5AVVB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avvB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avvB02
1HBWA 3UIAA 5AVRB 5AW9B 3M06A 2XU6A 1NAFA 3T97A 3KQGA 3VTPC 4I2LC 2IPPA 2WPQA 4I6MC 5AVVB 5AW0B 1YYCA 5CMZA 5AW5B 1T2KC 4KHXA 2ZXEB 3B8EB 1MV8A 1FOSE 2WT7A 4JYBA 2KP8A 1GU4A 3L37A 1CSBA 3NTNA 3M0DA 5APUA 3HE5A 1X8YA 1CI6A 2BASA 3KDPB 3TNUB 1GK4A 3VN0A 2P2UA 5AVXB 2N9BA 4LC1A 4RETB 3V4QA 2JJLA 4AYCA 3TK1A 1H8AA 5AW3B 2C9LY 4RESB 2XV5A 3HTKA 2VRSA 2W6AA 3WGVB 4M3LA 3VMXA 1HJBA 3L35A 3MD0A 3P7KA 5APYA 1GD2E 2C9NY 2QM8A 3IR9A 2WTYA 3M9HA 1MFZA 2Q5UA 2YNYA 3NXSA 5AVWB 4DZOA 3SWFA 1NWQA 4HYTB 4C7NA 2Q3IA 1S9KD 1G2CB 2R32A 1FAVA 3HE4A 3P32A 5APXA 5AW1B 4B86A 1H89A 2WT7B 3VMZA 1HWTC 1MUUA 1CZQA 1T2KD 3NMDA 4JYCA 4AUWA 3HE5B 3HE4B 3M9BA 3M91A 1CI6B 2R3CA 3V4WA 2QM7A 1H88A 5AVSB 3M0AA 3P8MC 1GU5A 3WGUB 1JUNA 3I5CA 2Z5IA 1A02F 1DH3A 2Z5HA 2WWWA 5AW4B 3LIEA 5AVZB 2E42A 1SP4A 3A7OA 1GZLA 1KQLA 3OAKA 5APQA 1S9KE 1JNMA 5APTA 5AW8B 1OXZA 5AW2B 5AVTB 2WPSA 3O8ZA 3A5TA 2W27A 3A2AA 2E43A 5AW7B 4C46A 1A02J 5AVUB 4C7NB 1OWAA 1SLQA 1FOSF 4XE5B 3LIDA 1GK6A 4GKGA 2P7JA 1J2JB 3L36A 5AVQB 1HUCA 2ZFCA 4GT1A 3TYYA 2XZRA 3TNUA 4EOTA 2WPRA 3MGNA 5AVYB 2R5BA 1GTWA 2YO2A 3A3YB 5APWA 2Q7CA 4AQRD 3VYIA 2YO3A 5AW6B 3NFQA 3V5BA 2R5DA 3VMYA 5APVA 2P67A 2H7HA 1IO4A 5APSA
chains in the Genus database with same CATH superfamily
1S7VA 4AZUA 4LDOB 5HGDB 5KVDL 4KU1A 4X9IA 1WO2A 4WIQA 5KZCD 1KBPA 2JCCB 2CO7A 2ZOLB 1IVTA 2VM4A 4PJFE 4MB1A 5KYYB 4X4MA 4J1UB 2FD6L 3RWFA 3BZFB 4EBQL 4N25A 1O9VA 1X9VA 2Z7WA 2H8PA 5C07D 4OFIA 5CN2A 2BMKA 1I85C 1Z3GL 2EEBA 4G8EB 4FL4B 5CBAA 4PRIB 4XPGH 4FNQA 1QA9A 1HOEA 2P5WE 4G7VL 4DIXA 5DC0A 4OQTL 1EX0A 1HXMA 1JV5B 2AXFA 4WQOA 2YSTA 5HJ3A 5TGBA 3NH7L 1SJEB 1NGPH 3CL3D 2AABL 4IRJD 5CD5D 5E8DH 4J8QA 2C3XA 4YPGA 1ZLWK 4UB6H 1XZ0B 3QRBA 1I9IL 4P5TC 3AE7C 3BQUB 5DJ8B 1IFNA 2GJRA 4MXVF 5FUCC 7FABL 1RIVL 4PJEA 4UQ3A 2K1AA 1G7QA 5ERWB 4N2OA 1UQSA 2R2EA 5D1ZC 3VXSA 3GBEA 5I6XC 5LGJB 2W07B 4NJ9L 3RL2A 1BMZA 1TTCA 3CXFA 4LVOC 3HE7D 4Q8BA 3V6ZB 4MTMA 4QTIL 5FS5A 4TUUA 3QHTC 3KPOB 4UTAL 3G3ZA 3MRQA 2J58A 3QZMA 4HWBH 4N2NA 1HHHB 4CBPA 2N1TD 1NLBL 1R75A 4KTGA 3WUWG 3WTXA 4GKSA 5E2WL 1JMMA 2WLLB 4N0FB 1MDTA 2X3CA 4RSYA 5MEND 3MLYL 4P3CH 4W81A 5CLYA 2CKBL 1KIRB 2EDQA 5I1GH 4DP7X 5D72H 2ITFA 1CVSC 1BZ9B 3N1FC 4BSVB 4AJVA 1OAKL 3LRMA 4BZ2L 1WZMA 5ES4B 4JFWA 3D09A 4OCWH 4DK5A 1F6LL 1XSOA 2HWZL 2KI6A 4DN4H 4GI6A 3B2PA 4IKIA 1ORSA 1EFXB 3V95A 4NNYA 3GMQB 3L74G 1E4WH 4EIZC 2KPWA 3KHOA 4KAQH 5GRJL 3WAKA 5K5GB 2OTWA 3UZVA 1I85A 2Z4QA 1IC4L 3FB5B 1JK8B 2ID5A 3INOA 5LHDA 1IK9A 3O8XB 5F72S 1KT2A 3BAKA 4GRLB 4JM2F 4ACPA 2DEWX 3WIHH 4NKIL 2N01B 4GAYA 4PD4I 2GBUA 3A24A 1AHKA 1DIPA 2PCYA 1W72B 5D93B 5E6SB 3X14A 4G3YH 2XWRA 3VGEA 4I77L 2VLJA 3KL0A 3ATFA 2VL5B 3PPSA 1KWGA 2Y7OA 2D31B 4BJLA 1T4KB 4P5TA 5CILH 4NKOA 3FULA 5LLIC 3V5BA 5GGVY 2AEJA 4F15C 1QGKB 2AERT 2XG5B 3ZKMD 5D1ZA 1UA6L 2DMGA 3RWIB 4DP2X 3FAXA 4LSRL 4QRPA 5CP3H 1P6WA 1T0NB 3ISWA 3D08A 1JNHA 3QCUH 4AOFA 3RIKA 3L3JA 4GAGH 4L4VB 1XGRA 1NIBA 3MA9L 1KG0B 2I32A 3GXNA 3MRDA 4B97A 1EO5A 3P40A 4F92B 1QEWA 1WZKA 3JWNH 4PJCB 4FFZH 3WFBL 3TPKA 2ZXEB 4H8WC 4S1RL 5IQ9A 5TQ0H 3CXHK 4CU6A 1EXGA 3EYUH 3LKNB 3N1PC 5SX4H 5L88L 4MMYB 2I9TA 2IG2H 1GC1H 4MMZC 4DF9A 3AVEA 2ICEC 3ZN6A 2VDLH 2KIKA 4HAGA 5FGBC 5GRVK 4FC3E 4Y9GA 2C9UA 2VDOH 3QUML 4IIZA 1HCVA 2ZONA 5DJDB 4AC4A 1NJIQ 3QORD 4ZMAT 3BASA 4BRJA 5KYXB 2RQ8A 4U1JA 1AFVL 2AMUA 4C56E 3U36B 3IJ8A 2X88A 2B39A 3GZOA 3RUGF 1QVOA 4EIBA 4UIKL 1DP0A 4RESB 4BQBA 4UANA 4P2RB 2QSVA 4RMRA 1S7RA 1A9VA 3WENA 1A1MB 4V11A 5CCHC 2J1ZA 1BE3G 4FQIL 4ATTA 1UD5A 5J8OA 4P4KB 1YITP 4HJ0C 3CMAP 4X8CA 3JUZA 3IFOA 4A7VA 4U05A 1Z5LB 3UIZA 2JJWA 1QPKA 5JIHA 4KJPD 3US0A 2I7OA 5FO8A 4JHAL 2HLOA 1ZT4A 1M53A 1TTRA 2VABB 3HG1E 1PG7L 1RVFH 2F5BH 4ODUA 2AKRB 4H20L 3GKZA 1UXWB 2B14A 4PBVC 1CU4H 2RFXA 3TESA 1F4YH 3ZKNC 1W0VA 3D2UA 1ZLVH 1GOFA 3LQMA 1DJZA 3NCMA 1SOQA 1UZGA 3QDMD 3DPBB 1AGEA 4IOSD 3JWDL 4FADA 3WY1A 3MYZA 2LXBA 3TPUA 1J8HB 1SVZA 1ES0A 3CDZB 4OT1H 1CDJA 1K6QL 5CCGC 2EICA 5D9SB 2F74B 3QNXB 3APCA 4GYBA 4KI5C 3OKKA 4YDNA 1Z9PA 2VKWA 1S7QB 4MMZA 4YEEA 3PE9A 3VQMA 4MQSB 2H0PA 3F5WA 2ICEA 5ABZA 4O5LL 1AACA 1WAEA 5FGBA 3C5ZB 4F8TA 2QL1A 2PTUA 5DQDH 1E4JA 5A2IH 2VZTA 4XP5H 4A7GA 1M3IA 3F64A 3N06B 1KCSH 3EJJX 4HK0B 4K7FB 2YPVA 4PBXA 3WDIA 4PJHA 2JKLA 5LJYH 1IE5A 3NIDB 2J20A 4XPFL 1FZEA 2XCMC 5GSVB 3CDGB 1KBVA 5CCHA 5DFWH 3C6SA 3EJZC 1D2PA 5GISH 3BPOB 4WWIA 2AANA 5LCVL 3WNKA 3FO9B 2JJTC 2Z1PA 3MRFA 4YHLH 5I1EH 3KXFA 4HD9A 2KH2B 4JDTL 3JCUE 5FGSA 1DL7L 4N3TA 3MRLB 4RFOH 4WJKB 3L9RB 4L9DA 4ZDHB 3SDCC 3V6OC 3TYFB 2XV0A 3BP6A 5ACLA 2EIMB 4OKVB 2X4RB 2XJKA 1E3XA 3NJGA 1NBCA 1GU4A 4RMQA 1XF4A 3RPIB 1QASA 2QVTA 3AQXA 3AU1B 5F7LB 2E75B 2AHIA 3UZEC 3GMAA 1LQBC 4UOW1 1F58L 5IF0A 1T1XA 3B34A 4G6AC 1H3GA 2VE6B 5I1JH 2EAEA 3APMA 2OMVA 1QSED 4LFHD 3NJLA 4YHIB 5EIVA 5CCGA 3NTCL 5ITFA 2NTFA 4Q74A 5C7ZA 4FQCL 2AGJL 5DJ6A 4PP1C 2NR6C 3FCBA 4LPVA 4OKDA 4YDJB 3BJLA 3UTSB 5HYJB 3ZJAA 1FDLH 4MD0B 4ONGL 4PRBB 3GHGC 2JB5L 5KSAB 3JTBA 5I66A 4ZPTA 3MV8B 3UPRA 3NFPA 3HJ0A 2KYVA 1VGKB 2GK2A 5DMGD 3VD9A 1ZRUA 1Q90D 4Y2OA 4BUQA 4YVUA 3L3DB 3JVFC 1J0JA 3FQUB 3POHA 4XNQA 3ZTEA 4WI7A 2GY5A 4XO4A 2Y6SD 2UZXB 3VFTA 3IU3B 4Y4FB 2VLRD 4K8RL 3ZTNL 4Z77A 1UB5A 3EJCA 3NCJL 3GS0A 1S78C 1KLFA 2EO9A 1J1PH 1T4WA 2CUAA 3PJSK 5I8EA 1YA5A 1RH8A 3PRZA 4IK7A 4AM0A 1RZJL 2CM5A 2JJTA 3ZL4H 4J23A 5AW4B 2ADJA 4BZ1H 1FSKB 5JDJA 4KXZI 2VDOB 4G6FD 4N0CD 1N73B 2GHWB 2W60A 2WWMD 32C2B 5IM7A 5BUAA 1F3JB 1UGNA 1V27A 1J0IA 1BD2D 1KQFB 3EYQD 3M07A 2EC9T 4P2OB 4WU5A 3EOBA 4N87A 3SDCA 3V6OA 3W9DA 1JYWA 4G80B 4UT9L 4IHOB 1U8QB 5CGBA 5CXPA 2R69H 3DHMA 4ODXB 2Y22A 4N8VB 3QCVH 4DGYH 2WHVA 4ASVA 1EZVY 5K93A 2O4EA 3UZEA 4WUUD 1Q9KB 1KTJA 4ZD3L 1PKQA 4EI2A 4YLCA 4FAAB 1BCCE 3MBXL 4JFEB 4XC3L 4XXDA 5FKAB 2E7BA 2YD5A 3BVTA 5JLZB 5D6CA 3VFGL 5D96C 4RAUA 1BQHG 3HN5A 2WPRA 2PETA 3MYJA 4YN3A 2NR6A 2IALB 5EOQL 1BW8A 1RKRA 4XXCC 4H25B 3FPXA 4JO1H 3QH3A 3GHGA 5PCYA 2H43A 5MEQA 1REIA 3G04A 4YHKH 3KS0J 4NQUA 5DCCA 3VFUA 2HTLC 4IDJL 4LDEB 4NQCB 1PNDA 4TV3A 3VFPB 1MIMH 2FECL 3L4XA 4OLZL 4P2QB 4WO4D 2NUTB 5DUBA 3RYMA 4L4TE 4ODWB 3E1F1 3L3OB 4JJOA 1NCAL 1V3JA 1YECH 3H1IJ 2JXMA 2E74C 3MR9B 1CL7L 2IJ0C 5CO1A 5BOZG 4DP8X 3T0ED 3ZZSA 4MNGB 1GZQA 4JFXB 15C8H 4OQ1A 5DVLA 4QHMA 2DH3A 4HDIB 2IMMA 3CH8A 2FYYB 1QO3B 2PYFB 1CGYA 2Q20A 2D0HA 2EO7A 3G7TA 4AVKA 2XPZA 1JMZA 1M56B 2XICA 5EMYA 3WXWL 3FMGH 4F9LC 2J72A 2CUHA 3KPSA 1J12A 3NMEA 3PIQA 3V6IA 4ZO9A 3U0TB 4AYFB 3T0AA 2XKNA 1W6LA 5EU6A 3B5HA 3I9IA 3SYPA 4WLCA 4HS3B 2EDNA 4HUNB 2R9HC 2YIUC 5DQ9B 3B2UC 3VWJC 2DM4A 2WTYA 3ULVE 1Q86Q 1IC1A 1X7QB 2RBLA 4J4PD 4XNXH 4M7ZB 2IANE 3BH9B 2NRGA 2C9QA 3QXAB 2H1XA 5TFSL 3ZE1F 4X7SH 5GJTL 2D7TL 1ACYH 2W9LA 4Q6YA 3QYNA 1MCFA 2WWKO 4HH9B 5C8JA 3KR3L 1T5WB 1RSYA 2P9RA 1UZ6F 5ISZE 3HC0A 3ARFC 4APXA 3FUKA 1IJDB 4GQ9H 4XXCA 5M1BA 1U92B 2BY0A 1MJ8H 1EDYA 1PZ2A 4IFMA 1EHNA 3MBWA 3PWJB 4PJ6A 1T1WB 2LAAA 1X4XA 2X4TB 3MBEC 1KYOK 4CW1A 4HIJA 3UOAB 4UMSA 4J2QA 4MQTB 1Q0YL 2RCSH 3VXOA 1CBJA 4ELMB 3GUTB 5J12B 1OOWA 3AY2A 2GK0B 4BH7B 3MV11 4ISVB 3MOAL 3Q44A 2CK3H 4KKCC 5HBBA 4QF1A 3B1TA 1E4HA 1DBAL 2CIIB 1PPJD 2CAKA 3F58L 4GUPA 1CDIA 4PJ7B 1SFCC 1WFNA 4HGWB 3ULVF 4PP2B 4P06A 1IZJA 1XGTA 4NS0A 2KS1A 5GRYA 4L8SB 4F9LA 4E36A 2ZYAA 4NBYB 2NXYC 4ZNEA 3GSNA 4AV0A 5BV7H 4JFPB 3A6BH 1Q0XH 4R4FH 3MUHL 1E2VA 5C08E 4D0CB 4JM2D 1A9EA 2EE9A 3E6FB 3X1GA 2ZE0A 3OZLA 3MC0A 3DRTB 4H13D 2X3AA 3CC5A 3DJRA 4JN2B 5HDLA 1IGTA 3OPZL 3PLNA 1I7TB 3SBPA 4X6CE 2CA4A 1USQA 2FX7H 3VWJA 3WMM0 3CWGA 4HWEH 1KYUA 2F54D 3RK3C 1XB6A 4W9LC 2C34A 1KPRA 4KK9D 1BX2A 1CJYA 5AVRB 2FQFA 2VAAA 2KUBA 4WTZA 2VLME 3HNVH 2FHBA 5IJDC 4LBEA 4JS7A 1FRGL 2QT6A 3NZ8B 4G43A 4ERSL 3KJ6H 3ARFA 4IGBD 3GIZL 4ODSL 3BZ4A 5JO5B 1CBVH 2JWDA 4LPXA 5J89A 1EJ6A 2CPSA 1OW6A 2YOCA 4KDVA 3TBCA 4PVMA 3WIAA 2VZSA 3N44B 3VFMB 2NY0D 3MBEA 2RIKA 4TOYL 2IMNA 4GIOA 4FYTA 2OSWA 2A45I 4R90L 1BBDH 5D7LE 5E08L 1A14H 3US1A 1R24B 3LHPL 3Q9PA 4GG8A 4Z0XB 4MB3A 2GHZA 5KAFH 2X4PB 4G1MA 1I1RA 3GB7A 4L0YA 4XR8C 1KB5H 2C7UB 1XGUA 5KS9F 1FHGA 1TQBC 3N04A 2XA8L 1ET7A 3ZE2B 2X4SB 1OT4A 5LNGA 1SFCA 4FRWA 2Q5UA 4PJFB 4NZUH 2LXCB 2NPLX 2YD8A 3UCQA 3C9IA 1NDGB 1S8DB 2Z0BA 3TFBA 3P32A 1KIPB 1NEZG 2ICWJ 3GLZA 3WNPA 5K39A 1HWTC 2EYSB 5F89A 2K9UA 3TCLA 1XXDC 2P5WB 3C8KB 4KH9A 3O4LA 1M57D 1VQPP 2EDFA 4X99B 1SXCA 1G9ML 1HILA 4PS4L 3QHFH 2RD0A 2WZ0A 4JUTA 2B2XL 4M5YH 3L73D 2XACC 4QTFA 5HI5D 3L1EA 3RPBA 3SBWC 2BM3A 2WD0A 2GFBA 3P9LB 3L71E 3BIBX 1ADQH 1OK8A 1XGPA 2D7PA 4P4RB 3FQRB 4RBPH 1L0LJ 4EDFA 1CYGA 1KTDA 1YY9C 1I7ZA 3IVKA 3S8WA 5I1CH 5DURB 1GKEA 3D4CA 3RDJA 4JFUA 2KERA 4BA0A 5DRZB 1N4XH 1UZ8B 3HB3D 1MPAL 3NOIA 2EO1A 3V6FB 2FQDA 4RDQF 2X7LB 1JCDA 1CK0H 3II1A 3ULVL 1JN6A 4HT1L 5DD3H 1LDPH 3ULUC 4GKZB 2FO4A 1GL2C 2FWOB 3VE0B 3H9HB 3I2CL 3FSZA 1K4CA 3NAAL 4RIRB 4YVNA 1A6UH 1XTLA 2ZUSA 3H9SD 3N41F 3PAYA 4ODHL 2JKIS 4PRHA 1F4WH 3SGDH 5MHSE 2RR3A 2NW2B 3CFBA 1U6AH 4N0RA 3VFWB 3EO9H 3QSKB 3T6VA 3TU6A 2R44A 1GIGH 2YC1B 3VXQB 1J5HA 2Z3FA 2QADC 3NSFA 3V7AE 2IXQA 3OG6B 2K7QA 2BINA 4UIMA 4M1CC 1S3RA 2VN3A 4Z5RB 2JJSC 2CBOA 2YKOA 1ZT1B 1ZLWH 4ELKA 5CU9A 3QUYB 4LCCB 4QT5B 2AJ3B 3NUKA 1AMXA 1FNSL 1YEJH 5CNHA 5BVJA 4L1SA 4NEHB 5DVNA 3ME0A 3BPNB 4PN6A 2BOBA 3A0HH 4AJYV 1EJOH 1SQQD 1TQTA 1UXSB 3TZVD 4K9EC 4OSUH 4RAHA 3SBWA 1F42A 4ZW6A 1FNFA 3P4MB 4NM8H 5INDA 2ADFL 1LP9A 3LN4B 1GS7A 1JI1A 5BV7B 5AW3B 2Q10A 1JNNL 1BF8A 2Y25A 1RJZA 4AMKL 2VRSA 2A1WH 3HE6B 4BE5A 3ELQA 4K3JL 4TTGA 3ARSA 4NZTH 2IPKA 5TDNB 3SIKA 4Q0XH 1NZRA 2VDKH 1LO0H 4JFQB 2DH2A 5F6IC 3LKSA 4C7NA 1NKGA 1RZ7H 4MD4A 4YQXL 3OQ3B 2X44D 4RFEB 5FA4B 3VMZA 3L2LA 1XDTT 3L72J 1B0RB 4X4ZA 4D94A 3APDA 4Y0GA 5K1JA 4LSQL 2IGTA 1GL2A 2JE8A 2QPDB 2XZQH 1UD4A 2WSKA 2XQYK 2HAZA 3MQIA 2IWKA 1Q8MA 3ECUA 2NQ3A 4JRYA 1LE9B 2ZYRA 4LCUB 2IPUG 5ID1B 4EN3C 1IAIL 2P7TB 1J86A 2VXSH 2AK4A 3E3QE 1XTMA 2DD8H 5F7EH 1YSOA 2OR9H 3MX0A 4Z76A 2JJSA 4U6HA 4M7JH 2PCPA 3DVIA 4MNHB 2IH1B 4I2XA 1DN0B 1KB5B 4N9GA 1VQ8P 3IFNL 3ZXAC 2OYMA 1ND0A 3VXRB 4B9JA 4RSVA 3HG1B 3L6FA 4MA8H 1YQ2A 2FGZA 4NM4L 4AENB 1J2JB 5KUKA 1JGLH 2WTPA 5E9DD 1S9WB 2F5AH 4B0MB 1BGYE 4U33A 3KVQA 2Z8WC 3QDGA 1E27A 2FEEL 2X6BA 1CXLA 2YD2A 1OAYH 1Z9MA 1VAHA 3H0TA 3NGBC 4OCXL 5D2LA 3CXHH 2V7QH 4GB9A 4U0RB 5FUZH 3F89A 4G42B 3C75A 1NCBH 2YQ2A 4OJEH 2HKAA 4F2MA 4Z3TA 3WEAA 3GSOB 3II6A 3FRPG 2FYUJ 4XNZB 2NQDA 1RZIB 1EWHA 1TJIH 4NO5A 2R2BA 2I69A 2ERJB 1JNLH 2YAPA 2FNBA 3Q8AA 2PMZA 3ESOA 2AJUH 3IJEA 4ORGB 2XNAA 4KGJA 2QHLA 2ZUTA 1SDAB 4S10A 4L3CA 4BWUA 5E6RB 5DQJA 3X17A 2FECI 1WFMA 1YMME 4I3GA 3HIZA 4LLQA 3HZYB 1SOKA 2VDPL 2V6HA 1UXMA 2ZCLH 1CXFA 3ALWA 2R1WB 3HZVB 4LP5A 1WSST 5G5DB 1CL7I 4GXUM 4G82A 2ARJQ 3K5SA 2A6IA 3NZHL 4OZFA 1QW8A 4EN3A 1OSPH 1OGSA 2DDQL 5ADOL 1DQJB 1U8JB 2QKIC 1N7SD 2IV8A 3OKLB 4PS7A 4KK8C 4JY5H 4WDIA 5AWNH 4CU7A 4L0ZA 2YBRB 3WNIA 2ZIDA 3WDJA 2GEQA 2WUCH 3QP3A 4UDTB 3MNVA 2FX8L 3TBWB 1X7TA 3U1PA 1EAJA 3STZA 4BHUI 2BC4B 4WENB 3DIVA 3JUYA 2WT7B 4HIEA 5EA0L 5ICXA 4F1SA 3LMJL 3OZ9L 5J3HC 4OLVL 1N5AA 3FB7A 5IVZB 1FNLA 4F37F 4YXWH 5IBLD 3MLZH 2HPCB 1AD9B 3F7LA 4FTVE 1IGYB 3N43F 4X6EB 1Z9NA 1J1DC 2W81C 3GPEA 4IIQC 2FBOJ 2KMWA 3LAFA 1RU9H 4MNQD 3FSWA 3E38A 3LEYL 4G9FE 1CVRA 2QGDA 5H37H 4FG0A 1N2RA 2IDUA 5HI4D 3SY6A 5FHBL 2HVKB 2ATKB 3VFOB 4Z78A 5SWZB 5BZDB 4I1PA 1KGIA 2IBZX 3AG4B 1MJUH 1HTYA 3TBSB 1OGAE 4F7MA 2OXHB 2R8SH 4F24A 3EO1A 5IB1A 2FBJL 5C09A 1JRHH 1ZHLB 1Y9BA 3R2PA 1URQC 3U4EB 2UVEA 4CN1A 1ZA3B 2O5YL 4PWKA 5HD8C 1C7SA 3QZOA 4W9IC 4G72B 1A7RL 3UABA 2K0RA 2WXQA 4FCAA 2VDKB 5GJSH 3QIBB 6FABL 3RZCC 2HG5A 2QKIA 3LRGA 5C0IA 1JPFA 3NJIA 3S35H 1A9BA 2MJZA 4A7TA 1ZHNB 2R0LL 3BX7C 4U3XA 2JB6A 3F62A 1PD6A 3H1JD 2YLHA 3I6GA 4AH2B 3FT2B 3IDJA 1IGML 3VXUE 3QEGL 4RAVA 4MMXC 4WU7A 5FO7B 1KWKA 4GUQA 1AGCA 3A4FA 4XAWH 5IBUB 3ILPA 2IH3B 3S3JA 4LCWD 4OCNC 2DN7A 3K2UL 4PJBF 1J10A 4FQJH 5CMZA 1UYWL 1IE4A 3EF4A 4Y4HD 5J6HA 1TZ8A 4HPOL 3LS4L 2BW4A 2FGWL 4IIQA 3M1OA 5MEOA 5GGTH 2AXGA 5I18L 3FXIC 4OJYA 5BMFL 3GBMH 2H6UA 1DZBA 4MBOA 1UVQA 1OGPA 4ONFH 3L75E 3MV9B 1CD1B 1ZXKA 4N2MA 2XWCA 5D7IA 3JWOH 4IU3A 4PMEA 3MNZB 3VRJB 2HFFA 4Q9RL 3OJDA 4MAUH 2OMWB 3BPCB 5FF6B 1URQA 4JG1H 4AGOA 1QR1A 4I18C 1PZCA 4M8UA 4X6DF 2QSIA 2OJZL 2XN9D 2WIMA 3DMMD 5TDPB 4PJIA 3RWDB 2AK1L 4L4TB 3GSUA 1SQVG 3FH5A 2P8PA 3P3UA 1FFNB 3RZCA 2MH4A 3LEXB 3P0YL 2KZBA 4H2AA 3VW3H 1AI1H 2W8ZA 4H8PA 4WFEE 3U2IA 4PS3A 2OZ4L 3K6SA 4RKUJ 4U3HA 3QJXA 3PL6D 4H26A 2YMTA 1IC0A 5B3SB 2CNYA 3PPEA 2X4NA 2X0UA 3DIFA 3GMNA 2GSGA 3MAWA 1T1YA 2ZUYA 1BFOB 2Y7NA 4MMXA 4OCRH 4DUVA 1A6WL 2F2HA 3IETB 3RU8L 4K3EH 2BOCA 5CHXA 4UNTA 5JORA 5GS0L 5KVGL 3T4AC 1DHKA 1PZBA 5IMLB 1LO5B 3AE9C 4PREB 4KK5C 3ZR5A 1Z9LA 3CC2P 1EXIA 2BNUB 1FNEB 1YN6A 1IGFH 1T1ZB 3C6LC 3CWBG 3VP9A 1BOGB 5AVUB 3SPHA 4GP5B 2EVFA 2IANB 4LOVA 4JRFA 4D3CL 3OC5A 2VUOA 4OM1H 2FT6A 5F96L 1Z56A 5ESQB 2YGOA 3FO0H 3CFEA 5ISZB 3QFJD 2F61A 1JUFB 5DYOB 1AR1B 5C0DA 1UASA 5KSVB 4U2YA 5JW5A 1FZJB 2E76D 5CSZB 3CFMA 1B2WL 2WQUA 1NC4B 1VQ7P 2X4QA 5A3IC 2ZUUA 1DVQA 2ORBH 1D5ZB 4R5TA 3MFFA 2Y3NA 3G4SP 4I18A 4V33A 3LIZA 1NTME 1VQ5P 3T3PF 2QJDA 3KLDA 2WQSA 4MRCA 1QSZA 2H6PA 2M2DA 2ZJSE 5EIIA 5JPMC 1OF2A 3AS2A 4OLXH 4HLZG 1MVFA 1WA2X 3VXMD 3L74J 1FG2A 2ESVE 1UHVA 2MOGA 1QWUA 1I8KA 4PCTA 1NAFA 2X6CA 5EBLB 4HPYH 1CW5A 1ZSHA 3E1IA 2IAMB 2VYRE 2JTYA 5BRPA 1UKQA 1SJHA 3FOMA 4EZJA 1SYVB 2FJGB 2VSMB 2WSPA 3L5JA 5I74C 1MFEH 1YN7A 4AEFA 3N50A 1CC3A 3KPNA 4FFVD 43C9B 5EO1B 4LQ1A 5DR5H 3EADA 3AREC 5C08B 4AZ8A 4WF7A 2OCCB 3TBVA 1Y18A 4IBYA 3OPUA 2LLLA 3T4AA 2PXYD 1K5NA 1E3ZA 4BCYA 1T5XB 5K5YA 1KXTA 3TLRA 4X6CB 1TJHL 4GINA 3C6LA 3RWCA 4NT6B 1RL1A 4O2EA 1IVLA 3T77B 3P4NB 3QDJE 1TNMA 5HHOA 4ZQTA 3FU7B 3QRLA 3TIDB 4PUBL 4S11A 4M3HA 1SMAA 3KWVA 1IZKA 3KXDA 1S9YB 3NIGE 3ZT7A 3GBNL 3PV6A 3QUZC 3STLA 1KILE 1DVFC 1KYOH 2XYBA 1YDPA 3ILEA 1I7RA 4KMQA 5JYMA 4ZUSA 4QOKE 4QRTB 5AL0A 4ZUWB 3AQZA 3R4DA 1MFCL 3UJJH 4OI8A 2BCKB 1LJMA 5E0FA 2B87B 1BAFH 2ZOOA 4HD5A 4FCHA 1S7UB 5TISE 1OL0A 4MB5A 2VXQL 1NKOA 4XOCA 3ABGA 5JA9A 3GO1H 4OB5H 3H1HD 1MHPL 2C8NA 2NY3D 1MEXH 2VDMH 4RGNB 5D7LB 1MKMA 1T6AA 2YA2A 2XLLA 4JFDD 1AIFB 2M8RA 2UZYA 1G5GA 3WG7B 2LQRA 4F7EA 1KYAA 3FYEB 3FO2A 5I1HH 5IROD 5JPMA 4NO0D 3TCTA 4XI5D 2JIXD 5FW6A 1EEUA 5LG6A 1BE3J 4YZFE 1GOGA 3FZUC 5EO0A 1E8XA 5C0RH 1BQLH 1J05B 5I2IB 1FGVH 4B41A 1NCWH 3A2AA 4QCIA 1DE4B 4FNUA 5AW7B 1IAII 1BZ8A 1JWSA 1ZA6A 4MRBA 4DOHE 4DVRH 1DD4A 1QFWL 1QLEL 1IV8A 1KF9B 1V3MA 1K4DB 2Y0SA 5KJRH 3JT0A 5L2JB 2UY6A 4XMWA 1X5FA 1VQKP 3TSIA 3PJSB 2EUVA 4AEIL 3O45B 2XWJA 4XX1G 1MVUA 3AREA 2CKNA 4ORZC 1Y0LA 3RA7L 3NCFB 1IBYA 4GSDH 3B2VH 2XV3A 4NYLA 4RGMB 3VH8A 4PVLA 1DANU 3DSNB 3FCGA 2X89D 3GEWB 4N6RB 5E4EB 3G6EP 1IAOB 3P0VH 5CZXD 2WBJD 4NQVA 3A3YB 2CBQA 1TKWA 3ARUA 1NJ9A 3EHBB 2XG4B 3QJTB 4Y5VC 3T4YA 1FHNA 2VDRL 4GXUN 2FEEI 3KH3A 1OY3B 3VJ6A 4M6AA 3C08H 3ELAT 3QUZA 4NJAL 1DVFA 2ED6A 3CLEH 3L4CA 4MJIA 2OLDA 2WV3A 1QNZH 4YSUA 3GSRA 3V4VA 1KGXA 1NAMH 1JZIA 5KKZB 3RDTD 1KJ3L 3MGTB 1QFOA 2PF6A 4X4ME 3Q1SL 1DVUA 2EUWA 4OFDA 5AW5B 3ZW3A 4Y2DC 1HI6A 1Q9WA 4LLUB 4DVBB 2P8LA 3CZSA 1KY6A 3JTSA 4FLQA 3CFNA 5CMAB 2ZNWA 4L1DA 3FOLB 2B5IC 5KVEE 3REWA 3ZDYB 2VN4A 3TJEH 3VRLF 3FT3A 3ULSA 1FQ9C 3P9MA 4NHUA 2XDJA 1THAA 3PP4L 4KRLB 5T1LB 1E8YA 1G9NH 2D7MA 2GPZA 3WXVL 4P59L 3PG2A 3G5ZA 5JPNB 4OY9A 1KYDA 1RZKH 1S7TB 5A2BA 1M3JA 2QQNL 4X83A 3UG5A 1QOKA 4TTDD 3FT4A 1FUNA 3FSVA 1NMAL 3O6MH 4GOSA 4JDEA 3ZX1A 3WUTA 1Q81Q 4PJEE 4BFBD 4A7UA 2D03H 1A2YB 4F20A 2IBZG 3LV3B 3VXSE 3T97B 2N3JA 1D5BA 3IPFA 4D0BA 1M1JB 2Y7QA 3PHQB 4L29A 1ZE3C 5F3HB 4JANA 2WTRB 3NQKA 4FA6A 3P3TA 2FY8A 2TAAA 2VH5H 1N6QH 3DBXB 3KPRA 4GLRH 3M9BA 4KVPA 3ZGHA 4GI9A 5ENWB 5DK3A 2R0WH 3BH8B 4UNUA 4Y5VA 4KUZH 3CTTA 5EO9B 2NY6D 3LCYA 1JHLL 1KN4L 3ETBJ 2J56A 5FKPA 3QO1B 4FFTA 3C5JB 1NU1D 3GRWL 5T1JA 3OKYA 2EIJB 1KJMB 2BRRL 1MCHA 1N7ML 4AYBA 1JXDA 3AE2C 4YBQD 4PJ0H 1A0QL 5GGSY 3BSZH 3JWNG 5GS0D 5DEFB 5C0CD 1TSHA 3AAZB 2FRGP 5GRUL 1L9NA 4LKCB 1V10A 4PJ8C 4Y2DA 4JX0A 4BXVA 2M8XA 5DI8B 1JBJA 3PHOB 5E95B 1I3GH 2ITDA 5CEXB 5DMKA 4UV7H 2KL6A 3CZJA 2H2PD 4NDMA 4XCNA 3EJQA 4M56A 5BRZA 4X4YA 1R9FA 2R1XB 2XWTA 1KCKA 1GK6A 1N8ZA 3NABH 5G4NA 1H3TA 3RY6C 4CNIA 2HT3D 2YUXA 4KBPA 5H2BA 4H44D 1JD9A 3MUGA 5F0PB 4HZLA 4PM1A 1HU8A 1IGJB 3NSYA 3D12B 4J3TA 3DTXA 4FQXC 4PRID 1QRND 4ZFOA 1A22B 3IM1A 2VLJE 4N8VG 4OVUA 2DQFA 2AZAA 1A64A 3J27A 3TJHD 1QBML 2K3HA 5FUCE 4K71B 4CKQA 1USZA 3H32B 1W9XA 2CDEA 1CFSB 3EOYG 3MRBA 1OX3A 3ZZLA 3II3A 4XWGL 4KKPA 3S1KA 5GPRA 3TC9A 1KBGL 1BFTA 5DZLA 4QRPE 1S5IL 1BVOA 4TUJB 2OSYA 5M7QA 3QEQA 2IFFH 1S9KC 2YXFA 1CFTA 4M43H 5B39A 3EKCA 2EE2A 2J5LC 2Y06L 4JLRA 1YEKH 2K4AA 4NLHA 1SY6A 4GT7A 2GJ6D 1LDSA 4GAGL 5DRWA 5EWIH 4LT7A 3UGXA 2WSFH 4LE8A 5C0BA 3V10A 3WCYA 2FZ3B 4AYEC 4R97C 3QDHA 4JKNA 5E24E 2DWSA 3ARRA 2MQ0A 3HFFA 1N67A 4FLHA 3VFSB 4XNYL 3TEXA 3MLRH 4G11A 4EVNB 5E2UL 4IL6E 5GGUA 3JVGC 4TQ8A 1JOCA 2Z91A 4KRPB 1GW6A 4C83A 4U6YA 2Y1VA 1K85A 4AYID 5I0YA 1NFIA 1MY5A 3LKRA 4NO2A 3OGOE 4PJ8A 1TU3F 4OLWL 4ZTPH 1DJHA 1ONQB 1YI2P 2DJSA 3B9KC 1COBA 1RK7A 5TF1L 4L37B 5B4MC 2WQ8A 5DJ0B 3OSKA 4ZUVA 2AJSH 1I7UB 3MCG1 5EF3A 3RY6A 1GGIL 2L0DA 3FQXA 4MCNA 1RZGB 3OR7A 1LTJC 1RD6A 4MVBC 4XN1A 1R0AH 2J8UA 3LH2H 4XMKH 1YQ3C 1W2EA 1YMMB 2OMZB 3BDYH 3HR5A 4FQXA 4MZRA 1IT9L 3O8XD 4QXUH 3QQXA 1NAMB 1FVEB 1KDJA 1PAMA 2I8DA 1HH6A 1HNYA 1ZEAH 3EH5B 3MLVL 3VGAB 2PTVA 1SEQL 2G5UA 3QIWB 2DRUA 5SX5K 4GDOA 1NBYB 1YEHL 4G8GD 2Q6WA 3MXVH 3QARA 2X4UB 2XPGA 4KX7A 5KVEL 1HIMH 1PQZA 1SM3H 4RH4A 4H0LC 3FQTA 4W9EC 2G9HB 3RL1B 2AXCA 3B2MA 3CVIL 3NJKA 3G5XA 3V2QA 1QR4A 1ET8A 3NP4A 4RFNB 1VQOP 1L0LK 3NFSL 3DHJA 1GRWA 1ZVYA 2DLEA 4QAWA 4XN5A 3SO3B 3TO4C 1B0IA 1WFJA 1X5GA 1L7IH 3GYRA 1OKEA 3RVUD 3TL5A 2DM3A 1O7DE 3GI8L 1W2BO 3S9DB 3VX0A 1GGUA 1HUCA 3VG9C 3JVGA 1PCSA 1VFAA 2JI2A 4FTVB 2Q9OA 1DUYA 4Q4IA 2DQHH 1ZKAA 4A39A 3R06B 4ZTOH 2B59B 1OO2A 4JFOB 2GJZB 4PJHE 3CSGA 1IJNA 4G9FB 4TSBL 4TNVF 2ZJSH 4JRLA 5CCHE 3TA3C 3L81A 3B9KA 3P30L 2G60H 1JGVH 4PRDB 4YPCA 4BE6A 3WUUA 2K1MA 1OGAB 5F7WC 4QRQA 1UACH 4L8CB 2D2CD 2DLFL 1RY7B 3H1IE 3PWVB 1HBWA 1LTJA 3KXFE 3R1GL 3D69A 3L3GA 3BIKA 3P4OB 1SXAA 1XCWA 1YJDH 3FUFA 4YSTA 2G2RB 4WW2C 5EBMB 1QI3A 5SV3A 2V7NA 2WN2A 4FQ1H 4PTUA 2A45G 1E42A 1CLOH 2CXKA 2G5BA 5HYQB 1HH0A 1T89C 2QPFA 1E2ZA 1PGPA 3CCJP 4PJXF 3ARXA 2WXIA 5TH2A 4I0KA 1WAPA 3QH9A 3L48A 2A9CA 5IBTH 1O9ZA 4C59B 5F7FA 3E1RA 5FYKE 1EEQA 3BWSA 4LU5L 2KI7B 2EYTB 3FONB 2OMXB 2PNDA 3IBOA 3HNTH 4PRAB 3SPVB 4Z7WA 5CCGE 1AIZA 4A2LA 4PJHF 4KI5E 1ZVSB 2ZT9C 3VXUB 1F2XK 4HCFA 3G9RA 3E9TA 4QHKI 5CJOL 3H7BA 4FNRA 4XT1C 1S3KH 3TO4A 3R0NA 1YJWP 2D3LA 3TBTB 3QWOC 2VXTH 4FJYA 3KGRA 5C0AD 3IR9A 1ZGLA 3IDNB 2VRKA 3DOSA 4N90E 5CFHA 4DO4A 1FDLL 2ZUXA 4Z7QE 2BNRA 1D5IL 5E8EB 4EDWH 2IBGA 4PRPA 4X4XB 5LNEA 3AMKA 4Z3HA 4HUVB 4YWGL 1LK2A 2FEDD 5ESAB 3C5ZD 4EDXA 1EXJA 1A4KA 2JNZA 4HHGA 5GTIE 1LTBC 3T1FB 4UZUA 2R3CA 2HJKA 2OX5A 3TA3A 1MVYA 3TO2A 2GW5A 3VQ2C 4U3CA 3SCMB 5D7SL 3TVMB 4KMTH 2OP4H 4U7JA 4TSCH 3K71B 2J3SA 1MRDH 3MP7B 2CG9X 4GI8A 5JQ6H 4YSQA 4HCRH 4XP1L 3TYGL 4OUUA 3BUYA 5LUMA 3X1EA 3D3VD 3GMLB 4LNVA 4WW2A 3V6OE 2YWYA 4RMTA 1GMEA 5EOTB 3P2BA 1BYOA 2G9KA 4PU2A 1EAPA 3RHWF 3UPCA 4MX7A 1T89A 2DLHA 4HHAB 4PMFA 5EZIH 4DT2A 3MU3A 5KTEL 1JHKL 1PKQE 1GJWA 4S2SA 1QFWI 1HSBA 4MAZA 1PMYA 4KHXL 2Z31C 4YK4B 3EOTH 4Y8AA 2P5EA 4JHWL 1LEIA 2CBMA 5ESVA 1GVIA 4UUJA 2KC0A 4ZAKB 1HQ4B 3O11A 4LIQE 3FQ2A 4I48A 4L0PB 5IR1B 3QWOA 43CAA 1FFPA 2C3WA 5ACZB 2UYLA 5L8KB 3U30B 1VKXB 2FYUK 3MRIA 5JMOC 1HSAA 4CJ1A 5KYUB 1Z9SB 4LL1A 2PO6B 4JHBA 4JKWA 2CHDA 5EOCJ 3MV8D 3B5NC 5I26A 2VDQH 2AI0H 2I60H 1I3RA 1I9JH 5I17A 2LR4A 1WFUA 1Q4NX 3PNWB 1FIGL 3L37A 2NYYC 3WIIH 5I16A 3ZL2A 4L5FE 3WFHB 1T2XA 4JM0A 2QFPA 3NEEA 1J5OH 3MJ8A 1Z66A 2IDCA 4O2CA 4UOZA 4HXAL 3HG3A 2BP3A 2Q3AA 1VQMP 3KPSE 1NGXA 1JYVA 4AV4A 4P07A 2FB4H 4KXBA 4U49A 3CCRP 4Y1AD 4AYGA 1HNGA 2E8ZA 3STBA 5EU6E 3BT0A 1WRFA 3GTTA 1OAXH 1IEBB 1SDDA 2CHNA 4WFFD 3PHLA 4RX4A 3QI9C 1V3KA 2ESVB 1DSFH 2XIDA 4DZOA 3FU8A 1L3WA 1NCIA 1KLUA 3NDZE 4FYQA 1SEBB 3F8UB 3K46A 1KCWA 4OVVA 3LNHA 3IDMB 4R96A 4R9HA 1G6RL 2Z31A 5CR1A 1TIUA 4HIQA 3QIUC 4M62L 3CHSA 4LSTL 4WKXA 1KJVB 4K0OA 1FO0L 2COVD 3MRHA 4OGAC 5F7UA 1KLGB 2E5TA 3CC1A 4N2FA 5F0LB 1TETL 3UYPB 2QQKH 1ACYL 1WLHA 2LU7A 2Q3XA 4JR9H 3N4XA 3TNNA 1MCDA 3LNFA 5ICYB 3IGAB 3O3BA 3SKJH 2BNQB 1FORH 2K9YA 4EXKA 2A83A 4MDJB 1PJWA 1L0LE 5IVNA 2B0SH 3V5KB 5BS0A 1CF8L 2XWBB 3LXBA 3CN4A 3B5NA 1KEML 4X7CC 1OMIA 4KRMB 2RGSA 2W27A 3S35X 4NQCD 3A4AA 5KAQF 4P8QA 1E5AA 3MJ9L 3IDUA 1QX8A 3NIGB 3TV3H 3B6SB 2XN2A 3PFQA 1KILB 3O9WB 4HKBB 3EYVB 3FT0A 1FVDA 4WI4A 5IHHA 5JIQA 4XN7A 3IXTB 3LEVH 1NTZD 4QOKB 4UTBA 1ASQA 4JJ5A 1F56A 1SRDA 2LFEA 4KY1H 3U2SA 3VXTA 4ZNEE 1VCAA 2F53D 12E8H 4N22A 4HFWA 5CJQH 1KPVB 2YK1L 4JO4H 2NMSA 2K8MA 1M56D 1H8SA 3JV5A 3JZYA 5LO7A 5EBWA 5FW7A 4Y5XC 4U7MA 2X40A 3QI9A 4S1DC 5FCUH 3VSQA 5DVOA 4UQIM 3TWYA 4WY4B 1PDKB 3KYNB 4J3OF 5DRNA 3LRSA 4I3SH 3UBXA 3LVTA 3DGGB 3QZWB 4IBTA 4NXKA 4WNJA 1NLDL 3QIUA 5IOPA 4R7VA 5CEZE 1RLBA 3EGSA 1DN2A 4OWFA 4LGDE 1FOSE 1OSEA 3G6AB 4IL6H 2WSCH 1JZ3A 1P6AB 3O3AB 2NNRA 4OFPA 2ZF8A 3VI3A 3FSAA 3UAJD 4K2UL 3RVXC 1K8AQ 3ZLQC 3LN5A 1XR9B 4XB8A 2GCYB 2KOGA 2NX5A 4B3EA 3T6XA 4EI5C 4ZMQA 1NMBH 3MRNB 3O3DA 4K3GA 4XCEA 1DQVA 4O02L 1VESA 3GF8A 3MNDA 1HF9A 1ZV2A 1JZ8A 3RWJB 3KGUA 2OSXA 4JZJC 1X5YA 1CGSH 1SLVA 1W8EA 1I9RL 3ZIYA 5CN3A 1J0KA 2FJHA 2J55A 4UAOC 4YUEH 1S7VB 1XR8A 4XBEH 2AQ3A 3VG0L 4CVWA 4N1EA 3BAWA 1FU1A 2CO7B 1GCFA 2WQAA 3S97C 4KH2A 3EO0A 1NCCL 5T33H 5EUOF 5L8JB 2ARJA 4CMHB 4M7KH 1WD9A 3RWFB 1HEHC 4FEMA 1M71A 2H8PB 3EYSH 1O5DT 3MUDC 2R0KL 3U0WH 4RWYL 2BMKB 5EV7A 4JO2H 4LCIL 2ZYSA 2OFQA 4ICWA 4L1TA 2VDQB 2HH0L 1LVEA 1QA9B 3TFKC 3MLWH 3O4LE 4JO3H 1H19A 1H6UA 1WIOA 1HXMB 4OJCA 4Y5XA 5HJ3B 5TGBB 3SZKC 4F27A 1QRKA 2JVUA 1MFBL 1KZYA 5JZ7C 1J1OH 2YEVB 3FTYA 4M4RA 5E9AA 4PWFA 1SQBK 3DX3A 3RK3E 1YYLH 2YZ1A 3FHEA 4H8WH 4YPGB 2P43B 4K55A 1KV3A 4F7TA 5BUGA 3RLSA 2DYPA 1IEAB 5AEAA 4PJEB 3ZK0A 1PX3A 4QI3A 4UQ3B 1G7QB 3KW8A 1UQSB 2R2EB 3A0BE 2ZCKL 3VXSB 1PY9A 1UFGA 1PP9E 3RL2B 2OCFD 1OWAA 2YPVH 2F7OA 2MQCA 4LSSH 1FJ1A 1BQRA 3KZIE 1G1CA 3DOHA 3SYAA 3MRQB 2EE6A 2UZIL 3MA7A 4LLHA 3KS0H 4EI5A 3L3IA 1YEGH 4GKSB 4U7SA 3PWNA 2ZYGA 3LZQA 3DURA 1I31A 4IRJC 2VZ1A 4RRPG 4HJTA 4JZJA 5CD5C 4X7EC 1GGCL 2Q8AH 1E5WA 3IN2A 5DD3L 3NA9L 3R8BB 1NICA 1L6ZA 4JFVA 2J6EL 4MJ4A 5AFAA 1NIAA 1WT5C 4NERA 4NNYB 3A6CL 2QZQA 4XE0A 3HE7C 1DEDA 1F4WL 1H3WM 3MUDA 4P23D 2OTWB 4FQQA 1SQPK 3UZVB 2Z4QB 1DEEA 1KXVC 1WS7A 3F04A 1ZXQA 5FYKH 2N1TC 3OLGA 1G7HA 1KT2B 2GG1A 3NTNA 2FWLB 4FXKC 3D9AL 5L7XL 2R29H 3SE9L 2H32A 4GAYB 2UX7A 4KROD 1QI4A 4PJAF 5IBUG 4GW5A 3ARVA 2Q3EA 3X14B 1L9PA 2ARWA 3DO3A 2VLJB 1J9QA 3QG7H 4BFGA 2VMFA 4O58H 3FN0L 4KO6A 2K3RA 4E9QA 2QVFB 3D6YA 2XTJC 4HUXA 4P5TB 5G2NA 4NKOB 5IWLC 3TK1A 1KTKE 1LP9E 4GMTH 1QQDA 1BCCG 1IMHC 5D1ZB 1Y6MR 3NJFA 5I6XB 1BJ1J 3EDDA 4ZZFA 4QRPB 3GZKA 1U8IA 1MLBA 4LVOB 1WEJL 1JNHB 2XQBL 5C07A 3L3JB 2WXGA 1XGRB 2HLFD 3QJFA 2B7DT 4PJGA 4PVNA 5DTFA 5F7AA 3MRDB 2OW7A 3EUUA 1QEWB 5GTIH 1X4YA 4D9RE 4N2KA 3VVVA 4QEGA 4HAKA 2BCCJ 5AW1B 1SBBA 2I9TB 2Y4SA 3LNEA 4IRJA 3CX5J 3ULUE 3HE4B 3GDCA 3FYIB 2V9UA 1JDAA 1IM3D 5DHYA 2HN7A 1A7OH 2PWHA 2XV2A 4U1JB 4JRYE 2FWSA 3ZKMC 1ZR4A 1QVOB 4YDVA 5HTSA 1WT5A 3V4PL 1FZBA 5AVZB 1CLYH 2AK4E 1S7RB 3HE7A 1MREL 5FO9A 3S3SA 3W57A 5A2KH 2XC8A 3COOA 2E0PA 1P1VA 2PR9A 4K23H 1KXVA 2F1AA 4H88L 2OMYA 2FLMA 1GAFH 2N1TA 3IFOB 3WIFA 4CBZA 1XH2A 1GHFH 3W2DL 3BCCE 1DQDL 4YHZH 1CIDA 4FXKA 1SQVJ 1AY1L 4I2XE 5FO8B 5MENA 1ZT4B 3UYRH 3CVHA 5HDBE 3LIDA 2BY2A 3QULA 4R4MA 1AFOA 4H40A 2WZPD 1C5CL 3ROOA 1CGVA 1RF1B 4OD3H 1Q9OA 1MUJA 4HEPA 1UKSA 4N2DA 1EANA 2RFXB 1R34A 4P5RA 4PH8A 1TOXA 5AB1A 1X9UA 3SGEI 5IHZA 5IWLA 1W0VB 3D2UB 3CZNA 3QDGE 3S6CA 4F15B 2A0LD 1X7SA 3S96A 5D2LE 1AGEB 3GXTA 4PLKD 4HIXH 5IIEA 2D7OA 4HIIA 3TPUB 5CIPA 3WFCH 2J73A 8CGTA 2OTLP 1ES0B 2CPBA 3ZE0E 5IGXL 4F2ME 5JIDA 3X13A 5HYIA 4YHYC 1MW1A 1R3IL 1OOAA 5FYJE 3AUWB 3OKKB 4KJPC 5T3ZE 5C70A 4NKQB 2AXTE 4L5FH 3N0PB 4M6NL 2ZWSA 4MMZB 4PD4J 3OHMB 2KZJA 5GGRY 4ALAH 3F5WB 4Z7UF 5BJTA 4TNEA 4C4BA 1MCCA 1AJ7H 4IQHA 1BYPA 5GHWH 4TNWK 3H3PH 1NAKL 3KLHD 4TNFA 2ITCA 5H37G 3ARDD 2HFGL 4W4OC 2XV6B 5ECGA 5IB2A 3QZPA 3SDDB 4GEIA 3D48R 4I7ZC 1T6BX 1BJMA 2VERA 3QK0A 3HTLX 4Q9QH 1L7TH 1O9WA 2VUYA 2Q8BL 2LR2A 1JI2A 3C6SB 3N9GL 5I73C 4M61A 1OCZB 4NBZB 1BEYL 2A9AA 2AF2A 3MRFB 3Q6GL 4IRZL 3LNGA 3KXFB 2QM8A 3QYMA 3VGHA 2J4WH 3WKPA 1INDH 5SX5H 1NCDH 1OCWH 3BP6B 2X5PA 4X80H 4WWPA 1KACB 4RO0A 1L2PA 5L6YH 2IDFA 1XF4B 3VXRD 3RWHA 3CX2A 2WUBL 1X9QA 1QKZL 1IEHA 5IF0B 2ZAHA 5SWSD 1SQBE 3S48A 1T1XB 2DLGA 1KEGL 3PTZA 4Z7NE 2E59A 3O2WL 1K8DA 1OT2A 5CS7A 4DQAA 4N2IA 5CCJA 3IMSA 5ITFB 2NTFB 2VOTA 4HOMA 4PB0L 3L5IA 5DJ6B 4PG9B 1F3DJ 4HMCA 2PR4H 1JCKA 1OXZA 4OIIL 4BXLA 2QEXP 4J3WA 1KFAH 1OV8A 2HXAA 4ZPTB 5C09E 1IFMA 1NBVL 5I66B 5I6OA 3UPRB 1DVYA 1YEIL 4HIHA 3WU2E 1MJUL 4PY8I 2FATH 3RB5A 3GSNH 3LW5J 4Y2OB 1X44A 5FGCE 4DP1X 4Z7QB 1JPSH 3CH1A 3F7PC 4W4OA 5IG7A 2VQ4A 4XNQB 1B6UA 3RGVC 1RMFH 3QDMA 5TE4L 3VFTB 4IOSA 3G9VA 3MKKA 4QRRD 2YJLA 5I0WA 1UB5B 5I15L 3GMOA 1KLFB 1KJ2H 1S5HA 3EFDH 3P8CD 1P5VA 5I8EB 4QHLA 4RMVA 5C2UB 4KPHL 1JZ4A 1EMTL 3MXWH 2QQLL 3QEUA 4AM0B 2H1PL 4LARL 4RDBA 5IUCA 2Z93A 1LO3L 1OP3K 2AJVL 1XH3A 2ADJB 4L23A 3OLDA 4R7XA 3QUGA 1S7SA 5CEZH 2W60B 2FNWA 5LBSL 1SQPE 2WN3A 1NPUA 3ZMEA 1DVTA 3AQDA 1RERA 4WU5B 4XH2A 3W9DB 4A2DA 3EOBB 5B66E 3SDCB 2DOCA 3BH4A 1Z3RA 2N1KA 5C39A 3QAZC 4WEBH 1MOEA 1YNKL 4V1DD 3TT3H 4IBZA 2Y6SC 3BGFC 3C87A 4J3OD 1PKQB 5FV1L 2ALWA 2P3YA 3L71G 3PWLA 4M7LH 3DRQA 2FH8A 2WKOA 1VB9A 2WINA 4XXDB 5IMMA 3B4NA 2EADA 5D6CB 4X42A 1QFHA 4RAUB 4M29A 2EDTA 3MYJB 3PQYD 1A7QL 4OCSH 5IMOA 4LLVA 5IHWA 5D7IE 5TE7H 1KPUA 1MN4A 4N0CC 1NCGA 3QH3B 3KVDD 3GHGB 2WWMC 3S3BB 1XF3A 5KLVD 3EYQC 5MEQB 3G04B 1UM4H 1QVGO 5HHVL 1L9MA 1AS7A 5SWZD 3VFUB 3JV4A 3VD7A 2X38A 1WD8A 3X3GH 4LCYA 3JWOL 3GRGA 4YIQA 5DUBB 3ZRFC 4PJIE 2RJMA 2MQ3A 4N0UB 3C8DA 4UT6L 5I1LA 4LLDB 2O5XH 3RGVA 4AQ1C 4ANWA 2JXMB 5IFHL 3S36L 2ZWKA 4JG1L 4M1DH 2WQXA 3M86A 1DDHA 2EH8L 4OQTA 3DLQR 4XPHH 2ED7A 1GZQB 2AJXL 2QPEB 4QHMB 3CQFA 3M91A 1DO5A 2GB2A 4TVPE 4XXWC 3LKQB 3IWUA 1H15A 1DBKL 1OLLA 3KPSB 4UDUB 3MIWA 1KB9E 3PIQB 1P7HL 1AYRA 1F8TL 4JF7A 3WKNA 3CDCA 4L8BA 2PYED 2XKNB 1KUMA 5HI3D 4U1KA 3UACA 4YXHL 5EU6B 1Q90A 5E5LA 3ABMB 3CSYA 3ARWA 4WO4C 2XX1A 3NJJA 3W1ZA 3KZIH 4OCRL 3H6JA 4CC4C 1A3RH 4UTAA 2VJ0A 3GJEA 4LEXL 2VLRA 1HJBC 4IDLA 3U82B 3OHXC 3AACA 3P11H 3L45A 3T0EC 1R4XA 3J7HA 2QR0A 3BUIA 4I87A 4D9QE 1E2WA 1WUNT 3D85D 4UQ9A 5D96B 2CKBA 2Q6QA 2CO3A 3OX8B 1R5SA 3IDXL 5C8JB 4JGNA 1PZ5A 3HC0B 4APXB 2DL2A 3U4BL 2IEPA 3I3EA 3LQAC 2YRZA 3H1KD 5ABAA 3MBWB 4OBSA 1BD2A 4QNPE 5C0JA 2IFGA 2E4TA 4S1SH 4BFIA 3MV9D 1P4BH 3PJLA 5TQ2H 2X6AA 2X87A 2YQ3A 3FB6A 4HIJB 4CW1B 1URLA 4YFLF 4U6XA 3H53A 2OL3A 3VXOB 3ZDMA 4K3DL 4PBDA 5JYLA 1SQXD 3KL5A 3QJZA 4WUUA 4AQ1A 1EZLA 1S5LE 1G87A 2E74B 3IU4H 4J4PC 4WTXA 3NN8A 1NTKE 4OCLC 3CXHD 3DA0A 3T09A 4KKNA 1WC7A 4QF1B 4A2HA 4AIOA 2IGFH 1FZCC 3O6LH 4GUPB 2IGLA 5BO0D 1JGEA 1OXYA 3HCVA 1PY0A 2BEQD 1XGTB 4XXWA 2KS1B 2R59A 1RXLA 4NC2B 3EH3B 3CK0H 3O6FD 3I9GH 3GSNB 1AGDA 2BP8A 2RTTA 5IQ7L 1KMGA 4M1GL 2KLTA 1A9EB 4QXTA 2HODA 3JWDC 1IBZA 3N42B 3CC5B 1PV3A 4WO4A 1IGTB 2C1OA 2AQ2A 4CC4A 2YIUB 5CEYA 5KYWA 2OS7A 1PYWA 1BGYG 5KTBA 3VWJB 2P42B 1HJBA 1BAGA 2VERN 4UB8E 5HHOE 2KXPB 3OHXA 1KPRB 3LB6D 1LTAC 4E41D 2N9YB 3T0EA 1BX2B 2QJKB 3SDXF 2VAAB 4G59C 4TKWA 4KNQA 2KSJA 5LGYA 3ULUH 4FI8A 1B2YA 5LBVA 2Z7ZA 1LWUC 4LBEB 4G43B 4ZSOA 3V0FA 4LGSB 4AKPA 4GG6F 1QBLL 4OGYH 2MFNA 3ARFB 4ZBJA 2L7EA 3BZ4B 3RG1C 2HKFL 1ZANL 3QUMA 2OYIC 4P46D 1X22A 2H3XC 2ZXAA 1AZBA 2RH0A 1FZKA 2KZWA 3C2SA 3SGJC 3CZLA 1YBKA 5H2FE 4JM2C 3A5VA 1OAQH 3OA7A 4QIRA 1DQKA 3MBEB 1SS1A 1U93A 1U3NA 2FYVA 3ZGIA 4DP0X 1Z0NA 4R2GD 4H13C 4JKPH 3SBQA 1BFVH 5CN1A 1NAYA 5K1VA 2RAMA 3UAAA 2BS71 1BAFL 4GG8B 4AV5A 3FPYA 1DQMH 4JBSA 4N3YB 3D4ZA 3KYAA 4G1MB 1WWBX 4J4PA 4PV1D 3GB7B 4ZNCD 4OLYL 2VDML 5T1KD 4KK9C 5BVZA 1VACA 2OMNA 1TUPA 1XGUB 1F45A 1KTLA 1DFBH 5AYUL 1QFPA 3RJQB 1FZCA 1K8IA 4XP6L 3WHE0 1SFCB 3AW5A 1J1XH 1CDHA 3HNSL 1DVXA 4HFUL 3V4LA 1GPOH 4K9EH 5CZRA 2OXGA 2NXYB 5E4IA 2APSA 5K39B 4EUPA 5F89B 5B7MA 5IB4A 2NY0C 1Y07A 4BA8A 4EQ2A 3UH8A 1FBIH 4ZS7H 3G6DH 5BRQA 3TCLB 3AITA 1Y8AA 3V9CA 3O4LB 3I50H 5ADPH 3FF8A 3QJOA 4HGKC 1PZDA 4F8NA 3QWNA 5CP7A 2PPCA 5FYJH 1HILB 4NRZA 4ZX5A 1TLKA 4FNSA 3RK3B 5T3ZH 4XNBA 4BKLA 2AXTH 2ZPKL 2NNFA 1A8ZA 4XMPL 2EE3A 3UC0L 4TVPL 1CCZA 1OTTD 1LWUA 1UH2A 1XGPB 5DHEA 1CICD 1SPDA 1UJTA 2CLZA 1KTDB 3QHZH 4MJIE 4LLMA 1I7ZB 3IVKB 2FJUB 4QYOA 2JQMA 3FUMA 3BDBA 3SGJA 3AG3B 4JM2A 4OZFH 3PDGA 2HRPL 1BEXA 4O2FA 4DTGH 4JPZB 2EEDA 1WBZA 5T8IA 1JV2A 4DH2A 1JN6B 4Z3FA 2GSMB 2WP3O 3Q9QA 5T1DH 4OI9A 4F3FA 2FO4B 4X6BA 2F54A 4RGND 5LCVA 4DP6X 3IRPX 5HI5C 4KKBD 3PAZA 1TQBB 1MCPH 4PRHB 1VEPA 3MUZ1 3TJEL 5EEXA 3CFBB 1VQNP 3AT9A 4QTHA 3U1SH 3S3DB 1DO6A 4FNTA 3EF7A 3UJTL 5GGVL 4ZRGA 4FFWC 4B9IA 4NWTH 5DD0L 5IW3A 1RZFH 5LG1A 2IXQB 3VO0A 4HYTB 2HP4A 3HB3C 4UIMB 4ELKB 1T7VA 5DD1H 1VFMA 1DSWA 4FLRA 2Y7MA 3CHQA 4KY2A 1KMIZ 1AKPA 1UM6L 4M5ZL 3KPRE 1PPIA 4JL2A 4BSWA 4RGOL 2W0FA 3WKML 2YBGA 5BVJB 3ME0B 5E1HB 5KSUA 2BOBB 2WXHA 3LZLA 4XPTL 3WELA 3U1CA 1FLRH 4BFEA 2CCWA 3A67L 4KO5A 4XX5A 2XXMB 2LV4A 3AFLA 3CN0A 5INDB 1LP9B 2DQJL 4ZJ9A 3RUGA 5INCA 1QMUA 3SODB 1RJZB 2R0WL 1BAWA 5I5JA 4F8LA 3WU2H 4KUZL 1KQLA 3MLUH 3SDYH 3SPJA 2O6CA 5JW3H 1EZVE 5JHDD 3O8ZA 2IPKB 1J88A 3L75G 4LHUD 3MJ7A 2P47B 5DS1A 3LKSB 4C7NB 4LAQH 3H6AA 2UZPA 5BRZE 3SE3C 1IKOP 4EQ3A 4PS8A 1PFOA 2BVUA 1BZDA 1HHGA 4GT1A 4YXKH 2PPAA 1GL2B 4MA7H 4N5EC 1QYGL 4G71B 2H6OA 1D2OA 3TZVC 4EOTA 3G5VA 3HMXL 5LXGH 4TLFA 3X3FL 4XMLL 4IW4C 3C8HA 2L5GB 4OM0L 1DBMH 2XQYG 3LKPA 2LVEA 4HV8A 4I3RH 4JRYB 4TQEH 1E5CA 2VCOA 4NHCL 2H0FA 4YNYA 3IRCA 4UT9A 4WJ5B 4IL6X 4A2EA 2DMKA 1YQVL 2AK4B 4YSOA 2QADB 1INEL 3CZFB 4C56A 3MX0B 4Y16D 4YR6A 4Z76B 1FGNL 2YN5A 3DTUB 3VFRA 5E7FA 4NNPL 4MKMA 4WCYL 4U6HB 2WNKA 3QEQE 1XIWD 3HG5A 2Y0EA 1MHHA 2PCPB 3IWVA 3FTZA 5G4OA 4YSSA 5F1KC 2A6KA 4I2XB 4N9GB 5HVWA 3WTSA 3RIAK 3ABKB 3IGKA 2E6QA 1ND0B 5HDBB 3EGXA 4FHJA 3L6FB 4FQ2L 2DQEH 4Y9FA 1JZ5A 1LO2H 3H85A 2P48B 1L4AB 1FH5H 1Q1PA 3KW7A 2V2TA 4M43L 2P58A 5C0BE 3H9SA 5ABDE 1BDDA 2V3FA 4HQQH 4LASL 5FHAL 2FLBT 3QDGB 5J0BA 1E27B 1BVKA 4ZOCA 4NQED 3H0TB 4MAYD 2IBZY 5D2LB 1MF2L 4RQQA 1F1DA 1ML0A 1BJ8A 1JNJA 1U8KA 1A6VH 1RUPL 3ZE0B 4F2MB 1OAZH 1MIEH 5DWUL 5F6IB 3KWXA 4NO5B 2R2BB 3EZ8A 2Z35A 1BPVA 4PIRF 3H3KA 4TRPH 3C2AL 4Y4KD 3SE3A 3TEUA 3IJEB 2XNAB 3SCMD 1VQ9P 5TPWH 1S46A 2YXWA 4L3CB 4H0GA 4ZTPL 1N64H 3P9WB 2XKUA 3EJPA 2J8UE 5DQJB 1TNNA 3B1UA 3HN3A 3B7YA 3TZVA 4LLQB 3MOBH 1EDJA 5AOIA 1G0DA 2BVTA 1DJYA 3S5YA 1EHXA 3LH2L 1KYOD 1BVZA 4WZ9A 2A6IB 4OZFB 5DEGA 1XD1A 2VSKB 4EN3B 2F18A 4TLUA 1NPJA 3KBFA 3ARBD 1C16A 3GUFA 2OYLA 1JIBA 4LLYA 2ISDA 3L1OH 3V55A 1AD0A 4DP9X 5BQDA 4WDIB 1CXKA 4W9JC 2GIMA 4JM4L 4ZOAA 4FA7B 3IXAA 1ACCA 1XTCC 1CT8A 1S9KE 1R3LB 3B9AA 1SN5A 4MS8D 1VF5D 3VD1A 3SQOL 1TFHA 3MNVB 3PDOA 4MHHG 4XPBL 4HG4J 3STZB 5K9QG 3TH4T 2XY2A 2XZCL 4U0QB 2UY7A 2XN0A 5GSRA 3ZKQD 4HIEB 5ICXB 5JW4M 2JELL 2JMRA 4NN6C 1N5AB 3FB7B 2Q76A 4Z3EA 3CZEA 3NGBB 2EXSA 4KNTA 3FO1A 4XN8A 4AEEA 1A4AA 1L7IL 3LIZH 2YQGA 3JSSA 4Z7NB 4HKXA 4OGQD 2B1OA 4ZTEA 4O00A 1YYML 3UO1L 3L73J 4XMXA 4XN2A 3UBGA 1N2RB 1M1XA 1S5LH 1PEZA 2FIKA 3S2AA 5J06A 4KRPD 4XPAL 3RBGA 3UTQA 3WMSA 1TVHA 3REVA 3QUHA 4NPKA 4DKFH 4YDLC 5IJBC 3T2LA 2Z8SA 3E7JA 4F7MB 1MNUL 2CMRL 1AVAA 1AS8A 3GXDA 4QLWA 3OVUB 4G8FA 5C09B 5E9DA 3UTOA 4FFYL 5IFJA 3QUXD 2RB8A 2BFVL 3VWKD 5FGCB 1R3KB 4OV6F 4F7CA 3OKMA 3KLLA 3QRFM 5IBLC 5JOPD 5TJHA 5HYSA 4I89A 5CM1A 1YJDL 5AALA 1YQ4C 2A73A 3D5OF 3ZKXC 2HG5B 1TQSA 2NY2D 2QKIB 5C0IB 3QZWG 4Q2ZA 4MSWA 1DUZA 2AEIT 4JPSA 4HF5H 3VMOA 5HI4C 4G7SB 1G9MC 3QPKA 1EDIA 2JB6B 4Z7WE 3MCLL 4BEIA 3QQNA 2H9GA 2DQIH 2AV1A 2DMCA 3I6GB 4JG5A 4PI0A 5HYEA 3WMPA 4OGXH 2BVOA 4LL9A 3IDJB 1HDMA 1MW0A 2RKLA 3CCQP 1EBPA 3GSQA 4WU7B 4RAVB 2EEAA 1D6EA 1AGCB 1TZHB 2DQGL 1HE8A 2VN7A 5L0QC 3ILPB 5FC9A 2H45A 4R4ND 5CAYB 2R7EA 2O5ZL 2DTML 2YA0A 1A1OA 4ZXBC 5H2FH 3RTQD 3WY3A 1LK3L 5APXA 2AEWA 2L8AA 4I9XA 5J6HB 3M1BA 2PPDA 3II2A 4IIQB 1J1DB 5I1KH 4PRPE 5MEOB 2R0ZL 3S4SA 2AXGB 4DUWA 3F01A 1Y47A 3ULVC 2EUZA 1UVQB 2FIRT 1T20A 2BZCA 5F9JB 1SQQJ 1ID2A 1CS6A 4QRAA 3ES6A 3A6OA 1ICTA 4JFZH 2NY5L 3K72A 1AP2A 2YN3A 3L08A 3DUHA 3NACH 1E9PA 5D7IB 1NINA 4IU3B 3PP5A 1T03L 1HQRA 2HFFB 3OJDB 5EPMA 1EA9C 4UOJA 1UB6A 3RK2D 1KENL 5J56B 1URQB 1QR1B 1RUMH 1DANT 2XRAH 4PJIB 5CGTA 3PRJA 4CPGA 1DQQA 5JQ6L 4Y4HC 3GSUB 1OP3H 3CIQA 2VR9A 1RFDH 2P8PB 1JZEA 3Q7JA 1VQLP 4MNQA 3AMLA 1K05A 3QJSB 5K9JL 1X9RA 2YD6A 3K6SB 4H26B 3ZRCC 3GNML 3K74B 2ZXWB 2P5EE 4Z3JA 3CD6P 5AZ2H 5I1IH 1LNUA 2X4NB 1KELH 3DIFB 3GMNB 3TT1H 2GSGB 4M48H 1SJVA 1T1YB 5KW9L 5BOJA 4MMXB 1O6VA 4Z0BL 3V4VH 2BOCB 5JORB 3MO1B 1YAZA 1MRCH 4LOUD 4XVTH 3FC8A 9PCYA 3DMMC 4Q6IC 3VD4A 4R3SA 35C8H 3DX6B 4ZXBA 4X50A 3U9PH 1HL8A 1YN6B 4Z7OE 5HHNA 2ETWA 1ACXA 1AG0A 3B8SA 3CCLP 3WUZA 1N9PA 5BUPA 4PD4K 3HI6H 1DBBH 1P69B 2HG0A 2NY1B 1DVZA 1KB9I 2HFED 5F6HI 5HJDA 4EN2A 3CC4P 3CFEB 3DVGA 1MNNA 5C0DB 3BGAA 2GABA 1P2CA 3BKCL 3NZUA 5JW5B 1NANI 2BK8A 2DMHA 3GHBH 1CE1L 3ESUF 1OAUL 5BVPH 1RLWA 3BLKA 3WIIL 1X5KA 2EZ0D 2X4QB 3TVMD 1F11A 2WXKA 2JJLA 1SHWA 3H9ZA 3MFFB 3B5TA 4I18B 4LCWA 1YNLL 5D5MF 4JGJA 4B50A 1UURA 1B3IA 4S1QL 3U7WH 3K6FA 3ZDXE 1UG9A 4ZO6A 2H6PB 5AZEH 2B88A 4Y4HA 5EIIB 1OF2B 3Q3DA 1HZLA 1FG2B 3LPGA 3M9HA 4YEFA 3BSGA 1I8KB 2ENPA 3VGDA 2WLIA 4P0DA 5EDSA 3B7RL 3BN9C 3GINA 3PXHA 3FOMB 2R56L 1LD9A 1P84D 4BXSV 4EZKA 4D6TD 1IC2A 1FFRA 2IFMA 1T2KD 1UD2A 2R2HA 1YN7B 1VPCA 1ED3A 1MCJA 4HKJA 5E1QA 5EZOH 1LJ2A 2E76C 2WZ5A 2RHEA 4M02A 1H88A 1SFHA 5I8KH 3MI6A 1L0QA 3F7QA 3HD7D 3KGSA 5FA3B 4AZ8B 3TBVB 1Y18B 4IFDK 4JFYA 4WK4B 1HOCA 3T4AB 5DJAA 2Z7UA 2XN9A 3DMMA 4FQLH 4Q6IA 4X9GA 4ZAKD 1DFXA 3FFCD 1BCCJ 1NGQH 1IL1A 2VWEC 4XTRD 3C6LB 1CR9L 3RWCB 4O2EB 3V5HA 5ILTH 3QEHA 4JQIL 1Z5HA 2MCPH 2VZOA 5BS0E 5KS9A 3D1MC 3VA2C 1NBQA 3A47A 4UMGA 5T5NF 2A06G 2NZ9D 4F9PC 2CHXA 4Q9BA 3PV6B 4UU9A 3OKNB 3STLB 3UL4A 4KZEL 2CALA 1YDPB 3BEVA 4YFDB 3ZO9A 5ID0A 4ZUSB 3MHVA 4L1LA 4YSAA 5I0DA 3NK4A 1ZRTD 1CIUA 4FFVC 3W5NA 1XQ4A 4LDLB 1CGTA 1T6WA 1E40A 1TZAA 4J3UA 5HPOA 3EG9A 2F7QA 2Y1AA 2ADGA 4BQ6A 4ADIA 3SKOA 4NZ8A 1YEDA 2UZYB 3UJIL 4F7EB 2AQSA 3FO2B 4QRBA 5JPMB 2RN0A 2QSQA 1QLRB 1NH4A 4EMZA 1OD7A 3DARA 3L70D 3SY0A 3B9EA 1N0LA 1VPOL 1W8OA 2EIEA 1SY6H 3LD8C 5EO0B 1GZHC 2AQNA 3K5RA 1BIIA 2VT0A 2F19L 4QCIB 5I74B 1JWSB 1ZA6B 3LS5H 3G71P 4G7YH 5JXED 1OCRB 2OQJA 2EYRA 3IMWA 1AKJD 3R7RA 1G2CA 4H1LA 4ADJA 2UY6B 2CK0L 5FW8A 4I1RA 2DLIA 4Y99C 2XWJB 2FXPA 1MVUB 1R46A 3AREB 1BP3B 4DEUA 8FABA 3EYOA 3IDYC 2WBKA 1PFCA 1Y0LB 4RLDA 2NY3C 3VI3E 3KPPA 1Y6NR 4NYLB 1U36A 1WFIA 3CXDL 3EDKA 4HSCX 4PAZA 3VH8B 5BRZB 3IFLH 2X2IA 1GK4A 4ZX4A 4ODBD 2FQEA 2NX5E 3MODL 5IROC 3WU1A 1EO8H 4JFTA 4NQVB 5DMYA 4POYA 4XI5C 1NJ9B 3O41A 3VXMA 3ZDZF 1DSYA 4U3FE 3T4YB 1NM9A 2IZ0A 3PGFH 3VI4F 5I5MA 4I13B 4Y88A 2BNQD 4PGCA 3TM6A 3BAEH 1ID5I 2BSBA 3VJ6B 4F9PA 3QUZB 4OLUH 1DVFB 4PB9H 4NGHH 1JZ2A 3S4RA 2BCCE 5IFAL 4MJIB 1OQOA 2H4EA 3W81A 3DYMA 1MFZA 1RSFA 1I8UA 2WNGA 3GSRB 3V4VB 4FZ8L 4NAMA 5HDQL 2CGRH 1KSRA 2Q7NA 2IOIA 2VC2L 1ZPUA 1HI6B 1Q9WB 3V52L 2P8LB 3JTSB 4JYCA 4PTTA 2ROYA 1JY2O 3H1IG 2PXYA 5GZND 4DAGH 4EZMA 3K80A 1P84I 3FCSA 3REWB 2C3HA 1WG3A 3VB8A 2ZKYA 5CZXC 4JAMA 1P7QD 2WBJC 2BJML 3FT3B 3P9MB 3FT9A 4NHUB 3ULSB 5EEYA 3PABA 4KK6D 1BECA 3DWTA 5EU3A 3W67A 4H4NA 3DSFL 3G5ZB 3MACL 1UM5H 5C0ND 3QJVB 1YPZE 1GZHA 3SJVD 3NIFF 2SODB 1CG9A 3FT4B 4KWUA 1WTGT 2NY7L 4WUKH 2AW2A 2EXYD 4JDEB 4GXVH 4PW3A 4WY4D 3A5TA 3FUDA 5E94A 3RDTC 3DX9A 1OB1A 1BQKA 1KGWA 4XP4H 4HH8A 4XN4A 1D5BB 4D0BB 2Y7QB 1K73Q 5F7YC 1YTZT 4L29B 4JK0D 1MXGA 1MI5D 4HMDA 4KJMA 2TRHA 4HZ1A 4JFDA 1NTDA 2IDQA 4POZD 4PEEA 4MZIA 3B3IA 3UYOD 3KPRB 1FS0E 5IROA 1N3NA 3CN2A 4I9WE 4R0LC 4NO0A 2FHFA 5DFVD 2JIXA 4EIJA 4Y5VB 2L04A 1HJCA 3D39D 5FKPB 2PWFA 3P2DA 4U6VH 2DM2A 4AXWA 4TTDC 5DT1H 4QXGH 3EW3B 3BWAA 1WZ1L 4DSYA 4IBUA 1IUZA 2HTKD 4PD4E 1YPZF 1DQLL 1NKRA 2CJUH 4OF3A 4Y2DB 3GGWA 2ITDB 5DMKB 1UH3A 3ZU8A 2M26A 4JN1L 4NDMB 3CFUA 1I4FA 4XCNB 2N7AA 4X4YB 1K2DA 4Q6KA 2B5IB 1I1AD 4YDKL 2EP6A 2OQQA 1N8ZB 2XWTB 2ADIA 3BDXA 4GW1A 4NKDA 2WBJA 5FFGA 4ZFQA 2DQCL 1BQ5A 2XBDA 3HZKA 3LXAA 2IDTA 3QNYA 3IFMA 3MUGB 3OD3A 2FXOA 4HZLB 5H2BB 2QGBA 2NY6C 2W94A 4ZFOB 3DTXB 5EF0A 4OIAA 2FX9L 3H1LE 2WAHA 1GYVA 3K0YA 2DW5A 1EZVI 4KTEL 3BO8B 2BIHA 4YBQC 2CDEB 1R6VA 5LWYH 3MRBB 3IE4A 3RDTA 1AJYA 5GS0C 3W37A 1ZCRA 4JRXD 5TDOA 2HPOA 4CUCA 2WTOA 2N0KA 3MDJA 4XC1H 2HUEA 4NCDA 1RI8A 3AM8C 4NUGH 1M05A 2EDRA 3QWQB 5C07E 3QEQB 4KXAA 4PJGE 2WZ7A 2WVUA 4IYKA 2H2PC 1F5WA 1CFTB 4FG2A 2V4LA 4XNUH 5B39B 1QSFD 2D3VA 1DBJH 4JLRB 3OWRA 2PGDA 1RQUA 1MAKA 2AJYL 1PSKH 4FMFA 5K69A 4R0LA 2L3BA 2Z64C 2HT3C 4P3WA 3HPJB 2VISB 3DROA 4OZIF 4H44C 4J6RL 3QFGA 3L71J 4IEFA 5DRWB 1N68A 4QXWA 1GXEA 1CGUA 5C0BB 4HJIA 4XO5A 3NFNA 5DHVA 4KGLA 5I6MA 3RWEA 3TGUD 3RI5F 5GGUB 3MGAA 2Z91B 5LGHH 5JHLL 1T8ZA 1EEZA 4J27A 4U6YB 4JB9H 4X5XA 4QHNA 1XBDA 2P4AB 1ZOYC 3DECA 3RFRA 1NFIB 2EABA 4AYMC 4BM7A 4XMTA 4A2MA 3LKRB 4NO2B 1U0QA 2A9DA 1AQKH 2ROXA 4PJ8B 3GSVA 1E67A 1BLNA 4TLKA 1OIPA 5D55A 3HC3L 2G4EA 1OANA 2WVVA 3U9UA 4ZUVB 1M1SA 1L0ND 2IO5A 2N1TE 4FG4A 3BC9A 1RK0A 1MFMA 5CSBA 3OR7B 5MENE 3CQQA 2J8UB 5JR1H 4C4KT 3TTSA 4ZZKA 2CZNA 2YFOA 4FQXB 4UI2A 1M1KQ 3FXDA 2APTA 2IOMA 1EGJL 2VR3A 2ZFCA 4R8WH 1BG1A 5FM5O 1GHFL 1V7MH 5FIEA 3H1HJ 2WXNA 3LZOA 1ZLLA 3ZOAA 3AB0C 3CFJA 2IF7A 1PX8A 3LN9A 4HHWA 2F7PA 4YX2L 5C0CA 3HHRB 2Y2TA 1WRGA 2Q6WB 1KIQB 2R15A 4YHOH 3AM8A 1U2YA 3ESPA 3V0JA 2D8KA 1T7WA 1JMXA 2VITA 2XPGB 1PQZB 1UIIA 3FQTB 2WSEH 2J5LB 5DU7A 3ERXA 5IQMA 2Z8VC 3G5XB 1LO4L 3BE1L 1J87A 3KPMA 1P0SE 4NQXA 2P24A 1MJJA 1NGMB 3H1ZA 1QRNA 3BKYL 2YSSA 4R97B 1L0LG 3O8XC 1EHLL 4JZNA 1U4FA 1HS6A 3WD5H 1E7UA 3GS4A 1LTTC 4QRFA 4UILL 3JT2A 5BZXA 5JXAH 1RUKL 1FZOA 1VFAB 1CI6A 1DUYB 1UOKA 4Y9CA 5I8OL 1IM9A 3TN0D 4ALAL 4FKKA 1DQTA 2GC4C 1RV6X 1FPTH 2H1LM 5E5MA 5DZVA 3S34H 4MA1C 2AAAA 2A06D 2AEQL 4UBDD 3B9KB 5IV2A 5DC4B 3SFEC 1KCVH 2XV5A 1XFPA 2BO0A 4QRQB 4YO0A 1AHWC 4HBCH 7TAAA 4F5CA 3ZRSA 2GJ6A 1LTJB 4XCFL 3F6IA 4ZFGH 3D69B 3L3GB 3AE5C 1RHZB 3BIKB 5F9OL 3KYQA 3RVUC 4G7QB 4PJBA 4KQ4L 1UCTA 2OI9C 5GGQL 4APQD 1U3HD 3GEFA 3MJGX 2UX6A 4FP8H 4PTUB 3ZYZA 4JDZA 3V7MA 4J7RA 2Y36L 2G5BB 3IB4A 4HXBL 2X2HA 5TH2B 1OCWL 2P8MA 4JQXC 4Q7DA 3HFML 4WTZG 3EQ2A 4JY6B 2QJPC 1SMDA 1X5XA 2QV2A 4Z7WB 2GY7B 4XVUD 1BA9A 4H0LB 2IC2A 1B4JH 2QBWA 4FNLL 1MCOL 4WY7H 2D2CC 3ARQA 5DJ2A 1WWCA 4FG6D 3ITKA 2IQ9L 3FTGA 3H7BB 3QQ9D 3TO4B 5GZOD 4R26L 4X6DA 1ZGLB 2B1HH 4NXSA 2YFNA 5D71L 4UTBH 2Z7YA 4DZBA 3ETSA 3O8XA 1M2OA 2APXA 2D4DA 1AXTL 3DOSB 3Q5OA 4HIPA 3EFGA 1CDUA 1NC2D 3VG9B 4EJ1C 2BNRB 2VXVL 2VXQA 4JFFD 3VGGA 1L0XA 4PRPB 3FUNA 1W5CE 1LK2B 3QDME 1KCUL 3U46A 6PAZA 1A4KB 3CHRA 4G8GA 4ZMDA 4NUJA 1WHPA 2C26A 1B90A 1JZ7A 5E2TH 4BK5C 2OX5B 2HJKB 3TA3B 3DIDA 3TO2B 4KITB 1JY3N 4X98A 3L72G 2APBA 1H3VA 1ZLUK 3SDDD 4YL9A 2R3SA 4BRYA 3BVWA 3LZFL 5L9DL 1GSMA 5C2BH 1AHWA 1ZTXE 3TF7C 3LJ3A 4TPRL 4P9ML 1AQMA 1NGYA 3CMOH 5L4FA 1YY8B 5DLMH 2HB0A 3M17A 4LMQI 4MDRA 2OZNA 4OUUB 3BUYB 4W68A 5F8RC 1UWGL 1RUAH 2HMIC 1JZFA 4WW2B 3BZEA 1NL0L 4K7PH 1J9SA 3QRGL 2CSPA 1F6AA 2A9ML 1KYFA 3WSQH 1EAPB 4JDVA 1TMCB 2J2ZA 5E6UB 5ACMA 4MX7B 4L75A 1AC0A 4OZHF 3B8EB 1U8MA 2FEDC 4JQXA 2VDNH 3C5ZC 5ALBL 4F58L 1AZVA 4HS8H 4S2SB 1HSBB 1U58A 1WJ3A 1BJ1H 2LAGB 3WEBA 5BQ7A 4KC3B 1T3JA 4AG4L 4ZO8A 1LEIB 4G6KH 2P5EB 2MPVA 2IDBA 2E7MA 1PP9G 5ESVB 3IPBA 1L6XA 4UUJB 4BDVA 1HWWA 1IBGH 2PWDA 2ZT9B 2KUTA 3O11B 4I48B 4PW9A 4JFSA 1YVLA 3Q2YA 5DUPL 4MCMA 3VGFA 5B7EA 3QWOB 5I30H 43CAB 1FFPB 4TL5A 4XNMA 2KNCA 2V5YA 2UYLB 4U1SA 4LLWB 1IGCL 5DHDA 2UXGA 2NRDA 3MRIB 3FFDA 4JREC 1CFQA 1HSAB 4I0PD 4RZKA 1F4XL 4Z7OB 2XKSA 3V0WL 2FYUG 1ANUA 1CTMA 1XB8A 4EZLA 3SWFA 3NJXA 5JIPA 4NZDA 2W1NA 4OLEA 5H94A 3SSGA 1I3RB 5KBKA 5I17B 1YNTF 4KHTL 5FOBA 4YS4A 3WDHA 4BK5A 3BUDA 4G9DA 1QSEE 4O4YH 4YSEA 5I16B 4L4JA 4CSZA 3KYKL 1XO8A 2K45A 3MJ8B 4DNLA 4O2CB 1IQWL 2BS9A 2X6VA 4AC2A 4AJWA 4F1ZA 4XPHL 5DA0B 1NGXB 3KPTA 1RP9A 5D7JC 4I1LA 3SZ6A 4QHKJ 5F7MC 5C0AA 4NZRH 5CBOA 4IRSD 4JPKL 5GIRA 3CFCH 4BUHA 1UATA 1YIJP 1CFVH 1MWAL 1I8IA 3ZDXB 1FC2D 1SDDB 3GXUB 4QGYA 1JG9A 1E8ZA 5E1AA 1D6VH 3H55A 4WV1C 3C5ZA 4IK6A 4HG4K 1JF1A