5AVVB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avvB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avvB02
3P8MC 2WTYA 3HE5A 3O8ZA 2IPPA 1H89A 3WGUB 4AQRD 1FAVA 1HWTC 5APXA 1HBWA 1X8YA 3M0DA 3T97A 1IO4A 3UIAA 3I5CA 5AW1B 5CMZA 2QM8A 5APVA 3VMYA 3WGVB 5AVRB 5AW2B 4C7NA 5AVWB 4I6MC 1SP4A 5AW0B 1FOSE 4LC1A 2R3CA 2YNYA 4JYBA 2WWWA 2P2UA 3A2AA 3B8EB 1A02F 2QM7A 5AW7B 3A5TA 1J2JB 3M0AA 2P67A 1CI6A 2WT7B 5AVYB 3TNUB 1GK4A 4DZOA 1S9KE 4C7NB 3NFQA 5APTA 3KQGA 1OXZA 4XE5B 4KHXA 3VN0A 2C9LY 5AVTB 1JNMA 5AVZB 2Z5IA 3L36A 2XZRA 3TK1A 1HUCA 2KP8A 1MFZA 3M91A 3TYYA 2C9NY 2WPSA 5AW3B 3M06A 3VYIA 4M3LA 3KDPB 3NXSA 1T2KD 5AVVB 4AYCA 4C46A 3M9HA 3VTPC 1CZQA 1GU4A 2XU6A 1GZLA 2W27A 2R5DA 2BASA 4RETB 1HJBA 2Q3IA 5AW8B 1SLQA 2WPQA 3HE4A 5AVQB 5AVXB 3OAKA 5APSA 5APYA 2JJLA 1FOSF 2W6AA 1NWQA 3V4QA 3A3YB 3P32A 5AW4B 1A02J 3V4WA 1GTWA 3L37A 2ZFCA 5AW9B 2YO2A 1H8AA 3L35A 2N9BA 3LIDA 3NTNA 2Q5UA 4JYCA 4I2LC 5APUA 1NAFA 2ZXEB 5AW5B 1H88A 3TNUA 4HYTB 3V5BA 2WPRA 1CI6B 2WT7A 3P7KA 2P7JA 1GU5A 1DH3A 2E43A 1G2CB 1GK6A 1MUUA 2VRSA 1GD2E 4B86A 2H7HA 1JUNA 3SWFA 1CSBA 3HE4B 5AVSB 2R32A 4AUWA 5APQA 2Q7CA 2Z5HA 3MD0A 2XV5A 3M9BA 2R5BA 5AW6B 3VMZA 4EOTA 3VMXA 5AVUB 4GT1A 1MV8A 3LIEA 3IR9A 1YYCA 3A7OA 3MGNA 2YO3A 3HTKA 4GKGA 2E42A 1S9KD 4RESB 1OWAA 3HE5B 5APWA 3NMDA 1KQLA 1T2KC
chains in the Genus database with same CATH superfamily
2OMTB 5AUMA 2EXTA 1INDH 1PNDA 2H26B 1UD3A 2CJSA 2YBRB 3RZCD 2ADJB 3LIZH 2FYYA 4KZEH 3X1EA 1ZGLB 4DK6A 4PSPA 3VACA 3WFBL 2Y72A 1ZLVK 1C12A 4NM8H 4HJEA 1L0ND 3NH7L 4KKCD 3UC0L 5A3IC 4PJFB 1JK8A 3HUJF 4OF5A 3QIBD 4G6MH 1B2WL 4K7PY 1JGVH 4NRZA 1TZIB 1IJDB 1KIUB 4UINL 1C5BH 3LH8A 3NACL 3B2DC 1XO8A 5BMFH 2Z92A 3NFNA 4K94C 1VFMA 4FABL 5IG7A 2A83B 5CBEA 5AB2A 1F02I 2R9HD 1ZSDA 1VQOP 1RUPL 2QJYC 1UQSA 4O9BA 1T80A 3QUYD 4P5TC 5F93C 3MOAL 3S4SA 3NSXA 3QEUB 5E94A 2R2BB 2OK0H 2EH8L 1G7IB 5IK3B 3TYYA 1ND0A 2IG2L 3PAUA 2HLOA 3D18B 3CCLP 2CO4A 2ZCKH 3NXSA 1NKOA 1HS6A 5GHWL 5C2UB 3H1LD 1K4DB 4UB0L 4ZUTB 5CJBA 3LXUX 3LRSB 3NIGB 1KLUB 2GHZA 2A9DA 3CX5E 1KYOK 3WJLA 4I9XA 3ARSA 2BHZA 2ESVB 3ESUF 4Z76A 3GJFB 1L4AD 6TAAA 3AY2A 4MD4B 5H2BB 3WL9B 6PAZA 1AKPA 2CDGA 4NUGL 4PJ7F 1YYMH 2UUDK 5T1MB 3QWRD 2PYFA 1OPGH 3HC3L 2RKLA 4LLQB 1EDIA 1HYRC 4PJ7E 4U6TA 1T03H 3KPOB 4Q2ZA 3NCMA 5E5LA 3VVWA 4ZXBA 2P1YA 3MUZ1 3ULAB 1DVTA 3ZRCC 2JIXA 4LSUH 3WS6C 4CL7A 3TNUA 1NINA 2EKSB 2G60H 5SWSB 2D7NA 4ODWA 2CUAA 1PAMA 5B7MA 4AZUA 2E43A 4LSSL 4OZFA 4QDGA 2BFGA 4FP8L 2IFFH 3KXFE 3RNKB 4GMSH 4A37A 1NCBH 2VDQH 5T3ZL 3S6CA 2R39A 2YQ2A 1PP9G 4RGND 4Q52A 1OP3H 3S9DB 4N2EA 2WSPA 5EDXA 4J3UA 4L1BA 4JPVH 5IHBA 2K0RA 3D25B 1JZIA 4OLXL 3T0ED 2QKIB 2A9AA 3K3QA 3VXNB 5I0YA 4L73A 4JO8A 4RSVA 4PLKC 4HQQL 1MHPH 2VXVH 2OW6A 3KLQA 3H0TA 3NIFE 4JRWA 5L4FA 1ADQA 1R5VA 1BXXA 1YEJH 1JDCA 4RESB 2BWQA 3GLEA 4HH2A 4XVTH 1KTCA 2IOOA 3P8MC 1I8MB 2LU4A 2YAOA 2FJHA 1CC3A 4G72B 4NWTH 3DO7B 1BPLB 1N6UA 1YNKH 1T3FA 4M6OL 2Q9IA 1VFBB 3HZKA 4EI5B 2K9FB 2WTRB 5APVA 3QSKB 4X7EC 1S7WA 3GBLA 4ISVA 1X6NA 2OJEB 2WLHA 2Z1PA 4ZTPL 1P5UB 4RIRB 1ICTA 2VKWA 2VYRE 1MLCA 3SYQA 3HI5L 4P2RA 3UBXI 2E9JA 4G6JH 1UCTA 5CIPH 1TNMA 3H4FA 5BS0A 3F2LA 4XP6L 2EUWA 1URQC 1FC2D 3LSOB 5E9NA 4HC1A 1PX4A 1D6VH 1PTZA 2F68X 2HT2C 2OJZH 3G6JF 3NJVA 2G5UA 5KUKA 1NOFA 1EFXB 5INCB 3PAYA 4NQTA 2XZRA 3LRMA 4YPJA 3QISA 2J71A 2D73A 2NX5D 3ZHLA 3QWOC 3EYSH 4JZJB 35C8H 3T65A 5BRZE 1R75A 4L5FH 3M06A 2I25N 4P59L 4BV1A 5KJ7D 5I6PA 2VZVA 3HMXL 3SPJA 4PJ6A 4TVSa 3TF5A 2XVBA 1RP9A 3QUML 3VE0B 3QFDA 4PWIA 5CS7A 2G0LA 1EHLH 1KB5L 2VQUA 1KELL 4ANVA 4IFDK 1CUOA 2E7DA 2HB0A 2JKNA 3N85H 4Z7UB 4XN2A 4C56A 1OP5K 1PZAA 1NDMA 2XVGA 2IPUK 5HDRA 2B1AH 2KKQA 2VLME 5KS9A 4UM8A 1MRDL 2Z91B 3NCEB 3O6KH 5D1XA 3H1HJ 2FGWH 4I3SH 4MMZA 4W6XB 2DTMH 1J1EC 4GAGH 2ZFCA 1L6PA 4HVBA 1MCLA 3B5GA 3GZPA 2JR8A 4KJQD 4U6YB 2R0ZH 3QAZC 3PHAA 1TIUA 2Q5UA 1EZVY 3PWNA 4FQIH 5GGSA 2NDGA 3HPLA 4KK9C 3A4DA 3LHPH 4O9HL 5GZOA 5KW9L 5DJ2B 4AYFA 4X6BA 3TX4A 4D8PB 4CKQA 4P48A 2LQRA 1JIBA 4PUBH 2G2RB 2LT9A 2CGRL 5F3BB 3IFMA 3UX9B 4B27A 3F6LA 1WLHA 4X7DC 5FIEA 5GS2H 2B08A 3EO0B 4QO1B 3LY6A 4NAMA 1HJBC 5D1QC 4AUWA 4HOMA 1KN2L 2X4NB 4LLDA 1E5UI 1TQTA 2AAVA 4MXQC 3V4PL 2MNJB 3BC9A 4XVOA 1EHAA 1Q9LA 4JAMA 1XTMA 4N9GB 1R3JA 3CIAA 5LGHH 5TH2A 3CFDB 3ULSA 5CD3B 4TPRH 5E1HB 3UDWC 1H3WM 3NMDA 3TNNB 3WIFA 2VZSA 4FXKB 1LE9A 4D0BA 4HKJA 3OQ3B 4RDBA 3RWHB 4HJUA 4YGVB 2GUSA 4CRPA 3OX8B 1OAZL 3FT2B 1M7LA 4AK1A 4YO0A 4F8LA 1I7TB 2KUBA 3FQXB 4F7MA 4JPWH 2M5AB 3OXRB 2OR9L 2YGOA 4IIQA 5EUKB 3P0VH 1NTKG 3RDTB 3QBTB 2JKWA 4GT7A 4HUMB 4GBXC 1KWGA 1A6UL 5AYTA 3NESA 4LDEB 1U95B 3Q9PA 1U2YA 2ZOLB 4EVNB 1QFHA 2FX9H 2ED7A 2H1PL 3WY1A 1UB6B 4JFOB 2XPGA 5FYKU 2WPVB 1TPXB 4TN9A 4FNPA 5KJRH 5IMLA 3A5TA 1S7RB 1LO2H 3ATEA 2J88H 4A1RA 5AVYB 1XTCC 5CLXA 2NY6D 2IDFA 4JRYA 4JLRB 4UT9L 1M1XA 1LT9A 3WV0A 3BQVA 3EYQC 4N2NA 2ZSWA 1KGYE 1KGWA 3TZVB 2PLTA 4G7SB 2XG5B 5DTFA 1IC1A 3L36A 3O8XC 4FNTA 3T6WA 4I3GA 4Z95H 1Z3GL 4JKKA 3LVTA 4DP8X 3GQFA 1RH5B 4UQ9A 4R97C 2HUEA 1I8IA 4JG5A 2RCSL 2XQYK 3RGHA 4P2OC 4H13C 1DJYA 2I1KA 2BCCG 4MN4C 3PAVA 3UP1A 5ALBL 3VWJC 2ICWI 4Y9GA 2G9KA 1N3NA 1FP5A 3O0RL 4QXGH 1JVOA 5DEZA 3WLBB 4Y0GA 1KJ2L 5EZJB 1NCDL 3SDDB 5TDOA 2Q3IA 3SDXE 4R3SB 3TTSA 4PB9L 3D6YA 1LO0L 1KNOA 1GYVA 3TYGH 1DBBL 4AYMC 4YHNB 2FO4A 5FEBA 1ZA3A 3QNXB 2BWDA 1G9MC 1R0AL 1G7MA 4R7NA 1SOQA 5A6LA 3T0EE 1MAMH 4HS6B 1IK9A 3CX2A 1GCYA 2GA1A 4Y4KC 4IRJD 1VKXB 3D2TA 1H3GA 3SJVA 3DV6A 4G8AC 5AOIA 1CDBA 3L3GA 3WCYA 1S8DB 4LVHC 3AXIA 4R4BA 4XVJH 2TRYA 1SHSA 2PYED 1HU8A 2I7SA 3LKQB 3N04A 3WFZA 3T2PA 2OI9B 4JO4L 1CI6B 4PD4D 2IC2A 3IPBA 3WJJC 5C08A 3DNKA 2FYUG 1T21A 2PFXA 1NOHA 3GXMA 32C2B 4FG6C 1KWKA 2PPDA 3NCCB 4KJYA 3NN8A 1BBJB 4KMTL 5ICZA 1EGJH 2X70A 1L0LE 4XMPH 2KNCA 5E08L 1NTKD 1GYCA 2DQUL 4BH7A 1RU9L 4XNUL 4Q9CA 3Q3GB 4N0CD 1ZTXH 2K45A 5B39G 4UNIA 1I3GL 1D7DA 3TXAA 1XZ0B 3MUY1 4Z7QB 5KVDL 2UY7B 4JCLA 4BUQA 1XF5A 4DGYH 5IBUG 3HC2A 3VVVA 3C6LC 1EIBA 4RO0A 1OF0A 1KGIA 1YEGL 3GBML 4G80A 5GRUL 2BOCB 2J5LC 4AL8L 4GW5B 1BVZA 5BQ7A 4R4ND 2WIIB 3EZJB 2WAHA 3NGBC 4YE4H 5KWYC 4P9MH 4Y4KD 4B96A 4YZFE 1EDJA 2IGFH 5BCAA 2UZPA 1SLXA 4C7NA 2DW3A 1PU0A 1HDMA 1Z7JA 4YZWA 1BDYA 1P4IL 1G6RA 3ARFC 4KKQA 4ZZKA 1USQA 4XP5L 3SPIA 5FECA 1UGKA 2QVAA 2R8SL 1TJMA 3RGVA 1M6OB 3DIFA 5JPMC 1AP2B 1YLBB 2W59A 3KPLB 3RIFF 1OHQA 4UOW1 3IMVA 3F00A 3S48A 4GP5B 1NCJA 2WSCH 2V2XA 3VD1A 1YUHA 4ZS6C 1WZ1H 4GY4A 4K2UL 1NL0L 2CSPA 3P1VA 3RPIB 2VDPL 2J2ZB 4L8SB 4WI3A 4EN2A 1HHKB 2F54B 2O61A 2IPTL 1ADQH 3ZE0B 4X6CA 3S4RA 3QG7L 4AV4A 3C6LB 5D5MB 2JJSA 4Y9EA 5JQHC 4PJBA 4ZNCA 4OD3L 1N7SA 3UMTA 4GRWE 4PGEA 2DPKA 3KDPB 1M2VB 4NPDA 5T5NG 1F5WA 3STBA 5K9KB 2GY5A 3L75J 2ICWB 2FT8A 4H8VA 4X8JB 2BSTA 1TITA 4M4RB 3SKUD 4KTDH 2NZ9C 4MNQE 3HFML 2G3ZA 2DM3A 3ZDWA 3NSCA 1EDLA 5EBMA 4TQHA 4PW4A 2LLLA 4UNTA 3K2KA 1PFIA 2YPLA 3ARGB 5DQJA 1S7SB 1EMTL 2B77A 5E8NA 3FT3B 2YO2A 3QIBC 4K8RL 4JL2A 3JZYA 3T1FA 2VR7A 5TPWH 4GOFA 3GF8A 1F6LL 1UM5L 2DQCL 5E8PA 2ZKXA 5JDSA 3S37X 1GJUA 2HH0H 3CMOH 5AQ0A 5MEOA 5AOZA 3TIEB 4KAQL 3WIIL 5INDB 2WB1A 5I16A 2XN1A 3WMPA 4R4FH 2ZXXA 1W6LA 3MBEC 4QRAA 5C70A 4DGYL 1NM9A 3UTQB 4CVXB 4CMHB 3EH1A 1YEDA 4L8BA 1GW0A 1CLYH 1UWXH 5DS1A 2JI2A 4EKXA 1PP9E 1FBIH 1YMME 2D4DA 2DJMA 2ZTBA 1G1IA 1JV5B 2X6UA 1P69B 4ALAH 1X3DA 2YGNA 2BZCA 3B9EA 4P2OA 5DU7A 5HI4C 1H6UA 3L73D 1TTRA 2HUHA 5C6PB 1CDJA 4GPVA 5JXEA 4NCC1 4MNQD 3ULVE 3JWOL 1CE1H 2W60A 4F1ZA 1X5MA 4QR7A 3KWTA 3IMRA 3KYNA 2FK9A 2J20A 3UYOD 2C9PA 5GS0L 1E5CA 4PJ7A 2EEBA 1DVFD 1VZHA 2YD4A 2FFDA 2Z9TA 2EZ0C 4LLUB 2CMRL 1RAMA 1NGXA 2ZXQA 4Y9CA 4EF3A 4PJCE 4JBSA 3P30L 4NZRH 4FTDA 5FW8A 4DKTA 5CBAB 1AXTL 1D2PA 2YN3A 4NQEB 5I66B 1L0YA 1MPAH 2GPZA 3KW7A 1AKJD 2WMMA 1HNYA 4JFYA 2F1BA 3RVVD 1IEHA 3RGVD 1VQKP 4K9JA 3WD5H 1YQVL 3L17A 5LBSL 4OCYH 3CPUA 2Z35A 4QLRA 1IL1A 4OZFG 1XFPA 1YC8A 2K3TA 4NEHB 3ROLB 4D7BA 3MGTB 2RCSH 4CMMA 3GJFH 1S3KL 3ABZA 4UIMB 3IF1B 3M91A 4UB6H 1NUFA 4PRBB 4DP6X 4AIZA 4RFNB 2OYIA 1AD0B 2OMWA 4LCIL 3FCUB 3RG1C 1ONQA 3IETB 1SJXA 4WW2B 3H1JE 2DKMA 3JVFC 4KUCF 4P4KB 4Y5VA 1IKFH 1A7RH 4N8VG 3EJQA 3BFWA 1DVFB 1PZUB 3B7RL 4NYLA 4BZ2L 4MSWB 5SV4A 2EDLA 4XZUA 4RETB 1U93A 1M90Q 3BCDA 3H42H 5SX4H 1Y8AA 4UB0H 4PR5A 3VXUA 1R3IL 5D93B 3BAJA 3CZNA 5DZNA 2P24B 2FB4H 1IGJA 2YXRB 4PRPE 2NW3B 4E5XA 4KROD 1NFIB 1PQZB 3P9LA 3QO0B 3REVA 4E9QA 2OMXA 5EUOA 4RCAA 4NC1E 1RZIA 2EEFA 1OB1B 4X4MA 5HHXH 3MREA 5EZLB 4PGJA 3BAYA 2N9BA 4H2AA 4IBYA 4NSKB 4YSDA 4ADJA 3LNDA 3ZE0F 5I1CH 2YAPA 3ILEA 2UXVA 4Y5YA 3D0LB 5LBSA 4P2QB 3KVPA 3S5LA 1WA2X 1W5CE 3PGCA 2SODB 4OB5L 1DQMH 2YGVA 1NTDA 3T2OA 4UYPA 3PTZA 5AKTA 2NY0D 5AZEH 5IFAH 3ULVC 1UOVA 5DK3A 3U4BH 4F3FB 1AQMA 3MCLH 3PG2A 4LRNL 4QMAA 2J25A 1SQPE 4XN4A 3VMPA 5C0FB 1O75A 4OVUA 2ZJSE 1JPSH 2CBPA 3L75D 2Z34A 5I76A 2WWMD 4BXSV 1KCRH 5B3JE 5HY9A 1INQA 2XTSA 2GCYA 4EN3A 1ZR4A 5KSAC 4GT1A 1UH3A 2CPBA 4OD2B 5CJXA 1I1FA 2V7HA 3KYQA 2XWRA 5E7BA 1BM3L 2ARJB 1UZ8B 5LGJB 4PJAE 5JIHA 1UOKA 2DMHA 3RWGA 3NCYP 5F7NC 2LTQC 2R29L 3CX5D 4OV6F 3FQWB 1RZFL 5BVJB 2X2HA 3KXFA 1IUZA 3IJSB 2WXOA 2XZQL 5D7JA 2NW2B 1A66A 1FZAA 4PHZA 4WTZG 3AGWA 4PD4E 3BVNA 1Q7YQ 2DL9A 2VLMD 1RJYB 1KPRA 1OGSA 1S7TB 3LKPB 3QJZA 4GH7B 4ELMA 1IGFL 4I6MC 25C8H 4H44D 5CBNA 1UACH 2OPCA 3QEHA 5D4QA 3RFRA 5GS1B 3VQLA 4Y1AA 3V6BR 2GI0A 3VRLE 3T09A 3K71A 3MRDA 3VOPA 3RUGE 1PW3A 3VXMD 1BZ7A 1DO5A 1NU1K 5L2JA 1ZLWK 2WZ0A 4U3SA 1AG0A 3CXFA 4O2CA 1XR9A 3T4YA 5AWNL 1FNEA 2DDQH 2YD9A 2E3VA 2VDOB 2XKMA 1LTJC 1EEUA 4J6RH 3CZFA 4JS7A 4M9OA 2YQBA 3PRJA 3BLPX 3FJTA 4HPOL 4LIQL 1T22B 2EYSA 5E56A 5KSUA 1NAYA 3VU2A 1S46A 4PJ5A 1JNHA 3POHA 3ZOAA 3L7EB 3A47A 2IPKB 3CDGA 2BC4B 3DJZA 5TQ0L 2N3JA 3VGAC 1AQ8A 1CT8A 2R4SH 4JM2B 4OKVA 1A4JB 1BVNT 1E40A 1WZAA 3QCUL 1BWMA 2IWGA 3PP3H 4NLHA 3CFMA 4IRSB 4MB1A 4R9HA 4CU8A 1BF5A 1RF0A 1L6ZA 5DQ9B 4N1EA 5D2NC 4N8CH 2D7OA 3KPRB 5IFHH 4NKOA 4N2MA 3RZCB 2VLRE 1RKRA 1FFNA 3UZEC 2H5UA 1U58B 1RURH 3EDJA 4G71B 4LSRL 3ZHKA 3CLWA 5CWSB 2VOTA 4B41A 5LXVA 4S1QH 3AROA 2QZQA 3N42B 3MLTB 5JPNB 4G3YL 4YXDC 1W72B 4MCYA 5AD0B 4OF8A 5BV7C 3OV6A 3FGAD 4XBGB 2JTDA 5JW4Q 3DX6A 3MV8D 3A0OA 3GXPA 2KHAA 5C8JA 3D4GA 3CN0A 3ZUCA 2G4GA 4LPUA 4WO4B 5JYMA 1KGUA 1CXFA 4X80H 5B1KA 2OULB 5I9QC 4Q8BA 2OYHC 2CPUA 3G04B 4X7SH 1OAQH 2PPAA 5DJTB 4YSUA 1MCWM 3ECQA 1YJNP 4XO5A 4TTGA 5EORH 3BCFA 2FWUA 2IAMA 4N90E 1QSFA 1DQJB 4G1MB 1G6RL 4NQCA 5D2NB 1IGYA 3WFDH 2WUBH 4YIQB 1YEHH 3V6FA 5I0ZA 4NNXA 4ZQTA 4KZCA 3H85A 4ORGB 4PM1A 4GT0A 4L4JA 1MCCA 4XWOD 1GC1L 1U8KA 4M3KB 2P26A 4M6NL 2IV8A 2VDQL 1NC4A 4NB7A 2E42A 4HXBL 4LHUA 4JZOB 3UP6A 3QB7C 4XNYH 4WY7L 3DDGA 4ZK8A 2P42B 3RHWF 5CJ8A 4JQ0D 3VRIB 1T2KC 4JR9H 1Z66A 1XGYH 3P4LA 2V5MA 5GS0C 2XWTA 3SDDD 3CQPA 4F9LC 3W37A 4I1NB 3L5HA 4EI5C 1ZT4B 4U1IA 3NZUA 4PV1D 3LYRA 1XF3A 3HCVB 4LLWB 1N19A 2KDGA 3QR1A 1JY3N 1ZLSH 3O0RH 1CJYA 3SGEH 3VXPB 1MCEA 2Z3FA 3FH5A 4XCNA 2AC0A 2GK0A 3IDNB 4BWWA 4XNDA 1JF1B 2N9YB 4B60A 5CU9A 1KYOE 3CX5K 2V0AA 1AD9B 4Y1AD 3AEAC 4U6VH 3S2CA 1QR1A 1MAJA 2CXKA 4HCIA 4MKMA 3LV3B 2ZXAA 4QD2E 3ULVD 1H9VA 3FFCA 4FF9A 4DEUA 1WC7B 1PZ5B 2O5YL 2NUPB 1LEIB 5DD1L 2IVFC 1BCCE 1DHKA 4IGBD 2KLSA 3PWPD 2HZHA 3L9RA 1SBSH 5J13B 5E6YA 3KH4A 5F1NA 4KI5E 4L75A 1AQ5A 4IIZA 3QWOB 4GRLD 3IGAB 4LF3B 3W11C 1GSKA 5ABAA 3WNPA 4ZMWA 1KN7A 2PR4H 4PU2A 4UOJA 4NUJB 1YNLL 4PWEA 4FKKA 1JD9A 3B2UC 3CSYB 2EP6A 1U8LA 2DS4A 3QIUA 5FFOA 2FSDA 3QORD 1M1JB 1AGBA 4L9LB 3AE4C 2H3XC 4EOWH 4TUJB 4Y5VC 3O41B 3B7YA 1U57A 1TKWA 5CINL 1AZRA 1VQ4P 2WD0A 5HVHB 5APYA 4JKPH 2IH8A 1RHHA 3I2CH 4JO1H 5HGAA 3TT3H 3WTYA 3L4YA 1HSAA 4UNUA 3RP1A 3B9KC 1JTOA 2JV6A 1A02N 3N2JA 1BBDH 5CGYD 3MLVL 1C9SA 5DF0A 5IR1B 1F86A 1ZIAA 1NFDF 3VFOA 2UUDH 2UZYA 1MJ7H 3UTOA 1R5IA 4GOEA 5FR3A 2SEBB 2GC4C 3FUIA 1EHXA 1NFDE 4YHLL 2FGWL 3KDMA 2FYUE 3BISA 4G6KL 4WWKB 2Z31A 1EO8H 2P44B 2CKBA 1JOCA 1OF2A 4ZBJA 1JUNA 1QLEL 1NCCL 5LJYH 1TJHL 4ONHA 1TOXA 2ITCA 5D6DC 3VFTA 4GRWB 3UCRA 1QTPA 2DYPD 3DETD 3VQ1C 4J8QA 3ZDMA 1JGUL 3IKCB 4UNVA 2Y6TE 3SDDC 3FTGB 4GKZB 4NFBA 3BQUA 4R84A 4WDIA 4XBEH 4XOCA 4UQDA 5F9OL 1XIWD 5CLZA 4EZLA 4DETA 1JM0A 5KVGL 4KZEL 4KTYA 4LSQH 1R46A 5D1QD 1SDDB 2X4OA 4BFFA 2D9CA 3FSOA 3RVWC 3U0TA 4CW1B 3FT0A 5CJQL 1MRFH 1D9KB 2EKJA 1CG9A 4OQTA 1D3CA 2NLJB 2L91A 4NZUL 4V2CB 2Q8BL 4K94H 2XN9B 3I5CA 5CUSL 2ZUXA 4PJXB 2IDBA 1U8JA 3MA7B 4JFHE 3U0WH 4ZODA 3ASWA 4GMTL 2QV2A 5JW3L 5FOBB 2J58A 1VHPA 1RZJL 3D50A 4WAFA 1MH5B 1A7RL 4OR1A 2M0BA 1A7QH 4UQ2B 3SGKA 5I17B 1SY6A 3BIKA 4NWUL 1KYAA 2L7UA 1XD0A 3LHPL 1TZHA 4LGPB 3JWNH 3UBXB 1Q72L 4A67A 2C3WA 2QEJA 4PIBA 5AW7B 1NTMD 1T04B 5DUML 2J72A 4YEFA 1EFXD 1NEZB 2XBTA 5I6NA 3I6SA 1JXFA 1GZHC 3RKDC 4W4OA 1H0DB 3RIFK 3IDGA 4HUXB 4LAQH 2FX9L 3RAJL 5EG6C 4OUOA 3ZDXE 1SQ2N 3PHQA 4OIIL 1L6XA 1U4FA 3PJSA 3QCUH 4JFDE 5E8DH 2LKMA 4JKWA 4F27A 5IV2A 4APXA 1R3LB 4KVCH 4XH2B 3WIHA 1Y0LA 1EXGA 4LSTL 3D71A 1GZQA 3OKOB 1DN0A 5IVZA 4Z7OF 1BVOA 1U8PB 2WXNA 3UAEA 2JKSA 3B2UD 3GSQB 4LVNB 1IBGL 4PJIE 1J8HE 1ZP0C 2XWEA 3N50A 2F6AA 1EJ8A 2BOBA 4HU2A 3WJMA 5TJWK 2H6OA 3QUMA 3WLWD 2CALA 3T5WA 5DHVA 5B8CC 2BNRD 3NA4A 3G71P 3I50L 2X6CA 4NWTL 2WBWB 2JJLA 3H3PL 2WO3B 4L9DA 3B2VH 3H1ID 1NWQA 4Q6YA 4LIQE 3JTTB 3C2SA 3QXDB 2Q76A 4DERA 1A6AA 5L8JB 3VFMA 1YEWA 5HPMB 1S9VB 1N70A 3CAFA 3HZVB 5FGSA 2QJDA 2NSXA 4JY5H 1JGEA 3BPCA 4I0PC 1FC2C 3VI3B 4IOSD 4QRQA 2AV1B 4LVHB 3IU4L 5EORL 1QI5A 5E1AA 3HI5H 1S7UB 1WFOA 4IYKA 3AWGA 1BE3G 1XSIA 5GS3A 4HYTB 3V5BA 4HPYL 1RJLA 5EMYA 1MI5D 2A06D 2ADGB 2UY6B 4A7UA 3RGVC 2AXWA 4TSCH 4NUQA 4RMSA 4GBXD 5JW5A 5C07B 3HRZC 4GIAA 2BINA 4J1UA 1L0LG 1M56D 2YEQA 3PWLB 1DQLL 4KGLA 3V4VB 4PMEA 2IDSA 2YRBA 4MA3B 1JZ3A 1FC1A 4R2GC 5DRWA 1FN4B 1L5GB 2JB5L 1F6FB 4J3XA 4X9FA 5FFGA 1TTAA 3VFUA 2A6DB 3E7KA 3QH3B 1FDIA 1MWAB 3D7PA 3FAWA 4LEBA 4WWID 4J3WA 2VL5B 2WKGA 4OF6A 1KJ3L 1UVQA 1DO6A 1N73B 1WS7A 4JKPL 4ODVL 4P05A 1ADQL 1DCLA 3T8XA 1UC6A 4O2EA 4Z7VA 2FL5A 3H1IE 2IH3B 3P02A 1LE5B 1HXMA 1UH2A 2BSCA 4P5TD 5CCHE 2DI9A 3UL4A 1L3WA 2NYKA 1HL4A 4D6TE 1T2QH 3CFCL 3IPFA 1EO7A 1VADB 1LTAC 4NQDB 3KLDA 2CH8A 5KYWA 4QT5B 4WFFE 4WLCA 4U6VL 5DJAB 4A7VA 1MW1A 1F1GA 1IEBA 5IFJA 3P8CE 4TRPH 1HC1A 2ICEB 2AGJH 1W9XA 2OP4L 3ARBA 1U8CA 1OWRM 3WO4B 3WN5C 3QUYB 1KEGL 3EZ8A 5E8EB 1LDPH 1QRNB 5DUPH 4YTPC 4OD1L 1RUKL 3IMBA 2WVUA 4JM4H 4LLMB 2AABH 3BGAA 3D12B 1KXTB 3JUYA 4ECNA 2WXRA 5IROA 4HU8A 4EZMA 2YUXA 1H8LA 4KNTA 4W7YA 1KLGA 2HG5D 3H8NA 5BO0D 1CZ8H 3L75E 1F3JB 1R17A 6FABH 4DKFL 4KJPC 1PDKA 1EPFA 4TVUA 3JWDH 4EI6B 5I8KH 1DVUA 1I9EA 1A1MB 4BRYB 4NI3A 4LBEB 3BP6B 2OTPA 2VM9A 1I1YA 1AMXA 3DSNA 5GSRB 4CA4A 2ODHA 4QEGA 5D7LB 4HS8L 2EVJA 5KLVJ 4XP6H 1LO3H 2HYMA 1A1NA 1L0LD 2BVQB 5EF3A 1AKJB 4XVSL 4J3TA 4LDOB 2QFPA 5GGVH 2Z0UA 3UERA 2X9XA 4XNYL 3Q8CA 4DWHA 3VMAA 1OSZB 3GSNB 3MRQB 4QHKJ 4Z23A 1MUJB 4B9PA 5F6IB 5FV2A 1QRKA 2E8ZA 5A16B 4X4YA 3ZRFC 1D7MA 4HT1L 3NOIA 4EDWL 3CN3A 3QC6X 3P7KA 4LT7A 3MNWB 4WU5B 2JKLA 4F58H 3CC2P 3M88A 4QRRB 1AE6L 1CSBA 3RX5A 5DFVD 1HWGB 1MI5A 5D1QB 3BH9B 3MZGB 4ZS7L 4GBXA 2ATKB 4FYSA 5EFIB 5AAWC 4L3EA 2WZ7A 4X9IA 4AGOA 1IM3D 2LGNA 3UIZA 2AJVL 3BIBX 4FAAB 2QKIC 4QRTA 1V5JA 3QWNA 4M7LL 1ACXA 2HR3A 1UD2A 2D3VA 2YFNA 4WCYH 4XO4A 5E95B 3QA3A 1NBZA 2WV3A 4QHLB 3P11L 3FO9A 4QRBA 3LS4H 2FGZA 3BSGA 2EJ1A 3OMZA 3EOAA 2YUZA 3BT0A 3HE5A 3H1IJ 3PJNA 4NKDB 5BZWA 4WWIA 3GHEH 4DEWA 4KDTA 1FO0L 2IO5A 4MAYB 4MNGA 1DANU 2CHWA 5C0CD 3TEYA 1QO3B 1NM4A 4QXVA 1KJ2H 5EOCH 5K1JA 4Q97A 2JB6B 3DMMD 1J5DA 4Y4FB 4WUUB 2DQMA 2CAKA 1KGCD 4XO9A 5DD0L 5IHZA 3LZPA 1SXSA 1DEEG 1NKRA 2DQGL 2AEQH 1P7QD 3QZOA 5KN5B 3H6PA 4GMSL 3SKNA 1NGWA 3EJZC 5C6TL 2KZWA 5FLUA 3MRLA 1HZHL 4RAUA 4X4XB 3HJ0A 3D3VE 5HGDB 5ICYA 1A7QL 5C09A 1CZ8L 4HA1A 3L4VA 2IANA 4NO0D 5JMRA 1U8OB 4KX8A 4UZUA 1XF4A 1FGNL 3JTSA 4OF0A 3SE3C 4C4KT 1FFRA 2AK1L 4X7TB 3B8YA 3G9VA 3C1LA 4YXKH 4YXLL 3SBPA 2ZNWA 1WT6A 4Z7NB 2KZIA 3ASOB 5C09E 3S96A 2DB8A 2VN6A 2ZX6A 4TS6A 4MMZC 2F15A 2WYIA 4D0CB 1OD7A 3UGUA 3MJ8A 3Q1SL 1BSHA 2YPVL 5IQMA 1JPTL 3T2QA 2DQDH 4YHYB 4PRIA 1LK2A 4JY6A 4RVBA 3V0GA 1RPUA 3F58H 1B6UA 25C8L 1JZJA 5LVEA 4KT0J 1S5LE 5FGBC 4BFRA 3D39B 2ZSVA 4RAVA 4IMLB 4F8PA 5JIPA 2HLEB 3WKML 4HCFA 4FCAA 4PRIB 2W0KA 5HVFB 2MRYA 1SLUA 1UA3A 4YBQC 4YDIH 4OLEA 4OB5H 1TYRA 1XCQA 1HEZB 2W0FB 4LKXA 3T3PB 3VXSB 4EJ1C 1ORSA 4TQPA 4KKNA 2X4UA 5DVOA 1OANA 4J28A 4WEBL 5I6KA 1AE6H 1NDGB 3O11B 2Q3EA 3ETBJ 1JZGA 4IL6X 1ILSA 4JFDB 3V55A 4HULB 4XCCH 5BRPA 4X7TA 2A45H 3UTTE 1BZDA 3FTUA 1GOFA 3ABGA 1XF4B 4XTRC 1IQDA 1YDPA 4BK5C 4EKJA 5C0BA 2OI9C 2BP8B 4UT6L 2EEDA 1T83A 2BSDA 2BHFA 3QQXA 3R19A 4I8DA 5ICYB 3EJYD 4N2DA 3CCQP 3EBAA 4RAUB 3GXDA 3FU3A 2G2PA 3KZIE 1RZGB 1WPCA 3PQYE 5ANMB 3OKMA 5IWLC 1MREL 3SYAA 4U7JA 2HT3D 1Z1WA 5TFSL 2VSKB 4EIGB 2HAZA 3GIVB 1TZOA 4G6AC 1IFIA 4BDVA 1S72P 3CX5H 1KBGH 2WIMA 4NM4H 4WUUA 4Z7WF 5A2KH 1QKZL 3SGEI 2JB6A 4XVSH 3AM8A 4JHBA 2YMXH 5DJ6B 4X6DA 4MNGB 4MAYA 2ZXDA 4YC2B 4UBDC 1VGEL 2PCPB 4C8XA 2UXGA 5J12C 4NKDA 5BZWB 4ERSL 3Q2LA 5LQBH 3HE5B 2IIJA 2N4IA 1AGFB 2PABA 4ALAC 2V8LA 3C09B 5F8RC 2O1JA 4QHLA 3B7TA 4I0KA 3ZMEA 2W81C 4BCXA 4YHMH 5ES4B 1U8IA 1M6UA 4N3YB 1JWMB 5IVXF 5I1HH 4YDVB 2VLJE 1NH6A 2OZ4L 3BSZA 1MOEA 4WO4D 5HDQH 4FLQA 3RRQA 5AENA 1OP5H 1K9MQ 3H1LE 4GSQA 4MNQA 3EYFB 4NHUB 4PWGA 3CXHK 4WFGE 1LYQA 2Q2EB 3MLUL 4I13B 5DUPL 2H3NA 3UAJD 3VFVB 5C9JB 4WU5A 3WU2E 4H8WL 5KUMA 3F89A 5DURB 2QV4A 4IOFD 2HWZL 3J07A 1ZANL 2WYZA 5APTA 4OZGF 1NCUA 2XETA 4BKSC 4TUOB 5HHPA 1OOAA 2KL6A 1KORA 3APNA 2VM4A 3WDHA 4ZXBC 3L16A 3GMRA 1Z0MA 1OSZA 1U0QA 2H9GA 2KP8A 3VGAB 1OPOA 2JF1A 4OZGA 3RUGB 1IE4A 3LEYH 1X5HA 4LPYA 3T3PF 1AKJA 4MB3A 3P4NB 2VN5A 1CYXA 1O9VA 3AE6C 4AYSA 12E8H 3FUEA 3SKOA 4MLIA 3MUJA 5AOKA 1NLDL 1E4XL 2WYHA 2ZOKB 4ALAL 4DP4X 2K9YA 1DJIA 5D7LA 4E9RA 2GK2A 2VM3A 1JY2N 1MFCL 3QG6B 1KC5L 3HB3D 5F7MC 3NJJA 5GS0D 2AQ1A 2R1WA 2BRRH 2VDMH 4IOFC 1QFUL 3WU2H 1ZE3C 5KVDH 1MW3A 3I85A 3SO3B 2EC8A 1MW2A 1A14L 4UQEA 3A4AA 2QKSA 1QNIA 4FX5A 4KAQH 1KLGB 3ARGC 4RRPG 3UCQA 1KTJA 4P8QA 5FV1L 3VGDA 1BD2E 1JXGA 8CGTA 2XWZA 1USEA 4BA0A 1JZHA 1ET8A 3CFBB 2H0EA 4LL1A 1NU1G 1BE3J 3F8UB 3P30H 1CGUA 4KGJA 5IP4A 5B3SB 2WT7A 4RMRA 2OKMA 5I0DA 4ODTH 3S2AA 4ZMNA 5EU7C 3MU3A 4WI2A 4NO5B 1OLZA 5IFJB 1JS4A 5FGCB 1YSOA 5AKRA 1IQWL 4S1SL 4HBQA 2Y2YA 5IIEA 2WQRA 1E28A 2LVEA 3ESOA 1I4FA 1P2CB 3NIFF 1NKZB 1HXMB 4TLFA 2YKPA 1XEUA 1DBBH 1EDYA 2X6MA 2ICWJ 1LTIC 2X3BA 3T8XB 4KNQA 3OAZK 2AF2A 1RZQA 1XQ4A 2JJTA 3MI6A 5IJVA 2WOYA 1OTSC 5KVFH 4NIYE 4IMKA 5K39A 4EI2A 1MWAA 4KVNL 5BJTA 1ZGLP 2LV4A 3ETTA 1DTUA 1FN4A 4RSYA 1H9DA 4G83A 2A73A 3D69A 5A2FA 1SY6L 2JKRM 4CBZA 2WVVB 3GSVB 5I1LA 1R34A 5BZXA 4ODHH 3B2PA 1X0TA 2F0CA 2ZUSA 3HBPA 3SDXA 4FQQA 4QHNA 1IGTA 2GJJA 2CDEB 4ZUVA 4Q0XH 2V33A 5T1DL 2NZ1A 4L4VA 4YNYA 1XX9C 4XHJC 4Y4HC 3EGDB 3FQRA 3HZ3A 4APQB 1A02F 1P84J 1JHKH 2UY6A 4UI2A 1J2JB 5D7JD 5B1JC 4OZIA 4P3CL 4NN7B 4FLSA 3P73A 3UC0H 2WLJA 2MKVA 1S7UA 2Q8AL 3K2IA 3QT2A 5E1AB 5FA4B 5J57B 5JZ7D 3TFKC 1KACB 4JHUA 2C9LY 3VWKB 4IHOA 2IF7A 2C1PB 5AVZB 2MTPA 1O9ZA 5BPPA 3O2DH 4Z7WE 3CSTA 3SGDH 1S9VA 3BUBA 3IKKA 4PJ8B 2OXHA 1FHNA 2EQDA 1K9TA 1KIPB 3LQAC 4NQEE 5GRUH 4P5MB 3VD2A 1JYXA 4TNEA 4DN3L 4EDXB 3QZWG 2PRRA 2GQHA 2KLUA 1UKTA 3HTKB 3NABL 4WK0B 3TPKA 3VI3E 5JHBA 2NY4B 1M71A 1EANA 1EAQA 3FF8A 4G6ML 1P84I 4R0LA 5IY5B 1RUAL 3WEMA 1JHTB 2BOBB 3MNZB 3V0EA 3WJMB 1CU4L 3DX0A 4WHYG 4DVRH 3WMQA 5TF0A 1CXHA 5E1GA 5K1NA 4ELKB 2B0SH 4MMYB 4OJEH 5D7LD 3EH3B 1RUMH 1JXKA 2ARJQ 1Y0LB 4X5PA 2AITA 4XH2A 2K4AA 3RB7A 2AV7A 3SQOL 3WE6B 1QBLL 3BDXA 3TGUD 3L4TA 4D6TD 3APCA 1AYOA 3PHQB 3WMM0 2QPDB 4WEUD 3RWJB 3U6XA 2QADB 2HVKA 1H0DA 3WUUA 3QJOA 1DQDL 3U30C 3DROA 3HNTL 3KGUA 3W5MA 1M1KQ 4DSYA 1HE8A 3Q6FB 4ZPTB 1ET5A 4BKLA 1DD4A 5FFLA 4FQIL 3IU4H 2V8MA 3UBXA 3EOYG 5H2FH 2AEQL 3QIWB 1LEKA 5F7BA 1OP4A 2EYTB 1MFCH 3QRGL 4H4NA 1M7IB 2FECI 2VMCA 4FLRA 2DWDA 5FOBA 2J8UA 4AYEC 4KKPA 5BZDA 4HKZB 2R2EB 3NVQA 4P46C 5BV7L 2B87A 1EJOH 2GUOB 3I50H 2XN9A 3LS5H 4FN0A 4LLAA 4XTRD 3GLAA 1T20B 1OAYH 4EXKA 3I6LD 4DOHE 1Q86Q 1CBJA 1DBAH 1S9YA 1D5ZB 2AVFA 2MMXA 4FJYA 3WY2A 2V5RA 4MDIA 4F37K 2X2UA 2ZIDA 2X3CA 5ALCH 5SWSD 3VG9C 1N5YH 1GGTA 1P9MC 5LHDA 2H2PD 3OKKB 3AABA 3IKCA 4DPCX 2YAEA 1GL2C 2PETA 3D0VA 2Q8AH 4CKVX 1LL1A 2N7BA 4WUKL 2W0PA 4WTWA 1SJHB 3VDCA 1OF2B 3GS4A 2R69H 4X98A 2P28B 3QEQA 5TQ0H 1SN5A 5LGKA 1RV6X 1MCFA 1EQ7A 1YHPA 4Q14A 2SEBA 2PCXA 1YUKB 4D9LH 1EBAA 4KHXA 1M7UA 1BF2A 2ZYAA 1MWOA 3DOSB 3GKWL 3HRPA 2WWNA 4MKTA 2W90A 4NX0A 1Q72H 3TJHC 4G6JL 1EAPB 5DJ0A 4FNQA 2IBZG 1H19A 1GMEA 4OLYH 1SQBG 4FC3E 1RUML 5D7IE 5I8OH 1EUTA 2Y0SA 1OGTA 3E2HB 3QZWB 4AYCA 1N5AB 5ADPL 2E5TA 5DXWA 2BVUA 1SUHA 1PKQB 3CL3D 2O6CA 2VMJA 3STZB 3QI9C 3WBDA 1M1JA 1AGBB 1IV8A 3UZVA 1V55B 4JMNA 2PW1B 3GWJA 3MOQA 3MGAA 1KN2H 5BS0D 1DL7L 3JWDL 5I8KL 4U1LA 4ZRGA 4OGYH 3X3GL 3CK0L 5DMGD 4NUJA 3HG3A 3SJVE 3IVKB 2R44A 1B0RB 4R5VA 3WN5B 4H0GA 2DICA 2OMZB 5I8CA 1BQ5A 4RBPK 4TPRL 4P57A 1XB8A 1KXVA 1I1AC 5KSAD 1QTYT 3KWVA 2E47A 3HE7D 1FVDB 4P4RB 4BQBA 2NUPA 2E74B 3IFPA 4CVUA 3FFCB 3VI4A 3SOTA 2WSFH 3ZZ1A 1E50A 4KWUA 2X0VA 3ZO0A 3MTRA 4M3HA 4J39A 4LEXL 4FQ1L 1D7BA 4YHZH 5GZND 2X6BA 1AD9A 3CFJB 4GB9A 2MQ3A 2FYUK 3IJHA 3BT2L 3K6OA 5J0BA 2DH2A 3DV4A 3DI2B 4JFWA 1SM3H 3AXLB 1SQXD 2J73A 3UROR 1E7VA 3BE1L 4WHDA 3VXPA 4OGQB 2AMGA 2BSSA 3ATBA 1RZFH 3HS9A 5EOTB 3CNKA 1JGDB 1QPXA 1HSBB 4K5OA 5DZPA 2EIZA 4PCTA 1BD2B 2QJYB 1ZT4A 1LP1A 4KROC 2ZG3A 3TP4A 5T1LB 3X1BA 4DVRL 3PWUB 5H37H 5J6HB 2E76C 4LPCA 1WIOA 3TVMA 5DS8B 2XN9D 4ZOCA 4JPKH 4MRCA 2CHNA 3UTSB 1AR1C 1SQXK 1OW7A 4LHUB 2ZT9C 3M0DA 5DWUH 1E9PB 2ZOWA 3VRJB 3A6CH 4N0FA 1JRHL 5SV3A 5D6CA 3AT0A 3LXAA 3VFWA 3V6FB 2PP7A 4YIQA 3E8UL 4KU1A 3OF6D 3N44F 4XWGH 4LCWB 2JSFA 2ZJSL 3QUZC 1HL5A 2AABL 4PRHE 3AAZB 2XZCH 3K2UH 4NO3A 4LIQH 5LWYH 2MWCA 3DMMC 4EDFA 1JPEA 5KBMA 4DK5A 2NR6A 1P4IH 3C5SA 5F9WC 4YK4B 5DD0H 1YN7A 4FFYA 3CU7A 4RLDA 2DEXX 3V6OE 1IZNB 3HAEB 5FCUH 4F7PB 4WWKD 1P6WA 3P2TA 1HZHH 1QVOB 1XV8A 1VENA 1DIPA 1N6VA 2AK4B 1FLRL 1LTTC 1ES0A 5CZKA 1E4KA 3DX6B 4PGDB 1IE5A 1VFAA 3PWJA 5AB1A 2FR4B 1W72A 4L0YA 1OAYL 3MLTA 1WAAA 4B9ZA 5C0GA 2BCKA 3UGXA 5DMKA 2GJZB 4JFZH 5FS5A 1USZA 1T6BX 1W8NA 4ODVH 4I18C 3ALPA 2NTFB 3RWIA 1NUNB 5I30H 4K5LA 1K8DA 3B5HA 4NBYB 5LDUA 3U7YH 4LEEA 4IL6H 4YLBA 5CCKH 2HODB 3T4AA 4IFFA 1PP9D 1YMMD 4Z7VF 3ZL1A 2AQPA 4JM0A 1A4JA 3SN6N 1AO7D 3X12B 5I1DB 1QACA 3C5ZC 2G60L 4HMEA 4ORZC 1QHPA 2IPKA 1PL5A 1TTCA 3CDGB 1JNHB 4A7TA 1NBVL 1UUSA 1J8KA 1SVFA 2CXGA 3VNZA 5I15L 3NCJH 2WJ5A 5GGTH 4H0IA 4P49A 1A7OL 5KSUB 5LUMA 1EMTH 3IGFA 1XGUB 2FUQA 2MCMA 1QD0A 4ACTA 5E6ZA 2EIJB 1F3DJ 4X6FA 3CWBJ 1BCIA 1TJGL 1S5IH 3K71B 3WNJA 3MUUA 1KPVA 4UT7H 1B6DA 4JE0A 1ZHKA 5MEPB 2HRHA 1E2WA 4I18B 1MXDA 1TTUA 4CGTA 3MLPA 2Z5HA 4U6HA 2NXZD 4YSSA 1P7QB 5CCGE 4F2MB 2WZ6A 3OPUA 2F18A 2Q8BH 3DSFH 4IRJA 3PGFL 5C0AE 2PWFA 3HR5A 3T2LA 2NW2A 1TQUA 3MQIA 2AXGB 3IJSA 3NMEA 1MY7A 2N7SA 3C5ZB 3W0WB 4CSTA 2V3DA 5EU6D 1FAVA 1BGXH 2EC9U 1UZ8A 3HLAA 4XAKE 3TVMD 3NFSL 2QSCH 1OALA 1T4KB 1PD0A 4IM8A 3FQTB 2XV0A 3V2RA 3GMOB 3IXTA 2NNRA 4JEGB 1LD9B 4P3DA 2GCYB 2XIDA 3BVWA 4ZD3L 3HD7B 1L7TH 4F33A 5HY9B 5HXMA 3GHBL 5DO8A 1A3ZA 3HHMA 3L3HB 1KENL 3IN2A 5CSZB 3UZQA 4ZFGL 3BT2H 4CVZA 1NA8A 1X22A 2IH1A 1KCLA 4XO8A 1DANT 5EC1B 3FBKA 4LXFA 3PPEA 4TSAH 1FAKT 1XVSA 4YHPB 3QJHB 4J3OG 2JJWA 4MNHA 3MLXL 4K23H 3KPSA 2KK7A 4HS3B 3S5LB 5FGCE 2J6EL 3EO9H 2KSJA 2FYUJ 1JNNL 2UWEB 1BXVA 2HKAA 1IAMA 1JNMA 2VWEC 4NSKA 2Y9YA 2FZ3B 1VGEH 3WEAA 4L1TA 1XTGB 1ECZA 1X5KA 1XCXA 2QJPC 2H32B 3MREB 5EZLA 3L9EA 1GHFH 1LILA 1WWAX 5JXAH 2XV3A 4K7PH 3CFKB 4XPFH 4Y5XC 5I1KL 3U4EA 1B4JH 4G43A 3T6ZA 3BKMH 4GMTH 4NBZB 2VZUA 2R0WH 3ARBD 1IGJB 5AKVA 3WIHH 4AH2A 1HKFA 5KAIH 2ERJB 1CFSB 3LDBB 3Q01A 3G9RA 4FULA 3SB3A 3QHFL 1NLBL 1DQVA 5GJSH 4IRSC 5ITBH 4CJ0A 5J8OA 2KXPB 2E76D 2Y7QA 5EU3A 4X42A 1P84H 4KK9D 3ES6B 3JQOB 2VTFA 1GU4A 5DD3H 3EYVB 1QLFB 4NZFA 3IFNL 4GXVH 1DEEA 4FG4A 1U3HC 4WW2A 3I6KB 4N3TA 4PS3A 3S4SG 1ZR2A 1SOXA 3Q1EA 4PJ0H 3HAEG 5KLVD 2XNXA 1SF5A 5DT1H 1CFBA 5HVHC 2OMWB 2BK8A 3V4QA 4DO4A 2YXVA 2NY7H 3LTVA 3LKNA 3FB5B 3CPLA 4U0QB 4MCZA 1AO7A 3MGTA 3U9PL 3ZDYB 2CCWA 2W6JH 1T7ZA 3GSWB 1DBJL 3H32B 1F4YL 1XH0A 2AZAA 5HHXL 3WO3B 2DLFH 2OX5B 3UAJC 4FS0A 1CGVA 4XMPL 5B66E 3IS0X 4GQPH 5SWQA 5KJ7C 3QULA 1ZRUA 3ARFB 4XI5D 4JRLA 3NH7H 4WVZA 2EDWA 3AXHA 5I66A 4NQEA 5ESQA 1PKQE 1JPFA 1XZWA 1DVYA 5ITFA 4WUKH 4OFQA 2VLLA 2COVD 5JHDB 4DZBA 5LXGL 1NIAA 4LP8A 2Q7CA 4P3CH 1MCJA 5CBOA 2JCWA 1A1OB 3LEXB 1NGXB 2KZKA 4N6QA 4DFHA 3D06A 43C9B 1GS7A 2R5BA 2D3LA 3VFGL 5HGHA 4G8IA 2H6PB 1MRDH 2ICCA 4D6TG 3TBBA 3GMAA 1MVUA 1ZGLM 2M8XA 1A6ZA 2CM5A 2WXKA 4U05A 4AUYA 1N10A 2HTLC 1NTZJ 2W5PA 5EC2A 4PCKA 1UB5A 3FFDB 4LHJB 4EUPH 3WKNA 3WGUB 3GM8A 3RK2B 1OW8A 1W8EA 1CYWA 5FO7A 5J06A 5SX5H 2H0JA 5CCHA 2QQNH 5LG1A 1S9KC 4LCIH 3KWWB 1X5YA 3IGLA 4S1RH 3NJIA 2NNAB 1KD1Q 2J6EH 4N24A 3TJHD 4YHIA 1Q9KB 4U1SB 4EUPG 4HSCX 2QGDA 3HBZA 4MNGE 1MJ8L 4Z7QF 5JHAA 1QA9B 2ID5A 3RK3D 4PBXA 3UTQA 4N28A 1NL0H 1GOHA 2V37A 5DJZA 3KJ4C 5E4EC 3DXAA 3AU1B 1S78D 1URLA 3TIEA 1OGAD 5D2LA 3CFCH 2NYZA 1A14H 2HFEA 3BW9A 1HQ4A 3KVQA 4YX2L 1NEUA 5E8NB 1S7SA 3N41B 1NMAL 1WQVT 5JYLA 1KULA 4DUVA 3C9IA 4HIXH 1IC5H 3VXRD 4AGLA 3G6JA 3FF7A 1OW6A 3US1A 1W2BO 3U1SH 5EBMB 2IAND 3S37L 2YD7A 3TGUG 3H1KE 3H1HE 4B5ZA 4QNPE 1CZQA 1E5YA 1W2EA 2XG4A 5I6OA 4PJCA 4NP9A 4M5SA 1UCBL 1KZUB 4DO5A 2I9TB 2XRAH 2XFXA 1OK0A 1EQWA 4JFHD 4X8JA 2G2NA 2Q6WA 5AZ2L 2ZOUA 4HD5A 4LSDA 2DIEA 4UCFA 2IZ1A 1M2VA 4APQC 5JIQA 1U42A 2HA1A 1U3JA 1N7SB 4LNVA 1TTFA 2ZCLH 1SDAB 3KJ4B 4P4KD 3HUJA 4LPXA 1AYRA 3EJZD 4U2ZA 1NOLA 4XC1H 3CMOL 4DF9A 1P4BL 2W38A 1F97A 3PGDA 1TQCB 2O61B 3OAUH 2EIDA 2J88L 3WKYA 1HHKA 3GBEA 4QHUB 3WFHB 4AY0A 2KQNA 1PVHA 2J2ZA 4L8SA 3U83A 5GRJL 2Q86B 3L95B 1SOSA 1A21A 3HG1D 1RE4C 3CCSP 1OQXA 1QSFE 4ODXB 4IKLA 1AGDA 3DIFB 1AHWB 1CGXA 5JZ7C 3A24A 2R7EB 3G6EP 1F13A 1F4WH 5A2IH 5FECB 4ZSOB 4FGMA 3DX9A 1J8HB 4WK2B 1G84A 4B9CA 5J7CC 2YRPA 4ZMLA 4FQJH 4K3JH 5FUCE 1HDMB 3D07A 2K3RA 4XHJD 4KTGA 5HYJA 2CRMA 4XGZA 3FUKA 2F74B 1M4KA 1VERA 4GUQA 2R2HA 2QQNL 4MWFB 7FABH 4CGUB 3A7OA 3QJXA 5BQ7B 3RI5K 3UC2A 4L1DA 1OV8A 1NBQA 1SJEB 1NCTA 1QLEB 1ZHLB 4KJQC 2V7QJ 1B4TA 4TVPL 4M29A 3T97A 1D9KD 2BIMA 3FT9A 3L4ZA 1YITP 1BQUA 4JFQA 2QPEB 4MJ5B 2EIEA 4DN3H 3KLKA 1P1ZA 3MV7E 1RK1B 4KZDH 1H5BB 1MFAH 3OJ2C 4CN1A 4HAKA 4BH7B 1HXYA 4OH2A 3W39A 3VSVA 2ETWA 1RZPA 2WM0A 2Q3ZA 2VRKA 3SPGA 1B0GB 2IBZD 4S0SD 3OKDB 2W1NA 4PJGE 2IOMA 3IDIB 2Y6SC 3O2DA 2YEZA 1TO5A 2OCCB 3M0AA 5EN2A 3ULVH 2VDMB 4BK4A 5C0AA 5FM8A 3DIDA 4FXGC 3QQNA 4R4BB 5FUZL 2R29H 3CXHH 1S8DA 1N68A 1CTNA 3IK2A 3NACH 4Q58C 1QNZH 3X11A 3DKHA 1NBVH 1OGAA 1N7ML 3LJ3A 1QBAA 2Z8WC 5KOMC 2ITAA 3TK1A 3T8MA 1WWWX 3MOBH 3ARED 3MKKA 4ETYA 4F15C 3K6SB 2OQJA 2ZWNA 3WMSA 3CHRA 1LK3H 1ZA3B 1X79B 3QNXA 5C0BE 3S8WA 4YHNA 1H3TA 1NFDA 2CLZB 2ZUYA 3EG9A 1R33A 2P8PB 4GXVL 4KVNH 5EZJA 5DMIH 1JZ7A 3JSVC 3I56P 4YDIL 3ARDB 4DAGH 1WITA 4RMUA 2QT6A 4HAGA 5C0IA 4C59B 1FVCB 1BZ9A 1KJMA 4KC3B 5B8CB 3HE4A 1IM9B 4OLZL 4HKXA 3X1NA 1I8IB 4CAGA 3DX4A 5FYLD 3ZIMA 5ADOH 4N2HA 3S7GA 3C60B 2P5WD 5I82A 5JIMA 4UT6H 1OVUA 2C3XA 4PJ5D 4R4LA 5E2WL 3M1BB 5DTFB 4PTUB 2IBZE 4ZAKC 1W80A 4AENA 4Z77B 3AEDC 1DZBA 1M1XB 2VZOA 4ADGA 1X7QA 4JRYB 1BBDL 2HPCB 4IGBB 4ZJ9A 3UTSE 2RAMA 4N5UA 1EZVE 4KJWD 2WPRA 5GS1C 3RPBA 1EUUA 3KPRE 1F0LA 5EO0B 3CBRA 1A8JH 3VM5A 2XPGB 3AREC 1UB6A 2H7HA 4JFOA 5F0JB 2BH0A 3U2JA 3A0HE 1JG9A 2NXYC 1NTKK 4O2FA 4ACPA 3PP3K 4ZNCD 4AQ8C 2K9UA 1LWRA 3GEWB 1RJCA 1VQ9P 5CEYB 2ADFL 5AFAA 3Q43A 3M9BA 3ZKMC 4G3YH 1UM6H 2E7LC 3F3HA 4FFZA 2AEOA 3AS0A 3LNFA 4PP1C 4Y16D 1I7TA 5CJOH 1SQPK 4N25A 2D2CD 1XGPA 4MJIB 1FSKC 3FT2A 3N1MC 4WENB 2C3VA 2XV2A 2BFVH 4ZTOL 3VTTA 5D1ZC 4XMTA 3QJRB 2HKFH 2V3FA 4FXKA 3Q1SH 1ZOYC 1NLDH 4O5LL 5CD3A 3MOAH 4U3HA 3BESR 5TH2B 5FDWB 3MTXA 3I02A 4ZAKB 3WGVB 1S9XA 4H88L 3RYMA 3EJCA 4FQPA 5E6RB 4UMSA 4OGXL 2FBOJ 3AITA 5KG9A 1U3NA 3S5YA 4AYGA 3CFQA 3C8DA 4JKLA 3WU1A 3D34A 2J4WH 3WFCH 3PY9A 5JW3H 3EO0A 3VGEA 1RIHL 2NXYB 2OL3A 3SYOA 3OQRA 2EH8H 2OFQA 2VIRB 4M8QB 3GSUB 1VF5B 4KX9A 5BV7B 2H8PB 4LLHA 2IQAB 5KG9B 4QXUH 3U2IA 4U3FE 2HPOA 4PJBF 1ZSHA 5GGSB 4JM2F 3TEUA 1YEEH 3G5XA 5FDYA 1IKNA 1UASA 4A55A 2FQDA 1IMHC 2HLAB 1AZNA 1N26A 4P2RE 3ETSA 2OSLA 3ARXA 2PN5A 4Y2NA 4X9BA 4M6AA 1XGPB 4M3LA 4MJIA 4MMXC 4RMVA 4UM8B 5KS9B 5CCGD 1T2KD 1FL6A 1NDMB 1QFUH 5EBWA 2OCFD 2V17L 2H0PA 4I1LA 1OXYA 3CZJA 1JP5A 2FBWC 3P40A 3C2AH 5CEYA 3RY5A 3UPRB 4K7FA 2R5DA 3L3JA 4MJ6A 3SE4C 3V4VH 2OMUB 2AJYH 2YMXL 1LJMA 3QXWA 3INOA 3R4RA 4PJIB 3FFCD 2HT3C 2PP8A 4MHHG 5CILH 5F72S 3T65B 2IBZX 4LU5H 3U36B 2I9LA 3X13B 4OKDA 4GSDL 2V3EA 4IGBA 4OAWA 3GUFA 4P46D 1X7QB 1A47A 3BN9D 4KQ3L 3DHUA 4RDQF 3VGHA 4HOWA 4XPTL 4BZ2A 5B39A 4GUPA 3T71A 1YJDL 2GSIB 4PLJD 1CXIA 2PO6C 3N1FC 4PJHF 2OQQA 3LSOA 2IBBA 2QVTA 5AW5B 3UOAB 1FH5L 2VUYA 3P77A 3GHBH 3AQXA 4KFZC 5IB5B 1KV7A 5BS0B 4XODA 2HTKC 4QGTA 2J5UA 3MVSA 1TMCB 1E2ZA 4HKXB 1GL2D 3LRHA 3VD5A 3HE4B 1IM9A 2NZ9D 4PBVC 4X6EA 1MW0A 3AWEA 2BNRE 1GZPB 4W9IC 4AGMA 2EAEA 1KELH 2XFGB 2Z7UA 3MJWA 3ARDA 4XBMA 4RIRA 2VR6A 2MJWA 5FYLH 4ISVB 1J9TA 4BSWB 3ATDA 2FB4L 5TK4A 4I89A 3ZDZB 1ZHBB 3IR9A 3A6CL 3EG9B 1VFBA 2B1AL 3HZKB 4FFYL 4ICWA 4CU7A 4B3VA 3DO7A 1J86A 2OQJB 3ATFA 5M95B 3OL2A 3MZTA 5J6SA 3PFQA 1AGCB 1XGQA 4S2SA 5E8DL 4ELMF 1R5VB 3KXDA 1YTZT 5EU7E 2Y7OA 3QAZB 1MKFA 2Z31D 2PO6B 5H94A 1BQKA 2EC9T 2B16A 3BAEL 3NCXA 4XPHL 4GAFB 4QRPE 1NJIQ 3ZIYA 3ZBMA 2HLFC 4M6ML 1B0GA 3RNKA 3O6QB 4BFOA 3D2UA 2KPNA 4YHZL 4IU3A 5DHYA 1IAOB 2CIKB 8PAZA 2FJFB 2FQFA 1JYVA 2QDVA 2WXPA 1H5BA 4LRNH 1P1ZB 1KCWA 4ZX5A 2J8UE 2V17H 1YYLL 3GI9L 2A74C 4YBLB 4DVBB 2PXYC 3FC8A 1GA2A 1ZHLA 1JK9B 4TSBL 5EZIH 3DUSB 4LGDE 1FYTE 2J1ZA 3HE7C 1BZ8A 4QJ4B 1TJXA 2O6FA 4WWKC 1WVZA 3FUNA 5KTEL 3BGFC 4M00A 5H2BA 1WZMA 3WL9A 5J3HC 2P5EB 5TD4A 1WMKA 4OLUH 2ZPKH 4KOBA 5A1AA 3RDTC 2ZWKA 5JW4M 5JQ6L 5IBLD 5LNDA 1XH3B 1MCSA 1RVFL 2XUWA 2X1QA 5DR5L 4JFFE 1E6OH 5TF1L 3MYZA 1A9BB 3E6FB 2R2CA 2Q1KA 3KPMA 5C0EB 5CKAA 2RQ8A 4Z0XA 5HGGS 1IZKA 4X80L 1MKMA 2R7EA 4ZFQA 4HOZA 4WZ9A 2X10A 4HCGA 1AHWA 3BUYB 1YJ9P 3JWNG 4G9FB 1F41A 2J4WL 3HC0B 5C7XL 5I30L 4ODXA 4LRIA 4XPGH 3GSNL 5F8QC 3B9VA 2VLKE 5EF1A 2Y25A 2VO5A 3KGTA 2BEZF 4YBLC 3VWJD 2YOAA 3PGDB 4K5PA 1KN4L 1CLZL 1N7LA 4RFOL 3RA7L 1A22B 4S1RL 2VLRA 4NC0B 4C4UA 3VD3A 3PLYA 4P07A 1J05B 1ACZA 3F7QA 2VXUL 2Q6WB 1TZIA 1N8ZB 4H0LB 3NPSC 3PFUA 5E00A 1LP9E 1R24B 2N59A 3VWJB 3DX2A 3H1HG 1T0OA 4XP9L 2IDTA 5HHMD 2W9EL 1HL9A 4PJCB 1QG3A 2QMJA 3X2QB 2W8CA 2XG4B 4JPZB 2PF6A 4FNLL 1C12B 3O6LH 3L7FA 5SWZA 4DGIH 1GTNA 4S1QL 1LLAA 4WUUE 1LO0H 2CU9A 1KT2A 3DIVA 4ONGH 1QI4A 1ZGLA 2FX7H 4EIZC 2YBRA 3KBEA 1GIGH 3LNHA 4LVOB 5FF6A 3SDAB 3HEIB 4QRFA 3BZEA 3NSFA 2UWEF 4W9KC 1XR8A 4BCYA 3S1KA 3R1GL 1KBVA 6FABL 1A3LH 4Q4IA 4LQFL 3HE6C 2B15A 2VXQL 2D0HA 5D2LB 4HIIB 3CV5A 2GC7C 3ZE1B 3A21A 3FH8A 4FABH 1V7ML 1SP4A 1FV1B 3Q2YA 2AEPL 2ZQKA 3L73G 3CVHB 4XOAA 2ZX9A 4QWWD 3AEGC 1Z5LA 4BHUI 1G2CA 2VAJA 3H55A 3VSTA 3BN3B 1NIBA 2YUVA 3OKNA 2A6IA 4TXVB 3TBYA 3C5XA 1DUYB 4YSRA 1NMCC 2NNAA 5L7XL 1QSFD 2BVEA 3W9EA 1YRKA 3TPUA 2VJ0A 3BP5A 1SEBB 2W88A 1VIWA 1CD1B 2V5YA 3TN0B 5FO7B 5LG6A 2EUXA 4LEXH 5DC2A 5DFWH 3GSXB 5KSBB 4JR9L 1UB5B 3FFDA 3FB6A 3GBMH 5EIQA 1S7VA 1Q9OA 1KYOI 2A0LC 3VI4E 3PUCA 4U0RB 5D7IA 1OM9A 4HSAC 5C0JA 4X83A 1A9EA 1KCVL 3MFFB 3ZKXB 3OSKA 1CGWA 4AX3A 5CEZE 3KPSE 1ZCRA 3CMEP 4TLKA 3IJ9A 3X1GA 3LEXA 1A1OA 4N8PA 4PD4K 4RX4A 3W57A 5I1KH 1ADWA 3CVBA 4XXDB 4AM0B 2A77L 4J2QA 1K5WA 1BQHB 2CLVB 3IXAA 4O02B 4R2GB 3D09A 5IKCB 1I7UB 3O3DB 3CXHJ 1URQD 2JK5A 1JPFB 3T9WA 4K8RD 5ESQB 4LB8A 1MHEB 5DK0A 4DO6A 5JPMB 4UBDD 1BVKB 5GRVL 4XN8A 5DO2D 4G6KH 1KFAL 4GG6F 4XN1A 2OX5A 1L9RA 1RF1C 3L9BA 5IJDC 4WW2F 1I53A 1LGHB 4RNRB 3CX5I 2P58A 2CJUH 4S1DC 2GITB 3K6FA 4OLYL 3MLYH 1AY1L 1YVLA 3FHEA 1AO7B 4WEBH 1CICA 4HX1B 4LVEA 3FB5A 1YMMB 4XE0A 1SFCD 4N0RA 3PAZA 1AZCA 3OB0H 1YMHB 2XSKA 4TLSA 2BCCD 1I9RL 3BMVA 4AVIA 3PDOB 4GRLA 4LCYA 5F89B 4B6ZA 2ZYDA 4WY4C 5BO1H 3MRFB 4JDZA 4HPHA 2M3BA 1HH6A 5C7ZA 4K8RC 5JW4N 3DXAE 1T6WA 4BRVA 3VXRE 3ES6A 2C9RA 3MRPB 4XX1E 2DLEA 2FATL 5CUSH 4PJFF 2BWIA 1NTMG 3MRCB 2KS1A 2YXMA 1CFSA 3O9WD 4TUKH 4UV4L 3VD9A 3CLQA 1TYJA 4YGAB 2X4QA 4WI0A 4WI5A 4AH2B 3Q5TA 3MGOB 3FO2B 4A63A 4G8GD 4JUTA 4JUSA 5E1IA 4UWQB 4A68A 1YPZF 3AY4C 4U1MA 5APXA 2H32A 1NKNA 5BS0E 2ZT9B 3PUUA 1Q0XH 5DEFB 1P0SE 2CK3H 4L2LA 1OTUC 2UWEA 1BXUA 4C56D 3LKRA 3TBWB 4HS3A 3P11H 2I27N 3BHBB 4JDVA 2PTTA 2X4SA 5IZ7A 3RL0D 4HIPA 1FFOA 5J11C 5EC1A 1G0XA 4E68A 3QR0A 1F2XK 3IBEA 2G5BA 1NYHA 3Q5YA 5F2FA 2IH1B 3UJIH 3B8EB 3U7AA 1M05B 1SHXA 5E4EB 4F91B 3RWFA 5HYJB 3DGGA 4NRYB 3D85B 2EADA 3DUUA 3MTUE 4JB9L 1IJNA 2EINB 3HD7A 4F33B 2AKRB 4KMTH 3KGRA 1IAKA 4N0UA 4R5XA 1V05A 9PCYA 5JOFB 3HLAB 4U3FJ 1P4UA 1T3JA 1LJ2A 2VAAB 3FQ4A 4G7VL 3O0LA 2NXYD 2FWLB 5IGXL 2X1WL 1VA9A 4XB7A 1BD2D 2FH8A 3CQQA 4GAAA 4FCHA 4Y8DC 2VDNL 4U3XA 5AYQA 2MCPL 4PLKD 3WAKA 4ZTPH 3LNIA 2I60L 5CGYC 2XT1B 3VYIA 3HR5B 5AZ2H 4IRJB 1SQVK 1Y6MR 4EOWL 5EO1A 3MROB 3TO4D 3N42F 1P7QA 3O6FB 2G9HA 4R4FL 3B34A 4U6HB 4Z3JA 2BZ7A 4OQTH 4HK0B 1FNSL 4EUPA 3IFOB 3GXUB 2QGBA 4HQQH 4X6FB 5TPWL 1JUFA 3MV9E 2Q3AA 2E75B 2CGYA 4KQ0A 5J9PA 1ETJA 5F7FA 3TBVB 3T1WA 3CSGA 3MBXH 2OGUA 5D5ME 3UBXG 1I1AB 3U4AA 1O5PA 3FXDA 1AHMA 3TT3L 1OE1A 1YBKA 3LIDA 3F85A 3TA3D 4AWJC 3L3OA 5GS2D 1TLKA 1SVBA 5CP3H 2ZWYA 5D5MF 5J5EA 2JJUA 1FYTB 1MCHA 2DL2A 3QJFB 2G8YA 4HXAL 1X4XA 4X4KA 1FNLA 3GMLB 4HUWA 3L5JA 1MF2L 2E5YA 3OHXC 3LQAL 2YOCA 3BWAB 2DQTH 4Y7MA 1OK8A 3L71J 4YBHA 3O4OB 4UUJA 3KNBB 2EVFA 1K8DB 3BVHA 4JZNB 3K7UA 5DK2B 4DGVL 2QG4A 4ELDA 3C87A 1D6EA 5IB2A 2XKUA 1ZAGA 2BCKB 3F83A 4LP5A 5C0GB 2D3JA 5IHUH 1KFAH 4TTDC 3ZYIA 2AEMA 5CHXA 1T2QL 3QUGA 4K7PX 4NDMA 1S5HA 2QHLA 3EKCA 3GDCA 3Q8BA 4H1LA 3O9WA 4MCMA 5I8EA 5IHLB 1ZW0A 4OT1L 5B5EH 2AK4A 4XN5A 2WQYC 4IW4C 4NO0B 3GBDA 3RGBA 2PR4L 3TA4D 3N9GL 4O02H 1IEAB 1IGMH 1KIQB 3HAEA 5CO1A 3SGJA 3L3DA 3KPEA 1FE8H 1YN7B 2YJQA 5ECJE 1VLXA 5TJHA 1ZVSB 1OKEA 2V7NA 4UTBL 1EJ6A 4NO3B 4BHUA 1JY3P 2YXQB 3HNSH 3MMEB 4M43H 4FA8A 3NDYE 2BY1A 3CHSA 3OAYH 4XNQB 5FKPA 1HHJA 3HPJA 3RNQA 1A7BA 5CFHA 3Q44A 5C0CB 5GXBB 4OI7A 1HJCA 3VFWB 1JY2O 1G9MH 3BEVA 5G5DB 3VUAA 2AXCA 1NJ9A 5TGBA 3KL0A 4Y28J 1FS0E 3ZVVA 1NSNL 5KEZA 2F5AH 2FEJA 5CNHA 1KZQA 1RK0B 1YAZA 4ZMTA 2HP4A 1HH0A 1U3ZA 2OV0A 5HI4D 7PAZA 4PWFA 3PP4L 4D0DA 3MNMA 1T5KA 4TULH 5I1CL 2WPSA 3BWUC 4X99A 5T1LA 1OZUA 2N0MA 1XAKA 3FO0H 3O2VH 1BD2A 1IAIM 4N6JA 4YFLF 3KLLA 5D7SL 1OP3K 2CBQA 1JGDA 5I19H 3SPHA 2BSSB 2XA8H 2HFED 2EIBA 3BPNC 3T0VA 3GB7B 2DYSB 3F6IA 3B2VL 4F2FA 4PRNB 4XP9H 1A5FH 1FLTX 2JLLA 1MJJA 2C9VA 1WDAA 3MCKA 5IJKC 1E5WA 3CFJA 1RZKH 5CN2A 4QRPA 2AXTH 1UJ3B 3FOLB 5TE6L 2H2SC 3T0EA 4K55A 4N26A 4QYAA 1YNTA 1SEQH 5TISH 2VLJD 4XXCA 5HHOA 4PTTB 3LKSA 3PL6C 4A7PA 1GTWA 3HG0A 3VI4B 3ZDZE 1TQBB 2YR3A 3IFPB 3ARWA 3OAWA 1FVDA 3RVVC 5I1IL 5L4IA 3LN5A 1YN6A 4OZ4B 3UH8A 3R0MA 4P57B 4MA8H 1PL3A 1ZJAA 5B3NA 3LQZB 3TNMB 1FL5B 1UYWL 4FYQA 2DMBA 4NERA 3NJHA 2X7LB 3PDDA 3O3UN 4HUKB 1NC2B 3KW8A 4LOFA 3QS3A 3U0PB 3U2SA 2CE6A 5I1GH 2GHWB 2PW2A 4DKFH 2YJLA 2VR8A 2HX9A 4P2RD 3VA6A 3UZVB 1EHKB 3JT2A 3RVXD 2VXQA 1AH1A 3STZA 4RZCB 3HG1A 1FCGA 1SYSA 2C1OA 3D33A 4JANA 3QCTL 4RQQB 1QSVA 2DQ6A 4I77H 4OCXH 4I4WA 5BXFB 2WBXA 4JG0H 1IJ9A 2DQJL 4ADIA 1EAPA 5DJ0B 1ET7A 1QRND 4ZS6D 1MWAH 3I3EA 4Z8FH 1ZJBA 1AO7E 3DECA 3F65A 3RVTC 3P3RA 3VJ6A 1IBYA 5AVWB 4HMCA 4QRSB 3RQ3A 3VCLA 1UIIA 4AGPA 3VXRB 1X44A 4DIXA 4X98B 5LXGH 3G08A 3BN9C 1GPOH 1M9WA 1YY9D 3UTTD 2ZAHA 1C5DB 4OCSH 3S35X 4RGNB 1IFJA 1VF5C 3VXTB 2IYOA 3BAEH 2NY7L 3GKZA 4XPHH 2XTJE 3D0VB 4R83A 1VQ6P 5I0WA 2MKWA 1WHPA 4JN1H 1DQDH 1OXZA 3OKKA 2YZ1A 2BMKB 3FONA 5GGUA 4I7ZB 5B1BB 3MLRL 4MDIB 3QW9A 3KPNA 2ZUQC 2WLLB 4KTEL 2JQAA 1MFUA 1CCZA 4NS0A 3LPPA 4YPGB 1T20A 4WIQA 1NVOA 3DK2A 5A2AA 3KLAB 1NAMB 3QUXC 3TOPA 4NPYA 1LO3L 2XZQH 5K69A 5E9DD 3TT1H 1C8QA 4EEEA 3G5VA 3V4LA 4E9WA 3L4XA 2VISB 4WY4A 5F7KC 1FZFA 1SLQA 3PH0A 1LEKB 1E9QB 2YMTA 3QIWA 4YDKL 4XP1H 2YAFA 4IS6A 2XJLA 2HKHH 2OYPA 3ZKNC 1ZDQA 3QE5A 4YAQB 4E42B 4WHTA 1KYDA 4QRPD 2GYSA 3DROB 4R96A 1ZLLA 1OW0A 4OJFH 2FNBA 5HHOD 1CURA 2DRUA 2NNXA 3ME0A 1EBPA 3H2PA 1ZWIB 4H8WC 3SE9H 3R1GH 4YSAA 4I7ZC 1FORL 4E41B 1U7MA 4Z3GA 1ETZA 4HHAA 1H88A 3SBRA 2NPSB 2MKLC 5EA0H 5JORB 3FHQA 1BSIA 1EDQA 3V0HA 1OT2A 1I9IL 4Z6AT 3BUTA 5C9KA 2EYRA 5KTBA 4DJMA 1HH9A 3EFOB 4N8UA 2VZ3A 5J56B 3CC5B 1FFPB 5AB0A 1AGEB 3KM1A 3OJDA 4PJEB 3K5SA 5GZNC 1IGCH 4WU7B 5EIVA 1CTOA 1BGYE 1WK0A 3WHE1 4BXVA 1M71B 1RLWA 1BW8A 4G59C 4NCDA 3QHZL 3UEZA 4URKA 1MFTA 1BP3B 1J9RA 3HTKA 1EXUB 3V6ZB 3BWZA 4GW4A 4DQAA 3E1F1 4EDXA 4I48A 3BAKA 2GT9A 5IVNA 1FGVH 1YEHL 2H89C 1BIIA 1FVEB 1E79H 2AQRA 1NCOA 2X0WA 4PJ8A 5IGXH 3BRGC 4FJ6A 1ZLUK 5JA9A 4E9TA 2IYPA 3WTVA 3U1SL 2D7PA 3UBHA 5KLVE 2XXMB 4AC2A 2Z7ZA 2DOCA 4ODSH 5FA4A 3GHGA 2PNDA 4X50A 4Y16A 1X9UA 2Y36H 3IJYA 3MSPA 4JO4H 1SQPD 3CHXA 4M7JL 1JPGB 2NPSC 4L8DB 4G9DB 1CFQB 3CZUB 2FAUA 3FQRB 3EGDA 1GXEA 5BUPA 3AADB 2WWWA 2P2UA 4L4VB 4YNYB 3WNIA 1VACA 2Y6SD 1EXIA 4HH9A 4KKLC 5DZAA 3SDXB 3MUGB 3ORJA 3UBFA 5I1LB 3M7OA 2OMYA 3BRVB 3HE6A 3JWOH 1HNFA 3DOHA 5DUBA 5BOJA 4K8RH 2WSEH 3CXHI 2BP5M 3EAKA 4OLUL 4Q9QH 1JZ2A 1A8ZA 3GSNH 4OZGE 1WWBX 5BJTB 2H1LM 1HUCA 1DCEA 4TOYH 4PJGB 3FCTB 4BK8A 5IJVB 1KB9D 2G75A 5L6YL 5I6MA 4NJAL 1Q0YH 4BWTA 4RBPH 3T8VA 1K2DA 1R3IH 3GI9H 3ILQC 5EU5B 3B43A 4J23A 4YDJB 4FP8H 2X05A 3QUXD 1EO8L 1I4FB 2PP9A 2ZF8A 1E28B 1X5FA 3MRGA 1R4XA 2ENPA 1SQXG 1II4E 5JIIA 2QVIA 2CCLA 1LM8V 2YD6A 2F53B 4G6FD 4GSRA 3A22A 1CN4A 2K70A 4JJ5A 4JREC 1GGYA 4XNMA 5H37G 2I1JA 5TTRA 3O8XD 1TQWA 3FQNB 4GXFA 1ZANH 3HUSC 3OR7A 2BY3A 4MRBA 1A02J 1AZUA 5EPMB 2CK0L 4K0OA 2WINB 3NCYS 3VB8A 1V27A 3T3MB 3BP7B 1U92A 4E9LA 5HYIA 3GUTB 3GGWA 2HX8A 1QPPA 3L5WB 4M8UA 1MJUH 3GMPB 3NRPA 1J1PH 3RKPA 1JV2B 1FIGL 1YECL 3ML9A 5JO5A 1J0ZA 1V3KA 4GQZA 3MLWL 3QEGH 2ILLA 1OTTD 2AJ3B 4OTXH 2WXJA 4KK6C 1OM3L 3KPPB 3TWYA 1JPST 5EOCJ 2NDFA 5CN3A 4OZHF 1T1YB 4M03A 1F3DH 3AEFC 2C3GA 3FRUB 5LQBL 2A6JA 4OZHA 3S3BB 3GSOB 3VH8A 4Z7IA 4YOKA 4WFHD 3U0WL 1Z9NA 2P5WB 2BSRB 3V10A 3TF4A 1DSFL 2B1OA 1A6WL 3P4NA 5EZOH 4EO5A 5GS0H 5DJYA 3UYRH 5KAFH 1KBGL 2P52A 4NM4L 3HUSB 1KJ2A 3LKOA 5B1AB 3LZOA 3HE7A 4KK5C 2HKHL 1HJ0A 2D7TH 3OW2O 2NY5H 3DVGA 4LCUA 3ARDD 2YRLA 1T0MB 5CMZA 5IEHB 4ELME 4G5ZL 4K9EH 4UINH 2E9WA 1FYTD 4FYRA 4OGAC 5AZEL 5GZNA 5IFAL 4H2CA 5DJ8B 1T5WA 4HPYH 2LOEA 1CIUA 2KUTA 1FDMA 3CSFA 1WA0X 1MNNA 1MJ7L 1SM3L 2XWJA 5FO8B 4YUEH 5F44A 4G42B 3EJUA 1FL3A 4Q56A 2WO4A 5GGRB 4MVBD 4POZC 3IPEA 3SBWC 1SMDA 3MLRH 5B38A 3WELA 2F53D 4G6FB 3QFJB 3RL0C 1F4XL 2ZAGA 4HFWB 3MBWB 4L3EE 3E6HA 3WFCL 4XBPB 1ZT1B 4FEMA 3O6FD 4P2AA 3VYPA 6PCYA 4JDEB 4NQVA 1P7HL 2C4FT 2HFFB 3LB6D 3WNMA 2YLKA 2YEVB 1AGFA 2YA2A 4J5VA 1LTSC 1KCSH 1W72H 4NQCD 2PCPA 4LSRH 4PN6A 4MXQD 2NZIA 4OGYL 2XNAB 4AG4H 4UTAH 5ENWA 3FOMB 1SUJA 4PY7A 4BDVB 3ARDC 5GSVB 3GIVA 3JXAA 4FFTA 4JE4B 1A3LL 1CE6A 2CO7B 3ILDA 3QUXA 4KV5E 2WQXA 5ANMA 5H4ZA 2FHCA 3D85D 1KV3A 1T8ZA 4WQOA 4ZNEA 1NTKE 3OM3B 3BZ4B 3QC5X 4FQHB 4Q0XL 1CFVH 3FSWA 1CS6A 3QUYC 1YDPB 1IQDB 4K35A 4M48H 3CCEP 3NAAL 3TJPA 1PPIA 4D9QD 4ZD3H 1SRDA 4URTB 4OGQD 1EV2E 1AHKA 4W7ZA 2W65A 1NDGA 2RN0A 3L70E 2X4UB 1ZVNA 1ORSB 1S3KH 4L4TA 1HEZA 3VXSA 2XX1A 2YSSB 4R8WH 4FI8A 2OZ4H 3TJEL 2BSEA 1NBYA 2Y3AA 2L7JA 4Y2OA 1RPQA 2HFGH 5I15H 3S35H 3NSYA 4HFUL 3SE4A 5F9WB 2R0KH 2AQNA 2VQ1A 3RB5A 4FQXC 3MRNB 4YL9A 3AVEA 1K72A 4XRCA 1MV8A 1CWVA 3II3A 4JQVC 1Q90A 3HHRB 1BLNA 2RQEA 2VSDA 1TJGH 2A77H 5ESAB 2GAZA 3CDZA 3R06B 5C0ND 4ZFOA 4OFYD 1FUNA 1WICA 5T8IA 3O8ZA 1MFBL 3HA0A 3S96B 4HG4K 2OZ4A 3MUHL 4RRPA 3MV9A 5KJRL 1V7NH 2EO7A 5AW2B 1IC4L 3ELQA 3JTSB 3RWCB 2MTAA 3VXMB 4BFBD 1U8OA 1XAUA 4N22A 4JK0D 1XGRA 3S36H 4P0DA 1KTMA 1G6RH 5HGBB 1GTFA 3MRLB 4X4XA 1VDGA 1I8AA 1NGWB 3E1ZA 4UT9A 3C6EA 4F2ME 4P2YA 3M17A 4GP8B 1DZ0A 4HGWA 5GTIE 4MHHI 3B7UX 1S9WB 4PJAA 2NY5C 2BXYA 4HUVB 5IHZB 3ZE0E 3VXUD 1NPJA 1URQB 5KYUB 1FJKA 1NICA 1PIXA 3W0WE 1DBMH 2PPCA 4HEPA 1FG2A 3NSJA 3OR6A 1TNNA 1LEGA 1DLFH 3FK3A 3NIGE 4MB4A 5F88B 4QCIB 5E9DB 1KILA 3FW6A 2BW4A 2LABA 1IBHA 3TCTA 4AGNA 2FUTA 2Y06H 1KDIA 3EOAB 2E9GA 4UTAA 2EECA 3TEWA 1GMJA 2ZKMX 2ZXCA 3VX0A 4JZJC 1XF2B 2W95A 1NBZB 3QA3B 3UADA 2BCMA 1J5HA 3TYGL 4OZIF 4K73A 3RVUD 3L9YA 2OR7A 2B0SL 5E2JA 5HD8D 1BQLL 1LWJA 3MHZA 4HJSA 4U1KA 4L3EB 2AQ3A 5EFIA 2ATKA 4GBXB 5J1AA 4TULL 3S3SA 1I1RA 4OZIE 2V9RA 4G5ZH 4K9EL 3HKZA 1OAKL 2XKSA 2YPLE 1NCWH 4KJWC 4ZMQA 5F6HJ 1QRNE 3LEVL 4U6XB 2QMKA 3POCA 5T5FH 2L04A 5FB8A 2R0ZL 1X5IA 3GIZL 3CCHB 1BFVH 3C08H 3MNWA 4MD0A 2COQA 2WSEJ 3UTTB 1AR2A 1R47A 2CO6B 1I8KA 2XNDH 5CCGC 5AKSA 4KXBA 5IHUL 2OP4H