5AVVB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avvB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avvB02
1FOSF 1H88A 5APXA 3SWFA 2BASA 3T97A 2R32A 3P7KA 2ZFCA 3L37A 1SP4A 5AW9B 2N9BA 5AW8B 2C9NY 1A02F 5AVQB 4AUWA 2WPSA 2Z5IA 3L36A 3IR9A 4JYCA 5AVWB 2QM8A 5AVYB 3L35A 3VMXA 4AYCA 3B8EB 3HE5B 5AVZB 2R3CA 3TK1A 1HWTC 2P67A 2XZRA 3MD0A 1FAVA 3WGUB 1SLQA 4LC1A 5APYA 4RETB 1GU4A 1MFZA 2WPQA 5APSA 4AQRD 3LIEA 2Q3IA 3A2AA 1CI6A 1DH3A 3A3YB 3M0DA 2R5DA 5APQA 5AW7B 2Z5HA 2XV5A 5AW3B 1H89A 4KHXA 1T2KD 3O8ZA 3TNUB 5AW0B 3NTNA 2Q5UA 1GU5A 2XU6A 2YO3A 4I2LC 1HUCA 2H7HA 4JYBA 1X8YA 5AVSB 2YO2A 1JNMA 1NAFA 2QM7A 4DZOA 1CSBA 5AW5B 3P32A 1CI6B 1OWAA 3NXSA 3V4WA 1JUNA 1MV8A 2YNYA 4GKGA 2P7JA 1NWQA 1HBWA 3VMZA 2JJLA 3UIAA 2WPRA 4M3LA 1T2KC 3VTPC 2WT7B 2WT7A 3I5CA 2W27A 3HE4B 4C7NB 1GK4A 3NMDA 1CZQA 1J2JB 1GD2E 3WGVB 3LIDA 4C46A 5APUA 1OXZA 2R5BA 1KQLA 3M9BA 1YYCA 3HTKA 3KDPB 1A02J 2W6AA 5APVA 5AVTB 3HE5A 1GZLA 4RESB 5CMZA 1MUUA 3M9HA 3MGNA 1S9KD 4B86A 5AW1B 2KP8A 2E43A 4C7NA 3TNUA 4EOTA 3VYIA 2WWWA 2Q7CA 4I6MC 3TYYA 4XE5B 3VMYA 2P2UA 5AW6B 5AVXB 1HJBA 3M91A 2WTYA 1FOSE 2VRSA 3A7OA 3OAKA 2C9LY 3P8MC 5APTA 1G2CB 5AVUB 2IPPA 3NFQA 3M0AA 3VN0A 1GK6A 2E42A 3HE4A 5APWA 3V4QA 5AVRB 1IO4A 4GT1A 3V5BA 3M06A 3A5TA 4HYTB 5AVVB 1H8AA 5AW4B 2ZXEB 1GTWA 3KQGA 1S9KE 5AW2B
chains in the Genus database with same CATH superfamily
1QSEB 4ZAKA 3BAIA 3HG1E 3HVDA 3FONB 4A7GF 1CGSL 4R2GB 5D7JB 3SDCD 2PCXA 3AG2B 4FP8L 3DIVA 4MNQE 2C3XA 2YA1A 2FK9A 5ITBL 3GJEB 3ARZA 1N4XH 2WO3B 3KWWB 3PHLA 4QOKE 1VPOL 3MJ7A 1HOEA 1NCDL 2XWTA 4M7LH 2WZAA 1FG2A 3VD5A 4TRPH 4PSPA 1Q86Q 1ZLVK 5LBVA 2XZRA 1RHHB 5TE6H 1JDAA 5DK0B 1JPST 4QOKA 5ABAA 1AI1L 3MJWA 1I9IH 4UU9A 1VF5D 2KUTA 4N8PA 3K0WA 5GS2D 1KCUH 2X6UA 4TS6A 1A7NH 2NXZB 3GLAA 1E8YA 4ANWA 4YBLB 2BIMA 5FOBA 1WAAF 2FJFA 1DR9A 2F8IA 1W2KT 2BS8A 1BQUA 4NQDB 3FCGA 1BDDA 1IEBA 1TSHA 5DZAA 3UG3A 1J1OL 5FYLL 2YO2A 1JZFA 12E8L 5D6CA 2QHRH 2YD5A 3TT3L 3Q6GL 5HGAA 3BAEL 1A14L 4Z18A 4L3EB 1XXFC 1PPJD 4PRPA 3ESVF 1RV6X 4X4YA 2ZKXA 2IH9A 1UA6L 2D3VA 2YWYA 1NCGA 3GXUB 1HHKA 5F7BA 2PF6A 2R2EB 3FCUB 2CJ3A 3F84A 4HJJL 3K6FA 4Y28J 2JR8A 1GZQB 3NJJA 2Y7NA 2R4SL 4Y9EA 4GKNA 1NCBL 4S10A 4WU5B 4GT7A 1DVFC 1OQOA 1PY0A 1A02J 1AQMA 4M62L 1PP9J 2NY1B 1QEWB 4LT7A 3H1JD 3UP6A 4LOEA 4F20A 5SX4I 3P40A 4DVRL 4BDVB 1C16A 4AXWA 3UO1L 3U9UA 4PFEA 2HFTA 1XGTA 3R1GL 4GT0A 1KTLA 3B5GA 3BH8B 4GAGH 3IXAB 5TH2A 4JANB 3VG0L 4ABQA 3SWYA 1N9PA 5DTFA 1U8KB 3QWNA 4NKIL 1PZAA 1G2CA 3VXRD 2OK0L 3D0VA 2VXTL 5DD3H 2C4XA 2OKMA 2VM4A 4JPVL 5J5EA 1ZOYC 2J8UF 3AM8C 3NQKA 3A6CL 4ZUSA 4LMQE 2JJVA 3V2NA 1S7QA 3MBWB 4LQFL 1NGYA 2IGTA 2VE6B 1MZYA 3OLGA 2P80A 2O01H 4HP5A 2PO6D 4K9EC 1BWWA 4EUPA 5CEZL 4LARL 4IOSA 1URQC 4ENZA 3MRBB 2TRYA 4X83A 2ZZUT 4GXUN 3V4PL 3ZYJA 1CE1L 1UM5H 4L75A 3RDJA 1QGKB 4U3FJ 2EILB 2NZ9C 5FCUL 1SLUA 2MQ3A 5H37H 3MCG1 2CDFA 3QQXA 5K9OA 1MHCB 4FNLL 2SODB 2YD7A 1IGJA 1OHZA 1CLYL 1JN6A 1X5YA 4WY4C 2ITEA 3MZTA 3W3BA 1RSFA 1T1YB 2JIXB 4KXZI 4AWJC 2PWHA 4BUGA 3CCUP 4FA6A 4YDMA 1QBLH 1EV2E 3BVVA 3T0VA 4K94L 1MJJA 3HAEG 1FLRL 4O58L 5BMFL 4P3WA 3QIWA 3FQTA 3S34H 2ODIA 2WSSH 2VDLB 1BD2E 1BIIB 4I89A 3AACA 4C7RA 3VNYA 5FA4B 3QQDA 3UG4A 2OXGA 4BCYA 2SEBB 3ASNB 4N6QA 2C9QA 2X9WA 1VRSA 1IFMA 1IQWL 5IMKA 1MFNA 4ZTOL 1PMYA 3CFEA 3DX1A 4PV1D 3PLNA 4MA3A 4YFEA 3D7PA 2VSKB 2R44A 1RP8A 2FEEL 1HH0A 4LEXH 5JYMA 1BZDA 3QULB 2NNAA 4OVUA 4FGMA 4RVBA 4V11A 2J88H 4XR8C 5FK9A 2QMJA 1E6OH 2BY0A 3BD4A 2YPLB 4WWKA 4R5VA 1XF3B 3NTCL 1KFMA 1OXYA 4G7QB 3OKLA 4RNRA 3L3GA 4XRCA 3L75D 1YEEL 5I1LA 3UZEC 1BVKB 2VR9A 3CLFH 5DWUL 3VFRB 1JXDA 4A38A 3NABH 2FZ3A 4HGWB 5DS8A 1J9SA 1NTMD 2HYMA 2YJQA 4MD4A 3P8CE 5APUA 3HTKA 1M53A 3QJSB 4OFDA 5DDHA 3SDXF 4XNBA 3ZZLA 4FERA 1T66D 4HUXB 5L9DL 1KBPA 3HE5A 1QFWH 1KFAL 1J8HA 1VPCA 1L9SA 1PD0A 1N4XL 3N1QC 2IAMA 2B0SL 3F04A 4UYPA 1JF5A 2DMKA 3DURA 1A6VH 1H3XA 2VDQL 4X7EC 5TPWH 3MUDC 4E9VA 3FFCA 5EC2A 4ZO6A 3B5NC 1ZR4A 3Q6FB 5EOTA 4NT6B 1R19A 3FRUB 4AQ8C 5KS9E 2CCLA 2IQ9L 4MJ5B 2EDMA 1IFPA 4GI9A 1R5WA 1LL1A 2PRRA 5EUOE 3VGBA 2EDWA 2JB6A 4UOW1 3HTLX 3MRNB 4NZDA 3HE7A 2ARWA 3T1WA 1RI8A 5E94A 3AE9C 3LRLA 3W0WD 3KVDD 1RZ7L 4FA7B 5JIQA 2BC4B 3D08A 4X5WB 2QQQA 4NHUB 1GXEA 1ZV8A 1E4JA 1KYFA 1MHPH 3ROLB 4AGQA 4RIRA 5CN2A 1XR8B 3DOHA 1XZWA 4ZFGL 2R2CA 1SQBK 5F6IB 3GXIA 3HBGA 3OR7A 4QOKD 2IBZY 1JZ3A 3C9NA 2YAFA 1JWSA 2WWKO 2YIHA 1KIRA 3VCLB 2J55A 5DJZB 1P84H 2WBXA 1X4XA 5DD1H 4ELKA 2Z91A 4L3ED 1JM0A 2XJLA 3SDDA 5AVYB 1WYJA 1FHNA 3KPTA 4I18A 4LFHD 3GDCA 1KPUB 4U33A 1P4BL 4GRLD 3ESPA 4N2LA 5F1KC 2ZX8A 2CD0A 2YEVB 3U30B 4S0HA 4R7LA 3DUHA 4YUEH 4LU5H 5GS1C 4UCFA 3LMJH 1N0LA 1TKWA 1U8MB 4QIRA 5FS5A 4JFZL 1PDKB 5ALBH 2Q8BL 2NY0C 4Q2ZA 1QABA 3RUGE 5J6GB 2DJSA 4WRLA 5F9JA 3IU3B 3QDGB 2KS1B 1O0VA 1UM6L 3B2XA 2YPLD 3C60B 4I3GA 4XBGB 1RLWA 2EDDA 2GK2A 3B5HA 1FZCA 4JPVH 4Z7WA 2HRLA 4IU2B 2AJXL 3DARA 1O7SA 1CF1A 3AITA 4JFDA 1EUTA 4D6TG 3H25A 3FWLA 3E6FB 2GJZB 1R3KB 4GFXA 4G83A 4NQTA 4HUWA 3U36B 2JP3A 1F97A 1VZHA 4MAYC 4FQIH 1VA9A 2J21A 3UBGA 2OK0H 1A9EA 4PB0L 2EACA 2XWRA 4HJ0C 4NQEB 5EU7E 4KVCH 1WV7T 2NNRA 5EEXA 1HEZA 2DIBA 1IAMA 1KB9E 1JHKL 4R2GD 4KKNA 4YEEA 1OP5H 4JFPA 1EHLH 2MCPH 3QORC 4MJID 4PRIB 2ESVD 2VISB 4KU1A 4I77H 1GTFA 3GMMA 2G60L 4TXVB 2LLGA 1SQPK 2HLFC 1KTCA 2ZYAA 4KKRA 5BRZE 3MOAL 1UT1A 1OE1A 4C56A 3H54A 3GHEH 4WFHE 3S9DB 2VDPB 4LCUA 3B6SB 3QUYC 4BM7A 4DGYL 2VDOH 4I1PA 1ORQB 2QSVA 4KXZH 3W11C 4PJEE 1L9TA 4IDLA 3N6YA 3S37X 4OCLC 4JFFB 4LDCA 1BEXA 4R0LC 2IOIA 4JO1H 1JPTL 3QZPA 1A6TA 5EUOB 4Z7QB 2NY4C 1HJBA 4PJDB 3BDYL 1OTSD 5KTEL 4CDGC 1U92B 1A4KA 3QG6A 4H44D 2DQGL 2V2XB 1MCKA 3FN0H 3MJ9H 4BZ2L 1OSEA 2ZJSH 5JW5B 1DJWA 2EABA 4P99A 5GRVK 1A7OL 4OFQA 4LEXL 1RE4C 3L73G 3NJFA 1GA2A 4HIIA 4PJBB 5M94B 3QUYB 5E2WH 2KQNA 7PAZA 3WMM0 4E5XB 1CL7H 3D3VD 5G4OA 1KUMA 1AHWA 3CSYB 1HHIB 3MROB 1YNTF 4MMXA 3VNZA 4G1EB 1IKNC 4HIHA 5IEKA 4HSAC 1CD1A 3ML8A 4M9OA 2F53E 3P3SA 3QW9A 2VMDA 4ZOEA 1JZHA 1RH5B 5G55A 1J1DC 1BSIA 3FPYA 3T2LA 5DA0B 5AAMA 3VXSA 4H44C 4JMNA 4JO4H 4PVLA 2D3NA 3H1ZA 4P9MH 5JQIB 5AAWC 2BRRL 5JHAA 3KPQA 1G7JB 5IROA 1IM3B 3T0EE 2AK4D 3FU9A 4HETA 1CE6A 4NAQA 3FQRA 2H26B 1FHGA 1TYRA 2HH0L 2MCAA 2XBTA 4HPYH 4W9ZA 5FHBL 4DAGH 3IJSA 3VQ2C 3MRKA 3D25A 1JV2B 2JJSA 3EOTH 4LLHA 4HUMB 3LIEA 1NICA 4PAZA 2DYPA 3GSWA 5L2JA 1J5OL 2M0BA 3TSIA 2J8UB 2WLIA 3MOBH 1P53A 5APQA 1ZD6A 1VACB 1MFDH 3RVWC 3TTYA 2ZVOB 2P8LA 4BKTC 1U0QA 4ZOBA 2I9TA 3PL6D 4PP1C 4MX7A 3PQYA 1EERB 4K23H 1A02N 4TNGA 4YSPA 3CFMA 2X2HA 1BFVH 3GHGC 2Y7LA 4ZO8A 1M71B 1AJ7L 2IPUK 1KJVB 3ARVA 3LH8A 5GS3A 2EDQA 1BQKA 1IV8A 5KJ4A 1DFBH 2NSXA 4AEIL 2MHAA 4O9BA 1NWQA 1HYSC 4FNRA 5I1GL 4LCCB 1UWYA 5C0DB 5AOMA 1EAOA 3KLAB 4M8UA 2WXPA 3U0TA 1E5YA 2X4UA 3L75G 4N5UA 4M7JL 4YVUA 1UTDA 1DEEB 3BIKA 3ZYZA 4CSTA 3TNNB 4U1KA 4E9XA 5HHOA 5CFAA 2R1XA 2YA2A 2HKHH 2B9AA 5D4JA 5AUMB 3DVFA 3QI9C 4AEHH 3V2AR 5HYEA 3GIVA 5GXBB 1ZA3A 5F3HB 1KLGA 5E8NB 3N40P 4U1IA 3G6EP 1HXYB 3L3OB 3QRGL 3L3DA 4NQCE 2YRPA 3MRNA 4RZCB 4A04A 3DUUB 4RX4D 1A65A 2B1AL 3V0IA 1AZUA 3X3FL 4ATWA 1PGPA 3SPGA 5FDWA 3D33A 3GMNA 3RY6A 1CI5A 2QEJA 3O3DB 4UILL 4ANVA 4XBPA 4PRHA 3EH1A 5ALBL 2OL3B 3CVBA 3RWCA 4WY7H 4G7RB 2HKAA 4K5PA 4R6UA 4NQUA 1NGZA 2AXHA 3SGKA 4D6TD 3AREC 4Y5VA 4AT6B 2WD0A 1P4BH 3GEFA 2E27H 1EVUA 2JKNA 1GK6A 4NPEA 2E42A 1D5XA 4YHKL 3RP1A 5BV7L 4TL4A 2WYIA 3K74B 3RX5A 3OF6D 3DXAB 3MFFB 1M7IA 3RX8A 2D4DA 4ORGB 5KSBA 1AIFB 1GKEA 1RZIB 3MUUA 4YQXH 3E9UA 5MENB 3GMMB 3GKWH 4U1HB 1VCAA 3ECWA 4FQLL 1ZGLM 4DUVA 3GTNA 3ABZA 3DYOA 3MRFA 4GG6F 4XVTL 5DZPA 4UNTA 4ABVA 3O0LA 1GL2C 4DKEH 2R2HB 4QRQB 2VL5B 3C6LD 3UGXA 5C3IA 5IBLC 5LO7A 1MLCB 1SBBA 4OJFL 3RK3C 1RZGB 1Y8AA 3N43F 4IIZA 4OFPA 1IGIH 3LS5H 2XX1A 2F6AA 2EO9A 2J20A 1F4XL 4Z7WF 1SQXG 1M6OA 3IR9A 2E9WA 2V9QA 3MRGA 2EYRA 3PQYE 3F12A 4H88L 4DGVH 1MWAA 1HWTC 2D0HA 4PB0H 4IU2A 3WIIH 1W5CE 1Y47A 3T3ME 5IJBC 1L0NE 4E9LA 4BEIA 4JFQA 3DJ9A 3V5DA 1QWUA 3VFNA 1CGYA 1LDPL 2APXA 4XXWC 1OAKH 1FZFA 1Z5HA 1BOYA 3E1F1 2L7EA 2AMUA 1S5HB 3UBFA 5DMIL 3G6JE 3I6LE 4FQCH 3NEEA 5EB9A 1FNGB 4ASVA 1UUNA 1W6WA 2R1WB 3JQOB 1Z6JT 3O8XD 3Q2CA 3T1FA 2D7MA 2A73B 1W91A 3CXHJ 1JZ7A 1AS6A 4FABH 3EOAA 2NCMA 5FKAB 2KC0A 4MQXC 3SJVD 3WFZA 2PXYC 3GTTA 2ZOLB 5JORB 1M56D 4PGBA 1XB6A 3ARGB 4P2AA 1E4KA 1CGSH 2PNDA 4H1LG 1DJHA 3U48A 3PWJB 4DCQA 2CWRA 5I2IB 1KELH 2DWDA 4GBXD 3U4AA 5HY9B 5ID1A 3BRGC 2WKOF 3SZKC 5E24E 1KLFA 2UXTA 4P2OD 1T03L 2ZICA 5I5RA 4FMKA 1QVFO 1I8IB 4HJ1A 2D31A 4L76A 3HN8A 3LHAA 4MAYA 3UBXG 3DX9A 3TV3H 2BIHA 4RGNC 3JTBA 2O01J 3B2DC 4PG9A 1JXJA 1CXHA 4F7EA 4PLOB 4RA0C 3QJRB 1ID5I 1OCWH 3CVHB 5TK4A 5FV2A 2DQJH 4IJ3C 1DEBA 5C0CB 2V2TA 4NXKA 2F5BL 4A63A 1RXLA 5D2LB 5GS0L 5F7LB 4JM2C 4ZUUA 2ADJA 4I6MC 3TYYA 3LTVA 4MJ5A 3RVTC 3D6YA 2XIIA 2FQGA 5B7MA 3ZL4L 3WLBA 5C9JB 3NGBC 2BZ7A 3NJGA 3LAFA 2J5LC 3ZR6A 4BWWA 1AHMA 4YHLL 3GUTA 2P5WE 1IAIH 3PDGA 2AJYL 2EIKB 1FN4A 1BFVL 3DHMA 4P2QA 1FJPA 3V4QA 3PIQA 4PJDE 4ZUTA 2WZ7A 3VRJA 1JCCA 3K1DA 1I1YB 1E28A 1VGEH 1A6AA 1BIIA 4QHKJ 3FB7A 5T33L 2H7WA 4R5XA 4A6YH 3G3ZA 3QWOC 4GOEA 3PGCB 4AQAA 4AI7A 4BJLA 3IDXH 3U4BH 5T5FH 3A47A 2CHDA 2P28B 3QDAA 4K7FB 5EBLB 4PWGA 1U8PB 5TQ0L 1TEYA 4AEIH 4HIIB 4ICXA 4YGAB 5D7JD 1JPEA 4I3RL 4IMLB 1QSFE 5DYFA 5I5JA 3Q8EA 1MCCA 3R4RA 5DGQA 1YIJP 2V7HB 4P8QA 3OC5A 1DTUA 4JRYA 4L1SA 5KYWA 1A47A 2Y3AA 1DH3A 4Q6IC 5IQ9B 3P0YH 2NTFB 1QO3B 1Q81Q 1EJOH 3GLEA 1F3RB 3NEXA 1IBGH 4K7PH 2GI0A 3G6JB 3OAZH 3S48A 1H0DB 3A4FA 1AP2B 3IDNB 3OG4B 4C59B 1Q9WA 2FCBA 4Z7VF 4H8PA 1Z5LA 2MJZA 4LO9A 2H7HA 3BT2L 4ZJ9A 2HG5A 4KO6A 3OB0K 2B1AH 1E5CA 3X3FH 1WA1X 4AY0A 4PJ5B 4P04A 2G0KA 2R4RH 5F0PB 3OZKA 4KKBD 1AHWC 4GRMB 4X7CC 3WUWA 2R2BB 5LLIC 4KFZC 3FB8B 4XVUC 3EJZD 1USEA 2AXTE 1IKNA 4LSVH 2BINA 3L5JA 4NS0A 4YLBA 3ZE0F 3CMOH 2BCKA 3V9CA 4OSUL 1J7VR 1V7NH 1A3ZA 2EDBA 3DSNA 3MKGA 3B9VA 4P59L 2GTZA 2KNCB 1W72L 3WGVB 4NPDA 1CLYH 4KXDA 5DYOA 1KQLA 4QHUB 2Q10A 2NRGA 5I82A 5CZVL 1HOCA 4G43A 3AU0A 2F53A 4OJFH 4QHNA 4XMXA 4IU3B 5AWNH 5I8CA 4MS8D 4U1MA 4PRAA 3B4SA 4JN1H 4MJIA 2NR6C 3SFEC 1O6TA 4K5LA 1U7JA 5CMZA 2EDNA 2WVVA 1DYZA 1ZV2A 3Q5SA 4FHBD 2JCCB 5D8JL 4LCUB 3RWDB 1U8LB 5A2BA 4HIEB 4C56E 1RZQA 3MGTA 2WXIA 5KVEL 5HHME 1A4JA 4QKTA 2GUOA 5MHSE 1IEAA 3WFBH 9PCYA 2F8OA 3BPCA 1R5IB 5I6KA 3F00A 4P5SA 5C0DA 1W0VA 2DWEA 4NSKB 3VXME 2P5WB 1LDPH 3GO1L 2XTJD 3CFDB 4LLUB 3AXIA 2DQCL 5KAFE 5I30H 5FGCB 2PYED 1EFXA 2FJGB 1KPVB 5IB1B 4JY5H 3BDXA 4KZDH 1B4RA 4LFHG 5DVMA 4YIQB 5E8EB 2DV6A 4WCYL 5T3XL 1Q8MA 2GFBA 4X6CA 4K3DL 5DMGD 1I9EA 4OGQB 3J7HA 5TQ2L 2Q87A 4TNFA 1AS7A 4FXKA 5AW4B 4CMHB 4FABL 3QRFM 2V33A 1X5AA 4M4RB 4R4FL 4JM2F 4FEIA 2NW2B 3W82A 4PLKC 1M4KA 3NPZB 3BGFC 4YK4B 3QDGA 3EG9B 1LTTC 3SGKC 5LGHL 3VGFA 5E4IA 3JTSA 4LAJH 1EC5A 1RQ5A 3GRBA 1BQLH 4LNRA 1BZOA 1BSHA 4X5WA 5IWLA 4X99B 2R1YA 4ODSH 3L71G 4XMKL 3X12B 3G5WA 3HFFA 4L73A 4FZEH 4XZ4A 4Z0BL 1TR7A 4C4KO 1WD9A 2YZ1A 3B83A 1SQXD 1FNGA 3MD0A 2AK4E 3IDJB 1ITCA 3CZFB 3QXTA 4QHKI 1DJXA 1R4XA 5F3HA 1K73Q 3SE6A 1FZOA 5D2NC 1I9JH 2DQJL 3DHUA 3FT4B 3F7PC 4KDTC 4UNIA 4XXCA 2BVQB 1P4IH 2IFMA 2RMZA 2NZ9D 4J8RB 2P5PA 5FW6A 1FPTH 2Q2LA 2X4NA 4YXHL 4JZNA 4C56D 1OPGH 3K4ZA 1QLRB 2CZNA 1MRFH 1JPSL 2W92A 5IT2H 4KTDL 4G8GD 4KXAA 1OCWL 5ALCL 5BXFA 3CFKB 1NGXB 3SDAD 4EO5A 2MKWA 4MVBD 3MA9H 5E51A 4D0DA 2EYRB 1DLFH 2BVPA 2YKLL 2TSBA 3EGDB 2PXYB 5B39A 5E2JA 3PAZA 3UGEA 3V4WA 3INUH 4UNUA 3ZE1F 1LILA 5ICYA 2H0JA 1CG9B 2HVJA 4RRPA 2BWQA 3E6HB 4CBZA 1T3FA 5J89A 1OARL 3CD6P 1BHGA 5F96L 4L3CA 1IFRA 3RA7H 5LXVA 2X7LB 1CFQA 1UWFA 1XVSA 3DWTA 3G7TA 2CMRL 2YD0A 3CDGB 3MNDA 4YE4L 3HBPA 1KYOJ 5HHOB 5JXAH 4A2EA 5DJ0B 1RE4A 2IGFH 4NRZB 2F7OA 2UXFA 4UT6A 3LQZA 2QVKA 4K0OA 4AYFB 3MOQA 4Y99C 4IDJH 5JPNC 5BVJB 4HX1A 1M6OB 4ADIA 2O6FA 1P9MC 5FIEA 2ZUQB 5FKAA 1IFIA 4TLSA 3IDNA 4EXKA 2WQSA 4EPSA 3DGGA 4PRIA 4RRPM 1KYUA 4Q9BA 1WFTA 3CBRA 3H9SE 4XBPB 3VD4A 4GRLA 4Y7MA 2HB0A 3HLAA 1U3JA 5MEPA 1AKJA 4HUUA 3BP6B 4NJAL 1NAMA 3LZNA 2QJKC 2OMXA 3EFDH 1WISA 1XGZA 2EADA 3L3KB 1QL1A 4ETYA 1XH1A 4KHXH 4PJ7A 3MXWH 3FTGB 4QLWA 2I69A 4R5TA 1S5IH 4GMSL 2AJUL 1G4MA 2DWYA 3KHQA 1VQKP 3BKMH 1EJOL 4B9YA 3I9PA 4D3CH 2UZYA 3QUML 2ZCKL 2E9GA 3KXFB 3TA3D 4U3FE 1OCOB 1MEXL 3U7YH 5CIPH 4U1MB 2Q1EA 2DLEA 1KB5L 3F7YA 4G42A 4WVZA 4AYID 1RKRA 5SWSD 1BVOA 4P59H 2BNQE 4HOXA 5DZJA 1N6QL 3FT0A 2P1YA 4HKXB 1UVQA 1DQVA 3H1JJ 3IGAA 2MIZA 1F2QA 1I1FA 1T5KA 3VXUB 2DBLL 4H0GA 3TBTB 2NDGA 3S35L 1ZT4A 3C6SA 4LKCB 5CLTA 4DP6X 5ACZB 2NMSA 1EDYA 3NJMA 2G2NA 2XZQH 1ZA6B 5D71H 5FO7A 2IXQA 3S8WA 5C71A 1OALA 3KLAA 1YTZI 2B2XL 5HVFB 3K2UH 1DUYB 4A7PA 4NX0A 4ZUUB 2CBOA 4ILDA 5GGTL 1ED3B 3AB0B 3EFFB 4N0CD 3ZTNH 4ZMOA 3BEWA 2GQHA 5H2BB 3WNIA 4D0BB 3BQUB 1PLGH 3AVEA 1M8OB 3TPUB 4YSAA 5A2JH 2A6DA 1MKFA 5HI4C 4YHOH 3I02A 5F1OB 2Z6FA 3VFWB 2Z31A 5D2NE 5DYOB 4UDUA 5BRQA 4HZAA 4X7SH 3H1IJ 5HHNB 4OCWH 2F74B 1IC4H 2VRQA 5TDPA 2DMHA 1S9WB 4U4BA 2VN5A 5CP3A 2KL6A 5DVKA 3KPRB 5L2KA 5T3XH 2C8NA 5L2KD 5FECB 1A4CA 5E70A 3G71P 2FY8A 1SLWA 2JWDA 1IZKA 4WWKD 2GCYB 5JPMA 1NMCC 4DJGA 1ZWIB 1F0LA 1MFEH 3SJVE 3D2UA 4JFXB 1IAKA 1OAQL 3G5YB 3BPLC 4XNXL 3AY4A 5BQDA 3SB3A 1KCVH 3PRZA 4PGEB 1YPZF 4LHUG 2VDRB 3SKJH 3U25A 1EIBA 1PGRB 4U6XA 3Q1SL 4D9RD 3QH3A 4Y4HD 1FVDB 1S78D 2CRZA 2VSMB 3L3HA 4N0FA 4MMYB 4OQTH 1E2WA 4OF5A 2F7RA 5J9PB 2J8OA 1M6UA 4OLUL 4Q6YA 1OD9A 2ZOWA 1AI1H 2KMWA 2XXFA 4BV1A 2CAKA 1J1DB 1NCHA 3HRZA 3LSOA 3QH9A 1PZCA 2GUVA 5IQMA 4U3XA 1FPTL 2P48B 3WTVA 3P3YA 2WSDA 5APTA 1QNZL 1FVEA 2RALA 1TU3F 1YQVH 2X0UA 2WZ0A 2OYHB 1UB5B 3VN0A 4YPGA 3C75A 4UTBA 1OLZA 3PU7A 4GKZB 3IE4A 1SQVJ 5PCYA 4R9HA 3ZE0B 4X9BA 2DIEA 2R23A 3QAQA 3GMQA 2AAVA 3F58L 2CLRB 4GUPA 1QRNB 2B8OT 5HGGS 1S9KE 1QQDB 2AQTA 2X1XR 4P3DB 5I74C 1H88A 2FEJA 1AR2A 2FTAA 3E7JA 1MRFL 1CLCA 2XFXB 3EGXB 3NCWA 4I3SH 4KZ0A 2FWUA 2M3BA 4M5ZH 5DRZB 3IMUA 4DCKA 4WK4B 2EZ0D 1CDCA 3QQDB 1KBKA 4LMQI 2VR7A 3F5WB 4QJ5B 2QJDA 3DPBA 3K72B 5E2VH 4YPJA 2JCCF 3ROOB 3RZCC 3V4PA 2WPGA 4ZNCA 1U6AH 2QM8A 4MLIA 2MRYA 3L35A 2WPVB 1KJ3L 1WJ3A 2NRDA 2EYSA 2N4IA 4Q4EA 1EZSA 2M83A 4FFYH 4ONHB 2WSCJ 4PD4K 5FF6A 3TVMD 1E79H 3OKDA 3ZU8A 3Q3DA 1V54B 2F2HA 4XB8A 2HT2C 3FTXA 2H2SD 4AMWA 1E4KC 3GSVA 2H32B 5A1AA 3RA7L 2EDRA 3RWEA 2NPSA 3BEVA 4WSJA 1YUHA 4QTHA 5CGMA 1T2QL 2VXQH 3L9RB 1TPXB 2F54B 2DBJA 4WY7L 1GOGA 1WCBA 5DI8B 4YX2H 5IFAL 5JOPE 1N0LB 1TKWB 3O41A 1LK3H 3VFMA 2V4LA 1DD4A 3SGEI 1I8IA 2Q6QA 1WFOA 1X7SA 4HKXA 5KSUB 3ESMA 3HMXL 4OV6F 1U8OA 2ZG3A 4A2MA 2XPGA 3GF7A 3U2IA 4JFFA 3TJPA 2QQLL 2N1TA 4DZOA 5IK3B 4JFQB 4BA8A 4D9LH 4KQ4H 4W1TA 1B6UA 4X4KA 2Q7YB 3RZCD 1V3JA 3EO0A 2P5EE 1ETZB 4WUUB 5DJZA 1A1OA 5HXMA 3T77B 4IRJB 2A9AA 3H9HA 5BU5A 2IAND 3D5OF 1I8AA 5T1DH 5FO7B 3C8DA 1EMTL 3L54A 1RPKA 4NFCA 4LCWE 4FRWA 3TGUG 4PBDA 4NNYA 2XNXA 1HQRB 3AXHA 5D5MA 5BS0E 5I71C 3RWGA 2IPTL 3PL6C 1DLHB 4JG1L 4P4KD 4DPBX 3V9FA 1KYOH 3I84A 1DQLL 3V4LA 1HH6A 2F74A 3T0WA 3WIIL 3PXJA 2WWMC 2RGSA 4PYGA 2E9BA 3ELQA 3BSZH 1ZVYA 2NY3C 3HNTH 3WEOA 5DVNA 5BO1L 2VSCA 3WFDH 3FOMB 3B6SA 1J1PH 4Y2DD 1YPZE 2Z35A 2CA3A 2ROYA 4PWEA 4RGOL 4B0MB 2VRSA 2NY3B 3C5JB 4KFMA 1LTGC 3SCMA 4IW4C 3SSUA 1J0HA 4JLRA 2B15A 4P5KB 3APMA 2XNDH 2BSDA 3RWFA 1OHQA 2KOGA 3ZBMA 2IAMB 4L8DA 1NANI 4MQSB 3LZPA 1VQ8P 1E9OB 3DI2B 2ZIDA 3F7LA 2CHXA 4WFED 3MLRH 3V6FA 5DGRA 1GZHC 1FC1A 4OIIL 2WVUA 2PPAA 4GG6A 3B8YA 3PNWB 1I7TB 1XGYL 3FOLB 3UTPD 1UCTA 2LOEA 2PN5A 2VR3A 4U49A 3T0BA 3HLKA 1XHHA 2CO2A 1G6RL 3PWNB 5FA3B 4ENEC 4PV8B 5IVXB 4OBSA 2X6CA 1LD9B 4L37B 4WKZB 5C0GB 5DWUH 3SQBA 4U6VH 3L08A 1J0ZA 4FCAA 1IGJB 4WB4A 2Y7QA 1XIWA 3RUGB 4YZFF 4CN1A 4JFHE 4XNZC 2OMTA 2KS1A 1H8SA 1S7VB 5CEYA 3FTGA 2OR9L 3FH8A 5F1NA 3QK0A 5F6HJ 2BP8B 1KWKA 1QR4A 4BH8B 1MFMA 3ROLA 4AUUA 3MRJB 4RWHA 4ZKPA 5F1IA 3OKNB 5TPWL 1UIXA 2G75A 4NM8L 5GRJL 3UX9B 3P9MA 4R7DB 4EZKA 2X6AA 1PCXA 1GL2D 1NLDH 1CB4A 3MGOB 4NQXB 4PS4H 5LDSA 2O5XH 2BNUA 3I6LD 5C0IB 2Y36H 1GS7A 1KFAH 4ONFL 2CH8A 3FXDA 2X2JA 1ZLWK 3UJIL 3UIYA 4BKSC 2P8LB 4UZSA 3WTUA 2WLZA 3VH8G 4WTZA 2W6JH 3PYCA 4ZUVA 3FUDA 4OQTL 1KT2A 4WY4B 4YO0A 1ZN5A 2WK2A 1I7RA 2VXQA 1UD5A 3EYFA 3BCDA 3FFCD 2OXHB 5D96B 1U8LA 1A0QH 4PR5A 2YSTA 4OZIA 2HJLB 1U8NB 2IQ9H 4Z7UB 1RF0C 1MFCH 3O6LL 3F58H 4TNEA 1TZHA 3ARBD 3GXTA 5I19H 1PGOA 1LEIA 1TTUA 3PWPB 1WF5A 4UMSA 3VTPC 3B2VH 1C08B 2BSED 3FTWA 2JKVA 2WKOA 3RGVC 4ZMVA 3PWUA 5SWSE 5DHVA 3MV8E 1IJNA 2D3LA 1EFXB 2FJGA 3KYOB 4PJDF 2LW3A 4NC1C 2OX5B 3ZSTA 3DK2A 1SJHB 1XH3A 4LLWA 1IL1A 1MHPL 5FYJH 3L9YA 2P52A 5TDNB 4DERA 1Q9KB 1VZGA 4XBGA 4LCCC 4M5ZL 3P0YL 4S1QL 5HHVL 1DBML 2XN2A 3RVWD 2VZOA 4G7YL 3FBKA 1JPGB 3BC9A 3QJZA 3LQAL 3TBWA 2HVKB 4OB5H 2DN7A 1DN0A 2GY7B 5AQ0A 3OXSB 1BPLB 1KC8Q 3DMMC 1H15B 4E41E 2OMXB 3VRLE 2MHAB 1WH0A 3AT8A 3P8MC 3L8QA 5HYQB 1LK3L 5F9WC 2TSAA 3QJHA 4MDRA 4Y5YC 5HHQA 3UROR 4K5NA 1P7QD 3V0HA 3VDAA 2A6DB 1Z0MA 1ACYH 3CFUA 1F2XK 1VFUA 2E74D 4NUGH 3UTTA 1NC4D 2GAZB 5D1XA 5F44A 1AC0A 25C8H 2Q8BH 3CV5A 5IROC 1JNHB 2E3VA 2HA1A 1YQ2A 3MMEB 5A2FA 4A67A 5AW2B 1FOSF 4N90E 4CUCA 4R4BA 1R5VB 3IGKA 3GTVA 4L0YA 2YC1B 1E8WA 5L2JB 1A7QH 3K71A 3NK4A 5I0DA 4HA1A 5FYJU 4F8TA 3KYMA 1WA2X 1MFAL 1S7XA 1CFNA 5E1IA 5I17B 3CSGA 2VQUA 2H1PL 4HBQA 4TOYH 3K5BA 1BP3B 1A1NA 1FSKC 2GFBB 2Z92B 1OP4A 2WNGA 1A9BA 4PWIA 3KLKA 5JOFB 2OTUA 5J1AA 4NNXB 3FKUS 2AJVH 1ZIAA 3UEZA 5ICYB 1FYHB 3BAKA 4HJTA 3UZQB 4NUJB 3AEGC 1C5DB 1RZJH 4PI2A 3VXUE 3EZJB 3DO3A 1PZQA 4TVPL 2DY2A 2IAAC 1MY7A 3MCYA 4PGJA 1PKQE 3AG3B 1UM4H 2C7UB 1GMEA 1ZP0C 4JUTA 5B8CC 5BRZB 2NYYD 4Z7NB 1SOQA 1H9DA 4MZIA 1A64A 3PG2A 2E76B 5E23A 3UYPB 5GISH 4P4RA 1JZ2A 1T7XA 4AQ1A 4GBXA 5D7JC 3UJJH 4UDTA 1EA9C 1BF5A 2VLJB 3JWOC 3M1BA 4GQ9H 4PTTB 4KX7A 4P2OC 1TJHL 3MCLH 4B60A 2X10A 2PO6C 2OTJP 3D18A 1N12A 3KM2A 4L9LA 4PTUB 2ZWYA 3U1SL 3FUMA 4PD4I 1HQ4B 4HC1L 3CX2A 4JVWA 5IJKC 2B59B 4NPYA 1KMGA 4NRYA 3VA2C 4M6ML 4S1DD 1JZEA 2R7EB 4WWIA 5DUPH 3DUSB 4PB9H 1XH2A 1U91B 1DE4A 4AVKA 2X70A 4OJDH 1XEUA 5IVXE 4PRPD 2VKXA 4WUUD 5IVZB 1TU2B 3HUJF 5ISZE 1PP9G 5KOMC 2ZKMX 2X1QA 4PJCF 4RLDA 4MB4A 1IGMH 1T1WA 4WNJA 1OAJA 4TT3H 1DQMH 3EYOB 3GBNL 3VSTA 3N7NA 4E41B 1EAPA 3ARPA 3A6OA 4MZ3A 4PJCE 3MRFB 5CIPA 2FGWH 2AJSL 5AOZA 3RX7A 4GG6B 4MDIA 1BECA 3IETB 3HS0B 4HZ1A 43CAA 4TULL 2V7HA 1SN2A 1UXWB 3X2QB 1JGEB 4M48H 3VM7A 2OZ4H 4C4BA 4HPYL 4DAGL 12E8H 2GITA 1LEIB 4FA8A 5J11C 4PRBB 4IGBC 4IOFC 3SGJA 3INUL 4Z7OB 3VWJA 3LKSA 3R0NA 3ZE0E 3QUXB 2OMTB 1T80A 3P3RA 1KV4A 4S2SA 1LLAA 1F4YL 2WP3O 1N0XH 3GM0A 5EIIB 1N2RA 4RWYH 4IKNA 1NUGA 4YHYC 5TDOB 4ZMWA 5ESAA 1KTMA 2POHA 3LXCA 5CWSA 5DK2A 3UTSE 5CJXC 1FV1B 3GRWH 5JQHC 1BE3G 3PTZA 3WTSA 4MFHA 2CNYA 1YMHB 4NQDE 2VN4A 4IDJL 4GI6A 1YBKA 3RGVB 1FH5H 2BCKB 1YDPA 2WBKA 3MLXL 4L8DB 4LCWD 5AUMA 3VG0H 1FORL 2Y5TA 1QTSA 4F91B 2K9JA 1AIFA 3NSFA 1ZR2A 5APSA 3FQYA 3ISRA 3B2MA 4MN4C 4MHHG 3DV4B 2QBWA 2X3AA 2QGEA 3FZUC 4R4BB 5DK0A 1FJ1A 4MBRA 3QA3B 3HI1B 4G7YH 4E9YA 3B5ND 4LF3A 4QD2E 5CBEA 2DIAA 3IFNH 5IR1A 3IJYA 1GMJA 2AEIT 5HJDA 4HJUA 1K4CB 1BGYD 1GGCL 2BJML 2Y0SA 3DMMB 2OTUB 4GAAA 5J1AB 5CCHD 2PWEA 1R24A 2XWEA 3QHFH 3BW9B 4QRQA 3DX9B 5D4QA 3QS2A 3DETD 3CHXA 3F6IA 4NUGL 5D7SH 2WXRA 4OQTA 2VLKB 5D7IF 4R3SB 4FHKA 2HTLD 5EDXA 3Q2VA 3WUWB 2R9HC 4NKQB 4HMEA 4N3TA 5SWZB 2GSGA 3D69A 4IL6E 3MBEB 1JY3O 5DJYB 1XZ0B 1Z3RA 2LAAA 3V6ZB 3OKMB 3VSVA 4A7GA 1QPXA 2DWTA 5E1AA 2PP7A 5E1QA 2ZCLH 3BUPA 1L5GB 5FLUA 2HODA 1CR9H 4H4NA 1RULL 3F83A 2X2UA 3S34L 3IF4A 1NCIA 6FABH 1OO2A 2XU9A 2EDOA 1INDH 3O6KH 1GC1H 3VD1A 5T3ZL 5GRUH 2F8VA 1SQQD 1KXVA 5GZNA 3E80A 1KOAA 4ZUTB 4OM0L 1A7QL 4H44B 3S96B 5CCHC 4JPIB 4NO2B 4ONGL 5LUMA 4HGMA 4X8JB 1N70A 2K1MA 2J1YA 3MLVL 4TTGA 1I3GL 1UENA 2HLEB 3CC1A 1K5NB 5FB8A 4RQQB 1UIIA 1B4JL 1EXUB 5HI3D 2XICA 4P2RE 4C4KT 1G2CB 3QFJD 2GK0A 2HPCB 2QT6A 4KZEL 3BFQG 2X70B 5E6ID 3JSVC 3S35X 3Q5RA 5CBAA 5INDA 4BE6A 4XN7A 1HAWA 4FFZL 5C0CA 1F8TH 2ESVE 4HKZH 1SUJA 3VXUD 5L4MA 1LWHA 3BPOC 3H4HA 4MJJA 2WB1A 5KBPA 5IHZB 3WI9A 5I8KH 1A8JH 1QFWI 4M93C 5GJTH 2GIYA 3HAEA 4R90L 2BNQD 5GISL 2XQYK 3GLZA 1NGYB 1NTME 3OXSA 2CLZA 1WFIA 1ZTMA 2HFEA 2NW3B 3G6JF 4U7SA 3SPIA 1CFMA 4P2QE 1JIBA 4UOW0 3RBSA 5I2IA 3S3PA 3HUSB 1PG7H 1BSNA 5AVWB 4FQXA 3WEAA 4ZX4A 1B2YA 1NFDF 3BSGA 2L04A 3NZHL 4U0RB 5MERB 2IJ0C 2VR6A 4G6KL 2QJYC 2DQHH 2LTQB 4X6FA 4XP1H 4JQXA 3EIFA 3SD5A 1V3KA 3EH5B 3V7MA 4KKLC 4OLUH 2L4OA 3HBZA 3ULVC 4EQ3A 2Y23A 2H2SC 2ENJA 1G7IA 4PRHE 4P2QD 4HMDA 4PJ5E 2N1TE 1GAFH 3T97B 1COBA 3LS4L 3TZVD 1BG9A 5HI5C 4Y1AD 5E6IC 2GSMB 4MCYB 4WW1B 4JFEE 3TA3C 2CHNA 5DUPL 1W6LA 1P7QB 1OGAE 2O5ZH 3MREB 5JA8B 5IHLB 1E28B 3NRQA 2XA8H 2ZUYA 3KPLB 5F88B 5LGJA 3AAZA 3GQFA 1QWNA 1MCBA 3O9WA 4U05A 4MAUL 3H32A 3QE5A 3MLYH 3S5LB 3CFJA 1PZBA 2F08A 3EBAA 1AE6L 1B9KA 3AE1C 1YN7B 2V5RA 3WD5L 2IYPA 4KTYA 3ZTCC 4IBTA 3EO1A 3OD3A 4OF0A 3AU1B 2Z64C 4JHAH 3EHBC 3GBNH 4P2RD 1KIPB 2VN6A 5CGYD 1L9PA 1VGEL 4WO4A 2WTPA 1ZKAA 1E6JH 2LV4A 2WHVA 1Y18B 3HNSL 2WNXA 2Z0UA 4YOKA 1KZQA 3RGUA 2Z4QB 4TUUA 4QLRA 3CCHA 4I2XB 3SPVA 1E4WL 4C7NB 4AQEA 2W59A 2AJYH 3G5ZA 2FXPA 3BWUF 3P4OA 1TJGL 4FG4A 5DD1L 2YRBA 3D0AA 4JRXD 4YHMH 3V0WL 1F3JB 1X6LA 2PW2B 2V3FA 3H1IE 2IH3A 4DEPC 3QXAA 2M5AB 2UYLB 1TTRA 2FNWA 3VP8A 1EVTC 2FSEB 4LU5L 1UKTA 1T6AA 5DO2C 1IFHH 2PXYD 2G5BA 3ARBB 1HH9B 3FWNA 4CSSA 3WMPA 4UZGA 1SDDA 3HFMH 5E99L 3ZRCC 1BVLB 2WNWA 3O6FA 3L73J 4ATTA 3VE0A 4PIBA 4FNSA 4U1GB 1PPJG 3GSUB 2CUAA 5L7XL 4LPWA 1XSIA 2IPKA 5CKGA 2RBLA 3HZYB 1RF1B 4U7JA 5KKZB 1G7QA 4PJIF 3CWBJ 1K72A 5JZ7C 1OP3K 4GW4B 2QJKB 1CK0H 3CFCH 3O4OB 1SEBB 5B38A 1P5UA 5FO2A 4F58L 3FUFA 1CGVA 4MWFA 5T1DL 3EUUA 4V1DD 2MOGA 3WUTA 3FQ1A 1XSKA 4PJHA 1N59B 5D7SL 1EHLL 1QX1A 4BFGA 2UZPA 3MV7E 4U31A 1DIPA 1LWRA 4GAFB 2ZX5A 5KJ7D 4JG1H 4WTXA 3MTUE 1P2CA 1CDJA 1L0NJ 4XNQA 5EORH 3RFZC 3BZEB 3SDXA 4WY4A 5JPMB 1ZVSA 3VMAA 3GMRA 4W4OA 4ZX6A 1JUFA 3FOLA 3I3EA 2WSEJ 4NRXB 4WFEE 2G0LA 4Z77A 1DVUA 2E7HA 3L3KA 4MYWB 3VGHA 1DQQA 1XGRB 2J1WA 2YD2A 2WM0A 1VERA 2AEPH 1YEDB 4WKXA 1I8UA 1CG9A 4LB8A 1T1WB 5K1JA 3V5KA 2IAMD 3BP4A 5AWNL 5C8JA 1AQ8A 2J1XA 3MLVH 2OTLP 2RKLA 1X0TA 3ZTJH 1O5DT 1PKQB 1MRDL 2IGLA 2X4OB 1OWRM 1H8LA 5J06A 4YSTA 5T3ZH 1NAFA 1DN2A 1XTLA 4GP5B 4HMCA 3TIEA 1XF2A 1HZHH 1HK6A 3QULA 4B9GA 2AZUA 3GUFA 3SE3C 3MX0A 2F7QA 1F6AA 3CPUA 2XIDA 3MRLA 5H37A 4B0MM 2L91A 2HCZX 2ITDB 4KUCD 1ILSA 4QTIH 2PMZA 1UQSB 2YPVL 2BVQA 2VLJE 4UQDA 3FCSB 3STZA 3ATFA 2E5EA 4LHUB 4JHWH 4YDVA 3LIDA 2CO6B 4MNQD 4NQEA 5LJYH 4B9PA 3BZFB 1TENA 4Y5YA 4YSQA 5E9DA 3H6PA 4UOQA 5KVGH 3TEWA 1GYCA 4CADA 4L8BB 4D6TE 2ZD0A 1H3PL 4JGJA 1AQ5A 2KLTA 3FQNA 4TTDC 3MR9A 4X98B 4CDHA 2A1WL 3L4CA 1WLHA 4EXPX 1TU2A 3T3PF 2CJUL 2X4TA 1NEZG 4BWNA 2VLLB 1TMCB 4N8VA 2F1EA 5T5FA 2I24N 1JRHH 2VB5A 3GB7B 1WBXA 4KI5D 4QRFA 5EIVA 4NXSA 5E4EB 4QT5B 3TF4A 1A1MA 2A9NL 1SY6H 2C34A 2WIMA 5E8DL 4FLOA 3T09A 1VESA 4F15C 3Q2NA 3TLRA 1S46A 5BVPH 5E4AA 5A2CA 5EU4A 3KBHE 2GB2A 1TQUA 5T3XD 1TOXA 4LIQE 5JIKA 4EZMA 3DJSA 3NSCA 3AGVA 3CHQA 5LG1A 2Z8SA 3AEBC 1P4IL 1O9ZA 3SDXE 3TNMA 4BFBD 3EGDA 3A23A 5AB0A 4GKZA 2WGNB 2XN9E 2YMXH 2QTVA 4F8LA 3ZE2E 4E5XA 4LEEA 2P5EB 2Y0CA 1X5XA 3KNBB 4JKMA 3CDZB 1OT4A 1UFGA 1GPOL 2F1BA 3MIWA 3DRTB 3LNEA 5BRZA 3RPIB 1UGKA 4P3CL 3V6OC 3KG5A 4Q6KA 4B53A 1QHOA 1CFQB 2IF7A 3TT3H 3F7KA 2QMKA 2X6BA 5B7EA 1DL7H 2HG0A 5K9JL 1CVRA 3DV6A 1H5BA 3NEOA 5FFOA 3E1RA 1DBJH 3K4AA 2WINB 4J3OH 5CU9A 5JHLL 3IAGC 3TWCL 5AOKA 4QXUH 3IMWA 3N44B 2DQ6A 4L9LC 4ODUB 2CKBB 2VWEC 2AITA 2FLRT 5CO1A 5F0JB 3RURA 1H89A 4XRCB 1MF2L 3FAWA 1MPAH 3CU1A 3V95A 1Q72L 2P42B 2BSTB 4OCXL 1ZWIA 3AT9A 5L88L 4FQXC 2JKTM 2KDGA 4O02A 2V5SA 4B3EA 4ZYKA 2B4CL 3H3PH 1IK7A 2OSLA 3FFCE 4I0CC 2YFNA 1SQVD 3VXUA 1XSJA 1Z9SB 4PJ0H 2QSQA 4RH4A 5C0CD 4LDOB 5EOCJ 1J8HB 4JPWH 1RMFH 4C83B 3P0VL 1CGTA 2BP5M 2PCFA 3CPLB 1GY1A 2WWOA 3J2PA 4P5TB 4NN7C 2DM2A 4JFWA 4NQQA 3JV4B 5E9NA 4HUWB 4OH8B 3LPOA 5C0RL 2I9LA 2PYEA 5B66H 5L6YL 2C9SA 4F2ME 1UB6A 5CF3A 5K9QI 2EIJB 2HLOA 1AZNA 4LEOA 4BFOA 1OF0A 2QKIB 5TE4L 2X53A 4L4VB 3X1GA 1CICD 2VMCA 1BJ1H 2W8CA 2C1OB 3VUAA 1MEXH 2N1KA 3U7YL 1YSOA 3U1AA 4HKBA 5LG6A 1ZXKA 1AH1A 2XN1A 2G4EA 4Z3GA 1QEXA 4GUCA 1YNLH 2FO4B 1F00I 3CXDL 3UMTA 2VAJA 4YSRA 1KILD 1IGYB 1FNLA 1PZSA 1MW3A 2AJZA 1I7ZA 3GLDA 5D1QA 2Y9YA 2OSWA 1L0LD 4EE2A 5C6PB 1C8QA 2W94A 2SEBA 4HOWA 5FUOH 2XQYG 4XH2A 3QIUD 2WSCH 2AQ2A 1PX8A 4IYKA 1JY2P 1ET8A 2CQVA 3VCLA 4PJFB 1FGVL 5F97E 5DEGA 3HR5A 4GQ9L 2OYPA 4KK8D 3M7FB 3ESUF 4DOHE 3BD5A 3QQ4B 3VMNA 5EO1B 4M1CD 3B71A 5DFAA 1UZ6F 2ZXEB 3C09C 1NGMB 4PY7B 4QY8B 4U3SB 1VQLP 2XX0A 3SDDD 3STLB 3FT3B 4NGHH 1L4AC 2MCG1 1UXWA 5JUEL 1LDSA 5JW4Q 1PIGA 3Q48A 2G2RA 2CLZB 2X6VA 1JV5A 4HF5L 3L4FA 4RGNB 3F6LA 3W1ZA 5CAYB 3HCVB 2KXPB 4LL9A 3L36A 5F7KC 3C5ZD 2FWLB 4ZS6D 1BLNB 1DP0A 1DBBL 2FEDC 1CIDA 1KCVL 2NY1D 3F6JA 4KOCA 3WNJA 4TPRL 1OAZH 2W95A 3UADA 1UKSA 3HC0B 4FTVA 1YEEH 3KPSB 2Y06L 3POCA 1DDHA 2WPQA 5BVJA 3OZ9H 5CEYB 2VXUH 4ALAL 1VKXB 2YN5A 3Q5TA 2IEPA 3MLTA 3HMWL 4Y2DC 1S8DB 3MRQA 2PP6A 3N4XA 5A2AA 3LN4B 1G5AA 4G8FA 3WEBA 4B3VA 3IB4A 2HKFH 3IJHA 2KH2B 2UWEE 1UXLA 2QHLA 5IQLA 3UH8A 4LPVA 4O4YH 3IFLH 2JJTA 3QNFA 2AV1B 4Z3TA 2Q8AH 4NQDD 5BZDB 5IHWA 2H0EA 1BD2D 1WZKA 1DLHA 1ZTXH 4KUZH 1U3YA 1LO2H 4HK3N 1YI2P 4UB6H 3HG1B 3FW6A 4DNLA 1I3RA 1L4AB 3BXNA 3IKKA 1NAMH 1XD0A 4YR6A 4A6YA 1GW6A 2MH4A 2KLRA 4YL4A 2VC2L 4X4MA 3NH7H 1P4UA 1PJWA 4ZSOB 3HE6C 2KI6A 2MNWA 3ECQA 4LPXA 5KAIH 1WE5A 3DK0A 3CNKA 4IHOA 1WICA 5MHSD 4J7RA 5GZOD 1BX2B 4TQEH 2HXAA 3BP5B 5CSBA 4CVZA 5AVTB 1FG2B 2W0KA 4W9CC 1FYTA 1O9VA 3CDYA 3V0EA 1RY7B 1FL5B 3FU0A 3QHTC 4WW2B 2VLKA 1K4DA 2P8MB 5IGXL 1SQXJ 1MUJA 4I18C 1QFPA 4UTAA 3BMVA 3SBRA 4IFFA 3MHZA 1N10A 1VENA 1XGQA 15C8L 4QJ3B 5B3NA 5KSAC 4Z7IA 1MG3C 5FOBB 3BZ5A 2Z92A 3V4VA 1B0RB 1DSWA 3CMEP 4G8GE 1E5AA 2FECL 2HRPL 2QR0A 1NUFA 3NUKA 4UTAL 2CBTA 4O2FA 1EXHA 1U21A 5DVPA 5KS9A 2JI1A 4DP8X 3MJ6A 3DVIA 3L6FB 1ULVA 2FWSA 4XPGH 3OMNB 1PX3A 2AF2A 5JHDD 5MENE 4KK5D 2W80C 3PHQA 2AQSA 4N9GA 2HWZH 4S1SL 1CTNA 5KVFH 4LSVL 1UACH 2PR4H 1VQ9P 5ESQB 1S3KL 2V6HA 1OE3A 4HHAA 1N7SA 1T2QH 2VXQL 3CMOL 5IK3A 4NYLA 3UDWA 1Y1DA 4RFEA 3KQGA 3ZE1E 1UXSB 2DOCA 2XFXA 4WGKA 4KKZA 4PJEA 1NAKH 4FG6C 1C1EL 1HYSD 2EEXA 4OZHE 5AKTA 4RZCA 4XC3H 4PTTA 3SKNB 4GQQA 4WK0B 3U1CA 1F3DJ 2CO1A 3LIZL 4Z1PA 1MSPA 1JTHB 5ISZB 2DQUL 3IFPA 3HJ0A 3LRKA 3FT2B 3U46A 1JYWA 1OEZW 4QHLB 2C5DC 4NWTH 4X6DA 4P49A 1PV3A 2DQFA 3L7EA 5EO1A 4NRYB 1ZK9A 1WBYA 5IM7B 4YDKL 3NCMA 3VG9C 2R8SL 1UT9A 3NIDE 1SLXA 4B6ZA 1M7DB 2DQCH 1VJSA 1J1PL 2QA4P 1QI3A 5CS7A 3RQ3A 3ZIYA 4LVNC 5EDSA 4LPTA 2PW2A 5DF0A 3UBXI 2C1PA 1NL0L 1NANH 1LE9B 5DQJA 4AK1A 5DRNB 4QXGL 4JYBA 1OW7A 2IH1A 1ZMEC 4OUUA 5C08E 3S2CA 3VXQB 2NUTA 2E56A 5F8RC 1AVAA 1SLVA 3UYPA 5F7DB 4FFWC 2X1OA 2MTAA 1PG7W 3MQIA 3BH9B 1S7TA 1S7XB 3S5YA 4JO1L 4LVHB 3LXBA 4N0YL 3P77A 1D5IL 3MV9E 4R90H 4JW3A 3O6FB 1KGUA 5D7LA 3F12B 1HE7A 4NC2B 5B21A 3WFHB 5AEAA 1MWOA 2C4FU 2ITCB 3CFJB 3FB6A 1T1ZB 3UBXB 1REIA 2IH8A 2CNZA 5GTIH 4JKPL 1L3NA 5SX5H 1K6QH 1NKRA 4ZMPA 4FZEL 4QRPD 3GBML 3QJFB 3SE9L 3H2QA 4KI1A 1N26A 3B7SA 3DIFB 1P6FA 4R96B 2XBDA 3ZTDC 1QFUL 2M2DA 4WNSA 3IJHB 4KJPD 3HOGA 2KYIA 4V2BA 3VYIA 1EZVI 1CU4L 1EH9A 4XOBA 4UQAA 4YO0B 4G82A 2IO5A 4JKNA 4XPFL 2I7SA 1H0TB 3AT0A 3BUYA 3WE6B 5IESH 3H1ID 2BHYA 3IFLL 3C6LA 4DP5X 4Z7VA 1U8OB 4BHUA 1ETA1 3MV8D 3VGGA 4N2IA 1KB5A 1XT5A 3HNSH 5G4NA 1II4E 1IGCH 4P57A 4NO3B 3CXHI 4ZD3L 3LXAA 4C83A 3EUDA 4X5RA 5APXA 3QO1B 4BZ1H 4CVXB 2EDLA 1HCZA 2GJPA 2IPUG 4WEBL 5KKZC 1BBJA 2FRGP 2GEEA 3FDWA 1L0NG 2AXGB 1IM9B 3WY4A 5EIQA 2Q8AL 1H3VA 2G2PA 2OJZL 4PP1D 4FL4B 1VDFA 1CBVH 4UQ3B 4Z7NF 4JYCA 2IQAA 4Q9QL 1KIUB 5DEGB 2QKIA 5E1HB 3HIZA 1Y6KR 3P69A 6PAZA 3D25B 1L7IL 4GAJL 2FXMA 1TZIB 4NPFX 2VC2H 1NEUA 3IETA 43CAB 4ODUA 2A9BA 1QUNA 1NSNH 3CD4A 3DKHA 4QRRD 1SQPG 1H0DA 1SVBA 1FFOB 1UH4A 2K3HA 4NLHA 4PJHF 5FYKD 5KYNA 3DBXA 2WV3A 4NQXA 1GJWA 3MV8B 4MXWH 1WFUA 2NY7H 2A2QT 4TSBL 3W0WE 2JWYA 4F7KA 1AC6A 1O7DE 1S9XA 3MNVB 5DLML 5E00B 4AZ8B 5DMKB 4JREC 4QMAA 5I17A 2H1XA 3HI1A 1BGXH 4JCWA 1LWUA 2HMIC 5IB3B 5FCSH 1WWWX 1KT2B 5I1KL 1EZVY 3QEQA 4AT6A 4BFFA 3HVNA 5A2KH 3A0BE 1DBMH 4HQQH 4KROB 1XDTT 4FTVB 4PBWD 2GJ6D 3CLEL 4N0UB 3SPCA 3EJJX 1B9ZA 4GQRA 3CVHA 1G7PB 2P49B 1HN1A 5D72L 3NFSL 2I9LB 1M1SA 2CO7A 3L5XL 1J0KA 2EXWD 5EZPA 3CSPA 4LRNL 3PCYA 5I66A 3RL2B 5EZOH 1U93A 1LM8V 2YGNA 4A6YL 1U2CA 5EEUA 2XG4B 3OPZL 4FYRA 3PJNA 4AX3A 2NR6D 3I3BA 1T04B 1SXNA 4GBXB 2JXMB 2FX9L 2ZYDA 2ITDA 4JEGB 3W39A 3NCXA 1NMCB 5CLXA 1WWBX 2E4TA 3DX2A 2ICCA 1ZVHA 5C08D 3VWJB 1JNLH 4MGXA 1TTCA 4XCNA 1BZEA 3MP7B 3PWLA 1HXMB 3DX3A 4AV5A 4ETQA 3U6XA 4MTMA 2BHUA 4Y9BA 2FYVA 1UZ6E 1KC5H 1SMOA 4PHXA 4AVIA 4PJ7F 3OMAB 4HUUB 4NWTL 3IDYB 3OR6A 2Y5EA 4K5OA 3MPCA 1H5BB 2ENSA 4OCMC 4W9JC 4EVNA 3CX5H 1S7RA 2LVEA 2AXFA 4WUKH 2CR0A 5IW6B 3S88H 2H88C 2JK5A 2K4WA 4LSPL 3D3VA 4U1LA 1X9LA 8CGTA 1IZJA 3ULUC 1FFNA 3SKOA 5EG6C 3IDGB 5I73C 5KJ7E 5ENWA 1VQ7P 1BQHA 2X40A 1TO4A 2CRYA 4G6ML 4H13C 2Y4SA 3ILEA 3WNPA 5AL8A 3P8CD 4A2GA 3WIFA 1GGBL 2BNQA 1FZOB 1SQVG 3QI9D 2WCPA 1EAPB 5B39G 2X2IA 3OHXA 3SE4C 4BHUI 1T6VN 2PCFB 3HTKB 3VG9B 2Z93A 3D34A 4LSUH 2BY2A 3V6OE 3ILPA 1DEEG 3OJMB 2UZXA 1KBWA 1WDAA 4XXCC 3WUUA 2Y07L 3O8XC 4M6MH 2W65B 4L4TD 1TYEB 3FQUA 1YEGH 2RAMA 4L3AA 5I1HH 2AANA 1NCCH 1BLIA 2GIXA 3FO9B 2C0WA 1EZUA 1Z9PA 1DQDH 1RURH 3ES6A 1ZT1B 4XPAH 4BK5C 4O58H 5BMFH 5IWLC 2H6PB 4YMPA 1LEKA 2DL9A 1FNSH 1YY9C 3D30A 4N8UA 1P0SE 1MFBH 3PF2A 3ULVL 4OKVA 1RY3A 1XX9C 4MQ7A 1JAEA 1PTZA 2F61A 5GZND 1WCQA 2EH8L 2YUWA 4WWOA 1R0AL 3SBWA 2WLKA 3X12A 3X11B 2ZUWA 3HE7C 2ZUQC 5CZXC 1OE2A 4U1SA 3KMDA 5I1JH 4YDIH 4N68A 1U6AL 2ZXDA 4GG8A 3WNLA 3H7BA 4NQVA 1YPZA 4M00A 4RGMC 4G1MB 4PJ9B 5ANMB 1D6VH 1JWSB 1FZJA 2A74A 4E9RA 3BRVB 5H2FE 2B77A 1IGCL 3H1JG 3JZ7A 4ZD3H 3RI5F 3VQMA 2FBWC 3ARFB 3AFLA 1INEL 5DMKA 1AFVL 4EDXB 4YX2L 4XVSL 4HWEH 2IBGA 3H42L 1Q72H 5DJCA 1DVFA 3APFA 4DZBA 3QG7L 1NQBA 2YBRA 5BV7C 1MJ7H 3IDMA 2G5RA 5D70L 3SYPA 5KG9B 2VJ0A 1RUKL 2AKRA 2DMCA 5T1KB 3DHJA 5C0EA 3B5NA 1RMFL 2Z4QA 3ISYA 3MUHL 3RTQB 5T1LB 1T7YA 1K3IA 4GLRH 5KVDH 4UQ3A 3C60A 4R7XA 2EEAA 2B88A 4RBPK 3T8XB 1QACA 4W93A 4N1HB 4NOFA 4FXGB 1AQKH 4AM0B 4H0LC 4LGSB 2XNAA 4Z0XA 1AR1C 2Y72A 1GHFL 4FQPA 3D39A 3D1MC 3FT4A 4LOFA 3NBNA 2FH6A 1P4LB 1NKOA 3IXAA 4BSWA 4IM8A 4Y19B 5F7UA 1C8PA 1MAML 3KPEA 4ODVL 3RY5A 2YKQA 3HS9A 1NIAA 1FCGA 2GJJA 3BWSA 4WI6A 2NY1C 3TTSA 2XTSA 3PPSA 1ASOA 3B8EB 3Q5YA 4L48A 4ZMQA 3MKKA 4ZFGH 1MHEA 3NFSH 1NZRA 2ADGB 1FQ9C 1U30A 3OW2O 1ED3A 2W9EH 2YFOA 3EFFA 1AIZA 2C9AA 4OF8A 3DOSB 4X0KB 5EZOL 3L73D 1S7UB 1XAUA 3JVGC 4KHXA 3QWRA 4HJSA 4HPHA 4E68A 1KGXA 3DLQR 4U2YA 1BAFH 3EJCA 4ODHL 4KAQL 1TF4A 2QQNL 1X9VA 3V5KB 5BZZA 4APQA 4BCXA 3BUTA 3MCKB 4EAEA 2D7NA 2HVBA 4ELMB 1ZRTE 3TASA 2EDYA 3CCEP 5AW5B 2K4AA 2CM5A 1UWEH 5HDBF 2FUQA 2Q3EA 4GKGA 4F1ZA 3N55A 4M8VA 2NDFA 5D6DA 2WPRA 4M3LA 2DH3A 3LV3B 2GVYA 4HB1A 3MA7A 1UT2A 2WT7B 3CX5K 1MJJB 3KLQA 1XXDC 3SDXB 3V4VH 4ZFFA 5D7LB 2Y1VA 5BOJA 1SVCP 4I0KA 1NCTA 4CW1B 5KANI 1OXZA 2VRAA 5GJTL 4XNZB 5HTSA 1J8KA 3KCWA 1P7KA 2N7AA 3DURB 1L0ND 2EH7H 2AXGA 2CKBH 4NKDA 3N5AA 3BCCE 1MCDA 3KD4A 2ESVB 3BVDB 1A8ZA 4FX5A 4GS7B 4Y5YB 4Y19D 1RJYB 3FCTA 2YK1L 3OA7A 2DQHL 4R96A 3PHOB 4ALAH 1JBJA 4YHZH 4NWUL 5F88A 2YQ3A 3KYKH 5LGJB 1ZHKB 4LHJB 2FEEI 4FJ6A 2FFDC 2WMMA 2QGBA 1IC5H 1G7PA 2BFGA 1I9IL 2RD0A 2ZX7A 4NI3A 4UDUB 4ONFH 2Y2YA 4ZTEA 4CSZA 2Y25A 2O6DA 3P9LB 5F1SA 3KXFA 3T4AC 1PG7L 2VC2B 1XF3A 1WFNA 4IEFB 3N42F 3L95A 3RTQD 5BW7C 2B1HH 3OKDB 3SBQA 2VT0A 4FOMA 5KJ7A 4RDQF 3EBHA 3PY9A 3RVTD 5ANMA 3DIDA 5GQBA 2IDBA 2PETA 4H2AA 3LS4H 4GJTB 1FDOA 3GMOA 1F1DA 1FNSL 4HYTB 2JJWA 3MNWB 4JY4B 4JQIH 4ZPVB 2AEOA 3BZFA 2V2WA 3NIFB 2GY5A 4P5TC 4XNMA 4ZXBA 3CC5B 3RYMA 3POHA 2M5AA 2UYLA 1NBYA 3E6HA 1UA6H 3VXSD 1Q94A 3ZIMA 3FN0L 4XPAL 4BFJA 4BZ2H 4RFNC 5KLVG 3D87B 2HP4A 3ARDB 4HJJH 3HN5A 4BH7B 3MYJA 5ESQA 4Q4IA 2ALAA 2K9YA 3EDFA 5FUCC 3BGMB 1FAKT 3VMXA 1CLZH 3EYSL 4X6CF 1BAGA 3SO3C 4P2CG 3MGAA 4LQ1A 3TK1A 1JFQH 2FNBA 3QUXD 1DO6A 1OARH 3B7TA 2OMVA 3CDFA 3IJ7A 3P1VA 5I1DB 3IU3A 5IW1B 1T5WA 3UC0H 3VXOB 1N59A 4OZFA 3Q2YA 1ZHNB 2Z5HA 1U3ZA 1GOHA 3W0WB 1P5UB 2RFXB 4NN7B 3EJPA 4XPGL 2EIBA 4P46B 5DD3L 5KLVJ 2Y6TE 3I2CH 2ICWA 4HWZB 1NFIB 3HD7A 2Z7UA 3JWOH 3OZLA 2ZP0T 2VQ1A 4GAGL 4XMUA 3WIFB 1P7HL 1SNRA 1J48A 5I0XA 1MQKH 3TT1L 4BRVA 2ZE0A 1JUNA 3VGEA 2YZ8A 2A38A 2WAQA 3CN3A 3SCMB 5GGSA 3ABLB 1IO4C 3S98A 3RDTA 4ANKA 4UB0H 2DIJA 2AERT 3BAYA 2KZWA 4X4ZA 5ISZD 2AHIA 5K69A 1RZKL 4XN5A 1U42A 5L7XH 3D71A 3N9GL 2GPZA 4A2FA 1K3ZA 1ZLLA 3QDMD 2F7PA 3QIBD 4V2CB 4AENB 2AABH 1GHFH 4L5FH 1U93B 5FKPA 2FIKA 4JO3H 1K8IB 2H89C 4OUOA 4XX1G 4L1HA 3QYMA 3OGCB 2ZUUA 1W0WB 4MNQB 4R2GC 4ELMA 1WCBB 5FYLD 1QBML 3IKCB 5TISE 1GZHA 2FJUB 2BVYA 2G2RB 3M9HA 3X3GH 1RU9L 3VXMA 2EVGA 5E6ZA 5EEYA 4IFDK 4Z7QF 2Q7CA 4H5SB 5KUMA 2F53D 2OSYA 2X4PA 3OX8B 1XGUA 2QV2A 4XNYL 1MAKA 1SYVA 4FQXD 5SX5K 2Q3XA 4LLDA 5F6IC 1DDHB 3GSXB 4UQCA 3GRWA 3IVKA 1H6EA 3RWCB 35C8L 3LV3A 1UOWA 4JFSA 1EUUA 2XQ0A 2FATL 3KPQB 3LDBC 5D9SB 4Z3JA 1YNTB 3DX6B 1S5HA 1NTZK 2NXZC 1HFUA 4LPUA 3L4UA 3ZDZE 1C12B 4XP4H 1BXXA 2OJEB 4M93B 5A3ID 1HDMA 5CJ4A 2ZXBA 2NLJA 1TCMA 3P7KA 3QNXA 2DQEL 2NPSB 2WKGA 4HG4J 1JCKA 3QJOA 4U3SA 5TE7H 1SVZA 2C1OA 2O6PA 3DROB 4U0RC 2CLVA 2JIXD 4JKWA 4KH9A 4YZWA 1S7UA 5EO9B 3ZZQA 2V7NA 1LEGA 3KLDA 2WPSA 1PZDA 3ZMRA 3W2DH 3H56A 2JQAA 2J7LA 3MJ7B 3VTMA 3WNNA 1X9RA 4XBMA 4ZSOA 4EN3B 3TEXA 2CKBL 4X6DF 4NKMB 1OW0C 1AMXA 1BVZA 1NC4B 4N4YB 4P5MB 5TF1L 2V2XA 3P73A 4TYUA 1A6VL 3NCCB 3U2SA 4NO0B 2J6EL 4N0FB 4MMYA 1OAQH 2VDKB 5D5ME 1CF8L 4X9YA 4QRAA 1L0LJ 3PHSA 5F7AA 2X89A 3VA6A 3RKPA 2WVSA 4XB3A 5MENA 4PJAB 1JRHI 1B2WL 3W9EA 4OLWH 1NTZE 5AB9A 2QKSA 2GI7A 5J56B 1SN0A 4HIHB 4GDOA 4ZS7H 3K91A 3EFOA 3PP5A 1NGWB 1IGTA 2IVFC 2HX9A 1E40A 3JYBA 4IRSC 4NZRH 1KTJA 4DH2A 2ILLA 1R47A 5HGAB 3UAJD 2A73A 1HBWA 5E8OA 5K5GB 4NO5A 5EMYA 4Q74A 2Q3ZA 3NQIA 1GCYA 2LLNA 3FQRB 5GTHH 2OX5A 4BQ8A 1QNZH 3TURA 4XOAA 2DQDH 5EFIA 4L0ZA 3MRJA 1MVUB 3H1JE 5DO2D 1N7SB 1AO7D 2AJZB 3FBQA 2APSA 1GSMA 2DWDB 3L5HA 3MLXH 3FB5B 5ID1B 3I9GL 2YQ2A 1LVEA 2N7SA 2PW1B 5D1XC 4CVZB 2ZYRA 4KKCC 4WJ5B 2F0CA 3ARGA 3KYMB 3OKOB 4XPBL 4A66A 4XPTL 4JZNB 4F2MA 3NCYP 4QRPA 4Y2LA 2MQ0A 4TV3A 4YZFE 3CXHE 5FGSA 2P45B 3V0VA 3DC0A 4F7MA 4G2AA 4G6JH 3TZVC 7FABL 3SFDC 4UT9H 5A7BA 2J2ZA 4F80A 4X2UA 4O2CA 2VQ4A 4FHJA 1QNIA 1U3HC 3BWAA 2BIIA 1QO3A 4NN6B 3H1IG 4BBWA 3D8MA 3I2CL 1KBBA 1ZRTD 3KE0A 1A3LL 1UOVA 2W9DH 2CGZA 1U33A 1WG3A 3IGUA 3H53A 4IBZA 4X80L 5GHWH 2OQJB 2NXZD 1CURA 3PDOA 5DZOA 4HKBB 3QUZD 3BP5A 4FQ1L 3OXRA 1M90Q 1FFRA 1F11A 2WQWA 3GS4A 4JFHD 4Y2OA 4JGNA 3E9TA 3KNBA 1SBSL 3QAZC 4RMBA 2EE6A 3V7AE 5DJ0A 2HLFD 2YUXA 1Q9KA 2FT7A 5TDNA 3AG4B 1YNKH 1NMAL 4XB7A 5G2NA 1G7LB 4WTQA 2FKWB 5AOIA 3O3DA 1ET5A 1QW9A 4JO3L 1EZVX 1PPIA 4G9FD 3QEHA 4LSSL 1AGDA 1BYPA 2JO1A 1ND0B 2HSIA 1X5KA 4LVNB 4P46A 4WJG3 1KPRB 2DEYX 3E8UH 3ZKND 1F6FB 1KGIA 2PO6A 5D4IA 2EXWC 4MKTA 1WK0A 4A7SA 2NY4D 3I6KA 2MCPL 1QSZA 3CK0L 4UT6L 5IVNA 4RRPG 1CLOL 4WHTB 2ZVNB 1KNOB 2Z8RA 2HTLC 4Z7UA 3MYZA 3TBVB 1WBXB 4Z3IA 1HSBB 2X41A 1JJUA 1KGJA 4HIEA 3RWDA 3VXRA 5MP6H 4NCDA 5FUOL 1IBBA 1RHHA 1ZE3H 1BFSA 4PVBA 4XT1C 1U8JB 4ICWA 2YXMA 4IIQA 3NESA 4XMPL 2UXVA 4XXDB 3AEDC 3ILPB 3VFTB 4HC1A 5E7FA 3NXSA 4KT0J 5DQ9A 2E47A 1JV5B 3OL2A 3CC2P 5IY5B 1AGEA 5LGYA 3CHRA 3WHE0 4WF7A 4OZFB 5I1LB 3L71D 5CCGA 3L45A 5L4JA 4MA1C 1A22B 2EKJA 2E5TA 3STLA 4DP9X 2VOTA 5HGHB 3I55P 3CFKA 3FO1B 5LCVL 2J59M 1M7XA 4S2SB 4PUBH 5HYSG 5IF0A 3DRTA 3IFOB 2GW5A 4OIIH 3EFOB 3RL0C 1TFPA 3OB0H 4HEMA 4OFYA 3H0TB 2Y3NA 5CUSL 2CIKA 2VLKD 2A99A 3O45A 2AQQA 5IBTL 4DP1X 2BH0A 1NTMG 4EOTA 3C87A 3HPLA 4HG4K 2Y9ZA 4R4LA 2A6IA 1VQ5P 4L9DA 4MRBA 3T1FB 4Q9RH 5D1QB 1O7VA 5INCA 4DEPB 1YMMB 3HMWH 5GGUA 4K55A 5IV2B 5C0FA 2L7UA 2EC9T 1P4LA 3B9KC 1CD9B 3IM1A 4R7DA 3MOBL 3M1BB 4XMZA 4AH2B 4N2OA 1TZIA 2YPVA 2ZWNA 3BT0A 2F54D 2BSEA 4I9WD 1SJEA 2WQ8A 4OF7A 1QTYT 3M45A 2WBJD 1OAZL 1BFTA 2ENYA 3FQXA 2WVTA 4K2UH 1EGJH 3PWJA 1KB3A 3OKLB 4JE0A 4RNRB 1USQA 4JDVA 1U8PA 3SQOL 4A39A 1LEGB 1IO4A 4M6NL 3QQ4A 3KM1A 4QCIA 5SWZE 1CICB 1MHEB 1QLRA 4L4VD 1BDCA 1R34A 5LNGA 3SGDI 1GTWA 1AVOA 1FZGA 2C26A 5IMMA 1NMBL 4HBCL 2EDFA 1E4WH 3OLDA 4PRAB 2OYIA 1SHMA 2HKFL 3UBHA 5JLZB 4FFTA 2BX5A 2BASA 4EYYQ 1NPNA 3GSRB 1YCSA 1C5DA 3L37A 4LLQB 1K2DA 3KH3A 4P57B 3ARDA 4MBOA 4Y8AA 2EXYD 1Q1PA 1NWOA 4KPHH 3VXNA 1PP9D 3ZKMD 1J5CA 3WY2A 3CCSP 4O2CB 3TGUD 3M88A 2H8PD 1ZTXL 4KUZL 3L9EA 1O6VA 1MLBB 2V17L 2P5WA 3WU2H 1A3QA 4MMZC 3KL5A 4KDVA 4AM0A 1NAML 3CTTA 4LNRB 3QDJB 1ZCRA 1KXQE 4P4RB 2HR3A 4LOUC 5FYJE 1OMIA 1IILE 2ZG2A 4HSQA 4O5LL 3PP4H 3VFUB 2TRHA 3CLWA 1L0LK 5CSZA 1WEJL 1O5PA 5E95B 5KVGE 1BM3H 4AC2A 1BW8A 3L17A 1L4AD 4RKUJ 2PCPA 3QG7H 3CU7A 1AD9A 1YEFH 2HT2D 2X28A 3PDOB 2XWZA 2F7IA 2I07A 3Q0HA 7FABH 1E5ZA 5C07D 2ADIB 3ZSSA 4QHUA 1JCDA 2MPAH 3N1PC 1UADC 3NFPB 2IC2A 1H6UA 1I1AD 5E6UB 3AAZB 1IBFA 4GXVL 2KZKA 2OXGB 3LKQB 1U57A 3CXHH 1FIGH 5I6XC 5LNDA 2R56L 3UL4A 1T1XA 4AOFA 4O02L 2WUBL 4G9FE 2CG9X 4H26A 2CGRL 2G9KA 2NY6C 4TUJA 3VXRE 5C0BB 3OKEB 3V55A 4JFED 4QY8A 2JKXA 3RWJB 5ADOL 5MI0C 3QCTL 5H94A 2R5BA 4GSDH 1YJNP 2DM3A 4WHCA 1IAIM 3C08L 3ULVE 2WSFJ 2XY1A 4JVUA 3MV7D 2DAVA 3ESNA 2EYSB 4NBYB 4Y2DA 3V0AC 1NMAH 5I5MA 3RVXD 4CN6A 2K6YA 3ZE1B 1S3KH 4DN3H 3G6JA 3TO4A 1E67A 4Q0XL 1QOKA 1V3MA 5EU3B 3BJ91 5FC9A 1ZLUH 4DKTA 1TQBB 3TYGL 3T0EA 1RZ8A 3R0MA 4E42B 1SFCA 3JSSA 3TO2A 5FGBC 2FZ3B 1D9KD 4N2DA 4KNUA 2HTKD 3TBWB 3JT2A 4GRWB 4PJGE 5DRWB 1A7PH 2X4SB 4TQ8A 2D03L 4FQQA 1YJ9P 4KAQH 2XDJA 2GSIA 2ITCA 3FB6B 3IMTA 2X9XA 4F7CA 2XYBA 1MOEA 2R29H 3TV8A 3WIAA 1G7IB 3CSBA 5IZ7A 4JAMA 5JPMC 2FQDA 3QYCA 3TCLA 4P23A 5EN2B 4ZFOA 1DZBA 4U3CA 4UAOC 4YSCA 3R19A 1Q9OB 1KCSH 2HLAB 4UQ9A 3KPOB 3RKDD 3WSQH 4Y1AA 4JM2B 5ABZA 5DJ2A 4OI7A 1CXFA 3HC3L 2XHNA 2R27A 1EO5A 2YPVH 4F8QA 1YRKA 4AGOA 3L75J 1IJ9A 2AQRA 2DQMA 4KRNA 3SBPA 3CCRP 1CWVA 4I48A 3NDYE 4J3UA 4PJIE 4BDVA 4LHUD 3E2HC 3NMEA 5HDQL 5TDPB 4P48A 1FYTE 1KGCE 5TTRA 3G6AB 2VERA 4PCTA 4EQ2A 4FYQA 4MQ7B 1FE8L 4ODXB 4HXAH 3CFTA 2HFED 1VZIA 1NU1J 5ENWB 2R23B 2E46A 1KQFB 4UV7L 1NCAL 1EHXA 4CC4C 3ZDWA 1Z5YD 2ZYSA 3A4DA 3CBJB 3HC2A 2WUCL 3NN8A 3P4NB 2BWIA 2UZYB 1OT2A 3V2QA 3TVMA 1Q9LB 1SLQA 3CZSA 3V8OA 1EO7A 3FUIA 1S5LE 2QJPC 4XWGL 3NSDA 4KV5F 3C6SB 4LKCA 4AVHA 4NHCH 5ESVB 4OZIF 2E74B 3M07A 2Q3AA 3QUMB 5L0QC 4U3HA 3TH2T 3QFDA 1AGEB 1RIUH 1SQBJ 2ED7A 4F7PA 5F71A 5CCKH 1H8OA 2J58A 1KB5B 2W5PA 5EHFA 5J9PA 4AG4L 1HUCA 1GGUA 3ARYA 2DBLH 3GZPA 4DFHA 3KCPA 2FJSA 3MACH 3GSRA 2H2PC 4MS8C 3BUYB 2OYLA 5IW1A 5GS0H 2NSQA 4DETA 4RMWA 1ORQA 4HHGA 3UAEA 1F3DH 4OGYH 4F2EA 3VDBA 3CH1A 4OZFG 4ZK8A 2P4AB 4XGZA 4KY2A 4W9GC 4F8NA 4OGQC 5C0GA 1QRNE 3APNA 1YEKL 4Q97A 4X5XB 5HGDA 1X5GA 3FS9A 4I7ZB 4X8JA 4MWFB 5C0BD 2QGDA 3EXLA 1RUPH 1JZ4A 4DP0X 3L74D 2WXJA 3DPDA 2V5TA 1H9VA 3I6SA 4M1GL 5AYUH 2QADC 1UA3A 3RVUC 4Y19E 3LKOB 1TG8A 3NFPA 1PY4A 1HIML 4LHQB 1A9EB 3KEDA 3FSWA 1IFDA 1WC7B 5JXED 4QHMA 3TPUA 3RIFF 3QGVA 5CBAB 1T21A 3VE0B 2XY2A 2KLVA 2OCJA 2W07B 1R5SA 3CG8A 4KPHL 3CXFA 3UMNA 4K07A 4G5AA 3FK3A 1ZT7A 4U1LB 4M29A 3GJFB 4DZ8B 4EI2A 4OQ1A 2NYYC 4R7VA 5IOKA 1GKOA 3J8F7 1Y07A 2BK8A 3FQNB 4D0CA 4NAJA 4F7TA 4Q2ZB 3S8FB 2AC0A 1YMME 5KVMC 1DQJA 2A77L 1GJIA 4YBLC 2OZNA 3U9PH 5AKVA 4ZDHB 4HWBH 2EC8A 3PWPE 3RL2A 1TUPA 4HQQL 4QRRA 5JYLA 4JRXB 3RK2B 1LE5A 5DQ9B 2R56H 4NQCA 3GMQB 2A6IB 3H1KJ 3BPNC 3RJQB 3PWLB 3E6FA 3KWVA 3T97A 5LN4A 3V0FA 4AGPA 2VO5A 4HAFA 3ZUCA 1CGXA 5LQBH 3MX0B 4ZKUA 1QP1A 3L48A 1ZLEA 1P1VA 5DR5L 4AQ8A 5ELIA 2L7QA 4ESKA 1FJKA 1JVKA 3VQ1C 2ZX9A 1SDDB 1HVVA 5CILL 3QEUB 4ACPA 3MA7B 4CGUB 4AL8L 5IF0B 4WFGD 2XUWA 3DPBB 2XG4A 3K72A 4XVJH 3SDAC 1U2YA 3SE3A 4F27A 5FX3A 5F72S 2YAMA 1ETJA 5TJHA 5B1JC 4IMKC 3T3MF 2XTJC 2C0XA 1HYRC 3KJ4B 5KSVA 3C6LC 4DQOH 3RL0g 1F4AA 4OCSL 1PAZA 4I48B 2X6MA 4KGJA 4R26H 3WFEL 1CDIA 4K15A 5IB2B 1U58A 2VERN 2BIPA 1RUAL 1YYML 1S3JA 3OPZH 3C12A 4KBPA 1A7PL 3G9RA 2JB5L 3CCHB 4I2XA 1EHNA 5BQ7A 1M1JC 4N1CA 4WTZG 4I1NB 5FF6B 2FR4A 5H94B 3RFZA 1OTUD 1TXKA 3AQYA 2YPKA 1MRCH 1QLED 3H7BB 2VDNL 3II1A 4NQVB 2G3MA 3UERA 3WS6A 3OKOA 2LGNA 2D2CB 2W81C 3MBXH 4M3HA 2VISA 1LK2A 3VWKC 5D1ZD 3T4YB 2Z7ZA 2DQEH 4Q56A 4IL6X 5KLIB 3U0PB 3RBZA 2PPDA 1UKQA 1E4XI 3CZKA 3G5VB 5IHZA 2DJUA 4LBAA 1CQKA 4MAYD 5C09D 4HK0A 4NP9A 4JO2H 4WV1B 3L2MA 3EF4A 1PP9E 4R0LA 4W9KC 1RK1A 4KQ3H 4HXAL 4PMEA 1K04A 1JGDB 2DKMA 2H6PA 3FF8A 4DP4X 1XTGB 5E8OB 4PJ0E 1RF1A 2HAZA 2ICEC 4W80A 2OYHA 1UB5A 4XPHL 3LNIA 4XNUL 3L81A 3MODL 3MAWA 4DGIL 4G7VL 5I16A 1E27A 5C0JA 1ZLWH 4XN4A 1I75A 4Y2OB 5LB1A 4FL4C 4A68A 5IJDC 1CFTA 3C60C 4UIMA 4NENA 2H26A 4HJGA 3EDKA 4U1JA 1A7NL 2W0FA 4GKLA 3U7AA 5CM1A 2YOAA 4BCZA 2P9RA 2B87B 3ZKMC 2FFDB 2MNJB 1XTCC 3MRCA 5GTIE 4RGNE 1OPGL 3U1QA 4BSWB 3QPXL 1KENL