD0A 2R29H 5CZVL 3L71G 4ISVB 1DEBA 5F7BA 4IHOB 2LFGA 1OE1A 3DJRA 2D7NA 2BNQA 1NDGA 3K4DA 1VSCA 3ARED 2NY2C 4OKDA 2Y22A 1A7BA 2A6JB 1H8OA 1NTKE 3HS9A 1HHIB 1TOXA 3GMMB 4R4LA 2PO6D 1F4XH 5IFJB 1DEEA 5FKAA 3UJIL 3CXHH 1QNIA 1FLRL 1GC1H 1ACCA 5AKRA 6TAAA 2FATL 3H6PA 1DFBL 4KUZL 3UPAA 3VGDA 3I3DA 2WC7A 3D85B 2PFXA 3H0TB 4K2UH 4JFEB 4XNAA 4TNFA 3ROOA 1S3KH 1UCBL 4TQPA 3RTLA 2QM7A 3PQYD 3ILQD 4Y0GA 1WZMA 2SEBA 3PRZA 1QSEB 2CM6A 4FQQB 2I9LA 4K7FA 4XA4A 3W11C 3IGKA 3PIQB 4BA0A 3KPPB 3RI5F 3ZQXA 4POUB 4TT3H 4KZDH 1RZFH 2WQYC 1K2DB 2K6YA 3TIEA 2CUHA 3F64A 5IOPB 2WNKA 4KVPA 4F7TB 1ZPUA 1BYPA 1Z7JA 1T1ZA 2WQVA 2R2HA 3JTSA 3BEVB 1XIWA 4P5MA 4JBSA 3T09A 1SQQE 2DQEH 2WYHA 3GBML 2FYUK 4XCCH 1IEAB 1ASQA 2Y24A 3PNWB 4TTDD 3V9FA 3WFBL 1I9JL 1DANT 3GHGB 1ODAA 3DTDA 3QRGH 4LLVA 1U8LB 1NTKK 3FW6A 3MV7E 3QYMA 4J6RH 5ABZA 1O9VA 4I3GA 3EH1A 3L7EB 4MZ2A 5APXA 3IFMA 4JN1L 2WTRB 3H9SB 2KLSA 1FNLA 4NS0A 4RSVA 5D1ZA 1TFPA 1BECA 4LSPH 3CCRP 4MX7A 1SP4A 3RWHA 1YVLA 5EU4A 4LCUA 1SFDA 3FOLA 3P4LA 3MLZH 1BAFL 3JCUH 4JEGB 4WW2A 3TU6A 3V52L 4HG4K 5IJBC 3C09B 4HJIA 2HTKD 1L9PA 1ZKAA 3S1KA 1NU1G 3G3ZA 2JE8A 1T20A 1KIPA 4HEPG 5CZXD 1GZHC 4NQDA 4E42A 2ZOWA 4WLCA 5F7AA 1SGKA 1JGVH 1INEH 2B39A 3I02B 3WBDA 1T04B 5D1QC 4CVXB 2APSA 4JVPA 5IBLC 2OYIB 2ATKA 3QYNA 1DN0A 1KXVA 2N1TE 1VFMA 1ZEAH 5TDPA 2MJZA 3QDMD 1JPTH 2OYKA 1MFBH 1SFHA 2VE6A 3RJDA 1BVNP 2Y7OA 4PMFA 4Z7VA 5BMFL 2VW4A 2B20A 2VDRL 5TGBA 2BVUA 1PZUB 1UENA 4TNWF 1P84H 3P3SA 4HJ1A 4EEEA 4Z8FL 4UTAA 5TDOB 2ED7A 2FBOJ 4RWYH 1CZ8L 2VOTA 4QF1A 3VXPA 4FA8A 4Q9CA 4LAJH 1D7DA 3DX7B 4ODSH 3CUPB 2XTSA 4JRLA 2HN7A 2JJSC 2BEQD 5FWRA 2NZIA 4QTFA 4NZJA 4YSCA 1CK0L 5AZEH 4LDOB 2VLMD 3M91A 5IT2H 1MWOA 1NGYB 1TSRA 1YJDL 1UIXA 2ITAA 2EXWC 3VFTB 3SDCC 2O5NA 1W72B 1LNUB 4WW2F 4JFWA 1CDCA 1F6FB 2W60A 3BKCH 4W4OC 2FO8A 4YDVB 3V6IA 1VQ6P 2EH8H 1S3JA 5ECJE 5GGQL 1SVCP 2KZJA 1MN4A 3IN0A 1HOCB 3NDZE 5T1KD 1O5PA 1OLLA 3UH8A 2OTPA 4MJIB 4IK6A 2HCZX 1YJ9P 3HE5B 2J4WL 5D93C 2XCMC 1DR9A 2AJSL 2J73A 1GGCL 2SPZA 2OMXB 3CHXA 2IANB 1A5FH 3ZR5A 2YA0A 3JWNH 1TJIL 2J59M 1T21B 3AY4C 4A1RA 1KYOI 4Z7VF 1FZJA 2XKUA 2IWFA 1LJMA 3VTTA 3QORD 4LFHD 5H37G 3PABB 2OARA 1H0TB 1FNHA 2VH5L 1EJ6A 1QHQA 3L3JA 2VXSH 3O11B 1PLCA 5SWZE 1JDDA 3MRRA 5SWQB 2HVBA 3O3EA 3GZOA 1VZHA 4XHJC 5CEXB 4URTB 2X6VA 5C7ZA 2Y07H 4QXGL 3BYYA 3UC0L 3FUEA 4MJ4A 4DP7X 1AZUA 3ARQA 1SXAA 3QIBB 5D2NB 5JHLH 3R4DA 2JLPA 2XRAH 1CLZL 4MLIA 4RZCB 3RDTA 2FIRT 3GKWH 4UT9H 1K4DB 3HI1B 4FDWA 1AQKH 3RVXC 2Y0EA 2CGRH 2NY1D 5T8IA 3NJVA 2ZX6A 3EJYD 3FRPG 1T1WB 2O5YH 5D1XC 3NTCH 4EVNA 4PB9H 3TGUJ 1PYWB 1GKOA 2Y06H 4QHUA 3WFDH 3GSXA 8FABA 3Q48A 5FO9B 3I6LE 3OM3B 1O6VA 1XF3B 5AAPA 4AK1A 4BFKA 5IY5B 4WWKD 1I31A 1PNCA 1E4XI 2H1XA 3IJHA 3C12A 3GSQA 4Z7WA 1W8NA 4QTHB 2O01N 2XNDH 5L8KB 4X6DA 1ED3B 3VXMA 4BZ1L 5ESVA 3LZFH 2ZOKB 4X6CA 2GJZA 2N9YB 1ZRTD 3EAKA 3PG2A 1AI1H 5FFLA 1RJCA 4C7NA 2A73A 5HD8C 5DD0L 4XP6L 5C8JA 3UPCA 4OT1H 4ONFL 5I18L 4NZTL 4F37F 1QL2A 2GTQA 3IDMB 4L8SA 1HHKB 2XN1A 4PN6A 4RMUA 3UIAA 4TL5A 2AJZA 4PJXB 2FHCA 4M62L 4P3DA 4G70B 3TZVB 2Z92A 3IE4A 4N28A 4IOIA 4GOFA 3I75A 4XN4A 5T5NF 4HCRH 1T1YB 2NUTB 1U36A 3WNMA 3BH9A 4I1RA 5EZJA 3C08H 5B39G 4Y2OB 5SX5H 1RL1A 4FFWC 1N0XL 1N2RB 1B2WL 1CGSH 3RK3C 1XDTT 1CE6B 4FD0A 3RP1A 4NWUL 3O6FB 4JQXA 4HKJA 4JVUA 1PG7L 2XN2A 3EJUA 4O2FB 3SYAA 3GLZA 4EOTA 1OANA 2OSXA 1IAOB 1J05A 3BWAB 2AK1H 4RGNC 3G3LA 2FXPA 1ET5A 4QRUA 1GGBL 3VTMA 1YTZI 4QRPA 4Z7WF 2YK1L 2EVHA 4MD0B 4X4ME 4PJ9C 1AA0A 4Z5RB 2UYLB 2K9UA 3HAEB 4X6DF 4ZTPH 5B1JC 4PY8I 1C5BH 3UOAB 2VSCA 3G6AB 3KYNA 4R7DB 4X6CF 3MTUE 1XGQB 2DLIA 4N2OA 4BFNA 5CP7A 5F0PB 3DMMC 3VTPC 1A9EB 3ZSSA 2PR4L 4XOAA 1TZGL 1BQUA 2KP8A 2XZQH 1MFCL 1MY5A 4XOCA 4XMTA 2POHA 1DX7A 1QFUH 3L73J 5IVXE 4B9PA 1QO3B 4XP1L 2FJFB 3UDWA 3HJ0A 1H6EA 1NCBL 4UT7H 3CVHB 4J1UB 3W82A 5D7KE 3CCEP 1MJUL 4UWQB 5IP4A 3OJAB 1JZJA 3MLUL 5M95B 2RA1A 2GT9A 4JRXE 4N78D 2R29L 5BZWA 3TWYA 2DYRB 4D6TE 2XUWA 5CCHE 3B6SA 2IBZD 3RL0D 1HE7A 1M7DB 5CD5C 5GZNC 2LT9A 3C87A 5ABDE 4C4BA 5D6CB 5G2NA 1DDTA 3FB7A 2EUWA 3A0HH 3TA3D 2NXYC 4HK3N 1G7QA 3TEXA 1EEUA 4N8VA 4PJIB 4KROD 1F4XL 4QUOA 4PJBE 4OUOA 1MCRA 3EYVB 1URQD 1GC1L 5LLIC 2DKMA 3AS1A 3HNSH 4KHTH 3FF8A 4N2DA 4UQDA 1E6OL 1WIOA 4K2UL 1G87A 1Q8MA 3ECBB 2V6HA 2VDNL 5AVXB 3K8KA 3Q3GB 3U0TB 3VXTA 2NTFA 3GBNH 4WWIA 1S3KL 4U1NB 1CL7L 3G5VB 3CBRA 3O4LA 5JZ7D 5IQNA 3N7NA 2H9GA 3SDAB 4R4FL 3WNKA 1EXHA 3CFCH 2IFNA 1XMEB 4W81A 3REWA 4KZDL 2JKXA 3K7UA 3RX9A 1ZE3H 5EEZA 3HR5A 1I9IH 1KJVA 4FNTA 4CNIA 4CW1B 3LHPL 4JG0H 2WCGA 1D5IH 5J1TC 3QQ3B 5EIIG 1PGQA 1Y18B 1QI5A 3APMA 3NQIA 5MP6H 1F6AA 3ME0B 4QI3A 3ZT5A 3OTTA 4XCCL 2K3RA 2IAMC 4XP5H 4XX1E 4PJGB 1FO0B 3FCGA 4DFIA 4HFWB 1YTZT 2FX8H 1G9HA 3QRGL 4ODXA 1NIDA 3N1GC 3HZKA 3QUMH 4J6RL 5HYSG 4WU7B 4YGAB 2AXHA 3ZDXF 1T66C 4AIZB 1JWUA 4QMEA 3Q8BA 5TFSH 1T22A 1D5MB 2BSSB 2OMZA 2QEJA 4FJZA 1FYHB 1NDMA 1E27A 4RNRA 4UQEA 4YSEA 5C2UB 1IGMH 5ACMA 1WISA 4R5TA 2DAVA 5M1BA 2JF1A 4LSSH 4LSPL 4J28A 1OB1B 4J3OC 3KXFD 4FERA 3D6ZA 3K8LA 3IF1B 1IGJA 1KPVA 3MLZL 3CXFA 4GUQA 1AXTL 3TT3L 4XPFH 1R5WB 2B9AA 1DP0A 2ZUXA 3BZ4B 3L7FB 5GGVH 3APDA 3WUWB 2D4FA 3AUWB 4JUSA 1S9KD 3AE6C 5CO1A 3SDYH 2QVIA 2W94A 2NY6B 3AXLB 5GIRA 1JGVL 3IXAA 2IH9A 2ZP8A 3MUGB 5DHYA 1E9QB 1DYZA 4KK5D 4KOCA 4WY4C 1NAFA 4WNQB 3TBYB 2H2PC 2IG2H 3LPGA 4I87A 5AB1A 5AB2A 1JPTL 1NSNL 1MFBL 3QEGH 5AL0A 2FX7H 3F3HA 2R1YA 4TM9A 4POZC 3ZE0F 3MJ9H 4ZOEA 5MI0B 1R3LA 3UTSA 4CPGA 5LAXA 4RWYL 1KILC 3ZTJH 3VFPA 3FN9A 5DMYA 4M02A 2YFOA 5LCVL 3FUNA 3L5JA 5IMOB 4QAWA 5DLML 4ODSL 4NO5B 1XXDC 1RV6X 4MA8H 3ARGC 2BRQA 1I4FA 1WGOA 1BPVA 1C1EH 2OYPA 4KQ4H 3EYSH 2H6OA 5AZEL 5CMAA 4G82A 4JR9H 4Y9BA 1JZHA 3ZDMA 1JGDA 2Q6WB 4X2UA 2MQCA 5JYLA 3RBSA 2D7QA 3T65B 1Y6NR 1II4E 5LXGL 1TT6A 2EC9T 3MRBB 1FVEB 2HVJA 3HC3H 1N59B 3BKCL 3NACL 1JRHH 2EH8L 2X2JA 4WDIA 3US9A 3CCMP 1MI5B 3KPQA 3L16A 4Y4HB 1JUFA 1T83A 3MRKB 1FGNH 4XN1A 1I8IB 3R2PA 5DJDB 5B66E 3U1SH 4WI3A 1TZAA 1DCEA 1H3PH 1SHWA 1G7IB 2P49B 5JPNC 4RLDA 3TBVB 3L4CA 3VACA 2WINB 4E41E 1YJDC 2L0DA 3AITA 4GI8A 5DMKB 2YPLE 3CIAA 4O51A 1HZLA 5D96C 2NQ3A 5E79H 1WAEA 1OCOB 3HNVH 1AYRA 3QW9A 4OZGE 3LXBA 2FYNB 3CC2P 4DGUA 4CN1A 1KGXA 2GW5A 5EFIB 3RJQB 3HI5H 2WT7B 1LILA 4S2SA 3ZHDA 4V1DA 4MCYA 3MC0A 2VXQA 1T2KC 3DO7B 1CLVA 3AEAC 4MB4A 5DVLA 3RDJA 1J10A 2OTLP 3BT2L 3QDGD