5AVVB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule keywords Na, K-ATPase alpha subunit
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avvB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avvB02
4LC1A 2R3CA 4XE5B 2Z5IA 2ZFCA 1GU5A 1GTWA 2YNYA 3VMXA 1J2JB 1NWQA 2XU6A 3LIDA 3VYIA 2WT7A 2W27A 2YO3A 3OAKA 4EOTA 3I5CA 2WWWA 3P32A 3M06A 1IO4A 2JJLA 2WT7B 3M0DA 2N9BA 3HE4B 2P67A 3NFQA 5CMZA 5AVTB 1X8YA 1YYCA 2BASA 2WPSA 4AYCA 4DZOA 1FOSE 2P2UA 5AW7B 1H88A 1SP4A 3L37A 1S9KD 5APUA 5AVYB 3VMYA 1CSBA 5APWA 3TYYA 5AW4B 5AVXB 3A2AA 1SLQA 3HE5B 2QM7A 4I2LC 3V5BA 1CI6B 1H89A 3SWFA 1A02F 3HE4A 2QM8A 2WPRA 1GK6A 1HUCA 3MD0A 4GT1A 5AVUB 1A02J 1JUNA 3IR9A 5APTA 3LIEA 3KQGA 3M9HA 3NMDA 2P7JA 3M9BA 2YO2A 5APYA 2VRSA 3WGUB 4C7NB 5APQA 1MFZA 1GZLA 2XV5A 3HTKA 3O8ZA 3P8MC 3A7OA 1GK4A 3VMZA 1DH3A 4AQRD 3HE5A 3L35A 1S9KE 3NTNA 1OXZA 4HYTB 3TNUA 1CI6A 5AW8B 2WTYA 3M91A 5APXA 3L36A 5AVWB 3VTPC 3B8EB 3TNUB 1HBWA 3A3YB 4I6MC 5AVSB 1T2KC 3KDPB 5APSA 1CZQA 2Z5HA 5AW0B 2ZXEB 5AW6B 3T97A 4C7NA 5AW2B 3M0AA 4GKGA 4JYCA 3A5TA 5AVZB 1JNMA 2R32A 2R5BA 2C9NY 2W6AA 2WPQA 5AW3B 2H7HA 5AVVB 4RETB 2KP8A 2XZRA 5AVQB 1G2CB 3VN0A 2Q7CA 2Q5UA 3MGNA 5AVRB 2E43A 4M3LA 1HWTC 1KQLA 2Q3IA 4B86A 1OWAA 3V4QA 2E42A 2IPPA 1GD2E 5AW5B 1MUUA 1GU4A 5APVA 1T2KD 4KHXA 3V4WA 4C46A 2R5DA 5AW1B 1NAFA 4RESB 3WGVB 1HJBA 1FOSF 2C9LY 3P7KA 1FAVA 5AW9B 3UIAA 3TK1A 4AUWA 3NXSA 1MV8A 4JYBA 1H8AA
chains in the Genus database with same CATH superfamily
1DUZB 5E9DE 4YBHA 5D7HA 4UMSA 3I2CH 4J8RB 3FSAA 1HQ4A 3LB6D 3D06A 1FS0E 2EZ0C 2FYUE 2Y6SD 1JL8A 1QRKA 1DLHB 1U8JA 3P4OB 5DLML 5I76A 1P9MC 5CBEA 1YQ2A 5KSBA 2PXYC 4M5SA 1WRFA 2ZTBA 2YQ3A 4J3VA 5IJCC 3Q48A 5KVGL 1QL1A 1A6WH 5B4MD 4Z3EA 2O01N 4AGNA 2WSEJ 1T7VA 3RA7H 3QDJB 3I9GL 3LKPB 2YKQA 2DOCA 3KW7A 4KUCD 5CJOH 2NY7H 4PJ5B 1DJZA 3KZ8A 3EBGA 3L8QA 4NZFA 4H13D 4MWFA 3FCBA 3NPZB 5TISH 2R2BB 1OKEA 2UVEA 2XACC 3CDZB 1D2PA 4ZUVB 4IKJA 2ZCHL 4YXLH 4AMWA 3G3LA 4PD4J 3CC5B 1QHQA 4NPYA 3GTNA 4O2FB 4CA4A 3H6JA 4XTRD 5BNXD 1G1OA 3IGUA 3VJ6A 2OA9A 3K0YA 1G4MA 2NT1A 3RDTA 1E9PB 2BVTA 4A37A 2DB8A 2E56A 1KXQE 3D1MC 4DQAA 4FFTA 2NRDA 2HPOA 2JKVA 3WIFB 4PIRF 4WI6A 4DP8X 1TNMA 1U30A 2X09A 4MJID 2WO4A 2BCMA 4W9EC 4W81A 5C86A 4DCQA 2YAHA 4OT1H 2D9CA 5DCCA 3WD5H 3MRBA 3U2SA 4TLFA 2MQ3A 3L3KA 4ODTL 4DGYL 1DQML 2Y22A 3JV4B 2IAMD 3CHSA 2VDOH 2X4TB 3S35H 3CDCA 2YMXH 2O26U 3LKSA 1SGKA 1DN2A 3L4TA 4J3OH 3U30B 5J4MA 1KIRB 1I9IH 2E6QA 2EXWC 3BUYB 2QKIC 5JHBA 2I32A 2O30A 1CUOA 4AXWA 5KAIE 2X2YA 1H3XA 4NQDE 4OZFA 1BZ9B 3RVWD 3E7KA 1L9MA 1MJJA 2Y4SA 5JHLL 4M7JL 2V7HB 5KVFH 2X4RB 2IBZD 1QPKA 2HRGA 3F58H 5LB1A 3II3A 3U30C 4BQ9A 1T83C 3U36A 3PTZA 4GXVL 3B7SA 4JCLA 3T6XA 2IC2A 4KK9D 3MKKA 4K5PA 2Z92B 5AL8A 4RMUA 5FO2A 4B9JA 5KYWA 1KGXA 1LO4L 1U8QA 1KLFB 4AIZB 5EO0B 4NZTH 3WE1A 1NAFA 5JHDA 3FSWA 2R3SA 2EDXA 1WS7A 1CD0A 4WW2B 4KZDL 4JZOA 1CCZA 1P6AB 1UH3A 4O2EA 5DJCA 3T8MA 3WNMA 5J57B 2HJLB 4O9BA 2YC1B 4DP2X 1YEIL 3V2QA 4JFVA 2L0DA 1JMMA 2DEXX 4K94L 5J13B 2I1KA 1KLUB 4Q4IA 3V8CA 4X7SH 1U8OA 4NO3B 4H8WL 1RUML 5JNYB 1OEZW 5CIPA 3B1UA 2DJSA 4HS8H 2W07B 4QHLB 5MEOB 2YFOA 2GCYB 4P5MA 3LPGA 4WW2C 5B1JA 5EU6A 3MN8A 2FXPA 2P46B 4V1DB 1SDYA 1MCFA 4LVHB 2ED8A 4JGUA 5I1CL 1N59B 3OXRA 2J5LB 2ZJSH 3M8OL 5J13C 1Q1JL 3V6OE 1JI1A 2DH2A 2H0JA 2P67A 3V4VL 1JF1A 1S7RA 3W9DA 2OR9H 5JIMA 2NY5C 1TQBB 4KHTL 5FA3B 1QOKA 2DYPA 2VLME 3B5TA 1D2OA 3MRFA 2WAQA 1J1OH 1CFTA 5LBSH 1JRHH 4BM7A 3D25B 4LVHC 3P73B 4HOWA 1WQVT 3QZWB 5D5MF 3D0AA 2NXYB 4L8SB 3RIAF 4RWHA 2J5LC 2BCKB 1G1IA 4XNXH 1S7VB 5K59E 5CILH 1Z0MA 4QI3A 3GZKA 2FLRT 4YZFF 1ZS2A 2WWNA 4TL5A 3QQ9C 1SUJA 2OV0A 4X6EB 4XXCC 3V0WL 2M1KA 1ODAA 1JV5A 4LAJH 2PCXA 2ZXGA 4Y4HB 4NQSA 4KTDL 1DANT 3LRLA 2NXYC 4A6YL 4F1SA 4W4OC 1P5VB 5CCHD 4BH8A 1IKNA 5DD0L 3GTTA 5L2KE 5D1XA 4L9LA 3JWOH 2JI2A 2X2UA 3HAEB 2BVPB 5DUJA 4IGBA 3RVUC 3VACA 3WN5B 2VDPL 3VRJB 1LWJA 4Y4HC 2IWGA 3D69A 4BK5A 1ZLLA 2BHYA 1J9QA 1FI8C 2HX8A 5HYFA 4DF9A 5IBTH 2JH2A 3S96B 2Z9TA 4H8PA 1ZRUA 1OOAA 3FB6B 4KZ0A 4K73A 4ZD3L 1FC1A 3CPLB 1HQRB 2OYOA 5DRXA 2CRIA 3ZDXB 1PL3A 3DMMD 3WN5C 3QI9D 4FMFA 2B4CL 3BAEL 3H1ID 1EAJA 1E5ZA 4X9FA 4XMXA 3QR0A 4QYOA 3U9PL 2V5MA 4NDMB 3QG6B 4XN1A 3WSQL 2JTYA 3B71A 3OKDA 5I30L 1LL1A 3OAZH 2WGXA 5D2NE 2VRAA 2LR2A 2PR9A 1BGYE 3PE9A 1D5ZB 3X17A 1KILA 3ZLQC 2BERA 1T3JA 1Y47A 2G2RA 4EN3A 1IGTB 3G5ZA 2YD1A 1PPJD 1B0RB 4K9EH 2WXFA 1NFIB 2GBVA 3Q8EA 2VC2H 3FWLA 5D7LA 2MCAA 3BWUF 4ODSH 1EDLA 2N1TD 2DBLL 4QRUA 3I50L 2C9UA 1N5YL 5BRZD 4Y5YB 1BFVH 2APBA 3MJ9L 1DBJH 1YNKL 4O58L 3AG3B 3QGVA 1J88A 4DTGH 1Z7JA 2FATL 2BEZF 3CZLA 1Y1UA 2YEVB 3L3IB 1B2WL 3VFPB 3LDBB 1XGPA 3ARGD 4EN2A 5C0EA 2NLJB 4K35A 4ETYA 1RF1C 1BXAA 2E74D 1S3JA 3NCEB 3QHFL 4WY7H 4NUJA 4MYWB 1VKXA 3BZ4B 4P3CL 1V27A 2L7JA 5CKGA 3NUKA 4NKDA 4C83B 1VFBA 1RK0A 2C34A 1WBZA 2BY3A 4Y5YC 2JCCF 5FW8A 5DTFB 1YVLA 2A6JA 1OF2B 2CHXA 3CH1B 3OHXA 1WGOA 4NQCB 4F2ME 2XYBA 5HYJB 1UZ8B 3VFRB 4Z7UE 3ULUE 3NIDE 4YBQC 1AIFA 4WUKH 3PIQB 4HSQA 1NEPA 4N0UA 1A6AB 1EQ7A 4H44D 1VENA 4D8PB 1UXSB 15C8H 2WZ7A 1XGRB 4MA3B 2O5ZL 3DXAA 5INCB 3SY6A 3OM3B 4PJHB 4F7EB 3LPPA 3PQYB 4HKJA 1PVHA 4AGOA 3K6FA 2X9WA 1NIEA 4JRXB 1UXLA 2AV1B 4M61A 1E42A 5AVXB 5F0LB 5CKAA 1NCJA 4DFHA 2ENQA 2AQ3A 5BV7B 3QEHA 2KI7B 3RNKB 2AQQA 1KIPB 1JPSH 3QJHB 2H1PL 2YPKA 3LN5B 1UD4A 1QA9B 2YAEA 2YKLH 3QWOC 1SYVA 1M1XA 4P46C 2YWYA 3MRMA 4M4RA 1WCQA 3T5WA 4BCYA 5L8JB 3J2PA 1Q9OB 4KVNL 4YHOL 4NZUL 4RGNB 4X98A 3GMQB 4OGXH 1OE2A 4H88L 1N5AA 3NZHL 1MLCA 4FX5A 3ZDMA 5BV7C 1SF5A 1MRDH 1PEWA 3MRRA 2EVFA 2WMPB 4G59C 1AA0A 4JFOB 4F7PB 3BD5A 4LIQL 3TM6A 1AXSB 3WJMB 1CI6A 1D9KB 3MR9A 4J4PD 4HCGA 3TH2T 1K2DA 3X3FL 4FXGA 2YJQA 5B1AB 4G6JH 1T1YB 4FFWC 4RGNC 3EFDH 1GJIA 3V2RA 2VO8A 1CQKA 1CDGA 1S2EA 1T2KC 1GZPA 4KTEH 4OU3A 5T3ZE 1E90A 1RZGA 1SHSA 2HG5A 1DEEA 3CFCH 4PJXF 2QEJA 4CU8A 2FJHB 1IM3B 4UM9A 1CGWA 1J1DB 3BFQG 4U7KA 5I2IB 3D05A 1D9KC 5IJKA 4LE8A 3H42H 1AH1A 2R4RL 4G6MH 4HZLB 5D4IA 4A67A 1B9ZA 1PYWA 2J72A 3CI9A 2OL3A 1E4XL 2WLZA 4KKAD 4RETB 4KX7A 3MCKA 3ZZQA 2DQIL 2OJEA 4FG2A 5TH2A 1LE9A 4TUOB 3I9AA 1GXEA 2WZ0A 2KBGA 2V5RA 2FT8A 4QIRA 4DOJA 1HL9A 1W15A 4AZUA 4PB9L 3WMPA 1J1DC 4JFDD 3VH8A 2C9AA 1UWGH 3E9TA 1JZ7A 4J3WA 2VB5A 3UAJD 3RL0D 4TT3H 3C8DA 4S10A 5A3ID 3V4LA 3E6HB 5SWSB 4UTBH 3CSYB 4LEBA 3KYKL 2W90A 1FOSF 4L05A 2Z8RA 5TGBB 3DURA 1U4FA 2CALA 2ZF8A 3O0RH 1LILA 1MEXL 2X38A 2FYVA 5F7BA 2BNUB 4IK7A 1CFQB 1AZNA 1IEBB 5C0IB 3LKNB 1VQ5P 1SDAB 3CXDH 3VMXA 4U1JB 2ATPA 1F42A 2A4CA 1RPKA 4UYPA 5ICZB 3RWHA 1MWAH 4JM2B 1BIHA 4ZNCA 2RN0A 1UB5B 3ARWA 3VU1A 2C3VA 1AO7A 1K8IA 4A04A 4LHUG 4J23A 1SUHA 4PREB 1R0AL 4HUVA 3NCJH 2GTQA 4G80B 2RKLA 4J6RL 3HMXA 4WWKD 5L6YL 1S5HB 3BN9D 5KG9A 2CBPA 2F5BL 2Y5TB 4X5WB 2HVBA 3OG6B 1S7QA 4MZIA 1CDUA 5JZ7D 1WBYA 1YC8A 1W0WB 5IQOA 1S9VA 3BLKA 2R0WL 4OF5A 4HH8A 1DEBA 3FGAD 1AS7A 4TUKL 5EH1A 2MWCA 3RHWK 2K9FB 2X9ZA 1YIJP 4MCZB 1J8SA 4M62L 2BW5A 1IGCH 2VNCA 1KT2B 3V55A 3EJYC 1JK9B 3S3DB 5I1KL 1B0IA 4WO4A 5I66B 3ITKA 1HEZB 4X7FC 3B7UX 3FAWA 2J1YA 3QR1A 4TMPA 4HW6A 4AWJC 5F93C 1MRFH 3U7WL 3KZIE 4FQCL 2HTLD 3ES6A 5IFHL 4MQTB 3C6LB 2IGFH 4NZJA 1AXIB 4UV4H 3W5MA 2VSKB 1AFVH 5I1HH 3QFDA 4R4ND 4IBYA 4Z1MH 1QSEB 4RLDA 4EQ2A 1R3HB 3JWDL 4ETQB 3ZE1E 2X4NB 4ZNEE 1K5WA 1WK0A 5J7CC 1QQDB 3RDTD 4DOHE 4JBZA 2AEMA 2W38A 4MQ7A 2KI6A 3C6LC 4D7BA 3SKMB 4ODBD 3PH0A 1AE6H 1FV1A 5D7JA 3VFNB 5T3XE 1F4XL 1DTUA 5I1EH 4Z77A 2VMFA 2ZUSA 5C71A 5CGYD 1PV3A 1SQPD 5AVVB 2IQ9L 4FQPA 1N2RB 4HSCX 5TDOA 3SE3C 4DPRA 2APVA 2P8LA 2CCLA 2J7LA 4QNPE 1KGJA 2YXRB 3CZNA 4DESA 4EEEA 2IFFH 2B20A 2C5DC 4X42A 4XVJH 3RLSA 5HD8C 2Y36H 4LCWA 1XO8A 3T3PE 1X7SA 1N73A 2OJZL 4KKBC 2YQ2A 4LF3A 1G43A 2AJZA 4GI8A 1FIGL 4QXGL 2EIKB 3CZJA 1MIMH 4U0QB 1XSJA 2QQQA 2YKPA 2VERA 3P9LA 5BMFH 2FJSA 1KJ3L 1D5BB 1QRND 3V5KB 4NQDB 1F58L 1TQCC 5DVKA 4YZWA 5CCGE 2JQZA 1PTZA 5I6NA 1FFPB 1ZT4B 2W95A 3C60B 3MRGB 1FNLA 4LCIL 2XX0A 1ZJBA 3UTZA 4P4KB 2BVQA 4XX1E 3MHVA 4EIGB 1LP1A 1JOIA 1JDAA 2YIUB 3C9NA 3IGFA 5HYSG 3TWCL 1A3LL 2FEJA 2BCCG 5SV3A 1ODUA 3O8XB 1BCIA 3CUPB 1T7YA 2UZXA 3MYZA 3GEFA 1IBGL 4N2EA 4M7LT 5JHDD 1WUZA 2Q6WB 3SQOL 5CS7A 1MCWM 4D9RD 4OZGE 1I3GL 4DK6A 1MHCA 3MOBL 2FYUJ 4LU5H 4ZS7L 3ZK0A 4B0MB 1YYCA 3HUSB 1MFEL 1SDDB 4BFJA 4AUJA 5ITFA 3CXHI 2YIUC 2H0EA 4LL9A 2CKBL 5J1AB 35C8L 1RY7B 1I4FB 3O8XC 4Q0XH 5ICUA 5JPMC 4ZQKB 5JHLA 5DJ8B 4P5TA 2WQVA 1T1ZA 3BRTB 3FT2A 3IBOA 3WV0A 1YJNP 1TMCB 4MZRA 4FP8L 5EBLB 1MVYA 3SIKA 3ZOAA 1ZHBB 4UQ2B 1Y1DA 2YPVH 4FNLH 1WLHA 4MA7H 3T1FB 5T5FH 2WXIA 4PG9A 2VC2B 5FUOL 3IR9A 3WCYA 4H20H 3BCCE 2NR6A 4JO3L 3KM1A 1KPUA 5C09A 4R7VA 2BSCA 4N3TA 5KS9E 1OTSD 3TT3L 3CX5I 5I24A 4ABWA 1F4WL 4NN6C 4DN3H 1AV1A 5KSUB 3DRQB 2CQVA 3PHLA 2C7FA 1JNHB 5JA8B 4KTYA 4UB8H 5D6DC 2AXGA 2VH5L 3MTRA 4G71B 3IFNH 2DLEA 1H6FA 4WGWB 4BXSV 1MHEB 3HZYA 3QEUA 3TCLB 3R06B 2OBGA 1BREA 2IPTL 3HG2A 4LNRA 3V6OC 3RX7A 3S3SA 3FTSA 2ZE0A 1JZEA 3QJQB 4PJAA 3MV9A 3MJ7A 2X9XA 4XPBL 3IJEB 3VFMA 5AD0B 3V7AE 4BZ2L 1BQRA 2XWRA 5D1XD 4H8HA 2POHA 4KFMA 3U2IA 5BJTA 5B39A 1BCCE 2FY8A 2NNFA 2EYTB 1R5VA 3KS0J 5DR5H 4FI8A 5ACLA 4ERSL 5GS0D 2I9TA 5L7XL 1MCQA 4W70A 4DGIL 3MP7B 2Y7SA 5L2KB 2EXYC 2KS1B 3V9EA 1WZKA 4RH4A 5PAZA 4OD3H 1CVSC 1WGVA 5HJGA 4C4UA 3QRBA 3Q3GB 3K81A 3L75E 3SKOA 5KLVD 1KIQA 1NBVL 2Z34A 5I8OL 4AQEB 3NFPB 3P3TA 1OGTA 3LRGA 2B39A 3E8VA 3O45A 1UEYA 1MN4A 4HXBL 3K6DA 4IDJL 1DIPA 5E9AA 1SQ2N 4EZLA 3UIAA 1NCCL 3BWAB 4KK6C 5EORH 3QXWA 4P05A 5SX5K 3SKUD 4A6YA 2GEQA 3NCYP 3NDZE 4S1SL 4WUUE 1ZP0C 2WBKA 4FYTA 5EU3A 5EEWA 3PLNA 1PD0A 2QSCL 4JPWL 1QO3A 3JV5A 1F3JB 1RIUH 2A4ZA 4R2GD 1NKGA 4EI2A 4MJ5A 3IDIA 3DX8A 2FIKA 4MQXC 3VTAA 4Y1AA 3GXFA 3BI9X 5INDA 2AEPH 4N2BA 2KNCA 1SQQG 4FG6D 4F3FB 3SKJH 3MNMA 3LEYL 5AWNL 1XHHA 1USDA 1L9NA 4UT9L 3K72B 2CCWA 2V3EA 2YKOA 4DFIA 1CGVA 5D2NC 2LU7A 5F7LB 5DK3A 1PPIA 1XL4A 3KPQA 3T9WA 3QE5A 4Z7OE 5F7FA 4HUWA 5IOPB 4ATTA 2OTUA 3PJLA 5T5NG 3Q01A 1MUJA 4HETA 3LNFA 3W67A 1SQQJ 2Y2TA 2XZAH 3BN3B 3OAYH 4PWFA 2OW7A 1NCIA 3H53A 4JKLA 3CWBE 3F5HA 3KPRA 3L4XA 3UAEA 4UM8B 1X22A 1MNUH 2EIZB 4I2XA 2BSTA 4PRDB 3ROLA 1E9OB 4ELKB 2AANA 4YXHH 1MIEH 4GSQA 5E23A 3RGUA 2P7JA 3RTQC 2YN3A 3G5XB 3N85L 4ONFL 4Y89A 5EIIG 5IVZA 3RVTD 4DEPB 2IADB 4HJEA 3MJ9A 4IMKC 3HB3B 1ZK5A 1L7IL 1K9TA 4X4YB 2C3GA 2MRYA 2NY3B 2TAAA 4KRNA 4LSSL 3WLWC 4BRJA 3HRPA 4UQAA 3TNNB 2ZPKL 1BD2B 4PJCE 5J9PA 3JTSA 2D7NA 5AKVA 1EDHA 4HU8A 5AG9A 1MWAB 2NNAB 3L5WA 4LVNB 3U4BL 4DAGL 1CG9A 4K7PY 2B5IB 4RAUA 1HX0A 3OAUL 3HA0A 1WD8A 1SBBA 4Q89A 2HJKB 5E1HB 4NC1E 1MFMA 4I13B 2FR4B 1SXNA 4GPVA 5F88B 3LY6A 1XIWB 1EZVG 1U2HA 3F7YB 3FXIC 3HE7D 4E9WA 5B8CA 1DQJA 4AQ1C 4BZYA 4M5YH 1JCCA 4LVNC 3RVXC 3TIEB 5CZVH 2B5IC 2BHZA 3KL0A 1Q7YQ 2JQMA 4LLYA 4GG6F 2VM3A 2HG5D 2X28A 4NWTH 1QZ1A 1E2VA 4L1DA 1MUUA 4PRAB 5ACZB 1A7OH 1DSWA 4UM9D 3QNZA 1OW6A 2D7TH 3KLLA 2HFED 3CSFA 1P4IL 4G8GD 4R90H 5H35A 4ISVB 4ZFFA 3DHPA 5C7XL 4N2KA 2OCJA 4AX3A 1R46A 1JSYA 4O9HH 1ED3B 1M71B 1HH6B 3AZUA 5I6XB 2F18A 2O5NA 4NEHB 4PYHA 4XMLH 5ID1A 1GYWA 3POCA 1AKJB 1Q72L 1BWMA 4B41A 4JZJB 5FCUL 1JERA 2PTUA 4JY6A 3M0DC 2GJ6B 1CQYA 3KD4A 5FYJU 4QRFA 4B9GA 1GS6X 5FKAA 4FC3E 4FMVA 4O02H 4QLWA 1LE5B 4DP4X 1H6TA 3GO1L 3UTTA 1MW2A 4TL4A 2IDFA 3PCYA 5A2BA 1JHKL 3KXFA 4ZFQA 4R5XA 3EOBB 4XC3L 3UTSA 2LAGB 3GMRA 2AJXL 4JZJC 4OKDA 1PJ9A 3FTGA 1RPUA 1I8LA 4TNVF 5FR3A 2CIKB 2VAAB 3CBKB 3QUXA 3L3JA 4I4WA 4C4BA 3QORA 3LQZA 5ABZA 4FDWA 3QUZD 4PJ7E 3N4XA 1FIEA 5CEYB 3VFWB 1EGJL 2ADGA 2DJ4A 4UU9A 3PFQA 3H9HB 2FSDA 4OGQD 2F8VA 2PR4H 1SQVG 4GT1A 1NIAA 4BA8A 1PY0A 2VUYA 2E7LA 1RVFH 1RFDL 1QWNA 4GIFA 1SQQK 1IAOB 4HKBA 2IYPA 5B5EE 2Q3ZA 3HS8A 2H4EA 4GOEA 1ERNA 1QYGH 3MA7A 3QQ4A 4OGAC 4V11A 2YUXA 3MXVH 2B88A 4GQRA 1U8CB 2WWKT 3FQ4A 4BRYB 1T22B 1YJWP 3S3CB 4GSDL 4QHPA 3A22A 5D2LB 3O4LB 3AQXA 4Y8DC 3QAQA 1SQVJ 5GJSH 3VNYA 3SY0A 4ADIA 2IBZX 3D87B 2N4IA 4NJ9H 1T5XA 4PGCA 3T6VA 3RGBA 4WO4D 4ZMQA 4K8RD 2H43A 1UH4A 3CCEP 3L3OB 4GRWH 1D3CA 1MF2H 5IB1B 1X5JA 2PPAA 1U8PB 1I1AC 1AMXA 3OGCB 2FK9A 4WK2B 4GKSB 3D6GA 2NY5L 4X6BA 2FO8A 3A4EA 5E1IA 3CCSP 2ZUVA 4P2QB 4OB5H 1Q0XH 3KW8A 1H0DA 4ODHL 3KPSE 4YWGH 3TN0B 1URQC 1OQOA 2EEBA 5CWSB 4ZOEA 5T1MA 3UH8A 3NPSB 5HHME 1JZGA 2GPZA 3TJEH 2DI9A 4NI6A 2FYZA 4I18A 2XPGB 2CGYA 3MCLL 3FQRA 2CR6A 3FU7B 3ZE1B 2X89A 2DEYX 4TSAH 2CA3A 2XNAA 3CDFA 3IE4A 3R19A 5D7JD 5DS1A 2G3ZA 1JY3P 3MLYH 3TN0C 2R7EA 3K0WA 1NHLA 1QACA 3GMAA 1EDYA 4XMUA 5AUMB 2VISA 2VSMB 5CEZE 1D7BA 2BNQB 2WXJA 3WU2E 3EHBB 4KQ4H 2D0GA 1TU2B 3OSKA 4KXBA 5HXMA 5MHSE 4DH2A 2YNYA 5AYUH 2X6UA 4LCWD 4OLZH 4RGOL 1BOGB 1NEZG 4HWBH 4HIPA 4PHZA 5A6IA 4PN6A 3MGOB 1S7UA 5T1KA 1VZHA 2WIIA 2AJSH 5TDNB 4PJIE 4I77H 4DQOL 1NO4A 1PP9D 2E9GA 3RZCC 2WO3B 1NMAL 4S1DD 5C8JA 3A67L 2PPDA 1XGUB 3PPSA 4ZMNA 1PIFA 3T3PB 3E6FB 4CVZA 2FO4A 1E0OB 4XBEH 1RKRA 1X0TA 1CDIA 3D85B 4KUCF 5CO1A 3L4CA 2VLRE 3ABLB 4IHOA 4XXDB 2NY1B 2KC0A 1JGEB 1IVTA 2RHEA 3FO9B 4IRSB 4DK3A 2V37A 3L81A 1SFDA 2MOVA 4RBPK 2OARA 2H89C 1BQKA 2W80C 1WC7B 3CQPA 4XMKL 5DQJB 5GSVB 4AQ8C 3RFZB 3GSOA 1VESA 4GAYA 4JDTL 1RJYB 2R44A 1CYGA 4JMNA 4EDWH 4LFHD 5TF0A 4AQAA 5CCGC 1VQNP 3NYKA 3OR7A 3TJHC 2RCSL 1T7WA 4KPHL 1JV2B 2NY1C 3EBAA 3MGTB 1SBSH 4IRSC 2ORBH 4ZDHB 3O8ZA 3D3VA 3O4OB 3DIVA 4P5TD 4QRSB 1ZEAH 4JLRB 2XG5B 1CLOH 3RFZC 1IBDA 2PYFB 2A9ML 3VXSE 1LDPH 1Z9NA 2CRMA 3CAFA 2R1WB 4FOMA 3SBWA 4L1LA 4ZO8A 3Q5TA 5E8EB 2O5XL 1RERA 1L4AB 5CCKH 1BPVA 1E79H 1HNGA 2XA8L 3AWGA 3OLDA 4N5ED 4X6CE 1IFRA 2AJVL 3O4OC 5F1IA 3TJPA 1ZTMA 4Y1TA 5CEXA 5C09D 5GIRB 4JK0D 4U1HB 3SKNA 1SQVK 1NOHA 1II4E 5LNGA 3R8QA 3IYLW 3X1FA 4PRNA 3V6IA 1EZUA 1Q9WA 4OY9A 2P3YA 4RAHA 4ACPA 1R3KA 5EZIH 2TSAA 5D96B 4HOZA 2BSSB 5I1LB 2QR0A 4GAJH 5JORA 4PTTB 3CZFA 1ZA3A 2CKBA 1VEOA 2PCFB 4MCNA 4ONGH 5DRNA 5HI4D 1MPAH 4IRZH 3GLEA 5C0BE 1F11A 4QHMA 3S7GA 3SYQA 3TO4C 2JEEA 2OZ4A 3VXME 4PPTA 1R5WA 1UWYA 2KQNA 4DO4A 5JQ6L 2YPLA 2KUTA 2CJUL 3MV9D 1AYRA 1CLVA 4MNHB 2ZXQA 4YL4A 1A7QL 3SO3B 3UGXA 1GW6A 5JIDA 1JMBA 3MACL 4GSXA 5D96C 5DEFA 5J12B 1IBZA 2WJ5A 2ZX6A 4U6VH 2YWZA 1EHAA 1NBZA 3NIFE 1OIPA 5EFWB 2DYRB 5D7IE 2KLRA 3QT2A 4M93B 3ULVE 2K37A 2VR8A 2EH8H 4HT1H 4XX1G 1QLRB 4NFDA 5BV7L 3RGVB 1A0QH 1KJ2H 5DJ0B 1T5KA 1FZJA 1NTKG 1OCCB 1BZQK 3DJSA 4Y5VB 3DO7B 1RZKC 2AGJH 4PJBE 3MUHL 4H40A 4KX8A 2X6BA 4M93C 3LRKA 1QSZA 3NAAL 3TVMB 3U48A 2WQSA 5I1GL 2HA1A 4K3GA 4HLZG 4ONHA 3RGVC 3RNQA 2MJWA 3D12B 4BGDA 4B5EA 4QEGA 1XXFC 1DVFD 3QFJE 1BYPA 5IP4A 2HFFA 2WSCH 5EA0L 4P2AA 3TS8A 4BZ2A 1JPEA 1EEZB 1OO2A 4LOUD 1IEAB 5H94A 2ZWNA 2JKRM 3I2CL 1IFNA 4WI3A 2B59A 1I7RB 2AK1H 5E6ZA 5FHBH 1F18A 4NN7C 2XN9B 1WG3A 4HIEB 1CT8A 4Y1AD 3TBBA 2P5WE 1GHFH 3KJ6H 1KV4A 2AXJA 3VAEA 3BMVA 1ITCA 2V33A 3OKKB 4UQ3A 1D5IL 1H5BB 3RA7L 1TKWB 2PLTA 3RBSA 3THML 5IWLC 1T66C 4AM0A 5CJOL 2NY7L 4OZHF 2YGNA 1PY4A 2R1YA 4AMXA 1WZLA 1KV3A 2CLRB 2DTMH 2TRYA 3CDYA 4G7VH 4KNSA 4QRRA 1MFZA 1AYOA 3TBYB 1ND0A 1FC2D 5A40E 4ATWA 4QT5A 3LN9A 2F1AA 1HAWA 3IS0X 3MI6A 4ZUTB 4E0RB 1KYFA 1R19A 4G6FD 4KTGA 1H5BC 3VU2A 1SQBD 3BCCJ 2DQTH 4ZUWA 3M91A 1TYJA 5DFVD 1KXTA 3KPRD 1OB0A 2WWMC 1C5CH 2FZ3B 3KJ4C 1X5IA 3VFSB 2O1AA 1L3NA 1N7SC 3SQBB 1M7UA 3M07A 4N6QA 3KPEA 5FYJH 2OXHA 1N8ZB 4AGQA 4YEFA 1NA8A 2FT7A 3SDCA 2AV7B 3MLVH 2J8UB 1UJ3C 2ARJQ 1N9PA 2YAFA 2J55A 3BZDA 4OT1L 4HEME 3IKKA 4R7DB 4UT9A 3D2UD 3KL3A 4Z78B 1Y6KR 5FOBA 4G7QB 4DZBA 5EU5A 1N6QH 3RIFK 3R0NA 5F3HA 3Q44A 3S35L 2OTWA 4JFHE 1ASPA 3FYEB 2H6PB 3AREB 2PCPA 4XODA 2AXFA 5I1DA 4ODXB 4GAFB 3ILQC 3VI4F 2QFRA 3K2MC 2EE3A 2HVKB 3CU7A 1KIUA 1UZ6E 4M48H 2MOGA 4MD0A 1KGCD 1CTOA 5EZLA 3S8FB 1YPZF 2FJGB 1F3RB 2EC8A 4JQVC 3SCMD 5AZ2H 3G3ZA 3V8OA 4JY4A 1NAMH 2BOCB 2XC8A 2ZAGA 3F58L 5DURB 1D6EA 1YEGH 4EI5D 4MZ2A 5DJDA 4Z7WB 1GZQB 1MV8A 4QGYA 5GRJH 1ZGLA 1S5LH 1TTRA 1HHGB 3FT1A 4RDQF 3T0AA 1HILA 2YS4A 1CXFA 4JFPB 4JX0A 5E5MB 4J2QA 3U79A 4B50A 4MB1A 4RFEA 5JXAH 1IO4A 1CB4A 2IV8A 1P9MA 2NY6D 2X87A 2FWSA 2ZZUT 1M6OA 2N9BA 1GC1H 2WANA 4NC1C 1R17A 2PXYA 1PY9A 4XBPB 1HGVA 4GRWB 1OZTG 2BASA 1BBJB 3WUWG 4X7SL 5HDQH 4PJGA 3SE8H 3HUJE 1L7TH 3ARVA 1HI6B 4OLYH 4ZS6D 4HS8L 4TRPH 1L0XA 3GKWL 3BQUB 2Y07L 3WFHB 1ZR2A 4HKZH 1KB3A 3P4OA 2YD9A 3FAXA 4XVTH 4D6TD 2DQHL 2CXGA 2ZJSL 1WYJA 3T4AB 4U1KB 2B0SH 1NTKK 4K3DH 5JIPA 2I5YH 2WQUA 5BVJB 4MNQE 1Y9BA 2OR9L 2YD7A 3UTTD 3L71E 2HLFD 4K0OA 1FF5A 5JIKA 3QDJA 3UTSD 3PRJA 4ZOCA 3H1KE 1J1OL 1WT5C 2XETA 5LBSL 1ZVYA 4PJ5A 1FJ1B 4GO6B 2ALAA 3PGCB 1XEDA 3JWNE 2Y7OA 4XNXL 1HVVA 2VLKE 2R2BA 5DEGB 3QORD 5CILL 2V2WB 5AKRA 3B8SA 4CUCA 4WVRA 3CC5A 4WEBH 5FGSA 5C9KA 2GUVA 1JZ4A 2IPKA 4P2OC 3EFOB 4O2FA 1Z32X 3GMLB 3PXLA 4FQ1L 4RVBA 5E0FA 1BLIA 1DQDH 4RSVA 3ULSB 1J0KA 1PEZA 4UQ9A 4R4LA 3WIFA 3GBLA 3JWOL 4WHDA 2A1WH 3UMTA 1GL4B 2XQYA 4Q14A 5D1ZC 1H3WM 2A7BA 3H2PA 4Q6KA 1KFNA 1PW3A 3NEEA 4LHQB 4XNUL 4MVBC 1BVLB 3AE7C 4Y9CA 3S36X 1JB0J 2CBTA 2NDFA 2X4TA 5IBTL 4ICXA 4V33A 3Q6GL 1T83A 2A5UA 1RUKH 3BUYA 4HIXL 1SXCA 4CPGA 5HI5C 4E9RA 1EGJA 3L4WA 3HC3H 1BZ9A 2DRUA 5DQ9B 3TXAA 2DV6A 3ZTNH 1ETJA 4YHNB 3JVGC 4IFFA 3GMMB 4PW4A 5FFOA 4OTXL 1XL6A 2V7HA 2X4RA 2LU5A 3UTPD 2OJ1A 4ODUB 4TULH 5IMLB 4OF7A 5F89B 1HGZA 1WIPA 4L3AA 3HI6H 4Z5RB 4K9EL 1O6TA 2O6EA 2Z92A 5FM5M 2VC2L 3CMAP 5T1LB 5DHXB 1KLFA 1QLFB 3AVEA 4ODSL 4AIZA 2X89D 3WTSA 1JPTH 3N1MC 3RAJH 5HHMB 3TCXA 4WW2A 1BFVL 4TYUA 1CLZH 4F8LA 4DTGL 2IANE 2W9DH 2YC1A 4OLWH 4RDBA 2EDEA 3RWGA 3FOMB 2RACA 1KLUA 2WQ8A 4NO3A 4WSGA 4WY7L 3UX9B 5JNYA 3LS4H 1TJHH 3KPMB 4QHLA 2W07A 4BJLA 2GAZB 2GCYA 4EI0A 3MTXA 4NLAA 4V1DA 1OD7A 2DM3A 3CBRA 2OYHC 1MCDA 5T1KD 5IJVB 1N59A 4PI0A 1G7LB 1S9YB 4WUKL 3RL0g 1KEMH 3VWKB 5K9JH 1HUCA 2QVMA 4YHMH 5FA3A 4TVPH 4POYA 2WNGA 4MXVE 4Q6IB 4RZKA 5FB8B 4PJIB 1V3MA 2Z93A 15C8L 2OX5B 3APFA 3WDHA 1LGHB 1ID2A 3D25A 3P73A 3QUMH 3FH8A 1OIOA 1OGAE 3VMAA 5AOZA 5JW5B 3IB4A 2BCKA 2Z7WA 4W4OA 1S7VA 1A47A 4WTXA 1P5UB 1D5XB 3WKQA 4WFHE 1M7DB 3VWKC 4DGUA 4PV8B 1KJ2B 3IMUA 2WTYA 1JPSL 4PJFE 4X6EA 2J2ZA 2NX5A 2YKLL 3O6MH 1KFMA 4P5KB 4Y4HA 4R26L 1E8WA 4V2CB 1A8JH 1P5VA 2MKVA 1WZMA 4PJ8B 3H7LA 5FYKU 2YGQA 3WDJA 1MRDL 4D9QD 2Q86A 3D3VD 5KVEE 4MD5B 3IMVA 3UC0H 3HAEA 1A7NL 1TJGH 5FWRA 3P54A 4KGJA 2HSIA 3WN5A 4JKPH 5CIPH 3SDXF 1HYSD 1SZNA 2K8MA 1HXYB 4XVUD 2JXMB 1FFRA 3O6QB 3D5OF 4MAYD 4YHPB 1QUNA 4G6JL 4AT6B 2OSXA 4AITA 4PJ8C 3IRPX 4KTEL 1UKSA 1YNTF 1ZV2A 1B6DA 5C2BH 2A0LD 1CFSB 3CPLA 1HQRA 3NT0A 3PHAA 4FLSA 3GRGA 3HLAB 4MNGE 2WKGA 3LD8B 5LG1A 3EJTA 1RAMA 3H42L 3RI5K 2NXZC 1LP9A 2QL1A 1EQWA 3FDWA 4IKNA 5CD5C 4W9JC 1QLEH 4LLMB 4NDMA 3QG6A 5AW9B 4MD4B 1P84H 1A7PH 1RH8A 3CSTA 3RVVD 3U6XA 2BFGA 3C8HA 4OQ1A 5A7BA 2ZAHA 1D5ZA 1L9RA 2JLPA 1SOSA 1KDJA 3LD8C 4GQ9H 1IGTA 1ZTXH 3TASA 1AGEB 3FCSA 3FTZA 1B0RA 1UWGL 3PAUA 2HRLA 1NFIA 3EDKA 3NZUA 4APQC 1KCWA 1RF1A 1SF3A 3HBQA 4UTBL 4MA1B 4NQEB 4YHIB 5A2JH 5C0GB 4Y5YA 4JJOA 1P7QD 4XHJD 3L3IA 1CU4L 3VFPA 3IF4A 2F0CA 2JIXB 3AY4C 2NLJA 3O2VH 3PWNB 4PIBA 4HGMA 5D7IB 4PBXA 3WFZA 1QTPA 2ZOKA 2EC9T 3CXDL 1HZLA 1FAIL 4I7ZC 1KCLA 1UD2A 2Z7ZA 3BZ4A 4MKMA 3IK2A 4A2DA 4F93B 3HTKB 2ESVB 1NC4D 2OYMA 5C0FB 3TV8A 4BFBD 4HCIA 1MWAL 1JMZA 4C83A 1J87A 1TPXB 3QUHA 1OF2A 5HHPB 4NQCA 3JTTB 3CLFH 1UZ8A 1EK3A 1H89A 4JDEB 1N19A 3VFRA 3UBXG 5HYJA 1NU1E 1LTJB 1G6RA 4I3GA 1T0OA 3NCJL 2IIJA 3E2HB 4Z18A 1KZQA 1A6AA 3SB3A 1RU9H 3ULVC 4D8PA 4WNQB 5J6SA 2IALB 1UXSA 1XGRA 4MA3A 2E7HA 4L3CB 4YTPC 3TCTA 3V4PH 1QSFE 4P46A 3QFJB 1HSBB 4F7EA 4WBAA 1NBCA 4D0CB 3H1JE 1NAMB 1KORA 1UJTA 1XB8A 3LAFA 3Q2LA 2AV1A 2CDEB 3PWPB 4MASA 2JKWA 1LTJC 5CHNB 2GUYA 1TVBB 4HHGA 1SMOA 4PAZA 4QWWD 3RNKA 3ZE2B 1SFCD 3QJHA 1N3NB 4ADGA 3LN5A 1IGCL 4KFZC 4TQIA 3U7YL 3C8KB 4QRBA 1HSAA 2BHFA 3W5NA 3W56A 4CSZA 4EIBA 4N2MA 1UACL 1AIZA 1R5IB 3GMQA 3FTYA 5FYLD 4QRRD 4JYCA 3CZSA 1JXJA 2WMPA 2KLTA 4JFOA 1L9QA 1X7QB 3TO2B 3FOLA 4F7PA 4CW1B 1N18A 3Q7JA 1AXSA 3PV6B 3SYPA 1D9KA 4IL6X 3Q5OA 5LGHL 3G6DH 1UWXK 4HKZB 1FA4A 1T1YA 3CN1A 1HWGB 4GW1B 2E43A 5A6LA 3H6PA 2P5ED 2E27H 2BZ7A 3VP9A 2VR3A 3H85A 2FJHA 4UB0H 4PV1D 1AE6L 1IM3A 5IFJA 1GOHA 3KS0H 3BASA 4PD4D 1HJBA 3SDCD 2BZDA 3LN4B 3SPHA 2HUEA 4NM4H 1DVZA 5IB5A 3F5WB 2G9KA 1J0ZA 3H8NA 1LVEA 4UYQA 4IRJB 1GS8A 3B43A 4XCFL 3QXVA 3ASWA 1PDKB 2QSIA 1H6EA 1XTGB 2EIBA 2IFFL 3IGAB 5H37A 4GYBA 5C6TH 5D1QD 4U1SB 1NC2B 3BSGA 2DDQH 4JRYA 4KZCA 4KNTA 5FOJA 3A0HH 1E6JH 3HC0A 3II2A 3BDBA 4ALAC 3E6HA 2A6KB 1BFTA 2OMVB 4G72B 5SWSA 5IHLB 5IVXF 2E9WA 1MIML 3NK3A 3NEOA 2EH7H 4OD2A 1G7JB 5TGBA 5BMFL 5DZNA 3DX1A 4LBEB 1OL0A 1UGNA 1X3DA 1ADQH 2PFXA 2JV6A 4M02A 1NSNH 3RWFB 3EYFB 2BNUA 2OFQA 3H3PH 5I15H 2DIEA 1CFQA 1IEBA 3ZIMA 2B89A 1UB6B 3LKNA 5C0IA 4XNBA 5AVYB 3CZEA 3QDGE 4ZKUA 2QLYA 5ICZA 1QVGO 1OSPH 4JM2A 4PJEA 1U95B 5IEHA 2EZ0D 2NPSB 4I2LC 4M5ZH 2O93L 3IJ7A 1UB5A 3VRLF 3VD3A 4ADJA 3V6FB 5MENE 3CCMP 2PXYD 5KLIB 4U4IA 3RU8H 3GBDA 4H1LG 4PREA 1T0MB 2W9EL 1JWMB 1S5HA 1OAXL 2Y5TA 4X5WA 1UASA 2IFGA 4Q0XL 1AR1C 4F8TA 3QQDB 4KH9A 2NPSC 4FG0A 1GY1A 4R96B 4W6YB 1V8HA 3K7UA 2IZ1A 3NQKA 5E9DA 3T0ED 5GSRB 2ICWI 3CPWO 1DVYA 3GSNA 1S8DB 4F92B 1SJXA 4GFXA 2EINB 2YPVL 4FNLL 4MCZA 3LPFA 4MA7L 5T5FL 3KBHE 4N0FB 1GL2B 2UV3A 1KT2A 1JK9A 3QDJD 4I6MC 4WAFA 4ZFZB 5I66A 1HEZA 1NTDA 5T3XL 3EXLA 4L5FE 4EZMA 3NMEA 2Z4QA 4NUQA 4QOKE 5TE7H 4DN3L 1WFNA 4PJDE 3C6LA 5H4YA 2J8OA 3HCVA 1GR7A 3MDJA 5IVNA 1JWSB 3IFNL 2R2EB 1KFAH 2IWEA 2N7AA 4ETQA 4Y5XB 2VLKB 1ASQA 3AXLA 1OFCX 3KWUA 1AJ7H 3SE3A 4BFOA 1QQDA 5B38A 4JNXA 3B1TA 1W0VA 3NFSL 3HG4A 2CXKA 2IDTA 2BXYA 4JFUA 5ADOH 3LEXB 2ZXXA 5TJHA 3ZKSD 2EXWD 4CADB 3VFNA 4PP2B 1MCIA 3D8MA 1GZHC 4MQSB 3WGVB 3JWNC 4BHUA 2QQLH 2VE6B 5EEVA 5IOKA 2V6HA 5ILTH 2WYZA 4N87A 3R4DA 2V2TB 3DVFA 3DSNB 5LBSA 1DQQB 4OD3L 5LAPA 2ZOOA 3QUMB 2LLLA 2V9TA 5B66H 3KWXA 1N10A 2FQEA 6PAZA 3AW5A 2BVEA 3VA2C 4F8QA 1WCBB 1AQDB 2FRGP 4BWWA 1U33A 4F9LA 1BDDA 1U92B 4XPTH 2NNCA 2ZX8A 3MV11 5F6HI 3T4YB 5IKCA 4CBPA 2Y23A 3L45A 2MCPH 1YQVL 3V5KA 1D5BA 4NQDA 1E28B 4QXTA 1CTMA 1FFPA 5FYKH 5DZOA 3MRGA 5HDWA 5EPMB 5EF0A 1RIUL 2XIIA 3KMDA 5CIPB 3EADA 5EOQH 1H8LA 2XKUA 3O8XA 4WDIB 5JPMA 4K9JA 1K8AQ 3L71G 2AEPL 4FQ2H 1NOFA 4RIRB 5IY5B 4IBSA 3PHQB 2NYYC 5IF0B 7PCYA 5JDSB 5HP5A 3A23A 1SDDA 3AU0A 4RBPH 4N22A 4WWID 2LQRA 4BZ1H 4I87A 3N40F 3STLB 3IDNA 3QNFA 5J1AA 3E3QE 3QCVH 1I4FA 4JFEB 1INQB 1DP0A 1QLEB 5K1JA 3K8LA 4OFYA 5DJ8A 4L4TE 5I0WA 3L71J 3OF6A 4NQTA 3GSXB 3L73G 2OTLP 1CFNB 1HKLH 2XZAL 4V1DD 4XH2B 5EBLA 1JY3N 2PYEE 1ZHBA 1THAA 3ARDD 3IGKA 3A4AA 5IW6B 1NKOA 3ALXA 5IEKB 1RZKL 1TLMA 3T1FA 5GRYA 1K8DB 3B2XA 3UG5A 2E9IA 1A4JA 5E5UB 4EQ3A 4F57H 1WIOA 4WEEA 2D73A 5D6DA 4IOIH 4YXHL 4P9ML 3W81A 3S9DB 3U59A 3O3DB 4HK3N 1K4DA 6FABH 1I3RA 1YEHH 3V6OA 4BUGA 3MNVB 1UA3A 2K9JB 4PJ0E 3MV8E 4W9FC 2VQUA 3L73J 3JYCA 5F1SA 1CC3A 3Q8CA 3FFCD 1JNHA 3B9EA 3FMGH 1KN4H 1OGAB 3P30H 3RVUD 1ULVA 3TCLA 2NX5D 3R06A 4AVKA 3S34H 3SGEH 3GLMA 1IBHA 1JNLH 3P3UA 5IHBA 4JS7A 3VGHA 1A6VH 2H9GB 4PJFB 1UUSA 4YDLB 1AHMA 1EO8H 3QEQE 3L7EB 3OB8A 4LCUA 3WFCH 1WH0A 2A9DA 2Y24A 3LZLA 3CCLP 4FYSA 3GHGB 4NO0B 2EYTA 3GGWB 3D34A 1SVFA 4X4XB 5L2KA 4M5YL 4XNYH 1E40A 2KS1A 5CZVL 3KR3H 4QJ4B 3ML8A 1LM8V 1VGKB 5BZWB 4ELMF 4EUPB 4WB4A 3DPBB 5E8PB 3H2QA 2OMTB 4YQXH 1A7OL 1IB5A 4AQEA 3GHGC 3NFPA 3I5CA 4P23D 2E9BA 2EIEA 3APNA 4F8OA 1OTTC 1PKQE 2FH6A 4F7TB 3EJQA 2BS71 2IAAC 4Y2OB 5DF0A 3BWAA 5DSCB 1FFOB 1CK0H 3S97C 3IDMB 4AYCA 1GCFA 1GMJA 4KKNA 1E8XA 3L9RA 4OZIE 4U3XA 1GA2A 4ZW3A 5APUA 2YAQA 1F3JA 2DKUA 3R1GL 3AE4C 2LOEA 2A06G 5C0JB 1RQUA 4YLBA 5KSBE 4F3FA 3VD9A 3F6IA 4LQFH 3QZBA 5SWQB 4Y2DB 1CXIA 1W80A 3CL3D 6PCYA 3M1OA 5I23A 1HESA 3A6OA 2IFMA 3K72A 5L0QB 3BPNB 5APTA 4WJG3 1KXVC 3U4KA 5DVLA 3P8CE 2Y3NA 1X4ZA 2WTRB 4EXPX 5IOPA 2K3RA 4HF5H 5E7BA 3WUZA 1FHGA 3ORJA 4UTCA 2DBJA 1ZT7A 5AOMA 4IMKA 4NQCD 1KBPA 1L5GB 4RZCB 3X1BA 2PR4L 3FB8B 4HHWA 5CBAB 3OKOA 3PAZA 3RPBA 2V5YA 4UM8A 1GS7A 1RVFL 3TF5A 2UXTA 4W9LC 1CDCA 1IC5L 4BFGA 5HPMB 3U1AA 4Z7UA 2YA2A 5APSA 2AS5M 3G5XA 1QYGL 2Q6QA 5AW6B 4M5TA 4P46D 4AYGA 2IADA 3MXVL 4G5ZL 1AXTL 3QHZH 5DJAA 5DJYB 4WI5A 4ZMLA 2J6EH 3B3IB 4AJWA 4NBZB 1ZLVK 3QJRB 5GJSL 2V0AA 1OARH 2COVD 3EKCA 3T77A 4NJ9L 1BD2A 2X4OB 1GOGA 2F08A 5K69A 2LU3A 3L70E 2ZOWA 3LZPA 4ZW5A 4KAQL 4NHUB 4B3EA 1MWAA 2LT9A 2NNAA 3T8XA 5KTEH 2NQ3A 4PJAF 32C2B 5IQNA 1JO5A 4RGND 3AC0A 4RMTA 2DYSB 3HG1D 1T2KD 2HJKA 3FSVA 1W6LA 3IAQA 1KN2H 4HK0B 3B56A 3IMRA 3KYAA 1ES0B 2FR4A 1YG9A 3QULA 1FAVA 4OB5L 5F88A 4DKEL 2JLLA 3F6LA 3F7YA 2O72A 1D9KD 3GSWB 4N2NA 1KTJA 4OCRL 3B3BA 5C08D 1R3IH 4NNXA 2ITDB 3JSVC 3ZZSA 1DE4A 3OKYA 3QS3A 2LXCB 3B9VA 5C0DB 3RBZA 1RE4C 2XV0A 4XPHH 5ACZA 2EP6A 4TSAL 4GRMA 1YY8B 4KGLA 4G9FB 4R4BB 4UNIA 4XN8A 3VFVB 1USZA 3Q8FA 5BO0D 3MRCB 4G7YL 3M0DA 4EPSA 5LKNA 4MHHI 1FBMA 1ED3A 5E08L 3GDBA 1XF2B 3CVDA 3KPNB 2XLLA 3OC5A 1WBXB 4WY4B 4L0PB 4PJ9D 1BA9A 4MS6A 3DJRA 4HCRH 2W0LA 5AYUL 1V54B 5JXEC 1AKJA 4JRYD 4KJMA 4HWBL 5DRZB 4JZJA 4FTVE 3IDYC 4CU7A 1NU1G 2FECI 2AJSL 3OPZH 2GJ6A 5EU6E 3M7FB 1KCRH 4I77L 2W59A 1HAUA 2L5GB 3AS1A 1LE5A 4WY4C 2V17H 4JG0H 2AZUA 1JRHI 4GUOA 1W72B 3DUUB 4PH8A 4XBEL 2IH3B 3EOBA 3W2DH 3CN2A 4XCEB 3F7RA 1MH5B 5I8KH 4URTB 3RJOA 1OAUL 1E5BA 3GRWH 4FKKA 3FCTB 1OF0A 2CIKA 3SGDI 1NU1J 3H2WA 3WEXB 4HLZH 2DPKA 4OCYH 4M6AA 1GK4A 4TNVK 3N06B 4NBXB 3ZIYA 3VFWA 3SJVE 3L9BA 3T0BA 4JDVB 3H6AA 3GNML 5GRXG 3ZE0B 2I25N 3H9HA 2IDQA 4PRBB 1WV7T 1SOXA 3EUUA 4X5LA 5F7MC 8FABB 1GW0A 4EDWL 1LT9C 3A0OA 3NZ8B 1Z5LA 3HHMA 4LKXB 2K6ZA 3VVVA 1IAOA 1AQTA 5DZVA 2K6WA 4UZGA 1SBSL 5DEJA 2ORBL 2YD8A 3K5RA 1F6AB 5L2JB 4DP6X 3H1HD 1CLOL 2IBZG 4K55A 1U8CA 5E9DD 4WJ5B 3DK2A 1T22A 2FHBA 3PAVA 4OAWB 3BAXA 2D2CC 5D2LA 4L29A 2XTJE 2X2JA 3QO1B 2FYUD 1FVCB 3HD7B 5CCKL 2VUKA 1E4WH 3OLIA 2D3JA 3LW5J 1XR8B 3BE1H 4N3UA 1JY2P 4MMXC 2AP2A 1ZHNB 1URQA 3UZEC 4E9XA 5AALA 3CMGA 4FQLH 2IZ0A 5IB1A 2KYIA 1QTSA 2IDSA 1U8PA 3BPLC 5I6MA 4LRIC 1DD4A 4GKSA 1MDTA 4X7CC 3WL9A 2FEEI 6TAAA 5B7MA 5K9QG 1T0PB 1TJMA 2A74B 1NGWA 1H3GA 3HD7C 2WXGA 3C6LD 1TEGA 4P2QA 5CP7B 3MUGB 5D93C 4GAJL 2DMHA 4ASVA 1ORQB 3BPCB 4GXFA 3S6CA 4ONGL 2XTSA 3TN0A 1MPAL 1M57B 4UZSA 5GGSB 5C9JB 5CWSA 1DJGA 1T6VN 2BNRB 3HC2A 2ZFCA 3M1BA 5EOCH 2XKNB 1B4LA 1VGEL 2X7LB 2XPGA 1A6UH 1DJXA 2XU6A 2A74C 1F97A 3FU7A 4GNKB 2ETWA 4NPFX 4KJQC 4UTAA 4U6VL 5D7LE 5B3NA 1XGQB 3QWRA 4P07A 2CDFB 2EJ1A 2EVGA 2H26B 2EDRA 2I69A 3UJJH 1YI2P 2NPLX 4IOIB 2D3LA 3EW3B 4KKBD 2WBJD 2BM3A 2EH8L 5AUMA 2EACA 1MREH 2BNQA 1LQBC 3RZCA 1OGSA 4PBVC 1D5MB 1XXDC 2NSQA 1OVZA 1KJ2L 5FFGA 4GSUA 5KKZB 1DBML 1TU2A 1RUQH 2DLFH 4J6IA 2OYLA 4OJFH 4GXUN 4KDWA 2FGWH 3GMOB 5HDBF 3H25A 3U4AA 3HE6C 3GXIA 4D3CH 4L8CB 3CN3A 3MGOA 1KV7A 3CX5E 3OB0K 1K6QH 1HJBC 3L2LA 1QR1A 1X9UA 3AQDA 1XGUA 2G8YA 5KKZC 1GSMA 3SFEC 4IKLA 4NQDD 1YUHA 2ADIA 3TP4A 3IN0A 4AQ8A 3A47A 1JP5A 5BS0E 1QEWA 2AK1L 1ZVNA 5FHBL 4LL1A 3LSOB 3T97B 2VERN 1N6UA 3DXAE 3FK3A 1J5CA 5CCGA 1GYCA 3BVWA 4XXDA 1JBJA 3UC2A 1JGEA 1HOCB 4NRXB 4Q97A 1GHFL 3FO9A 1A2YB 3KJ6L 1HL4A 4IRSA 4ABQA 4BGLA 2XNDH 4TOYL 4JGJA 2M8RA 1XH1A 3RFZA 3ESUF 5GSVA 5DQJA 3OMAB 2VYRE 4Z23A 3DLQR 1NTZE 1NU1K 1RJYA 4NKMB 5B7EA 2ATAA 5F1NB 4B9ZA 1ZMYA 1Q81Q 1LTIC 1MFCH 2H0FA 3I6LD 3IEAA 3QXTA 1JV2A 2BHUA 3MGTA 4ZDHA 5KYUB 5KSAC 1CGUA 2MKLC 3L17A 4OFYD 4JLRA 2XG5A 1DR9A 5KANG 3OF6D 2EUVA 2FEDC 2IYOA 1V3LA 2DQTL 1AQKL 4Y4FB 5E4EB 4KI1A 4MLSA 1WITA 5E8EA 3NTCH 2IQAB 4DJGA 4TPRL 3UG3A 4FJ6A 1PPJG 3CXHH 3PWLB 1MCSA 4PY8I 3OGOE 4KV5F 4W68A 2BVOB 2PYEB 3QFGA 1QFOA 5KVMC 1AGDB 3V4QA 5FYJL 1I8AA 2CWRA 3VXPA 1ETZB 5GIRA 3BVUA 4U1HA 3KLHD 3JCUE 1ILUA 2M3EA 3L2MA 3E3QC 5HHXL 3MLVL 2MNWA 4Y4FC 3ULVL 1SQQD 3T08A 1RHFA 2F15A 2VLMD 4O2CB 1UWFA 2VITB 5K1NA 5I1LA 4EYYQ 3VM5A 3WJJC 1N6QL 3Q5RA 4ZZFA 4RDQG 5KS9A 2PCFA 3MV8B 5FGBC 2KZKA 1RJLB 1F3DH 2FGZA 1CXLA 2JSFA 4L2YA 1S3KL 2EXYD 3O9WB 3HS0B 4LGDE 3GXDA 2WWOA 3S37H 1EJFA 3K2KA 3BEVB 5AZ2L 1TVHB 1NAML 4BKTC 3ARXA 4ODWB 4TVSa 2CM5A 3QEQB 5H8DA 5L2KD 2VDQH 4HIIB 1QLRA 3O9WC 3RGVA 4KK6D 5DJ0A 1CXEA 1DQVA 1RHHA 1R34A 2NY2B 2QZ5A 3UPCA 1TMQA 2BH0A 1VQOP 4HU2A 3MRLB 5AAMC 3VRIB 5KAQG 5JXAL 4M1DL 4HWEH 3MOAL 3SGJC 1GC1L 4MQXD 4QHKI 1AO7E 4G9DA 2P8MB 1Z66A 2NY2C 3CVBA 4ZPTB 4TTDD 1XF5B 3SE8L 5HDQL 1EEZA 3BWZA 1PKQB 1IEAA 2V7NA 5IHZB 4TRPL 1I7RA 1E3ZA 3S4SB 4WU7B 4BV1A 5IWLA 1RE3C 3PWUB 1TDQA 4XVTL 4HIEA 4TS6A 2ZOTA 5GZOD 4OZIB 3RK2C 2B0SL 3MRPB 3JXAA 3UBHA 1RZJH 2I5YL 4OCSH 4G82A 3IE9A 1FDLL 4ZPVB 4JPZB 3MU3A 3OKKA 4ALAL 1H5BA 3H54A 1JMXA 1TKWA 2HJFB 4PV9B 5F97E 1ESOA 2Y1YA 3OJ2C 2HFTA 1FZBA 2CLRA 2Y7LA 1N7SA 5C0RH 2ZKHH 4XN9A 3TBYA 3RTQD 3QUYC 3ZDZF 1JY3O 1HJCA 4JG1H 4WEBL 4WI0B 3ZJAA 4WU5B 2JVUA 1RURH 4Z8FH 3EFFK 1INEH 3AADB 5HVHC 3DX4A 5K39B 3EOAB 3VO0A 1BYOA 4DO5A 1DQDL 1BIIA 4U4BA 1C8PA 2FZ3A 1KTKE 1JGVH 4U33A 3MLWH 3SQBA 5A16B 2WKLA 1UWXH 3ULUD 5E1GA 4QTFA 3FTWA 3FUDA 3G6JF 5ESQA 3ZT7A 3UERA 2A1WL 1N8ZA 4HMCA 1YEJH 2NTFA 2AV7A 1E3FA 1G7IB 1FO0H 3KEHA 5KVGE 5KW9H 4ABUA 4DUVA 1MFDH 1OP9A 5I19H 5SV4A 4M1GL 5CJQH 1G9NH 4P2RB 3HIZA 3TDKA 3BKJL 4LC1A 3AREA 5I6PA 3W57A 3NSYA 4ODXA 3RVXD 2OMYB 3ZY7A 1FP5A 2IGTA 2HVKA 3OVUB 3COOA 3HC3L 4Z7VF 4PJCA 3ZTNL 1IGIH 2WXMA 2FJGA 3EGSB 2AXTH 2RD0A 1VQMP 1URZA 1U8HA 3B83A 4N2GA 3FXEA 1SQVD 1MAJA 2BOCA 3PGFH 3RYMA 3H9SE 4WI4A 2VZTA 4P3WA 1T21A 4TULL 1GZQA 2WLIB 1SS1A 4BKLB 4BKSC 3RWDB 3IPBA 4UT6H 1DN0B 3GF7A 1HHGA 3CFNA 5LGJB 3FUEA 1M42A 3BJLA 4JFPA 4YC2C 1JPTL 1KCVH 3RAJL 4A2LA 3DX2A 5CZKA 4ZUUA 2B77A 1CLZL 5T3ZD 2HYMA 5IV2B 2W9DL 3QPQC 2PRRA 1JHLL 1NDTA 1U91B 4OLWL 2E9JA 1Z1WA 2W8ZA 4G7RB 5KTBA 3GK8H 3BZ5A 3LNEA 2XBDA 1HI6A 1XCQB 3LS4L 3BAJA 1FZOA 3K71B 4MXQC 3WFHA 4C7NB 1Q0EA 3IGLA 4LP5A 1WT5A 5EV7A 3GSRB 1MJ8L 4MYPA 1MI5B 4FFYH 4HJIA 3TNUA 4U1KA 3VSUA 4MCYB 3UDWC 1GKEA 3L54A 4GY4A 3ZX1A 5BVJA 3LZNA 3OPUA 1KEML 5F8RC 1BP3B 5K9JL 3IMBA 4YHML 1TJIL 4TVPL 1QFWL 4P2OA 3PRZA 1VQ4P 2CDGB 3MRIB 4CC1A 1TQVA 4IBLT 3ATDA 2HT2C 3TEYA 2FDBP 4JFZL 1FJ1A 3QUML 1IAKB 1SN0A 1LWUB 4C4KT 2A9CA 2C7UB 4Q8BA 4QRQB 4OGAD 4GRLB 1O7SA 5AOLA 4AE0A 1JCVA 3EFOA 5F9JA 5D1ZA 5CUSH 4K15A 3O6ML 5H2FE 3ZTCC 5L8LB 1NMBL 4HWBA 4L1SA 1MKFA 4PJ7A 1EAPA 1LWUC 1B9KA 4IM8A 4P0DA 4OZFG 3SJVB 3ZRCC 3DX9A 4AMKL 5IMMB 5LDSA 2ODIA 4L3FA 3EIFA 5DUMH 2PMZA 3QDMB 2UX7A 2WK2A 3V4WA 5FAAA 1NFDF 3LH8A 3UC0L 4X6FB 1TJGL 1RUAH 3B4NA 4JKPL 4OKVB 1I1AD 1URLA 2Y0EA 3W3BA 4CC4C 2WKOA 4YNYB 3QW9A 3KGUA 4BFKA 1AY1H 1BVLA 3VGAB 4PBDA 4HBCL 1PGPA 1FNEB 1AKPA 4IBZA 4LDOB 5BW7A 4K3EH 2QV4A 2OYIB 2HMID 5C2BL 1URQD 3EYQC 2XTJB 1O9VA 3QVAA 5BU5A 4ELDA 4Y9FA 2AQPA 5D5MB 3WUWB 5DQ9A 5B3SB 1CIDA 4Q9QH 5IJBC 2CGRH 1YNLL 2DJMA 2YLHA 4QLRA 3GMMA 1QLEL 2LLNA 3VGAC 2QRXA 4OCNC 3AE8C 1A7PL 3HE4B 1NJ9B 3O2DH 3M1CA 3ZL4H 1AQ5A 2OYIC 1XV8A 3SFDC 4IGBC 5IMLA 3KLAB 4CVUA 2XTJC 1J7VR 3ZBMA 3SDYH 1HOEA 4YDJB 2EO1A 4GQ9L 2X4QB 2J88L 3SBPA 3WY3A 1YHPA 4WHCA 3WNOA 3KPSA 4DERA 2XNXA 5T1LA 1CN4A 4BE6A 3TYYA 1QLFA 1TEYA 4LK4A 1GIGH 4K2UH 3DV4B 5T1JA 5FO7B 1P1ZB 3LRMA 3GC3A 3U83A 3SPIA 5EDXA 5I6OA 2OYHA 4K5LA 4KO9A 5T3XD 5L4MA 3RZCD 1HNFA 3NEXA 5MI0B 2DM7A 3O2VL 1SLUA 4PJGF 1Z9OA 2AAVA 2YAMA 3KPMA 4P9HC 3PHOA 4OVNF 4OJDH 3DNKA 4G8FB 4XWGH 5PCYA 4I1LA 9PCYA 4EN3C 1I1FB 3VMZA 1OSEA 3MA9H 1ZLUK 4UILH 3CLFL 4DCKA 1VB9A 4IBQA 1IAIL 1TO5A 1G7LA 2UZIH 4HQQH 4PBWD 2FJUB 4ZTPH 5EEZA 2KHAA 3U1QA 3VWKA 3A5VA 1RU9L 5BQ7B 4PGEA 2OS7A 5AVSB 3KWVA 1VFAA 1AOHA 4PJIA 1QW8A 3N42F 5D4HA 3MO1A 1NUNB 4M00A 2OX5A 2DW5A 5KVEL 4PR5B 3P2BA 3BUQA 2MIZA 4FLOA 5JW5A 5CCGD 3WU1A 4M8QB 1AGBA 4YDZA 2NY1D 3APCA 3MFGB 2VDQB 1IGYA 1R5SA 1P4UA 2UWEE 1D5XA 4IRSD 2J6WA 5JHMA 4PV8A 3TBTB 1KJ2A 1FGNH 4MRBA 4PU2A 4OIIH 3U6XS 5E5RB 3L1OH 3ZU8A 1G7MB 4P5KA 2FWOA 4XMVA 5KLVG 5E6IB 4XE0A 2PETA 3UTQA 2ZCKH 3CFJB 1BSNA 4NBYB 5M1BA 4N26A 1M7LA 1LYQA 4KOBA 4PJ8A 5TF1H 3BWUC 3NN8B 4MD5A 4PLNC 2JCCB 5JIIA 1BG1A 3TLRA 5DDHB 5E6IC 2JXMA 4RFNB 3O6QA 1D6VH 4YHPA 3G6DL 3DA0A 3GS0A 5KLVJ 4UDTB 4FHKA 4AT6A 4AVJA 1PCXA 3VXSA 3VG9B 3DGDA 2E27L 1XCWA 4NKQB 3TO4D 4NX0A 5EDSA 1LD9B 4Q7DA 1ONQB 4TV3A 1L6XA 2UXVA 4ZMPA 4JZNB 3BGMB 2JTDA 4Z9KB 4RFNC 4X6CA 4APQA 3BCCD 2WUCL 2GITA 3S5LB 1BAWA 4RAVB 1A14H 4MD4A 1A3ZA 1KY7A 3VG9C 3ZDWA 4LVOB 2G9HB 3CFDB 3PS6A 4U6TA 2BP8B 5C6TL 4KKPA 2DDQL 1AGEA 4UNTA 1KB9J 3NIGE 1Y0LB 1E6JL 5DK2B 3VXUB 3AY4A 5IW3A 4UWQB 4A7GF 4QRTB 2NYZA 4LIQE 2WLJA 3HFFA 4C56E 3VXMA 1A9VA 2HT3C 2E8YA 4YHIA 2G2PA 4LVOC 1FN4B 3V95A 2A9NH 5JOPE 1NCHA 1ADQL 1ITBB 2KDGA 4GG6E 4OV6F 1NSNL 1A21A 3H3PL 1E5UI 2MEJB 2JIXA 2WQAA 1MCHA 3KXFE 1M56B 4JE4B 5D7IA 1UVQB 5KEZA 1FO0B 3K6IA 4LCVA 4PWHA 3HTKA 1NGMB 1O6VA 2ESVA 4FL4B 4A7QA 3P8MC 1H3TA 4PJXB 3W11C 1NTZG 4AI7A 2FQGA 1CFVH 3WE6B 3JTTA 1AJYA 1KYUA 3HZMB 4AV4A 2VXTH 4JDEA 4AL8H 2W83C 2ATKB 1LTJA 3RU8L 3CFBB 3FX0A 4IS6A 3DTXB 2BC4B 4AQZA 4WNQA 2IALA 3RPKA 4NXSA 4FL4C 5FO9B 4L3CA 3QFJA 3BKYH 4D0CA 1NAMA 2FIRT 2GIXA 1NTZJ 4PGDB 1GW4A 2CDEA 1YEEL 3PWPA 4WUUD 2GJZB 4W7ZA 5EC2B 4UQEA 1A6PA 2BWIA 1TCRA 4N1CA 2A77H 2E7CA 2OW6A 1ZGLM 1N3NA 1TSRA 3E9UA 3BAIA 1QVOB 4XBMA 1FG2B 1MJ7H 3C8KA 3OXSB 1X5XA 5TQ0H 1DEEG 4ZO7A 1MLBB 3RUGE 5KOMC 3ABKB 2WWMD 1JIBA 5SWZB 3NP4A 1R5IA 3ECQA 4KKQA 4MLIA 4HALA 4YXWH 1WUNT 1N7SD 4X50A 1JG9A 1FU1A 1RULH 2ITCA 4UBDC 2ZX5A 2WVRA 3ZTJG 1X7QA 1JM0A 5DZAA 4HUKB 4F7MA 1KFAL 4Z1PA 4F8NA 5C0AE 5TE4H 2M83A 4H2AA 1XCXA 1LDSA 4HKZA 1LJMA 3VFOB 2OXGA 1XR9B 4FJYA 1R3JB 1CD1A 5DO8A 3G7TA 3L7FB 4NUPA 3VH8G 1MCKA 1TQUA 4GW1A 1GTWA 1U93B 1HCZA 1W72L 3KL5A 5ADOL 4R9HA 4QTIH 5BZXA 4JJ5B 3QIUD 1YTZT 12E8H 1BJ1H 2XY1A 4N8CL 1ZLSL 3F62A 5EEYA 3SGKC 4AG4H 5KLVK 3LN4A 2QQLL 1LP9F 3MUY1 1NKNA 3RBXA 4NZDA 2DWDB 4XAWL 5FLUA 2A4EA 5ILTL 4BDVA 3D39B 4RRPA 4X4ME 4XNDA 1L9PA 2QSQA 3C8VA 3NJHA 3QS2A 4LEXH 2OSLB 3DJZA 2Y72A 1U41A 4HEMA 2BZCA 4LEOB 4D0DB 4AW4A 1NC2A 1TEFA 5C0CE 4PWGA 3CCRP 4MS8C 4KKRA 3OWEA 1UATA 1OPOA 2A6KA 2OMVA 4MA8H 4XPTL 5LN8A 4P57B 1Q38A 3N3EA 3NBNA 1WWCA 1G7JA 5I0VA 4Y4KD 1E9QB 2Q8BL 3S35X 2WPRA 1BQLH 1KB9K 4WI7A 4R0LC 5D7EA 4F9LC 3FO0L 5CZRA 1VFUA 1KJVB 3CLWA 5HHOE 1UEMA 5IBUG 1FYTE 5FYKL 1ZHKB 4H2CA 3RWFA 1EMTH 5APYA 1UB6A 2YIHA 3H9SB 1ORSA 3FPYA 4I0PB 1KPRB 3HJ0A 3MLZH 2VLJB 3EYVB 4FQ2L 1U95A 3R7QA 2R56H 2NPSA 5F9OH 3SN6N 1LXMA 1FZCB 2D7MA 2R29H 5JW3H 4YPJA 3TF4A 5DMJB 3Q9QA 2JJWA 3MRKB 2WQWA 1VL2A 4BZ1L 1UIIA 2X6CA 1T0MA 5GHWH 4J12A 4RMBA 1T0NB 1JWMA 5I0ZA 2AK4E 5GTHH 4ZW6A 3UJTH 1W16A 2MHAA 1FFQA 3B4SA 4KJPC 5LXVA 3K5BA 1J0JA 3WUTA 1L0LE 4W1TA 1FZCC 2A6DA 3F7KA 3MRDB 3O2WH 3HUJA 1NOLA 1H3VA 1SYSA 5DHVH 4XP9L 1PZCA 3TBCA 2OTPA 2BFVL 4AYBA 1QTYT 4U1GB 2N01B 2ROXA 4N0FA 4NFCA 4F57L 4P2OD 4IKKA 1NTZK 1U8KA 4ZFZA 1TT6A 3IFMA 1S9XB 1RK1B 4HH9A 4MNQA 4GQZA 2K8QA 2KLVA 3T0XA 4PMFA 5GGUA 1FLTX 3V0IA 2GIMA 3MJ8B 2C0XA 3FMGL 2X1PA 2ZYRA 1N64H 1KN4L 5IUCA 1JWSA 2R0ZH 3FHQA 2R2EA 3P30L 5D1ZD 1OCOB 3MMEB 2VLKA 2DD8H 3S34L 3V0VB 2RR3A 1JNLL 4LHJB 2Z4TA 3AQYA 1A6VL 3MX0B 2F54B 3KVPA 3WUUA 2B3IA 1EO8L 1ZPLA 2YPLE 3LEXA 3A4FA 1HE7A 1PP9G 5MEPB 4K3AA 1PZSA 3WFCL 1U42A 4OZ4B 4CADA 4L3ED 2V3FA 4PP2A 3US9A 1IBYA 3MBEB 1Q9KB 2E7DA 4ZAKB 1I3VA 2VE6A 2WTOA 4GIOA 3TYFB 5HVGB 2HP4A 5DD3H 3KHUA 4KZEH 2WZAA 2V2TA 4X5XB 4BINA 1DQQA 4YGVB 2EEAA 3QUMA 4X80H 5FDWB 3T3ME 1Z5HA 2WIMA 1HKFA 5JHAA 3BDYH 5KWYC 1A3RL 4YQXL 3PABA 1PP9J 1WCBA 4JFQB 1AQDA 4ZAKC 2KUBA 4HOMA 1EIBA 4YR6B 3BO8B 5AYTA 2G3XA 2QVFB 4F33B 3T4YA 5F7EH 3MRJA 2WC7A 3CX2A 2H8PB 1J8HE 1CK0L 1ZE3H 4GW4A 3NJGA 3CVHA 1J1PH 3CCHB 3P4LA 1E28A 2ARJB 3Q6FA 4M03A 4RO0A 3LIEA 4H25B 2QVTA 5AFAA 5L4IA 2GY5A 1JY2N 1EANA 2DI7A 1YN6B 3VE0B 3MRNB 1TLKA 5AZEH 2WM0A 4RNRB 1GZLA 3ESOA 1A5FL 4XFJA 2EE2A 2DQUH 2XV6B 3KPSD 1WMKA 3SPJA 4AH2B 4PHXA 4WDIA 4AQRD 3W0WE 4PJEF 1AVAA 5HHMD 3P9MB 1IX2A 3PHQA 4LQFL 4UDUA 3GUTB 3ABZA 1UYWL 5IF0A 4GOFA 2EO9A 4KXCA 3TPKA 3VD1A 2P24B 3KWTA 2H2PC 4K3JH 2NY0C 2OMZA 3HHRB 1QKZH 4OJCA 4OUUB 2Z3FA 1UD5A 2VSCA 4JFEA 2IANA 1INQA 2Q3AA 5C07E 1C5DB 2P5PA 4LMQI 3M0AA 1BBDH 4HF5L 5CEZD 2HKFH 1I31A 4AE1A 3BIKB 1JGUH 1WO2A 2VQ4A 4QKXB 1S46A 3C5JA 5DZ9A 1CFNA 4XH2A 5IUSA 2LTQC 2VXQH 2IWFA 4HZAA 2B2XH 5HY9B 5CXPA 5MHSD 1FH5L 5IW6A 1M7IB 4F58L 3VN0A 2VMEA 1YEDB 1DFXA 1K8DA 2BOBA 2VABA 3NJKA 3R8BB 3VWKD 1JZJA 1IGML 3RK3B 3O3DA 3FQUB 2XKMA 2FLMA 1FNSL 5AW5B 3GG2A 3B37A 1XT5A 5FEBA 2DY2A 3QHZL 5B39G 1BX2B 2Z7UA 4AK2A 3SDAD 2QEXP 1I8MB 5FUCE 1A64A 4YHLL 1B0GB 2JR8A 2YUVA 2MKWA 2J6EL 2YBGA 4OFKA 3TK1A 1OARL 2I24N 2X6AA 4HKXB 1YECH 5D6CB 1OGAA 5I71C 5KYXB 3LW5H 3BD4A 2R8SH 1CR9H 2VLRD 4ZFOB 4JYBA 3ZDYE 1U3ZA 3FT4A 1H0TB 1DDHA 2UWEB 25C8H 5KTEL 1GGCH 2H9GA 4PJFA 4U1NA 4YUEH 2ZXDA 2QPUA 5GXBB 1QR4A 4GINA 2KS0A 3L7EA 1KN2L 1SN2A 3C5ZB 1BJMA 4N8PA 4ZJ9A 2GJPA 1C08B 4H8QA 1M1JB 3GHGA 4NO0A 2NSXA 3GGWA 5C0NC 1FGVH 4X4XA 5CMZA 2OCFD 3DECA 4IU2A 2FX8H 2NXZD 1EHKB 3WIHA 4J3BA 4LT7A 3WNKA 1DEDA 2P48B 3QXDB 2Y0DA 1VGKA 5BZWA 3VXSD 2BSDA 5E6UB 4NKIL 2C1OB 4EUPA 4ANXA 3C5ZC 4BQ8A 3WNPA 3FXDA 2IXQB 2H45A 5E8PA 1DBKH 5IB4B 2OMTA 4XPHL 2SPZA 3AS2A 3U0PB 2DKMA 3MREA 3VGBA 2JK5A 2ZUQC 1UQSB 2DLTA 4TLUA 4APQD 4F7TA 3B9KB 4Y2OA 3P0VH 5DSCA 2X70A 1GK6A 1FFOA 3FZUC 1OW8A 4MNGA 5DD1L 1U8MB 3IDMA 2WXLA 4L4VB 3FT3B 3GBNH 4WVZA 2HFGH 1NKZB 4BSWB 3WY4A 5ISZD 5C0BD 5I5RA 1KXVA 4LLWB 1SQBG 3WLBB 4XNQA 1S4IA 5C0JA 3TEZA 3QQNA 3VXMD 3VUAA 1Q1PA 3B9DA 3LEVL 3QEGH 3LQAC 4TM9A 2CCVA 2H32H 4KROB 4PRIB 1UFGA 2V17L 3KWWB 3LRSA 5SWQA 4U05A 2VXUH 4K71B 4LESA 5CLXA 1UIXA 3TFKC 4XC1H 3CE1A 1A6TB 4XRCB 3W2DL 1JTHB 2FBJL 4CMMB 2EDLA 4OI8A 2R9HC 5DVNA 4LPXA 2HTKD 2DQEL 3Q06A 3Q9PA 1KXHA 1EXGA 2D3VA 5I8KL 1IC1A 3ULVD 3F00A 4P3DB 4PJ5E 4GG6B 1SQBJ 2G75B 3TZVC 3S8GB 4KROC 4OCYL 4JCMA 1BYNA 5E1AB 3D52A 2Y1AA 4M6OH 3CLQA 1P6WA 2MMXA 4LLVB 4WFGE 1MDAA 5D71L 4BWUA 2XFXA 1L5GA 4RZCA 3V2PA 1FE6A 3QDHA 4HPOH 1G2CB 4FXKB 1U36A 4A68A 1MW1A 5I18H 1QX8A 2ZP0T 2D03H 2XZCL 4MZ3A 5HPMA 4JMXA 2GI0A 3QJSB 2R2HB 1T7ZA 4MN4C 2A9AA 4OIBA 1BFOB 1U3HB 3KPTA 5ALCH 2R5DA 2EECA 4ANVA 3VGGA 2HPCB 1ADQA 1LO5B 3FONB 4WF7A 2ZYIA 3ECBB 3PDOB 3A6CH 4L8BB 2DLGA 4FXKC 1QSFA 3HVNA 1E4KC 5DHYA 2X4OA 1E4WL 4YSPA 3BE1L 2EDJA 5K59F 2M3BA 1U3HC 2AQ2A 2P5WD 4NHUA 4FQLL 4N0YH 1P7HL 1A1MB 3Q2NA 1MAMH 32C2A 3WY2A 5T5NF 2ZKWA 3P3RA 5FWQA 5C39A 1ES0A 2VL5B 1RE4A 1ZANH 2DM4A 3N91A 1RK7A 3I9PA 4OJEH 5DMGC 2VR9A 4PVMA 5I8CB 1TZ8A 3VXRB 2KLSA 3T65B 3VB9A 3EUDA 3GSWA 4LO9A 2ITEA 3DTUB 4FQJL 4IEFB 5IQLA 4OLEA 2R1XA 5EOCL 2X41A 1BDCA 1CDBA 2C9QA 3X2QB 2QGCA 4K3HA 1L0NE 4D6TG 3V52H 1A6UL 2CO1A 2CUAA 4XO5A 5C0DA 4YHYC 4GO8A 3WJLC 2PWFA 2XUWA 5CSZB 4ZX3A 5JXEA 3G4SP 2FD6H 4R4BA 3ZKXB 4I1RA 4MAUH 2QKSA 3VFVA 3UJJL 3MRCA 4L37B 2WB7A 4ZX6A 3CFMA 1CICB 3OHMB 1LEGA 1MKMA 4CN6A 1F6LL 1XF2A 1KGUA 3KPNA 2Z1KA 1FZKB 1WBXA 4WY4A 2VXSH 5B22A 1X9RA 2DLFL 1RUQL 2DN7A 1C8QA 1UOWA 2K70A 4OJFL 3HFML 2FGWL 3WEAA 2YXWA 3ZKXC 1O6SB 2R69H 2BIOA 5DRZA 4D3CL 4JFHD 4HS6A 3H7BB 1CICC 2WVUA 1K6QL 1JPFB 4FZEH 4HP5A 4YFDB 1UFUA 4KUZL 3EO0A 4HUCA 5GGVH 3VXNA 5BUGA 1DUYB 4M6NL 1W72A 3DUUA 1VQ9P 3KHQA 2IH3A 5FHAH 4PVBA 3HC4H 2E8ZA 5LAXB 1ZRTE 4OV5B 5T8IA 4XCEA 5FM8A 2FBOJ 4E9QA 1MH5A 2XWDA 4GMSH 2VM9A 1LT9A 5DK0B 1YZZA 3EWKA 4N28A 2Y5QA 3DBSA 3WEXA 5E6SB 3GIZH 1AR1D 5GISL 2XWTB 1KF9B 1TG8A 2DQFA 4WLCA 4OVVA 4NQUA 2EDOA 4JREC 3QZPA 4WWPA 5GRUH 3QDGA 1UUNA 3NSDA 4F1ZA 1GTNA 5LBGA 3O6FD 1SQBK 3IJSA 8FABA 3OX8B 1IFIA 4LKXA 5ETUB 4AK1A 1RQ5A 5MENA 3ULUF 4Z7UF 3NIDF 1DYZA 3ARFD 1F6AA 4LGRB 1AQMA 4MMXA 1CGTA 3AT0A 1AZVA 5KZCD 2DTSA 2F6AA 4LSPH 3QYCA 4GKNA 2I07B 4WJ5A 4GKLA 4YK4B 4LRIA 4OAWA 4WGKA 1EXIA 3X11B 3QO1A 4P9HL 3LPOA 1FVCA 3HD7A 1RV6X 3KEDA 2OMWB 5B1BB 1XR8A 3SE6A 1FJKA 3D6YA 1M53A 1ZHNA 4M9OA 1NCBH 1ZIAA 1IGJB 2ZXBA 4MNQD 4AJVA 3D50A 3ZYJA 4R97C 3L71D 2JJUA 3LX9A 3EJCA 4H13B 2H2SC 3UBFA 1WJ3A 2A74A 3H1KD 3LKRB 1X9QA 4BZ1A 2EKSB 1X5FA 3MUGA 5CP7A 1LNUB 1ORQA 5T1DH 4RX4A 2M2DA 2N59A 3BPCA 4B0MM 2KQMA 4QOKA 5GGSA 3D0LB 5C9JA 2VLKD 1CDHA 4ABVA 3LV3B 5I1AB 4PJDA 2BNRA 4U1IB 1P7BA 1IQDB 2O6DA 2IDBA 2XKNA 3C75A 2EE6A 4H13C 3FFOA 1NM9A 4EDFA 3GXMA 3S37L 1VSCA 2Z91B 1JJUA 4KX9A 3OKEB 4X4ZA 2VDLB 4B27A 3S5YA 1KYOE 2XJLA 2CDFA 4WO0A 3BDXA 3HE6A 4MJIB 1RD6A 4KHXL 1KCUH 3FUNA 3MV7D 4IOIA 2PO6C 4JUSA 4WEUD 4XTRC 2VN4A 4XCCH 3AM8C 2VDQL 4PQXA 3WMQA 3X13B 1D5MA 2I9LB 3SPCA 5L8RJ 1QI3A 2KK7A 3OJAB 1CL7I 2IAMB 1GGIH 1Q94A 1NH6A 4HFWB 1IE4A 4GI9A 2ZXWB 4PP1C 5LXGL 1LEKA 4OH8B 3NVQA 3GMOA 1OT2A 4NNYB 4ORGB 5IVOA 3HJEA 3AUVA 4L8CA 2FX7L 2X4UB 2GUOA 2WXNA 2K7QA 4HWEL 5DJZA 3EOTH 4FQQB 1CDJA 3U1CA 3DVNB 4QRPE 1DL7H 1ZK9A 2YSTA 2IAMC 4IKIA 1I9JH 3Q5YA 4AKOA 4DIXA 3TGUE 3P11L 3C09B 2NYYD 1EXJA 2YMKA 4EXKA 1U21A 2ZCZA 4YE4H 2Z31C 4MCMA 3LSOA 3T97A 3L3GB 5FXCH 4ASWA 4PJHE 4NZRL 2GSIB 3G08B 3HZVA 3PQYE 3QDAA 1HOCA 3PNWA 4NRXA 4JRXE 1A2YA 1E5CA 5KSAA 1MZ9A 4XAKE 3KCWA 2KP8A 4OCSL 4YVNA 1HXKA 3C09C 2G60H 5DMIL 4D8OA 4UOW1 4IOSD 1L0LJ 2X40A 4U6XA 3HNTH 5AVRB 1RZFL 2P45B 2QHRH 3W0WB 3BZEA 1P4BH 1S4XA 2NQDA 3NSJA 3CNKA 3HLKA 2ZF9A 5C0RL 2IAND 2ZKHL 4DT0A 3N7NA 5KYUA 1T3UA <