5AVVB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avvB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avvB02
2WTYA 5AVZB 3V4QA 2P2UA 2R3CA 1OXZA 3NMDA 1S9KE 4C7NA 1CI6A 5AVQB 3TK1A 1HWTC 1NAFA 3HE5B 3P32A 3LIDA 3VN0A 2VRSA 3MGNA 3UIAA 4C46A 2E43A 3OAKA 3TNUB 2R32A 1CZQA 2H7HA 4M3LA 3NTNA 5APTA 2XU6A 2YNYA 3A3YB 3B8EB 3WGUB 2W27A 1JNMA 3VMYA 2BASA 5AW1B 1OWAA 3M0AA 1H8AA 3M91A 3SWFA 3HE4B 1G2CB 3VYIA 2P7JA 4JYBA 4RESB 5APYA 5CMZA 4B86A 4AUWA 4GKGA 3M06A 1H88A 1MFZA 2P67A 5APWA 4AYCA 3V4WA 3VMXA 1HBWA 2N9BA 1SLQA 3I5CA 5AVYB 1DH3A 2R5BA 5AW2B 2WT7B 3MD0A 2Q3IA 1GK6A 5APXA 1HJBA 4KHXA 2WPQA 4EOTA 1NWQA 2IPPA 3A2AA 5AVRB 2WPSA 2Q7CA 3VTPC 1X8YA 1JUNA 1S9KD 4I6MC 1A02F 4I2LC 4C7NB 3A7OA 4RETB 2Z5IA 1CI6B 2KP8A 3P7KA 5AW7B 1FOSF 2C9LY 3NFQA 2R5DA 4DZOA 1IO4A 3KQGA 1A02J 2W6AA 3A5TA 2Z5HA 2WPRA 2ZXEB 1MUUA 2XZRA 4JYCA 1KQLA 2WWWA 1GD2E 5AW6B 1FOSE 3HE5A 5AW5B 5APUA 1YYCA 2C9NY 3M9HA 3L36A 1GTWA 1GU5A 1GZLA 3TNUA 2QM8A 3LIEA 4GT1A 3T97A 5APQA 4AQRD 5AVVB 3M9BA 3L37A 3V5BA 5AW3B 1SP4A 3HE4A 5AVSB 3KDPB 3O8ZA 3NXSA 2YO2A 1J2JB 1MV8A 5AW9B 3P8MC 2Q5UA 3WGVB 4LC1A 5APVA 1GU4A 5AVWB 2ZFCA 5AVTB 1HUCA 3IR9A 1T2KC 1FAVA 3VMZA 5AVUB 1CSBA 2YO3A 5AW0B 1GK4A 1H89A 3M0DA 2XV5A 2JJLA 2WT7A 3TYYA 2E42A 3HTKA 1T2KD 5AW4B 5APSA 2QM7A 5AW8B 4HYTB 3L35A 5AVXB 4XE5B
chains in the Genus database with same CATH superfamily
4YBLB 2P2UA 3PHLA 4JY6A 3H9ZA 4G6FD 3VXQB 1MFMA 3SDCB 5JA9A 2ARJQ 2ZX8A 1E7UA 4MRCA 4QHMA 1WAAE 2X40A 1JPFA 2R0ZL 1JCCA 3CZSA 5GGTH 4XVOA 1E5BA 4Y9BA 1E9PA 5GGSB 3CZGA 4P5SA 1CDUA 1MZYA 2QADC 4O4YH 4ZT1A 2FQEA 4O58H 4UYQA 3GMLA 3HMWH 3HE6C 1KENH 3OB0K 1FL3A 4OIIH 3L5IA 1QBMH 4YL4A 3V7MA 1H0DB 2CO1A 3PFQA 4TULH 2FX7L 4A55A 1ZGLP 1NTKG 2NX5B 4UQCA 2RBLA 4Q9BA 2Q9IA 2APBA 2A73B 2BM3A 4M1CD 2WTPA 3CH1A 3KXFA 5C07D 5I1DB 4TUJA 5IESL 2YRPA 4JKMA 1PW3A 4KI5E 1JEKA 2Z4QB 4FQ2H 3U0TA 2OJZL 1EFXD 4KFMA 3LW5H 3SDAA 5IJKA 3AE5C 3FTGA 1CGVA 5IROA 4JFFB 3UTZB 2IOIA 1SOQA 4HWEL 3DX3A 2CU9A 1S9YA 2HTLD 1TZAA 1K9TA 3MX0A 3FUIA 2W0LA 4NQVA 4TT3H 4Z0BL 1WC7B 4ZFFA 4LPXA 5B3JE 5FKAA 4HX1B 5JIKA 2VDMB 3SE3C 4FFYL 3O6KH 4K2UL 4K3HA 1N19A 1J0JA 4B3VA 1K4DA 3LEXB 2F2HA 1J8HE 1MFEL 4FZEH 5C0AE 3MRJB 1KXQE 1D7DA 4F5CA 5J13B 1TJMA 1EO7A 5JIQA 1QOKA 3VI4A 5KVGH 2IGFH 4YZWA 1HL5A 1MHPH 4LLHA 4UAHA 1WBZA 4OLUL 1P4IL 3HMXH 3L4VA 1AANA 1N64H 2VLJD 5JW4Q 5KJRH 4GMTH 1HC1A 4JPWL 4YN3A 3R4YA 2GSGB 2P5WD 1A7PH 2Z1KA 4E41A 1PY0A 2DLGA 3F5WB 4HEPA 5DJZA 2IADA 3AT9A 2OYMA 2B3RA 3O8ZA 4IBLT 3M1BB 3MREA 4B9CA 5HHME 1NCTA 4GAGH 4D6TG 4XHQA 4XVSL 2CM5A 3C6LB 2R0ZH 5ITBH 2BOCB 3GJFA 1RIVL 1W8OA 4CU6A 3T2QA 3LIZL 4BZYA 1UWXH 4CW1A 1QI5A 2CJUL 1FPTL 4G8EB 1P7QA 4PLJC 2VZUA 2A6KB 1BMZA 1NUNB 3ZRCC 3UEZA 3BH9B 1JGEA 2C5DC 1QNIA 4KITB 1P5VA 3FUEA 3KLAA 2FQDA 2BY3A 4FABL 2AJYL 1M56B 2FX7H 2J1WA 3BN9C 5DJXB 2YOAA 1OTUC 3WO4B 3WE6A 1G1CA 5T33L 3NMDA 3UBXA 1CBVL 1LTTC 3VNZA 2PN5A 4YHKL 1N7SD 1ZGLM 1W2BO 3LDBC 2A4EA 1J9TA 1UXMA 4Q0XL 3CD6P 3QDJB 1M05A 1S7QB 4OCWH 2IWKA 5E6UB 5EO9B 5FUCE 3SKMB 4XMWA 4HWEH 2E75B 1IO4C 2AXTH 1O0VA 2VMJA 4Z0BH 3O4OB 1MOEA 4Y5VA 4L5FE 1UJ3C 4LL1A 4APXA 3W38A 4ZKUA 1U4FA 4AITA 2YQBA 4FFYH 3ME0B 4K2UH 5DZAA 2WZ7A 4Y2LA 1YLBB 2X2UA 1IKNC 5F7FA 5J6HB 1WJ3A 1KGYE 4HEME 1MFEH 3GWJA 1YMHA 3F84A 4IKIA 4ZO7A 5C07A 3CHXA 5IK3A 1PPJG 4LFHD 4J6IA 3IMWA 4HUNB 3IJYB 3V9EA 4OTXL 3LNGA 1G4RA 2D7PA 1EFXA 4OLUH 1P4IH 3CXDH 4Q2ZB 5F9AC 4L05A 2R69H 3FN3A 1KILD 3CC1A 3FF7A 3BYTA 3QYCA 1YN6B 1T22A 3W39B 1I82A 5AD0A 5AVRB 2ATKB 4H26B 4PJ5D 1KYFA 1WBXA 3LQAC 1I4FA 2KLUA 4PJGA 2O72A 5L2KD 1LT9C 5IMMA 5EEXA 2X70B 4OW6A 5D96B 4YR6A 4UTAL 1L6PA 4XVSH 1FYTE 4GYBA 2VZSA 4KRLB 2Y0EA 4IHOB 1DQKA 5DJ6A 2J2ZB 1RIVH 2QKIA 1CFBA 3VXNA 2CJUH 1FPTH 3E6FA 4Y28J 5EC1B 3RVVC 3Q2VA 4GIAA 3EXLA 3QZOA 1UA7A 1GU5A 2YAMA 2YKLL 5JLZA 1MH5A 1NGWA 1FO0L 3LIEA 3WFZA 2VLJA 3MZTA 3OXSA 3PTZA 2X3CA 2AJYH 3ABMB 1CICD 2BVOA 2MMXA 1FZEA 2MNUA 3G9AB 5D6CB 2P5WA 2WVVB 1EGJA 2N4IA 3V8CA 5T33H 1VF5D 2M3EA 4D3CL 1CBVH 2CLVB 3UTQA 5CGTA 4YHKH 4ZG1A 5IMKB 3CMGA 5TPWL 1T66C 1X5FA 1OEZW 4DN3L 1RJZB 3GS0A 1QAWA 4QRRE 4Q0XH 5FLVA 5DC0A 2ZT9D 4M8QB 3L6FB 3ISRA 3VXUE 2J1KA 1G43A 1ZY9A 4PMEA 4EDWL 1WBYA 3RPIA 3PXLA 1KPRB 4RFEB 5TDOB 4AZ8A 5KLVJ 5DMGC 4IDLA 4ONHB 5MI0B 3SE9L 5JZ7C 5D1ZI 3MROA 4HJGH 3AS2A 1UFGA 3OAZK 1WITA 2EUXA 2KXPB 3NGBC 1AGDA 2IQAA 4P2YA 2Q7YB 4N6JA 4UT9A 3BD3A 2B4CH 1JUFB 1N7SA 1QPKA 2BVPB 1FZCC 3FHEA 5GRZA 3IGKA 4DWHA 4OTXH 4M7LH 4PJBA 2YEZB 4RZKA 3CFCL 5JNYB 2IZ1A 5E7BA 4B9FA 3CUPB 1O6SB 2CCWA 5DRNB 2XJKA 3BP6B 4GKLA 3VTTA 5JXEC 1UENA 3OSKA 5DFWH 5EEZA 1F00I 3HS9A 1EJOL 2O6DA 4JRLA 4ZUTA 1OZHA 5CO1A 4UTAH 1PG7X 2UY7B 3EXJA 4KGJA 2KERA 3IPEA 3HS0A 2DZEA 5IZ7A 5A43C 3QFGA 1KPUA 2V7HA 4OF8A 2AI0H 1REIA 1AAJA 5F1KC 3RFZB 5DJYB 1DH3A 2X89D 3ULAB 2AV1A 1IGFL 1RK1A 2H45A 1WTGT 1A4AA 1R5WA 1QACA 2BP8B 2BVQB 2YKLH 2F54E 4X5WB 3A0BH 1HX0A 5GGRB 4IMLA 4DKTA 1FO0H 1GYWA 4EN3D 3DYPA 5DK3A 4ZZFA 1NAMB 4G8IA 2XN2A 3VTPC 3UZVA 1RIHH 3WTUA 1D5BB 1JY3O 3WOVA 4JO3L 4D3CH 5M1BA 1FG2B 2BP3A 2K1MA 2OCFD 4PJ5A 1W0WB 1ETA1 1RQ5A 5L2KA 3K81A 3QA3B 4FQXB 4ODUB 5F88A 4DN3H 3QO0B 2BH0A 2C9PA 3MZWB 4B0MM 4U7KA 5DO8A 2I85A 2Y9ZA 1BXAA 4QRTA 5GGQL 5CJ0A 1B0GB 1O7SA 4JPIA 4AV0A 4EDWH 1AP2A 2J43A 1RURL 1A65A 3GHBL 4K23L 2LKMA 1KYDA 1U8JB 5HYIA 1XF1A 1TYEB 4PWIA 3LD8B 1H0TB 3KYKL 4CKVX 4DP5X 5I66B 1DO5A 4BQ9A 3HAEA 4D8PB 1LLAA 2IAMD 2W9EH 5JHMA 5TISE 2PP7A 5I15L 1H8NA 2H1LM 1CICA 5DVKA 4CBPA 1QYGL 3QZPA 2YGNA 4HEPG 2D2CC 2ALAA 1Z9LA 1W91A 2FYUJ 2IPKA 4MWFB 3I6LE 2WYTA 1KNOB 3PNWB 2DLFL 4PWHA 1T1WB 1D7BA 3CJJA 3M17B 4XBMA 4DOHE 2HX9A 2B4CC 1QWHA 3S4SB 1AE6L 4KJWD 5ADOH 3CFCH 3ARGB 3FQXA 3QUMA 1DVFD 4LF3A 1FZKA 4EZJA 3DX9A 3KCPA 1ZPUA 4BWUA 2X12A 3CC7P 3DARA 5AB1A 5IVZB 5T3XE 2CDGB 1ZJBA 1MCDA 2DQEH 4MNGB 4QJ4B 3EOAA 2VH5L 2VERA 4PGBA 1EJOH 3VI4F 3HRNA 1FAKT 3NBNA 4DP6X 5JXAL 2DI8A 5E8PA 3LYRA 3WU1A 2P1JA 8FABB 5HHQB 5H2BA 1TZIA 2PPCA 4Y5YA 3EIFA 3UBXG 2L7EA 3EJZC 4WUUE 3LKRB 4PJEA 3RIKA 2YGVA 5HYJD 1NANI 1OTUD 4LL4A 3ROLB 3KPPA 3H4FA 4DZBA 1T7ZA 1IGFH 2R9HC 3R8BB 5C0EB 1E43A 1I3UA 2JJVA 3DHPA 1EEQA 3ZIMA 1QNZL 1KCVH 1PYWA 2L7JA 4OJCA 5GTHE 4PVMA 5F9WB 3DVGA 3MUHL 4G71B 3RZCC 4OZGF 4X6FA 2UWJE 1IBZA 3AE3C 4G5ZL 2YLKA 1I1AB 3QUXB 4GBXC 1UXWB 5HJ3B 3TT3L 1AZRA 2OW7A 2D0GA 3FL7A 3IDYB 4GI8A 3E1RA 5EEWA 5JOPD 4WO4D 3EQ2A 1A1NA 3NA4A 2VKWA 2XQYA 2MJWA 2E8ZA 1Z56A 1UOVA 5C0AA 2BY0A 1MCIA 4HIIB 5GGQH 5DC4B 4BIKA 1FZFA 2AZUA 1UUSA 3MD0A 1RURH 4FQIL 2F68X 4V1DE 4K23H 2X89A 2E7LA 3KJ4C 1VEOA 1JGLL 1M8OB 2CHDA 4D9LL 5DZPA 3KYKH 3FB6B 3DX4A 4EN3A 2GC7C 1E5YA 2VLLB 4Y5XA 3CD4A 4Z3FA 4NPFX 2VNCA 5C0BD 4U33A 4FCAA 5I15H 1IIIA 4XMTA 1P7BA 1E4JA 1QYGH 5D1XB 4N6RA 1QPPA 4IK6A 1DANU 3APDA 1LM8V 5IB1A 1L0NJ 2QR0A 2B9AA 1WRFA 2DLFH 2QL1A 3CDGA 5IOPA 1HAUA 5ABDE 5ID1A 5E2UL 1AE6H 3EJPA 2VQ1A 3SE4C 5JUEL 2Y0CA 2D0FA 1U30A 3MGOB 2HPOA 3ULUD 1SOXA 3IRZA 4B95C 4XE0A 4Z18A 1GZLA 1F8TL 1ZK9A 4N0FB 2VUOA 4PJDA 4ATTA 2R1YA 1MCPH 3FN9A 2PMZA 3NRPA 2NXYB 1PEWA 3B37A 3DHUA 5D5MA 1PZSA 1BZDA 4EI5C 5JXAH 2IAMA 1NGZA 5FO7A 1OP5H 3BWSA 2DQJL 1HHHA 1CXHA 1R5SA 2VSDA 3D39E 3H85A 4LKCB 3BZFB 2JKVA 2V7NA 4W6WB 3BVNB 5DQDL 2QLYA 3DDFA 1F6LL 4IU2B 3IXAB 4P5TB 4O02L 1G1OA 4R2GB 2JCCB 5HYSB 3L4TA 1OT1A 5IEHA 3RK3C 4OWFA 3H1JE 2F08A 4PJGF 3OA7A 1T66D 4KKCD 1QNZH 3UERA 3S3SA 3PGCB 1NUDA 1DVFA 2PETA 2WSCJ 4ZD3L 3CFEB 2E4TA 4FG2A 4G5ZH 2NY0D 3TT3H 1DANT 2QVAA 3L8QA 2GJZB 2NY6D 3V0VB 2X1XR 1MAMH 3OKOB 4JFEB 3WIFA 1JK8A 1JXDA 1B9KA 4U3FJ 3L4UA 3RE0A 2J25A 5B7MA 5KBLA 4PJFE 4GQRA 2AHIA 1CDYA 1GJUA 3GBML 2ZP9A 4PLNC 2XFGB 3AU1A 1OP3K 4ZQTA 1G7LA 4QOKD 2VRSA 5HYJA 1QSEB 2FL5B 2CRIA 2LR4A 6PAZA 4FQIH 3WLBA 3QBTB 4QYOB 5KLVD 3KJ6L 1Q81Q 2DOCA 4K94L 4NRYA 5C9JB 2QPDB 1VPCA 4M7ZB 2FO4A 4OZ4B 4GLRH 4JFOB 3DMMC 1E9OB 4FMKA 4R97B 5GRWA 1X5IA 3EYQC 3TYFB 3NA9L 4XX1E 1GZPA 1YDPA 3TASA 1MLBA 1MVYA 1NWPA 2H3NB 2XN0A 3IPBA 4M4RB 4MA8L 1SZNA 1Z5HA 4HF5L 4Q4IA 5JXED 3AB0B 5IQNA 4WO4A 4F7PA 5E2WL 4HOZA 5E2UH 4ACPA 5MEPA 1KB5B 4O2FB 4PTTB 5JUEH 1CFSA 3MBWB 4Z5RA 4W80A 3BQUB 5MEOB 2QEJA 2RAMA 4GSRA 2FT8A 1BZ7A 1A1MA 3SDXA 4GKNB 1FVDB 1U8QA 2CPBA 3MOQA 4XMZA 3ULSA 4BELD 5I17A 4LFHG 2OTWA 3V6OE 1F42A 1SDAB 5I30L 1YJWP 1MCQA 3LKQB 4NUMA 4S2SB 4JRFA 5BRQA 3VD9A 4C7NB 4LU5H 2X1WL 2Y4SA 2YD0A 4PJBF 43C9A 1AA0A 1P2CA 2IFGA 4JPSA 1IGTA 2W6AA 1FL6B 1GZHA 5DQDH 1BFVL 5JYMA 1SQXE 1QO3A 2IO5A 5EMYA 2YD3A 1UZ6E 5D1ZC 1CXFA 3HI1A 4M7LT 3GMRA 4L4VE 4Y19E 1RULL 2XDHA 3M9HA 5FUZL 3PQYB 5AAWA 2OMZB 4ASVA 1L5GA 2P8PA 2YWZA 3EF4A 5HDRA 1YQVL 3FQRB 4ZD3H 5KAQG 4X7EC 4ZX6A 3LS5L 4LLQB 4PCKA 3HB3B 3Q3DA 3VD3A 3HHRB 2ORBH 3BVUA 5HY9B 4TVSa 4Y4KB 4FL4B 4R8WL 3HAEG 4EQ3A 4UANA 5BXFA 4HGWA 3EHBC 4HGMA 4JK0D 1A6UL 4U49A 3GBMH 2GJJA 1MI5E 4OD1L 1DZBA 1INQA 3ULVH 3MUUA 4DVBB 1GTFA 5CP3H 4YFLI 4ZYKB 1MCKA 4M5SA 4YIQB 3KJ6H 2RN0A 3AE4C 4H2AA 1L9TA 3FONB 4JO2L 4X9HA 5F97E 3G3ZA 2ROYA 2GFBB 5H37A 1JO5A 4KX9A 3DHMA 4GSUA 4XE5B 5DCCA 4HSAC 1JOIA 3NA9H 3TBYA 3DUSB 4YSCA 2CIIA 3UTTD 1GXEA 3PWLA 3DROB 2B7DT 3L81A 3ESVF 4MA8H 3S8GB 4HF5H 4N2FA 2Q86B 1ZT4B 3F6JA 4LNRB 4PSPA 3ASWA 2GCYA 4GB9A 1RF1B 3EFGA 3MV8D 4HXAL 5E2WH 1OW7A 2DEXX 3S97C 2CRZA 1F58L 2A9ML 1R33A 3QXTA 5DS8B 1I1FA 3D3VB 1YMMB 4ZX4A 2YC1B 1CL7L 1BZQK 4QOKA 4YHML 1SNRA 1CZQA 2JMRA 2H7HA 5DMIL 2UYLA 5D70L 3BP7B 1DP0A 4M6NL 4UNTA 4PRPD 1MEXL 4J1UB 3NCMA 1WAAF 3ZE0E 5I30H 5F9JA 3GDCA 5CLXA 1L9NA 5F6IB 5IQLA 4KI1A 4Z7QE 2APVA 4KRPD 2WBJB 4X7TB 3LKSB 5DMYA 1BFVH 1CW5A 2W8CA 2NYZA 4GBXD 3ZO0A 4AEIL 4K8RC 2CDEA 5JXEA 2XQYG 1TZHB 4FYSA 4UTBL 1RULH 4K15A 5FUZH 4AT6A 1T3JA 1THAA 1MRFL 2BERA 2OQJB 1NC4B 3HC3H 1H3UA 4HCFA 4TNWF 3EOBB 3NN8A 4O9BA 5E00A 1AR1B 5DJ8B 3CFDA 3J8F7 3LS5H 4KMLB 4OSUL 4ASWA 1LE5A 4PJEF 1FL5B 4YSPA 2X87A 3EGXB 1JN6B 4DP2X 4U31A 5DK0A 5HP5A 1AZCA 4KI5F 4R8WH 4YSQA 1KPVA 1FOSF 5I73C 1HHIA 4AQAA 1OSEA 2NT1A 3D8MA 1RUPL 5IQ9A 3RWHB 3MSPA 2V7QJ 1A6UH 1IC5H 4AMXA 1P5UC 4OD1H 1KJ3L 5FAAA 4LLYA 1ROWA 4C8XA 2DJ4A 3V4PB 1E28B 3EGSB 3ULVC 3KBHE 4N5UA 3T3PB 1HXYB 4HKZB 5IUSA 4PJIE 3E1IA 4PRHD 5KVDH 4JO2H 2AK4E 3BIAX 1A22B 1AZNA 5T1LD 3MYJA 3T9WA 2WSEH 1DN0A 3P4NB 2QSCL 3SBQA 4N22A 1HI6B 3CZFB 3QULB 2Y2TA 3F7PC 4JPZB 2H5UA 3LKOA 5IB3B 1HHJA 2Z0BA 4P48A 3PAVA 3HE4A 3GMOB 5KUKA 1AGFB 4XMPL 1NDGA 3UPRA 1TJIL 1KJVB 1KLFA 3AY2A 3HE7D 1S3JA 2FEEI 1OLLA 2Z7ZA 4ELDA 2J5WA 4HXAH 3D4CA 4BJLA 2AVFA 1F58H 2A9MH 3ZE2E 2ZYSA 1OVZA 1B3IA 1CL7H 1E5ZA 2OULB 4YHMH 2OAAA 1YC8A 5DMIH 3DXAD 5D70H 4GS7B 1T5KA 2ZX6A 3MRLB 4M6NH 3UIYA 2WWMD 3CVHL 4CPGA 1MEXH 3MLZL 2ZYGA 3GSXA 3QZWA 5E8EB 1KFGA 3FO1A 1B6UA 3L74J 1QTSA 3CXFA 3JT2A 1R3HA 5EU4A 3UTTA 1DVTA 4AEIH 2ENJA 5I9QB 5A6MA 1DJSA 5J4MA 3S96A 3PL6C 2IH8A 4H4NA 1AHWB 5DQJB 2IV8A 3O3AB 2W90A 3SFDC 4UTBH 1KQSO 3MV8A 1NMCB 5B1JC 4XNDA 4I7ZC 5KEZA 1MRFH 4JJHA 3HZKA 5D5MF 3VRLE 3STBA 5JPMC 3HZ3A 1PNCA 3A3YB 4H44B 2Z7WA 1PDKA 2WQUA 1N59B 4OFYD 4OSUH 3FT0A 4B9IA 4NCC1 3M91A 5B39A 4ZOCA 5D1QB 4PRPA 4RESB 1V3LA 3GXDA 2ROXA 4NKOB 2VW4A 5ABAA 1OMIA 1RUPH 2ADGB 4U3FD 4JFWA 4KAQH 4OKVA 4KBPA 5HD8D 2R2EB 3MNWB 4QKXB 4AQ1B 3GHPA 1U2HA 4YAQB 1KB3A 1D9KC 4WK0B 1PY4A 5FA4B 2VDQB 5FM5O 3EYQD 4U3XA 3GINA 3FQTA 4AEHL 2W59A 4N2MA 2XG4B 3RVVD 2XY1A 1HZKA 5CHNB 1IGYB 2DKSA 2XTJD 4XCFH 2VZ3A 4GIPD 4MX7A 5EFIB 3MMEA 4MJIE 3ABZA 4AKOA 4CSZA 2QSCH 3HW7A 4IRSB 3EJQA 4NO2B 5B8CA 1T4WA 1A9EB 3MRQB 2BSSB 2XN1A 4XMPH 3MCKB 4NI3A 1TJIH 3CX5E 1QLRB 3IS0X 1H8SA 2A45G 2WQAA 4DCKA 1BSNA 1XGYL 4FI8A 2VIRB 4RZCB 3TOPA 4E5XA 3NEEA 4NNXB 1WA1X 4CSPA 2J55A 1WHPA 4MTMA 3DTXA 3WHXB 2HFFA 4E2OA 1GDTA 1JZEA 3QORC 4XP6L 2VN7A 3C9IA 4TSAL 3CVHH 5SWQA 3HJEA 4PJ7E 1RAMA 4F8NA 3MLZH 3SKOB 2K9JB 3DKHA 4PRHA 3W9EA 2EYTB 3TU6A 1XTCC 5T1LA 1LNUA 1X5ZA 2APTA 2P44B 1W0VA 1MWAA 1WDAA 1OCWL 3RBGA 1OVUA 4JG9A 3TEZA 3KLQA 1YEWA 1J2JB 3BO8A 3H7BA 3GGWB 4YOKA 5LGKA 2J7LA 4TNFA 4YO0B 2YD4A 5INCA 3HE7A 4HJSA 5LN8A 3WJJC 2WZAA 1UWGL 3L4WA 5CIPA 2B20A 1EEZB 2JQZA 4RGOL 2PO6D 4JZJA 5D93C 3GLDA 3DXAA 5J1AA 4DUXA 4N3TA 1VHPA 4BFFA 1WFOA 2PLTA 1ZHNB 1TVDA 4PJCA 5H37G 3V4UL 5FB8A 1VCBC 1XB3A 2OYIA 3H1IJ 3HLAB 3D09A 1WK0A 4MN4C 1MY5A 3T77A 1JRHL 1QUPA 4NPJA 2ADFL 3ULUF 1F4AA 4LCCB 2N9YB 1DIPA 4FFVD 5HDBF 5LAXB 4AEHH 4NSKA 4AQEA 2Z31B 5AKRA 4NJ9H 5DVOA 5AB2A 5CSZA 3OPUA 2FLMA 5E4EC 3H0TA 2ZOUA 5KSBE 3CHRA 5M94B 3QJFA 1HOCA 1RZGB 4FLRA 2ZSWA 5HGAA 5DEFB 3F12B 1P84H 1SFCC 4OFYA 1BIIA 5KLVG 4IRJB 5AYUL 3B43A 2A4CA 4PJXB 1A7BA 5BVPL 5T3ZE 4FNRA 5CJ5A 3BAWA 1KLGB 1W15A 2FIKB 5ESAB 3AG2B 1JE6A 4UIMA 1GMEA 2QTEA 4Z0XB 4HUVB 4L3CA 1XGYH 2D8KA 1S78C 4LGRB 5IJCC 3GHEL 2UVEA 4K73A 2IG2L 3TC9A 5BZDA 3V0GA 2ZSVA 1JTOA 1EAPA 2BNQB 2NW2B 4LDCA 2NYYC 2IWFA 4XP6H 1NSNL 1BFOB 4K8RD 5I75C 2AJUL 4X80L 5DVMA 4B97A 4WEEA 3MRKB 4N26A 1B6DA 5F3FA 3WEAA 2QVFB 3TZVD 1OCWH 3NIGF 2GAZB 3GBLA 4XNQA 1BD2E 3UZEA 1SFDA 4APQB 2IDUA 1JAEA 4YHYB 5KAIH 2ITCB 3BGAA 4CU7A 2OYHC 4LRIC 3WJLC 5BOPA 4PBDA 1S9WA 1MG2C 2DQUL 3GFUA 5KWYC 1UWGH 2HT2C 4GI9A 5C09E 2H8PD 1C16B 4DP0X 5EOQL 1VGKA 2YXVA 4RGOH 2K70A 2C4FU 4JDZB 3QPQC 5FYKD 3RTQD 3VJ6B 2X4PA 4FXGA 3H2WA 3NZ8B 1J1DC 3R8QA 3GSQA 2QPFA 1A14H 5JDSA 1PP9E 3AE9C 3Q8BA 1MV8A 2QGDA 1LEKA 5I76B 1CT8A 1OZUA 4PREA 4O2CB 5EOTB 4WI2A 1UWXK 3CFBB 3UXFA 1JRHH 1JVKA 5EUOA 5GGUB 2ADFH 1HQRA 3NEXA 4XAWL 2CA4A 5I0ZA 2V5RA 2GTWB 1O9WA 2CXGA 1KLUB 5F8RC 2ESVB 2KLVA 1HVVA 1FZAA 3KVPA 2Y1AA 2BSTB 2V8MA 2VAJA 2HLAB 2B87A 1SQ2N 1FFPA 1UACL 2WKGA 5ICZA 1A4CA 2PO6A 5K9KA 5CF3A 1W5CE 2DTSA 1T1YB 5AYUH 4QRSB 5C08B 2D03H 4JHBA 5CJOL 1WFMA 2FT6A 3QZWG 3DIDA 4MS8D 1CXLA 1VQPP 2VL4A 3WMPA 5J6GA 2K37A 1K8DA 4IMKC 4CN1A 4DHLA 2K7PA 1PLGL 5C86A 3BQVA 4FLQA 1TTBA 4JFVA 3GHEH 3P30L 2IG2H 4A6YH 3PE9A 1EZVE 5A6IA 1E4KC 2C4FT 2OXGA 1OE3A 5ID0A 1NSNH 3PL6D 5IG7B 2AJUH 3E2HB 4L9LB 4X80H 5AW1B 2ZXWB 1DUZB 3MRBB 3A5VA 1EA9C 2K6YA 4PJ9B 4UQ2A 3ETBF 3L72J 1S2EA 4JAMA 3APMA 2CRYA 2NY2D 5D7LD 4DO4A 3L74D 5B39G 5EZJB 1VQLP 3Q2YA 2KLRA 2ZYIA 4KWUA 4TNVK 1QQDB 4JBZA 4AMWA 4KH2A 1S1CX 1GC1L 4P3DB 1GZQA 4WK4B 2DQUH 1OVVA 2YQGA 3FXIC 2IANE 4YBQC 4HIQA 3VMOA 2PPFA 5MHSD 4N3YB 4M3KB 3FO0L 5EOQH 5JHLA 5GSRA 4KHXA 5KG9A 1X9LA 3L16A 2B8OT 2QQQA 4KUCF 3ZDMA 4NZTL 5BOZG 3KNBA 3U0PA 1SQPK 1T8ZA 1BZ8A 4HU2A 4JY6B 4EIZC 1FNGA 3NK4A 2VXSH 4QHMB 1FIEA 4FQJL 1VQMP 4P23C 1JPFB 3RFRA 3TZVA 4R90L 1E9PB 4X7DC 5DZJA 3ZKSD 3L1FA 3VP9A 1WF5A 4QLWA 4XAWH 3LQZA 3LZOA 2NY3C 2YFNA 2BDNL 3GMLB 1DSYA 3WEBA 1G1KA 1C5BH 3QIUC 1FL3B 3MJWA 3HBZA 1KJ2L 1MCLA 1I75A 2BZDA 2YAFA 1QFWI 3KH3A 4KROB 4E5XG 2Y0DA 2Q9OA 4TLKA 1PLAA 3I84A 3DX6A 2H8PA 3SY0A 1CQYA 2ZAIA 5J12C 4KZEL 1UACH 2MSPA 1MCFA 2QGCA 4HP5A 3S3DB 3AM8A 1U8MA 1YEJL 5BV7C 3TEYA 3ERXA 2QVMA 2EUWA 4HWUA 3RTQA 4RRPM 3FB7A 3CH1B 3KXFB 5J06A 4OY9A 4TUJB 5CJOH 3QORD 3OLEA 1YITP 1ODAA 3PGDA 2J88L 3CZJA 3U0TB 3KPRE 1USQA 3SDAB 1NZRA 1PLGH 3FTGB 4OD2A 1HUCA 3ZE1E 3VWKA 1JTTA 3P30H 3V4LA 1G0XA 1S9YB 3HIZA 4NNPH 2EXYD 3EFFK 3MX0B 4NQVB 3BRFA 5B3SB 4ZFFB 1BAWA 1RUAL 5FKAB 1JGUL 4JO1L 2PW1A 4DP4X 2WK2A 4WCYL 3UFIA 1K4DB 3QR1A 2IBZE 2G3MA 4E9SA 3JT0A 2VDNH 2ZUQC 3GNMH 4HIJA 5EU3B 1JPTL 1S7UB 3VI4B 1ZRUA 1NAFA 3BZ5A 3CC2P 3HG5A 1WBZB 1ZLVH 2MNJB 1HNGA 3FO0H 3OBAA 1FVEA 1P4BL 1SQQE 3GPSA 3IU4L 4E41B 2W27A 4WTQA 3S8FB 4NZTH 1SEQL 1DO6A 1RPUA 1OWAA 1XR9A 2IADB 3HC0A 2DKMA 2QELA 1RI8A 2R0WL 3IRPX 3MREB 4JYBA 3A0HE 5B1JA 4K3GA 2ZCZA 3CSTA 1DL7L 1TQTA 4FQJH 2BCKA 4R90H 2RJMA 1T1XA 3GLEA 5D7LA 2FX9L 5CBEA 5D4JA 4KQ4H 5F7EL 3GJFB 4PRID 4BXSV 1CLZL 1NTMJ 4FE9A 4CW1B 3W56A 1MFVA 2BDNH 3GLMA 3WN6A 1T2JA 5AVYB 4HH2A 3E7KA 1P7QB 3TCXA 3ZDZE 1QZNA 1T0PB 4IHBA 3FH7A 4U3FG 1CLVA 1JGEB 3LPOA 1FNEA 1P5VB 2Q3IA 4PJCF 4HLZG 1UOKA 3KLAB 2VMEA 3OKNA 3OHXC 2YGOA 4KZEH 2X3AA 1YEJH 3H1ZA 5K39A 2EKJA 1QZ1A 2W9DL 2BW5A 3WE6B 3UBXB 4IOIH 2EDTA 1JY2O 1KTLA 2NYYD 5FW8A 5TH2A 2DMBA 4G6FB 3CL3D 3EH2A 3ZGHA 2O01H 3D25A 2ZYAA 3QUZD 2HXAA 2NNXA 4GOFA 3BUPA 1M05B 1RHHA 5IFAL 4EQ2A 2QPEB 1H3PH 4Y2DC 5AW5B 2UXGA 2JLLA 3KPSE 3WFEL 1FC2C 1V3KA 5J3HC 3QFJE 2VO8A 1L0LE 1FCCA 5KYXA 4Y5VB 3KLSA 4APXB 1RUAH 3PAZA 1TJHL 3K6OA 4JO1H 3LNHA 3L3GA 4WCYH 1KYAA 3ZKMC 2HT2D 4WW1A 4XWOC 5IWLA 3IJHA 2KNCA 2VUKA 5BZZA 1YMHB 4AX3A 5KN5A 1TQBB 2BNRD 1JYVA 3QPQD 2WPVB 5C07B 1JPTH 5I16A 1R5IA 3QORA 3QQ4A 4TKWA 5IK3B 3CLWA 4PTUA 1AGCB 3FTSA 2W0PA 4A39A 3VXME 1EFXB 4HIEA 3E9UA 4FFWD 2ENYA 1G84A 4XO3A 4MMXC 1T22B 4MQ7A 1NIFA 5AD0B 3IU4H 1WBXB 1I4FB 1SEQH 3TA3C 2KB7P 1MFNA 4FULA 4PJGB 5IMMB 3QQ9D 4L3AA 2R0WH 2J6EA 2HRHA 4XVJH 3TP4A 1II4E 3QARA 4YR6B 2WPGA 5GS0H 1DL7H 3B5HA 3LNEA 3NPSC 2J12B 2CO3A 2FX9H 5F7EH 2F7RA 1TZ8A 3OKDA 4YVUA 5DJ6B 2QKIB 2HFGL 3US9A 2G2NA 5AOLA 4S0HA 1AQTA 1NCJA 4HH9A 3RGUA 3MLXL 4KXDA 3E6FB 3EYFA 3S5ZA 4LVHB 3V0JA 1ZLDA 1J1EB 7PCYA 5KSAC 4XNBA 3TNNA 5JLZB 1MH5B 1NGWB 4AGMA 4L2LA 4L0YA 3BRGC 1OOWA 4WRLA 4ZMOA 2UY6A 1O6TA 3OXSB 3PP3K 3TV3L 3VB9A 2BVOB 3D12B 4POUB 1KILE 2YD9A 1GRWA 4I2XA 5EUOF 2P5WB 1HWWA 3UTQB 1RXLA 4BFIA 2HJLA 2DYSB 3TN0C 4FS0A 2E4FA 4Y89A 5LAPA 1RY3A 4PIBA 2QKSA 3BKJL 3LCYA 1KC5L 1EWHA 4JVPA 2QGEA 3NCXA 5IFAH 3GSWA 5I1HL 4PRIA 3EW3B 4FD0A 1WBYB 4XTRD 3RPIB 1HXKA 3V7AE 4AZ8B 1HQ4A 3WFEH 1HHKA 5GRXG 1ZW0A 4HG4K 4W81A 3E3QC 4Z7QF 1TJHH 3RDTC 4IJTA 3MROB 5HYQA 1RHZB 5EEUA 1RERA 4FTVD 4DW2L 3C08L 3FPYA 1AGDB 2IQAB 2XIIA 3SQBA 3L72D 4LOEA 3ZRSA 1TUPA 3F89A 4XMKL 5ITFA 1QSFE 2NR6C 1XSIA 3JZYA 5F0LB 1D5MA 4TQIA 3T0XA 1K2DA 2PRRA 4Y8DC 3EO1A 2AEIT 4PJBB 3QUZA 2CMRL 1EANA 1UH4A 5GRJL 4P23D 4JHZA 4QRPD 3FH5A 2G3NA 3KLKA 2AEOA 3CH8A 4BRYA 1EDIA 1UZ8A 1OAKL 4NQDD 5I1KL 3QDHA 3M9QA 4RISL 2H2PC 4ZUTB 1KN2L 1H3VA 5KBDA 2W60A 1FHGA 5KAFH 2WZ0A 1NGMB 5GS0C 3H9HA 3HS0B 2GT9A 4MCNA 4YDLC 5AAMA 3RJQB 2A06D 2V7HB 2XZAL 1A3QA 1SHSA 1DFBH 2HFGH 1MRDL 3AS3A 2BNRA 1VZGA 4UQ3A 3MLXH 3I9GL 3TEWA 1P6AB 2AV1B 2ZZUT 1RK1B 3DRTA 1R5WB 2NZ1A 3QW9A 1BVOA 3VFSA 3BWUF 1J5CA 4P3WA 4IMLB 1YTZT 1I7UA 1WA0X 4HXBL 4MXQC 4LCWA 2YA0A 2V4LA 4OCYL 4CJ1A 4U1LA 5CLTA 2AJ3A 1Q9KA 1UYWL 3NIDE 4XVUD 3RL1A 4PJ5B 5K5YA 2W91A 5IVOA 1M6OA 2KDGA 2J1YA 3KWWA 3VA6A 5C97A 5L2KB 5E8DL 1KYUA 5F88B 3BKJH 1KC5H 2B9BA 3OLDA 4HPOL 4GFXA 4QRTB 4ADGA 4JPIB 2P80D 3MNVB 4I1RA 5I1HH 3DPBA 4DKDC 1TQCB 1AP2B 1B4JL 4A68A 4Q7DA 1S3KL 2QV2A 3RI5K 4AM0Q 5KVEL 2WO3B 1AVAA 1KQGB 5CD3A 2WQXA 1OCRB 3HAEB 3ZJAA 5FFGA 4DW2H 3C08H 4B60A 5K59E 3NUKA 4OZHA 1CICB 1E0OB 4P06A 5D7KE 1N8OE 3LRLA 3U48A 3UYRL 4XMKH 5DVLA 5C0GA 1YPZE 2J71A 2LQRA 3LVTA 5F7MC 1TPXC 2XVGA 1VF5B 3VQMA 4H2CA 2IPKB 4ZMYA 3WUWA 3EAKA 4JBSA 5CILL 5CZXD 1YEKL 2YK1L 2EE6A 5FGSA 3GDBA 3FQXB 1UVQA 3QUMB 3L74G 4HZ1A 4LF3B 1FZKB 4PLKD 2ZT9B 3K8KA 5GRJH 3NFPA 3DX9B 4ORGA 2POHA 1YJ9P 3BSZA 5DK2A 3QUKB 4K3DL 2B59A 1JXKA 4BFOA 1OAKH 3QJVB 4DGYL 5I1KH 3EOAB 4PVBA 4G9FE 1GGBL 4PGBB 2AITA 2PYFA 1KN2H 1U41A 1IBDA 2GKIA 5E8PB 1A02F 4FTVA 3NFSH 4IGBC 3QK0A 3LIUA 4OUOA 5H2BB 1TZIB 3X1NA 1YN7B 4Y5YB 2C3GA 4PJEB 4F2EA 3L1EA 3U2SA 3OLIA 1EXUA 3IBOA 3KPPB 1KZQA 5IT2H 3CDCA 2G2PA 3I9GH 4DZBB 3T2NL 1JVOA 2EVFA 1PYWB 4PG2A 2WMMA 1N12A 3DVGB 2A6JA 3TONA 4HXBH 4Y99B 4X6FB 2BP5M 4P23A 4MNQE 5CJ8A 4QRPA 3WXWL 2EVHA 5L2JA 4OCYH 2R4RH 2AXCA 2QEXP 1MNNA 5CCGD 2JKLA 4XB3A 1FC2D 4NQDA 5J3HD 2DM4A 2Q3ZA 2JE8A 3C75A 2FKWB 3ZMNA 1A1NB 1BLNA 2UWEE 4RA0C 5C0JA 1ZANL 3PYCA 1IJDB 2H47C 5EF0A 5C0AB 5LGYA 4UUJA 1D2PA 2KUBA 2AQ2A 2BS8A 4J4PC 1CLOL 5HI3D 1BXUA 3MHZA 3Q6GL 4XWOD 2P28B 1V7ML 3D50A 2V5SA 1B4JH 3H25A 4QUOA 3ZYOA 1S3KH 5M95B 5BRZD 1M1JA 3AW5A 4FXKA 2FFDA 1AGEA 1KFNA 3IGAA 4W9EC 3IE4A 4WJG3 2X7LA 4MBOA 3OR7A 3ZTDC 4EN3B 4Y5XB 1G7IA 4LPYA 4WJKB 2QMJA 3BLKA 4X9FA 1A6WL 3W11C 3UYRH 4N6RB 3EJYC 4PP1D 5DVPA 2EDJA 3S5YA 5B3NA 1NGPL 5IB1B 2Z0UA 2QR0B 3CDGB 5IOPB 3VI3E 3OF6D 1IZNB 4I0CC 5CILH 1YEKH 5ID1B 3N42F 3GMMA 1NFIA 2VQ1B 4I5BA 1R1CA 1SJHA 2VRKA 1OP4A 2VMDA 2D9QB 2HPCA 2P80A 1MFUA 3I9IA 4B7LA 5DJDA 3WNIA 3S3JA 2DQCH 2Y69B 5LGJA 4K3DH 2ADYA 1VFBA 1MREL 1KYOK 2R1YB 4PJDB 4Q56A 4HULB 4DGYH 2BS9A 5DD5L 3P1VA 1ZCRA 5KSAD 5D5MB 3C60B 2IAMB 1NGZB 3IDUA 5FO7B 1HHHB 4YDVA 1MJ8L 3SQOL 3FCGA 2V7NB 9CGTA 4PBVC 5C0BE 3BAXA 4XXCC 5LDSA 1I85C 5EO1A 1ITBB 4L3FA 4L1DA 4B96A 3SSGA 3WDJA 5IEHB 3T2NH 1NH4A 3TN0D 2XA3A 3FWNA 2CUHA 4FKHA 4JKWA 1ASQA 1S9KC 1NCIA 1DVFB 2EDMA 2L3BA 3B7YA 4ILDA 4OZFH 3GTNA 1XVSA 5KZCD 2IPPA 2Y23A 2YN5A 4XT1C 3TLRA 1HE7A 4ZS7L 3DBXA 3QR2A 1X8YA 5DZLA 1A47A 3S0PA 4TTDD 3QDGE 2ZUWA 1TENA 3WIFB 4G6KL 1JK8B 2YAQA 1ZANH 3NFQA 4EIGB 4RFNB 1SQVK 4G59C 1OWRM 1NVOA 4YDNA 2HYNA 3AU1B 4AJ0A 4WI6A 1G7LB 2ZXEB 2HKFL 5HYJB 3Q6GH 4FTDA 1T3FA 3H9SE 1V7MH 1H15A 4IJ3C 1EVUA 1BEYH 2FYNC 3WLBB 4F9PA 3QAQA 3AT0A 1G7MA 5EU5A 3S37X 4PV9A 1MHEA 3IAGC 3KWXA 1A4BA 3POHA 5DJ0A 1SQPJ 3AEGC 2FO4B 3UAJC 1BQRA 1JZGA 2VLKE 5JHDD 3V2RA 1UCTA 2X6CA 2X05A 1QBAA 1A6WH 3EH1A 1YDPB 5CCGA 4QGYA 2WP3T 1MLBB 1Y8AA 1NGPH 3D5OF 4JDVA 5D7IE 1KGWA 2R29A 2EKSA 3MNZA 4WO4B 5JYLA 4W70A 3ABGA 5MEPB 1DQDL 1Q9OA 1NPUA 3A6BL 2D31A 1CFSB 5FYLL 3OZLA 4OFVA 4Z5RB 2QJKB 1BZ7B 1A1MB 2UUDK 3ULSB 1U8QB 4TUOA 5BRZA 2OTWB 4BSJA 1MREH 2NY4C 2DQGL 3MPCA 4HKBA 5DD5H 1KXVC 2AQPA 4ZNEA 1WD9A 5KLVE 4DAGL 2FH6A 3X12A 1OTTD 5CN3A 3L3OC 1IJNA 1BVZA 2NQ3A 2YAOA 3IMSA 1P2CB 4X9IA 4YDKL 43C9B 5ADPL 1MJ8H 4MXQD 1IGTB 2P5PA 3SQOH 3SCMC 4X5XA 3FN0L 1KB9H 4MMXA 4V2BA 1QGKB 2WCGA 1IEAA 5JW4R 4FG6C 4XNZC 1M42A 3HI1B 3GMRB 1VESA 4M5YL 3ZL1A 1TTUA 4ESKA 1L7IL 2Y25A 2VXVL 1VKXB 2EH8L 1L5GB 2P8PB 3M86A 4HK3N 2OTPA 1ZAGA 4OR1A 5HDBB 5TK4A 4IL6X 1VL2A 3R4DA 4ZS7H 1ZR2A 1DJYA 4JO5A 4WFED 4KRNA 3PS6A 5BXFB 4HGWB 4G6KH 4XP4L 2XVBA 2BSRA 1IC7L 2QVIA 3GPEA 3HG1D 1IFGA 4B27A 2IWGA 4H7VA 2H6OA 1INQB 2HKFH 2ZD0A 4KDVA 2WLJA 3UPCA 3WUWG 3TL5A 4R84A 3UBHA 3BCCJ 2XV6B 2B89A 5LLIC 4ISVA 3GRWL 3K72B 4TLFA 1N18A 4TVPD 5JMRA 2ZWYA 3TN0A 1A0QL 4MA1B 5C2UB 2NNCA 3OZ9H 2Q20A 1K73Q 3TIDA 4NOBA 4YPCA 3L2LA 4OGXL 4HDIA 3AROA 3VTAA 3TBYB 2NY0B 3L73J 2CIIB 3RY4A 3BUBA 4POZD 3PWLB 3N1MC 4RSVA 4LBEA 4OBSA 2NY6B 2ZNWA 3USSA 3L48A 2GCYB 3B34A 1ACZA 1KULA 3SGJA 3AE1C 2R51A 1DQDH 3L72G 4M48H 2OTUB 3NIGB 3A6BH 1I1FB 4IGBD 2NRGA 1NL0H 5E99L 1BHGA 1P9MA 4QOKB 3QAZB 5JPNC 4OZHF 3NG5A 2UYLB 4WWOA 3ARDC 3Q5SA 2B2XL 1YNKL 2OR9L 4G7YL 1Z2KA 2ODIA 3KBFA 4DAGH 5F9JB 4JGJA 1DBAL 3L37A 2M26A 2ZXAA 5J6SA 2IGTA 3GD1C 3V0WL 3VD2A 5SWZA 1CGUA 2VXUL 2ZXDA 4Y4FC 4YDKH 5ADPH 5JHDA 2VJ8A 3D30A 3L3DA 3KDPB 3V0FA 3FN0H 3ZHFA 3CHQA 3OKLA 1J87A 1SVBA 4X2UA 2CDEB 1AQDA 1SLXA 2NCEA 4HK0A 4P2RD 2FYUE 1MG3C 2YWYA 4M5YH 1IFHH 1NCAL 4GG8A 1L7IH 2YAEA 2VXVH 3BHBA 3VSQA 2EH8H 2EDLA 2A06G 3HBPA 3NN8B 1KYOI 4RDQF 1H89A 5E00B 4U1GC 4J4PD 3CFDB 5SWSD 1LE5B 2IZ0A 3QUYC 8CGTA 5AW4B 3MJ9L 5DK0B 1PZ2A 2WXGA 2W65A 5C0RL 4AQAB 1A3LL 5HI4C 4XP4H 5IQ9B 1OXZA 1IZKA 1IC7H 3BESR 2RQEA 5IF0A 3RLSA 1Q0XH 5DEGA 4WU7B 4LLYB 3H1HD 2GTQA 3TBBA 2OSLA 4TUUA 3W11D 3EJYD 2CUMA 1F41A 3GRWH 2IMMA 4LEEA 2ZOKA 2ZQKA 4XOEA 1A66A 1A0QH 4M6ML 1HCVA 2EADA 3BH8A 4Z3EA 3MYJB 4P4KD 1DN0B 2ZG3A 3PDGA 4Y1AD 1P84K 5IQ7L 1X3DA 4OGXH 4MVBC 3SYAA 2W95A 3V0EA 2FATL 3LKOB 2D3VA 1HHJB 3VGHA 4GO6B 2XWEA 4C4KT 3HE4B 2P7JA 4OCSL 1BBJA 1NDGB 2G60L 3UPRB 3EDKA 4B9KC 1KLFB 4CVZA 1DE4A 4M62L 3KLHD 2EE0A 4GSQA 3E1F1 4NYLB 4R7NA 3IGLA 3C8DA 4OJDH 3ZMEA 1SXSA 3GSNA 3HG1A 5AB9A 1UOLA 5IUCA 5E99H 1PL3A 1A9BA 2ODHA 2X4RA 2XU9A 4I0PD 2F8VA 2AEJA 2WV3A 4ZDHA 3WCYA 1PIXA 2B2XH 2OR9H 4IBVA 3GSXB 1FP5A 3QZWB 2MJZA 1DBAH 1FDLL 3V0WH 2LU7A 4WENB 3FO1B 1S9KD 5IREA 1AXTH 4JZOA 4QRBA 3I55P 2VR5A 4AMKL 1R3HB 1UB5A 5EU4B 3UTTB 3ARSA 1PGJA 3S96B 5HHVL 3UC0L 3V4VA 1WS7A 4I1NB 3MV8B 1BE3E 1L0NE 3JV4A 2WP3O 3Q06A 3HZKB 4HG4J 1IBBA 4IGBA 5C7XH 4NFDA 5DD3L 5E9NA 1PDKB 3K80A 4DGIL 2H0EA 4G42A 4WEMB 5B39B 3QWQB 1MZ9A 4YPJA 1EJFA 5E79H 4PRPB 5C0RH 3OB8A 2VCOA 3RK3E 1T0NA 1JZFA 4OKVB 5KBNC 5I1GL 4OGQD 3CCLP 4KRPB 5D7JD 1UB6A 3O2DL 4KTEL 4PV1D 2BIOA 1LJ2A 2UXVA 1TNNA 1ZJAA 3FQTB 2G3ZA 3SDDD 3V2AR 4WVRA 2FWSA 1BSIA 3H2PA 3BT2L 1UEYA 4P2RA 2QZ5A 4MX7B 1SQPD 4R7DA 3TYYA 3MMEB 1LO2H 2X2JA 4K7FA 3ZQXA 1SHXA 2FATH 2WVTA 4NZ8A 5B8CB 4J4PA 1T0MA 5SWSA 1S46A 4PUBL 1BF5A 4OCSH 4S1QH 2G60H 5EEYA 1BDDA 5DMJB 3KJ4B 4M62H 5EU7C 2IDQA 1AIFA 4ZX3A 4YDJA 2YEQA 3DX7A 3CLQA 3CCJP 3FK3A 3Q5PA 3FSOA 3B9KD 4J3UA 4E5XB 3Q5TA 1ZLSL 3FFCE 1E5WA 3V5HB 2HT3C 4JO4L 1U92A 3SCMD 3ASOB 1VADA 3DTXB 2HFFB 3TPUA 1F45A 3NP4A 3SDCC 1XH1A 3JWNC 4LSVL 3TEXA 5SWQB 1S3RA 3PIQA 3T6WA 1WFJA 3W9EB 4PRHB 4F80A 2ZONA 2I8DA 4P04A 2KOGA 5T1LB 3S88L 1LNUB 1S4IA 1FDLH 4P4KA 5HGHA 3V95A 4Y1AA 1W0VB 5KVFL 2JO1A 1MWAB 4TSBH 3SBWA 3LB6D 2CSPA 1KGCD 3CU1A 3BO8B 3H7BB 4AMKH 3BLPX 3BAYA 2B16A 4XA4A 5BUGA 1CLCA 5INCB 3HE7B 1HWHB 5HHVH 1XGUA 3UC0H 3GB7A 1F90L 4PB0L 1U9KA 5HHXL 2XPZA 4J3OH 5CIPB 4EOWH 2YXQB 2H9GA 5DC9B 4XOBA 3X3GL 4N28A 4NUJA 5DD3H 4QXWA 4JZJB 5J1AB 3DXAB 3D51A 4I0PA 4DGIH 3DWTA 4XXCA 3GXNA 2J59M 2EE9A 2X2YA 4LQFL 5EZIL 2FLBT 4PJCB 2J21A 5FB8B 2OYIB 4JRXD 3BP5A 3QHFL 1ZHBA 1T83C 5I1GH 4L5FL 3T77B 3X1GA 4KTEH 1Y6KR 1SVZA 4AQEB 1E4XI 4X7FC 4NSKB 3A23A 1WMKA 3OD3A 1HJCA 3BCCD 5B4MC 2Z35A 2M8RA 1Y9BA 3BT2H 5CSZB 4NGHL 4ODXA 4X50A 4ZAKD 3SGEH 3H0TB 3MV9D 1F1DA 1RE4C 1PZ5A 4QWWD 3D9AL 1HSBA 2AEWA 3QJFB 1HOCB 2ZSWB 5HGAB 1BVLA 1W6WA 3WIHL 3ZHLA 4DKEL 2GBAA 1TTGA 3ESOA 5J13C 1BIIB 3P69A 4PUBH 3L75J 1F18A 2UX6A 3L73D 1PJWA 3MQIA 5BW7A 2XTLA 3CN1A 2XACC 1UADC 4IBTA 1U8NB 4UIMB 3QGVA 3W37A 3WGVB 4L3CB 3IDJA 3S34L 1AZZC 4BWTA 3CCEP 1ZLSH 4D7PA 5D7JA 4Y4FD 1PGPA 4JO4H 4H1LH 3GS4A 5GS2H 5BZDB 2ZSVB 3MXVL 1I9RL 1EAPB 3SDDA 1XTMA 3LRSA 3MV01 4LSVH 2XBZA 3MRPA 3ZTJH 3C6LC 1WZMA 2HJFA 2XTJB 5KVFH 4XOAA 1XGPA 2DI9A 4PLOB 4X7CC 4ZODA 4UZGA 4AQZA 1NCOA 4XNQB 4EKJA 3QFDA 2J8UE 3MAWA 1CC3A 5ANMA 3LIZA 3IN0A 1W2KT 2QQLL 1XF4A 4F58L 2JQMA 4S0TD 1S9WB 3MKKA 4C4KO 1PD1A 1F90H 1KXVA 3KLLA 4RAUA 3RWFA 4PB0H 1HINH 5HHXH 3B9KA 1ZLUH 5CZVL 5HI4D 1XSOA 5C7ZA 3X3GH 1A6VL 3WO4C 4JPQA 1VGKB 2HB0A 1J48A 3SCMA 1P69B 1JYXA 2NPSD 3SKJL 1HCFX 2R0KH 2VXQL 2X4PB 4FXGB 4TNEA 2VSKB 1G6RL 5A2CA 3IPFA 2OSXA 2VRQA 1Z7JA 3GSQB 5JDSB 5AZEH 3FKUS 4NJAL 1LEKB 3LH2L 2MCG1 4E9YA 1CT8B 3A22A 4L5FH 4PREB 4YXWH 4Z7UE 4CC0A 4MVBD 5EUOB 3WS6C 4OB5L 1HQRB 4NM8L 3O4OC 5GGVL 3CPUA 2E46A 5AFAA 4NGHH 3IFLL 1UGNA 4YHNA 2NMSA 3EFFA 1KYOJ 2H32A 5FM4A 3D9AH 4MA7L 3D2UD 1FRGL 1MZZA 2B87B 2XWTA 3WIHH 1FFPB 5EWIL 5ICZB 5K9KB 2PO6B 3QC5X 4F33A 1D5RA 5AOJA 1N0XL 3CDZA 1TT6A 1Y6MR 1OAZH 5J6GB 1JM0A 4KJPC 1K8DB 1BGYE 2B3IA 1KIRA 4UIKL 3ULVE 3FT2A 3KHOA 4XGZA 3SO3B 4JRXA 2VN3A 2R1WA 3S34H 3QQNA 3VRJA 4CADA 1BJMA 2RTTA 3ATDA 5JO5A 2NQDA 2FAUA 1GR7A 4DCQA 3HUSA 3GI9L 3MXVH 1I9RH 3P9MA 5ISZE 1NPJA 3FCUB 1ZVSA 4LLDA 4XI5C 1D5IH 2OXGB 4DP7X 5ID0B 4P9ML 5D96C 4MQXD 4ZAKA 1TIUA 5E1IA 4BE5A 1AQMA 3MV9A 2W92A 2WLHA 3QXVA 3FOMA 4MJ5B 4UQ2B 1ZV9A 2WHVA 3G4SP 1AACA 4UTAA 4JAMB 2B08A 3T04D 1N4XL 1WG3A 4FQPA 1SQVJ 4HS3A 3SZ6A 2C9RA 5F3HA 3ZSTA 1JGVL 1U21A 2XXGA 4U3HA 3UPAA 2QQLH 3ZLQC 1NAMH 5CMAA 4ZK8A 4F58H 5M7QA 1GZQB 1VQ6P 5MEND 1K8AQ 3SKNA 3R19A 4QYAA 5CZVH 2WSEJ 1FO0A 3JCUH 1X5JA 4JFDD 4RMSA 1OALA 4Y4FA 3PF2A 2OP4L 5GSRB 2XWBA 5KG9B 4MJ6B 4LSPL 2NY5L 3SKJH 1IFJA 2XETA 2WBKA 1LGVA 2AQRA 3KNBB 2VXQH 3U0PB 4HUMB 5APSA 1SFHA 2H26A 2XHNA 1FBIL 2WLIA 3QB7C 1DLFL 1FNGB 3HC4L 3M1OA 1OAQL 4OFPA 1BBDL 1R17A 4F8LA 1I1YA 3OKKA 5K9OA 4NJAH 2GIYA 1HT6A 3LH2H 2JKRM 2XN9E 1JHLL 4LSDA 3TZVB 3VXRE 3N55A 1PEZA 3IU3A 4OB5H 1NMAL 3LQZB 2YUVA 2MKLC 3PREA 3VWJD 5MI0C 3MI6A 2GUOA 3GXFA 4R4BA 3IFLH 4KGLA 4X99A 1A7OL 2PPAA 3DX6B 1FRGH 1R6VA 2H8PB 3H1HG 3IKCA 3SY0B 2YNYA 5I1EL 4CC4C 5EWIH 2WXFA 2VDOL 2OJ1A 5CR1A 1NTZJ 1QFUL 1U8MB 2NPSA 1FS0E 3VFMA 3NFNA 3RTQB 1H8AA 4JRYE 3RL2A 3VI3F 1OGSA 1N0XH 3FB7B 3VU1A 5LVEA 1SBSL 3SDCD 1J0HA 1SQBK 3PGDB 4M5ZH 4UIKH 1UH3A 5IIEA 3BKYL 5J57B 2A38A 5T3XL 1U8CA 4ABQA 4OD2B 3VWKB 2YBGA 1HBWA 2FD6L 2XWZA 5KVDE 1LK2A 3UTSE 3SN6N 3GI9H 1ND0A 3EG9A 1P6WA 3KGUA 3T4AA 3U4EA 1HYSC 1IE5A 4GFTB 4MA3B 1KOAA 1YEFL 3CPWO 2Y07L 2KPWA 2PW1B 4LEBA 2R59A 3ZQWA 5C0FA 3EUDA 2W8ZA 5B1KA 1GOHA 3D2UA 3UCRA 3KWUA 3TSIA 1RQVA 1IC0A 2V0AA 4KV5E 5SX5H 1N4XH 2AXGA 2PUQT 4A2LA 3RFZC 4I6MC 4M3JA 5ECJE 4NXKA 3WNPA 4HIJB 5BUAA 1JGVH 1I3VA 5E1QA 1L9MA 2HRGA 4PGZA 1KUMA 1CF8L 2IH3A 1G9MC 4OF7A 5FO9B 2ZUXA 3QRGL 4XXWC 3UGUA 2HT4D 4H20L 5IQOA 2JJSC 2FY8A 2BEZF 2OP4H 4PHZA 3QHTC 5BJTA 4LSPH 3DUUA 2IOOA 3FGAD 2NY5H 4HC1L 4FQXC 4G83A 1XR9B 3HC0B 4MJIB 1A6TA 4N2AA 2L7UA 5B4MD 1FBIH 1DLFH 2MKWA 2FEDC 3HC4H 1OAQH 2ZP0T 1BBDH 3TCTA 4QJ5B 3FRPA 4I7ZB 1GGUA 2BCKB 3CFIC 2GBUA 2Z34A 4G8GE 2UX7A 4QRQA 1JHLH 1T1XB 2F7IA 2NY2B 3H42H 4XN2A 3MRIA 5D7LB 2GJ6D 4ACTA 1EZUA 5CBEB 1KT2A 1NMAH 1SOKA 5DTFA 1UCBL 4POYA 2NT0A 5DR5L 3LD8C 4HSQA 2ZJSL 1YBKA 1T2KC 3PHOA 1RZJL 1AS6A 1FNEB 2WJ5A 4ZBJA 2WANA 4DIXA 4GODA 4AGQA 1XD0A 3B7TA 1A7OH 2SODB 3EBHA 4L4JA 4JFDA 2VDOH 4KO5A 3OX8A 4RBPH 5DO2D 1QFUH 5K39B 5L4IA 2QM7A 3DV6A 2I7SA 3G5WA 3L75D 1OGAA 2JKTM 5DHVH 4ZMZA 5I0DA 1SBSH 3GQFA 1KTLB 4OGZA 5TH2B 1SQPG 3V4QA 3ARGC 4NT6A 4LLUA 3WMM0 3D25B 4ZW5A 4Y88A 3BKYH 2KS0A 5T3XH 4DEPB 3GUFA 4X8CA 1RHHB 1GIGL 1FU1A 3H1IE 4KJQC 4TNGA 2FD6H 5D6DC 3RVXC 4NN6C 3PJNA 3WFBH 1QVOA 5C8JA 2EC9U 2DWTA 3ZDYB 3VWJA 4FDWA 2XA8L 3FYEB 5KYXB 4DVRL 3N42B 4N5EC 1YEFH 4HJ0C 4TNVF 2Y07H 4M4PA 4LAQL 2VQ4A 1M56D 2WSDA 3L3GB 1DR9A 4WW1B 1FA4A 3IJHB 4UYPA 2KNCB 4O00A 5H94A 3RWCA 5KN5B 1ZSDA 1FAIL 4GEJA 4F9LC 3Q6FA 3K4AA 5I16B 1R5IB 3QORB 3VXSD 3QQ4B 3SDCA 3QWOA 3VXTA 4PTUB 4KKNA 1N2RA 1M2OA 5EIQA 4A7VA 4K35A 3QRGH 3RPBA 4HIEB 1EK3A 4IS6A 4XXDA 1I1AC 3QUXC 3WDHA 4H20H 4NQTA 2FR4A 4QT5A 2PGDA 4KNSA 5HHOE 1MF2L 3C2AL 2WITA 3IDYC 3LEVL 4MQ7B 4XNYL 4QDGA 3TTYA 2XQ0A 3CVDA 3PAYA 4HC1H 4E9VA 3VG0H 1LWHA 1O9VA 1C5CH 1NBQA 3PWPE 4YDIL 4AV5A 5G2NA 3DX0A 4K3AA 1JMMA 4M1GL 3UO1L 4C7RA 1P4LA 2PYED 3OKDB 3IJEA 1UCBH 3NCCB 5DR5H 4HH9B 2EC9T 3T2PA 3EYFB 5CJ4A 2ZJSH 3HRZA 4OIFA 4AYMC 1RZJH 2ZUYA 2BWDA 4KJPD 3TNNB 3IGFA 3KM1A 4P99A 2GBTA 4XN7A 3PP5A 1KYOD 3ZIYA 2PTUA 1NFDA 2UY6B 2ED9A 3EF7A 5D1XC 3UO8B 1EC5A 1JERA 3GC3A 3F7RA 2LU5A 3BCCG 1I7ZA 5IVXE 4YS4A 3S1KA 5HBBA 2ARJA 2ATPA 4BFIB 2HJLB 2VLME 2BXZA 5JIDA 1JZ4A 4Z7VE 4WI3A 1CU4H 3F3HA 1K4CA 3QEHB 5E4EB 5FF6B 3MBXL 1GIGH 2HFED 3GSWB 4ALAL 3L73G 2GJ6A 3DETC 3KGSA 4PRIB 2NW3A 4I9XA 5FW6A 2EEBA 4Z78A 3DIFA 1MUJA 1HQ4B 2NXYC 1CGSL 1HHKB 2XA8H 5SX4I 4DVRH 1BM3L 2A5UA 1P84E 4L2YA 5HJBA 5IW3A 4K9EC 4RSYA 5HYQB 3FTZA 3KYMA 4LAQH 2WINA 2AP2A 3KPQA 1CB4A 1ZHKA 4P5TC 3SQBB 4R2GC 2GSGA 5ITFB 1QLFA 1SQVD 4MNHA 2VB5A 4DP8X 5LGHL 1FAIH 2OZ4L 4CGUB 5LJYH 4O02A 1D5MB 5K1JA 1OM3L 4DP9X 2R44A 1K2DB 2WMPA 3REWA 3EO1B 4IKNA 2HUEA 3QUZB 4FLOA 3TF5A 4LHUD 4UNUA 1YEGH 4IRZH 1UJTA 1VQ4P 3WYRA 4NQEE 1MF2H 3C2AH 1FNFA 3LEVH 3LZQA 4XNYH 5A2JH 5ES4B 3OR6A 4BRYB 1XGZA 3NIFE 3T0EE 2JKIS 1UZ8B 2Y5QA 3MLUL 2HVBA 3NTNA 1QR1A 3WTWA 1GS8A 3FCTA 5CEZE 3EFDL 3OKEA 3L71J 3L70J 1SJMA 2Z1PA 1URQD 4N0YL 3BT0A 2W60B 3OMIB 4KC3B 3BMWA 4M1GH 3H9HB 3UO1H 2GT9B 4OJAA 4NB7A 2JKWA 4PS4L 1NKZB 1FUNA 3PLYA 4UQ3B 1OSZA 1BQHA 1X0TA 3VFWA 1ICTA 2VC2B 3VXSA 4M7ZC 1D5XA 1R3JA 3DRTB 1G5AA 1XGTA 3VFSB 8PAZA 4PRDA 4R97C 1I7UB 4LCWB 4WY4D 1MDTA 1U7MA 2ZIDA 4U1LB 4U2ZA 2YJLA 2AJ3B 1Q9KB 3RL1B 3AB0C 3AFLA 1OARL 3N43B 1OE2A 1M6OB 1LTJA 2Z8WC 3KWWB 4QO1A 4K5MA 4OBRA 3O3EA 5C2BL 2PWDA 1CDCA 3BQUC 3MBXH 1XAKA 4HCIA 1XGRA 3LZPA 4H8QA 1WZ1L 3EYSL 2PYEA 3NESA 3DPBB 3MBED 5I18L 1LDSA 2CBQA 2EC8A 1KQLA 2GK2A 3RU8L 4DFHA 1CGSH 1YVLA 3FQWA 3IF4A 2LLNA 1AKPA 2V9TA 3VB8A 3OTTA 1BM3H 5CD3B 1C7TA 2VQUA 1GS6X 2BZ7A 2F5BL 3QJSB 3SJVE 3ZPDA 3L9RA 3T97A 4OZHB 4TV3A 4Z8FL 4HH8A 1S7RA 5C0GB 5T1MA 1NKGA 2KZJA 5LGHH 2OZ4H 2FECL 3WUWB 4FYQA 1T1ZA 3BWZA 2O1KA 1E90A 3FRPG 5KANI 2GIMA 4RFOL 2BSED 5EOCL 4L0ZA 5JIMA 3MLPA 1H19A 2GEQA 1UVQB 1Y7VA 3I3BA 3FQNA 3UC2A 4NOFA 3OJDA 1JY2N 1F6AA 4UT6L 3HB3C 2DBLL 3DK0A 2HFEA 3NFPB 4MD4A 4UOW0 4Y4KC 1X79B 4ORGB 1I9EA 4FL4C 5CJXC 5AVUB 4NO3A 5DK2B 2B59B 3MLUH 1DBKL 5F93C 4UM8A 1OCCB 1HZHL 1EXHA 3A67L 2CO7A 1T2KD 2KSJA 2PYFB 3EFDH 4PJAA 2XRAL 1ACXA 4FTVB 2BFVL 3V4PH 1NBYA 1TTRA 4N0YH 5D2LA 5I5RA 1KB9K 5DRXA 5GISL 3RWGA 1MQKL 4K4KA 4PS4H 4NQCE 4RWHA 3DDGA 3U2SB 2ETWA 3I75A 1EXUB 2JTYA 1UASA 4IIQC 4N8VA 3U30B 4W9LC 3WKYA 1IKFL 2X9XA 3CHSA 4UNIA 3V5KA 2LE9A 2A6JB 4L3ED 2A77H 4LHUA 4P23B 5IGXL 3QRLA 4QRPB 5L2JB 4NLAA 3RVXD 5CWSA 2R39A 1GAFL 4N8PA 1GL2D 1OARH 1RF1C 4NQDB 3C5SA 5DUML 5C0JB 1BLNB 3OAWA 5C2BH 5A3IC 4N5ED 1MXGA 1URQA 1IL1A 4UUJB 1BJ1J 3SWYA 3U1SL 1WZ1H 3EYSH 4GRWH 1BCCD 5I18H 1C8QA 1QVFO 4G2AA 1JUFA 1F4WL 1JWMA 3JWNG 1QABA 1M1JB 1DQLL 4FXKB 2FFDB 1AGEB 1NTME 3V6IA 1OCZB 5F6IC 3IGAB 3RK2B 2X7LB 3OR7B 4HAKA 4HUUA 3CXHK 2WBJC 1VFMA 3Q5RA 1G7IB 4ZW6A 1TVHB 1M2VA 4WY4A 4BK5C 3QEGH 4TTGA 1JVLA 2OSWA 4DKFL 4Z8FH 2XQBH 1U95A 4MASA 5ENWA 3H1KE 2JJTA 3Q2CA 3WN5A 4EO5A 3TX4A 1M7LA 5E94A 3D69A 1GMIA 2O1AA 4R5XA 2OR8A 3T8XA 3FU3A 4RFOH 4DK6A 1C8PA 3GMMB 5CNHA 1NFIB 4UTBA 3QISA 4I5BB 4TUKL 1H3GA 1EMTL 1SJHB 4UT6H 6PCYA 3K91A 2HPCB 2DBLH 2ICCA 2ZYHA 5KYUA 3VSVA 3MBEA 5DJDB 1VENA 3SYOA 3U6RA 5LGJB 3VVWA 2V2XA 1RH5B 2ZG1A 1DBKH 1HZHH 4ZW3A 1J5IA 3AMKA 3A67H 1IGIL 1AY1L 5DUBA 3HFFA 2WCPA 4A37A 2XRAH 2Y06L 5I6PA 3AVEA 4HPHA 5AUMA 2SPZA 1OM9A 4YDVB 1IAIM 1F2QA 1X4XA 4OD3L 5GISH 1OAJA 1MQKH 2FHBA 2JJSA 5G4MA 1FG2A 2BJML 5EO1B 5TD4A 3VDAA 4NHCL 2Q5UA 1KZYA 4IFMA 3JQOB 1IKFH 4V11A 2BSEA 1DEDA 1X9VA 3W5NA 2M2DA 1YIJP 5D71L 1OAXH 1EDLA 2C3HA 5IGXH 5HTSA 3H32B 1A3ZA 2Q1EA 4AW7A 2CLRA 5FV1L 1GAFH 2BNUA 4JW3A 3DBXB 3HI5L 2NXYD 3ARWA 3SYQA 5C6PB 2B1OA 3NPZB 3E8UL 3R4RA 3QXAA 1W9XA 5DUMH 2PXYD 1HWGB 3AY4C 3QPXH 3RI5F 1MW3A 1T2QL 3PXJA 2NDFA 2VDRL 4JMXA 3RHWK 2KZIA 4EYYQ 4GS7C 3QRBA 3VG9B 3U1SH 4QAWA 3L75G 5I19L 1T3FB 2HG0A 3K74B 1H15B 3MA7A 4WDIA 3ZYZA 3K5RA 1F4WH 3ZT6A 1G7MB 2WLLA 5EU5B 1TOXA 1MHEB 2ZUSA 4PV9B 4QTFA 4B50A 1Q90D 4L8CB 4LP8A 4PWJA 3OKMB 5DJ0B 2KQNA 1HEZA 3TGUJ 3QNZA 1G7JB 5FOBA 1PF3A 2RA1A 4L3EA 3AITA 4MKMA 1RIUH 2HLFC 2J8UF 1PL5A 3C5ZA 4DKFH 1FHNA 4Z7WE 4BSWA 4QNPE 5I9QC 2KI7B 5LB1A 1AHWC 4ANXA 1GL2A 4JDVB 5CBOA 3FSAA 1NMCC 2PKDA 2EKSB 1XSKA 3MNZB 3T6ZA 2ZF9A 3CNKA 5E8OA 1Q9OB 4H44C 4TUKH 1EMTH 3E3QE 2D31B 3UJIH 1KBBA 1BQHG 4OCXL 3DGDA 3ROLA 6CGTA 5D1QC 2I1JA 4U6VL 5AW2B 1I3RA 4ABUA 3MFFA 9PCYA 5BRZB 1MCJA 5EA0L 5C0EA 4NZRL 4HKBB 4C57C 1IGIH 1AY1H 3CN3A 3TV8A 4AQ1C 4X4YA 4P0DA 2MRYA 2M5AA 2Y06H 3X12B 3L71D 2XSKA 1CDBA 1SQBJ 2WCSA 4E9LA 3B7SA 4X5XB 4OFDA 4MMXB 2HMID 1NO4A 3KW7A 4NHCH 1WFUA 4NQSA 3RX5A 1DBML 5DURD 1PKQE 4MLIA 2A9DA 4IRSC 4WJ5A 3ZKND 1NBCA 5T3ZL 3BQUD 5D71H 2D3JA 4M02A 2FGZA 3HG4A 1NTKJ 3CI9A 4GXUM 3ZX1A 1MFAL 1D7CA 1KIPA 3HI5H 5HJDA 2YD2A 4M43L 4PI2A 4DT0A 4ENEC 3K71B 3E8UH 4QPEA 3GZOA 1JL8A 2BSRB 2GJRA 1WIUA 1T2QH 2VDRH 3SIKA 1J86A 1L0YA 5I19H 1HKLL 4UCFA 3MCG1 1C1EL 4Y9GA 3MV7E 5I1IH 2IC2A 1NA8A 1I1CA 4ISVB 1RJYA 3HJ0A 3NQKA 2V4HA 4MQSB 4ZMDA 3TN0B 1KD1Q 1ONQA 3TIDB 2WQRA 4LCIL 2H3KA 2XV5A 3T6XA 4DT2A 4IIZA 2HA1A 2GIXA 4HDIB 3HB3D 3BAJA 1P53A 5KZCB 4WW2A 1E5CA 3OJVC 3GUTA 3HN8A 4WFFE 4LBEB 1EPFA 3KS0H 5J5EA 4NNYA 3BOVA 2PXYA 4H88L 1F02I 1SQVG 3KWTA 3P77A 4Y2OA 4NRXA 4Y2NA 3VN0A 1JPSL 1ZTMA 1IT9L 2O6CA 3BUQA 4LDEB 4N8VG 4U6VH 4BSVA 2F8XC 3CXHI 2FYZA 1HIML 5EA0H 5KUMA 4NZRH 3M88A 4LP5A 1Q90A 3II2A 4JG1L 2K45A 5DUJA 2R27A 2MQGA 5EZPA 5SWZB 4PJHA 1THCA 5JHDB 4LCCC 4R4NC 3L3DB 2Z31C 3P8CE 2E27L 4JHAL 1EDHA 1R24A 3OKLB 1VDGA 4TNWK 1GYCA 2TSBA 1AQDB 4N0RA 4K5OA 1H88A 4Z76A 1DBMH 4N0UA 4HK0B 3T0WA 2P5ED 1YY9C 3PRJA 1L3WA 5C0CD 1DTUA 4EIUA 4GG8B 1YMMD 3BHBB 5T3ZH 1QL2A 4HPYL 4WI8A 5D2LF 4IRJC 3JTSA 1J8KA 1CE6A 1S7XA 2APSA 2B39A 2XFXA 3MLWL 3Q7JA 4YDLB 2BEQD 1MFAH 3RB7A 5KAFE 2XV2A 3N0PB 1OPOA 2W65B 3O8XB 2GUYA 4G3YH 4M43H 1N73A 3R0NA 2K3RA 1X44A 4HJ1A 4AXWA 1GW3A 2Q2EB 2K1AA 4IL6E 1RUQL 2NZ9D 3UIZA 3HNVL 5CCHD 1UM5L 4ES8A 4GG6A 3UP1A 5IF0B 2ZX7A 3AQDA 5DEGB 1MJUH 2F5AL 1M90Q 1HKLH 2ICWI 1C1EH 2CHZA 2H3NA 2W83C 2OSLB 2ZOTA 3L7FA 3QCUL 2QGBA 2XKUA 1SUHA 2ZOKB 1VQ8P 3RUGE 1O5DT 3GSUB 3JWDC 4W9DC 4L75A 1HL8A 1V8HA 3BH8B 4LCIH 5TE6H 3FZUD 4APQC 5LKNA 1OF0A 4HFUL 4ODBD 4YHYC 3FU0A 1TFPA 2WSFJ 4U6XA 1NU1J 3G3LA 2ZYDA 2YRLA 2A6DA 1BBJB 1FDOA 4S1DD 3BD4A 4CVZB 1DE4B 3V10A 1KXTA 4S2SA 3KBEA 3W2DL 4NAQA 4JL1A 4R7NB 4H88H 5B1BB 3ARUA 5IP4A 1CO1A 3GSNB 3HG1B 3LZNA 2NTFA 3R2PA 1SY6L 4XB8A 3AC0A 1A9BB 3IR9A 2X4RB 1OAUH 4MYWB 4ZDHB 3VFRA 2JKJA 1KCWA 2ITEA 1M57D 4YSTA 4PS8A 4LSQL 4JDEA 4O5LL 3IEAA 3LTVA 4I3SL 2EUZA 4JG1H 1NCWL 1Q94A 3ATBA 2WJ7A 1LO5B 4GOSA 2AEQL 4E9TA 3LN9A 4I9WE 5AVXB 3LPPA 4KK5C 1YEEL 4JZOB 2E27H 4JHAH 4NM4L 3Q1EA 1K5WA 1UB5B 1FFTB 3EH4B 5LUMA 3ZYIA 2Q2LA 3LXUX 3V4VB 1ZLUK 5H4ZA 2X4TA 4FHJA 3MRNA 3JV4B 3RA7L 4HPYH 4IGBB 1JWUA 3OLGA 5EU6D 3MLWH 4G42B 3S4SG 2AJXL 2YPKA 3CWGA 4IIQA 3HFMH 4MA3A 1RE3C 1YEIL 1T0NB 1RUQH 1AZUA 3TJHD 3HNVH 1UM5H 3FSWA 2PP6A 1UB6B 2HLFD 4ATWA 4FMFA 4NZUL 2Q7AA 2F5AH 4R4MA 3QCUH 5FPIA 4L9LC 4BYHA 4AH2A 2C0XA 5HVWA 4XMVA 1XQ4A 3HR5A 2P5EA 4P2RB 4DH2A 3PCYA 5C0CA 2DQTL 4X6CE 1HSAA 4OLZL 4UMSA 5IFJA 4R7DB 3TGUD 3CWBJ 2QA4P 1YMMA 1BCCG 3EGDA 3K8LA 4K7FB 3NSDA 4HFUH 4EOTA 1NWQA 1FLRL 3LZRA 3ZR5A 3MVSA 1T0MB 5SWSB 4PD4I 4AJVA 4ENZA 4BUGA 1K6QL 4G6AD 1AIFB 3M0DC 1ZSHA 1T5WB 4YDJB 3W2DH 3DX7B 3BE1L 4XMUA 1YQ2A 5CCHA 3G6JE 4XHJD 5F7DA 3J7HA 4P2QD 3IB4A 2C8NA 1SY6H 2DLEA 1U92B 2YPVA 3L9BA 4CNIB 5MERA 4EN2A 1VADB 4DERA 4LIQH 3FU9A 3TPUB 4BFGA 3I3EA 2OCCB 2DWEA 5IW6A 4F57L 3PIQB 4G1EA 3O3BA 3SGDI 3DK2A 4O5LH 4FHKA 3GJFH 2X4OA 4QXUL 2QM8A 2YA1A 5JW3L 1NCWH 3LSOA 4P4KB 1NHLA 2A99A 5HGHB 4Y1AB 2AEQH 1SQBD 5AVVB 4MDJA 5EFWB 4DETA 1YEEH 3WHE1 4R0LB 4NM4H 1VZIA 3TURA 4F7EA 1AO7E 2DKUA 3LHAA 3LMJL 1VQOP 4I77L 1XGUB 4ENED 3GB7B 4BINA 3F8UB 2YKKA 1KJ2A 1AG6A 1AR2A 1EGJL 2C9SA 5D2NE 5FM5M 4HBQA 3CK0L 5GHWL 3RA7H 3TXAA 2H9GB 2Y7MA 3BRDA 3WY2A 4OLXL 2KZKA 4NUJB 3VMNA 2AEFA 1DX7A 4ZRGA 4L73A 4I0PB 1UEMA 1CGWA 2VZTA 2HRLA 3EYVA 4Z7VF 1RP9A 4KKBD 2EDNA 4IOIA 2IF7A 2ZNXA 5E1HB 3QDME 3SDAC 2VKXA 1OQXA 5IJKC 1R8EA 1YEIH 4NENB 5IROC 5LO7A 3BP5B 3K6FA 4GAJL 3CZFA 4UDTA 4J3BA 2EECA 4HHWA 3NJKA 1OGPA 1VAHA 2R2CA 1UOWA 4X6DA 3E6HA 4P9HL 3QR0A 1OVRA 4GW1A 4HJTA 4Y4HD 4AGNA 3WTSA 1UXSA 2Z35B 5GGRY 1YAZA 4K71B 4ODXB 4KDTA 4YHIA 5EULV 2DQTH 3UIAA 5E0QA 1PZ5B 4OLZH 1NCDL 3S48A 5GQBA 5JORA 1HSBB 1M7IA 4UT9L 2EIEA 2G4EA 2IPUK 3N1GC 3APFA 4LT7A 4UOJA 2E9JA 1BVLB 4JFSA 4H0LC 1I8LA 3GZKA 4OCLC 2ZXXA 1FLRH 1QRND 3DO7A 5EU6A 1J05A 2FSDA 4UQDA 3WEMA 4IJ3B 2VITA 1K6QH 1YSOA 4OJFH 1CLYL 2WLMA 4WFGD 3TH4T 3BE1H 1U3HD 3IDJB 3ZO9A 3F64A 3QP3A 4OGQB 3AWFA 3FUDA 3EOYG 5D7JB 5DF0A 5DUPL 4C58B 4PV1B 4W9FC 4B3EA 4C47A 1ROCA 3SDDB 4WW2F 4FG4A 3LRSB 4M1DL 1D5ZA 2E9WA 2X38A 4M7JL 5GGVY 3MRPB 4BE6A 4F57H 3Q1MA 1DVSA 2CBPA 3WNNA 2HJFB 4QXUH 1YY9D 5SX5K 2N7BA 1LEIA 5JW3H 1I31A 1XGPB 1JIBA 5B5EH 4FQLL 2G2RA 3PV7A 3KGTA 3QFDB 3EADA 3EYUL 3KWVA 4UU9A 5PCYA 2JWAA 5ANMB 2ZXQA 3VNYA 3I9PA 1XF4B 1EV2E 3LMJH 4B41A 3L71G 2LAGB 1IFIA 1INEL 3RWFB 3B9KB 1EGJH 3ARVA 4WI7A 1DVYA 3CK0H 3EUUA 4P2QA 4K07A 5DZ9A 3IDIA 4PJHF 2H6PA 3CXHJ 4OLXH 5GZND 1GH7A 1W72A 3GHGA 3T8VA 3RIFK 4D8OA 3KHUA 2JIXB 4KVPA 1OK8A 2CD0A 5TFSL 3CZLA 4YDZA 4Z7AA 2DYRB 3HRPA 3T3MF 3M9BA 5BPPA 1EVTC 4GAJH 1Z9SA 1G9HA 5DLML 3Q44A 3A21A 3LNFA 3US1A 1QA9A 4KZ0A 4NAMA 2EIJB 2D9CA 2O5YH 2LXBA 3C09B 3RILA 1WT5A 3QJTB 2WOBA 1ZE3H 4P9HH 4Y5VC 2ICEA 3LXCA 4J12A 2CK3H 2EEDA 2VQTA 4GO8A 2DM3A 3KCWA 5EBWA 1QHOA 4YHNB 3EFFB 2H32B 3UACA 1NCDH 2AEMA 3LRHA 4GAFB 2WO2B 1P1VA 2HN7A 4UT9H 2C7UB 3JYBA 4RBPK 2SEBA 1IAIL 2XWTB 4U6YA 4GG6F 1TQBC 1GGIL 2ZOOA 2JJLA 4M1CC 5FCUL 5DFVC 4Z7IA 1NU1D 3BPNB 3BRVB 4JFHD 2YD1A 3CDZB 4HS6A 3CBKB 2VLRE 1OW8A 2CQVA 3DTUB 1TNMA 4YDMA 2H88C 1CLYH 2P1YA 2WTYA 1KIRB 3UTPD 3FT2B 3PPEA 4XGZB 4JRXB 1DQJA 5HDQL 2EO1A 4CADB 1J9RA 3NSYA 2ICWJ 5JO5B 2HTLC 5DUPH 4YXHL 5DFAA 4YGVA 2J1XA 3PGFL 4DCQB 2FJUB 3HUSB 2KS1A 4KK5D 4P2OD 3NJGA 2KMWA 3CPLA 3P9MB 4Y4HA 3GTVA 1RZKC 1F97A 1ZVSB 4L4TE 4LLDB 4MFHA 3PJSK 4F7KA 5EO0A 2E86A 4YSDA 4LPTA 2N1TE 4UZSA 3LN4A 4OJYA 4ZAKB 1R3IL 3BJLA 1UHVA 1LT1A 3FT1A 3MV9B 4EUPA 3GW6A 2XY2A 3FOMB 1BV8A 1ZDQA 3KH4A 1KTCA 2EO7A 2QKIC 2YUWA 2Q76A 3V55A 5L9DL 4HS3B 1JNHA 4XX5A 1QRNA 3EYUH 4F3FA 1GHFL 1J1EC 1ESOA 3W0WD 1XF2A 4A7SA 3FTVA 1XBRA 3HPLA 5CMAB 4AUWA 4BFJA 3VWKD 1INEH 3MACL 5CKGA 1U3HA 3INOA 3SKNB 3HUJE 1LILA 1SDYA 1GGYA 1SLQA 1FO0B 1URIA 3N4XA 5LAXA 4U0QB 2XWBB 4YHOL 4EJ1C 3ARTA 5TFSH 3QEQD 3CN2A 4MQTB 2V2TA 1S9VA 2H26B 4AYFA 3ES6A 2WLIB 1ADQL 3BXNB 1U93B 4AYGA 1SM3L 1I1YB 3OKKB 5K9OB 5A2IH 3CHPA 4NXSA 4A7QA 1KV7A 2QSQA 1R4XA 1L0PA 1LQBC 3IU3B 4U1GB 1E65A 1K3IA 3HAEH 4LCUA 2GUOB 1PZDA 2DAVA 4P9HC 2XI9A 4ZW7A 4G8FA 2YKQA 4R4BB 1DQQA 2VWEC 5E6ID 4X99B 5MENE 3IKCB 3CWBD 2WXQA