5AVXB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avxB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avxB02
4KHXA 5APYA 1YYCA 3V4WA 1SLQA 4RETB 4M3LA 3LIDA 5AW6B 1MUUA 3VN0A 3VMZA 1KQLA 1S9KD 4GKGA 4JYBA 2WWWA 1CI6A 3OAKA 4B86A 2QM8A 1T2KC 3A7OA 1OWAA 1GZLA 5AVUB 5APXA 2WT7A 1GU5A 3V5BA 1A02F 1H88A 1J2JB 5AW7B 5APQA 3WGVB 3VMYA 5AW2B 2WTYA 1NWQA 1JUNA 2Z5IA 5CMZA 2E42A 3HTKA 3MGNA 5AVVB 1S9KE 3IR9A 2E43A 2VRSA 2Q7CA 2W6AA 3TNUA 3A5TA 4I6MC 1FOSF 3V4QA 2R5DA 1T2KD 2KP8A 3A2AA 1OXZA 2WPSA 2WPQA 5AVTB 3NMDA 5AVQB 5AVZB 4LC1A 4I2LC 3NXSA 4GT1A 2P2UA 2QM7A 1FAVA 3HE5A 3M9HA 4RESB 5AW3B 2YNYA 4HYTB 3VTPC 5APSA 1MFZA 4C46A 1G2CB 3UIAA 3L35A 3HE4B 3VMXA 3P32A 4C7NB 1HUCA 1DH3A 2JJLA 5AVRB 1CSBA 2YO2A 1H89A 2XZRA 5AW9B 1GTWA 5AW1B 2R3CA 4JYCA 4XE5B 1SP4A 3M91A 1HBWA 3WGUB 3M0DA 2ZFCA 3A3YB 2YO3A 2ZXEB 1GU4A 3KDPB 5AW0B 3NFQA 2P7JA 3P8MC 1GD2E 5APWA 3KQGA 3MD0A 5APUA 1H8AA 3I5CA 1GK6A 2R32A 1CI6B 3NTNA 2W27A 1CZQA 3TK1A 4AUWA 3L36A 1NAFA 2R5BA 2IPPA 3M9BA 5APTA 5AVYB 1GK4A 2WT7B 3B8EB 1FOSE 4AQRD 1MV8A 2N9BA 2C9LY 2Q5UA 1A02J 2WPRA 3M0AA 4EOTA 1X8YA 1HJBA 4AYCA 2XV5A 5AW4B 3HE4A 1HWTC 1JNMA 4C7NA 1IO4A 2BASA 3M06A 3TNUB 2H7HA 2P67A 5AVSB 3VYIA 2XU6A 3L37A 2Q3IA 3P7KA 5AW8B 3T97A 4DZOA 3O8ZA 2C9NY 5APVA 3HE5B 5AVWB 5AW5B 3TYYA 2Z5HA 5AVXB 3LIEA 3SWFA
chains in the Genus database with same CATH superfamily
1AA0A 2AKRA 3WU1A 1JMMA 35C8H 2UZYA 2OTWA 3I3BA 1C8QA 3F7PC 2DD8H 4GOEA 1MOEA 2N7BA 1RSYA 3JUZA 1QHOA 2D03H 4FQLH 4IL6X 2A74C 4UM8B 4N0UB 2EDWA 3FT3A 3D6YA 4JKMA 3L9BA 2F8OA 4IBWA 1HKLH 2QM8A 2W6JH 2PW2A 2BOBB 2X40A 5BV7H 3CFBA 2KKQA 4N85A 5F9JA 1MRDL 1C5DA 4M4PA 3NFNB 1NTKK 2AJZB 2V2XB 3PHOB 1KBVA 3LKPB 3GGWB 4UIKL 5H94A 1GGIL 3QO1A 1QEWB 5T1MB 1QRKA 1JB0J 2XA3A 5DURB 3S3CB 4A63A 1HCVA 3AG4B 1S7WA 3B3IB 4JFXA 4O2EA 3CPWO 5IR1A 3ELQA 4IRZH 1GIGH 1RULL 1W72L 4OUOA 1KENL 1CLCA 4RGND 2W90A 3A2AA 2BFVL 1N18A 5EBWB 1CD0A 2XFGB 5D1QB 2QTVA 4C83A 2C1OA 1NTKG 1F4XL 1GZHA 5FK9B 5TQ0L 2WXMA 2HB0A 4BZ1A 2MHAB 4S1SL 2Q1KA 1A6TB 2W60B 3TIEA 3X1FA 3SDYH 3T77B 4HKBB 2V5MA 1AD0B 3WY1A 4B9PA 2WNGA 2O5ZH 4DK5A 3L75J 2F1AA 3C60C 4O2CA 5H35B 3OLEA 1OAZL 1Q81Q 3TZVB 1CFTA 5GSRB 5KSAA 3TBTA 4I3RH 3KNBA 3MRGA 3WGUB 2W5PA 3PF2A 5BW7C 4FTVD 1WA0X 3D52A 1SQVJ 3UZQB 4JO4L 5CJXA 3N44F 2VISB 3QJZA 1JHKL 1TVHB 2DKUA 1FRGL 3MYZA 3CFKB 3MLSH 3SEPA 4XVJH 4LQFH 1LLAA 5EG6C 1BVLA 4KKBC 2QELA 2GITA 5D4QA 3VXSE 2DLGA 3X1NA 4D9LL 1FC2D 5K9KA 1CDGA 4KRPD 3ZDXE 5IQLA 3MGTA 1HC1A 4AMKH 2M3EA 1N7SD 3CVDA 4XCEB 1UWEH 2PLTA 4PJFB 4KZ0A 3VGDA 5TDOA 5J1SC 5D7KD 2NSMA 2DKSA 4K94C 2Y36H 2EH7L 1JZ2A 4I1PA 1H5BA 1YMMA 2G2RB 3QXAA 2V3EA 3DV4A 3GI9L 4CBPA 3MRFB 3WLWC 3QEUA 4J28A 3CFDA 2QSVA 5E7FA 4TS6A 4HWNA 3UZVA 3S8GB 4HWZA 2QJKB 3KPTA 4YLQT 1SQPE 5H8DA 2FJGB 3LNIA 1SFDA 4HLZG 1QKZL 2CJSA 2J5UA 1D5RA 5B38B 1S5IH 3IJYB 3DI3B 1L4AB 1BYOA 2OR9L 4HKJB 2ICEC 4YPGB 1O9VA 3FNKA 3L4WA 4GXUN 4TNWK 1XEUA 4LLHA 2B08A 4WKZA 5L0QB 1EC5A 2XZCL 4X8CA 1KCWA 3GT6A 2P7TB 1YAZA 3DSNA 4A6YB 4NS0A 2XBDA 1XCTA 4Z77A 2WXQA 4JFUA 3KJ4B 3K2UL 3AREA 2X4OA 2RR3A 4R4MA 3VU1A 1QFUL 3MNVB 4NUGL 4Y5VB 2C4FU 1OP5H 1SQBG 5IQMA 4U49A 2VLJD 2WNWA 4OGXH 3RI5F 1T2KC 2X4SA 3UGUA 4K55A 2IG2L 1XH1A 4FN0A 3VRIA 1NJ9B 4IKIA 5DUPL 4ZO8A 3CL3D 2OL3L 2Q10A 4LASH 4MJ6A 3Q2YA 4YHIB 2A06E 4F33B 4K7FA 2OMTB 3LIUA 3Q8BA 2CUAA 2PR4H 3H0TB 5DZOA 2CLZB 4N28A 4XPFH 2GIXA 1A9BB 4FNSA 4M9PA 2WLLA 4N8VA 4XO9A 4FXLA 1JYNA 2R2CA 3SGEI 2V3FA 1L2PA 2M8XA 1KUMA 1BDYA 1QACA 2FQEA 4YBLC 3UJJL 1VADA 2G3XA 4WI4A 5FGCE 3S3SA 4FQCL 1NCCH 1FZKA 3I3EA 5FOBB 1YYML 4JRXA 4PB0L 3TASA 1PG7X 1BQLL 5DVMA 5LUMA 1GGBL 2AK1L 3U30B 4R4FH 5CHNB 2IQAA 4IM8A 2R4RL 1HQRA 2A99A 3L35A 2K4AA 5A2JH 3H1HD 1OALA 2EDTA 2X4TA 5E8PA 2NZ1A 1MXGA 3E8UH 1NLDH 1IQDA 1M1JB 1DQKA 4LEBA 2R8SH 1BIIA 3LNFA 5AQ0A 5IB4B 4L0ZA 2ZOLB 1Y6KR 5E6RB 5K59E 3B83A 4XX5A 5IB3B 2YC1A 4Z7QF 3HD7A 3N1MC 3W68A 4HA1A 5JW4M 5KYYA 1L3NA 3HAEB 5J3HC 4DN3L 3H55A 1NBVH 2JKSA 2ZQKA 1N64H 1KIQA 4X8XA 3W2DH 2DZEA 4WV1C 3WSQL 1VQ4P 1U8PB 4I7ZB 5IVXE 4KITB 1MW2A 2ENQA 2ZKMX 2KC0A 3D08A 3OKOA 1B3IA 4CDGC 4YZFE 5F3FA 5I1CH 2IBZI 2KZKA 4P46B 1KILC 2C9LY 3BZDA 3C12A 2WPRA 1YMHB 2PCPB 5G5DA 1IM9B 4EOTA 1QTYT 4HXBL 1T1WA 2N0MA 1O6SA 3GLZA 3S5LG 3QHFH 4PS7A 2XV5A 4U0RC 4TNEA 2G4EA 5A2BA 5FO2A 3RGVC 1J8SA 1B88A 5JA9A 4JFTA 1OP4A 4P5MB 3L73D 1B2WH 4KH9A 4UQCA 2CDEB 1GL2C 1QWHA 2XJLA 1SQXD 3RX5A 1JV2A 2DPKA 3WHE1 2Z8WC 1WAAA 4LARH 2PPCA 5EZJB 4ATTA 4X6FB 1GYAA 3CD6P 3MLRH 5CLXA 2YIUC 2QHLA 2WN2A 1OK0A 1KN2L 3HE7A 2P26A 5CR8A 1PPJD 4XH2B 2A6IB 2AEPH 3IE4A 2A0LD 5EN2A 2G5UA 1MCPL 3G9RA 4YPCA 4QHLB 2WO4A 3KWUA 1EO8H 4ZMYA 4Y19D 4IRJC 1WWCA 4LU5H 5DZJA 3RG1C 3O45B 3ES6A 1N3NA 4DTGH 5JIMA 2W80C 5A40E 1LK3L 4BHUI 1NEZA 2PO6A 1NPNA 4L3EB 5CBAA 4QT5B 2VN4A 1NCDH 5TE6L 3LRSA 3RVTC 1KB9I 4N9GB 3FCTA 1M7DA 3VA2C 4ZNCD 3FOLA 3FO0H 5CLZA 3WU2H 1M2OA 4CMMB 5B66E 1QX1A 3MVSA 1R6VA 3QQ4A 3A5VA 4OF6A 1PYWB 1DZ0A 5SWSE 2GSGB 3C8KA 2XRAL 3T0ED 4DGVH 5I19H 3NGBB 1EANA 3NMEA 4GKZB 4HALA 4OT1H 5DGQA 4DKAA 2RQEA 3BKML 3UTPD 3WNKA 5CCKL 1EHLL 2WYZA 3CVCA 2QJYB 2KL6A 4GEJA 4HCRA 3WE6B 3RVWD 1T0MB 5E00A 3TA4D 4OCXH 5T3ZL 1FNSH 5A43C 2VZ1A 3TT1H 3GXMA 4GIAA 2YJLA 2NQDA 3KPRD 1XH3A 2JO1A 2BW5A 3BZEB 2BZDA 3FO2A 4HEME 4YSDA 1VA9A 1E27B 2RA1A 4NC0B 5DD5H 4MDIA 1AO7D 3OZLA 3U1SL 2B1HL 5F1IA 2V4HA 3PXLA 1DN2A 3MACH 5ADOH 4E9RA 1IBBA 5GISH 1PFIA 2BXZA 4GAJH 1P7BA 5DRZB 3B2PA 1QHQA 2A83A 4A7GA 4DP4X 3WHE0 3CC4P 2HN7A 2BRRH 1FHNA 2R7EB 8CGTA 3AWEA 1CI6B 1N4XL 3A0OA 1PKQB 1CICC 2VZSA 2A9MH 4L5FE 3QCVH 3LEVL 4RAHA 5EF0A 1A14H 4LP8A 2WITA 3EZJB 1ZV8A 4UU9B 3ZE2E 4RGOL 1QZ1A 3IF4A 4P3DB 3ME0A 4TQEH 3VM5A 5IHZA 1TG8A 4KVCL 5CIPH 2DWDA 5F7HA 5DUML 1PGJA 1OV8A 1UIIA 5C2BH 3S5LB 4R9HA 1EDLA 3D0LA 3DC0A 3P3UA 1SN5A 1SN2A 2ZYDA 4KROB 4V33A 1A4KB 1IMHC 1DHKA 2IOIA 4QOKA 3EGXB 4P05A 3VJ6B 2ZP9A 1RLBA 1D5BA 2VKWA 2FYNC 1I8UA 3DLQR 4FQQB 4X83A 3U4BH 4DN4H 1U8LA 3B8YA 3O8ZA 3HE6B 4GUQA 1UHVA 4APQC 2VCOA 4YHLH 1KNOA 4Z95L 1WH0A 5FYJL 3W38A 2G3NA 4RFOL 4OI9A 2B1AL 4KGLA 5D2LA 1JRHI 5JNYB 4XPHL 3THML 5FR3A 2H88C 1HVXA 1WBZB 4B97A 4ZXBD 3O6MH 2K78A 1XAUA 4BJLA 2FYYB 3AEAC 4P4KD 4DP2X 4ZD3H 3F6JA 1KIPA 3L9RA 2C0XA 15C8L 4KWUA 1JFQL 4UIMA 1IC0A 2XG5B 3ARZA 3TNMA 4RGNC 2WQAA 4BKSC 4X5XB 1I9JL 2Z0BA 1OXYA 3HVNA 5GZND 2WVTA 4Z7UE 2YUWA 4PU2A 4TL5A 1A3RH 3G08B 5TPWH 4B7LA 4UM9A 2QQKH 2MQCA 3FONA 4PD4I 2VQ4A 2VLME 3GI8L 3KPSE 3WEXB 4UZGA 1NGWB 2C3HA 4N0UA 4MXVE 3VCLB 4C7RA 3KM1A 5DWUL 1UD8A 2P45B 2EZ0D 2HT2C 4EUPG 1IFRA 1MCBA 1BZ9B 1DEEG 5ECJE 1NICA 4UOZA 1F41A 3KHUA 1H19A 2WWOA 3RDTA 3HNVH 3S6CA 3O81A 3UABA 1BGYD 5DTFA 4KZDL 2BS8A 4Z3EA 5IQNA 1KEGL 4OZGE 3VI3A 4JPVH 2ZSVA 2CDGB 2PW1A 2YAOA 3HRZB 4GOFA 1BQHA 3IDNA 3P4OB 4NRZB 4EN3D 1BD2B 3I6LE 2AJ3A 2I7OA 2QZ5A 2APFA 4YSQA 1M90Q 2FEEI 2EVHA 4L9LC 4DZ8B 4H8QA 1IGML 2XOTA 4KTDH 3J27A 1T1ZA 4KRPC 3NIDE 1N7SC 2J55A 5T8IA 5EBWA 2KNCB 4D8OA 2NNFA 3AM8A 3H1IG 1T66C 2Y7SA 4L4VE 4XN8A 5FK9A 3ZHLA 4I4WA 1EGJA 2A2QT 5L4FA 5MEPA 1MIEL 3PHSA 3DA0A 2GPZA 2WB7A 3EJPA 4FRWA 4GBXB 3HHSB 2N7SA 5EU4A 2OXHA 4FHJA 3U6XA 2HP4A 5KSBE 5HYSG 4GW1B 3IFOA 4LCWB 3SE4A 1IU1A 5A7EA 3BMVA 1T04B 1S7TA 2WBJA 1NL0L 1PGOA 2JCCB 1AR1B 2YPLA 3KVPA 2HPCA 5E5MB 4X6DA 1CU4H 5CUSH 3BSZA 5DQJA 2MPAH 4Y8AA 1SBBA 4HC1L 2JVUA 3I84A 2JFCA 1CT8A 3ZPDA 1I9IH 1B4RA 5MEOA 1OSYA 2X4UB 5HDBF 1LEIA 3TONA 5EC1A 5AWNH 3DV6A 3ISWA 3ZKSD 3L74D 1JNMA 3U48A 4BDVA 1DDTA 1QWNA 1VFBA 2VZOA 2PWEA 4KRNA 5CJ8A 3X11A 1P84K 1RZJL 2XXCB 4P48A 2WWKO 3P7KA 1SJVA 1T5KA 5FDYA 4HWEL 4N78D 5KS9B 4L4TD 5KYWB 2K88A 2C9NY 5CILH 2NXYD 4KJMA 1LO2H 4HWUA 4PGDA 5L9DH 3BP7A 2Y23A 1N8ZA 3MO1A 3BUPA 2YIHA 1H6FA 4RRPA 2DMCA 2E5EA 2KT6A 1G9HA 2HPOA 2V0AA 4QPEA 4B3VA 5F1SA 3TGUE 1FV1B 2VR9A 2ROXA 2YGQA 2HT3D 1CE1H 1L4AA 2YWZA 4Y9FA 1PSKH 1ACCA 3AABA 5I17B 3QA3A 4OJFH 1VCAA 5IUCA 1JTTA 3WKNA 1XSIA 1Q0XL 1VPOH 1J2JB 2VIRA 4I9XA 3MX0A 1VEMA 5CBEB 3IDYB 2VTFA 2AHIA 2FRGP 1ZK9A 3FMGH 4FG4A 1WC7B 5CMAB 5D7LE 3T8XA 3P30H 3V6ZA 1IGYA 4NC1E 1T22A 3QFJA 3QRLA 5AKVA 3GF7A 2FCBA 2W6AA 5HHPB 1NJ9A 3K4DA 3OG4B 2YKLL 4DP9X 1JPTH 5IJVB 1USEA 3HUJA 1CTMA 3AEEC 1M05B 1TSHA 2I32A 4GXVL 4MCNA 3T2QA 2WXGA 1GW0A 4YHIA 2ICES 3VDAA 2DW3A 5E94B 4WW1A 4A2GA 1UM5H 4JHUA 4QHKJ 3CX5E 4M8VA 2X05A 4DOHE 3QNZB 1JAEA 2BSBA 3DECA 1IAIL 3ALPA 1C16B 3MRQB 2KI7B 4YQXH 4Z3JA 2R4SL 3WIIH 2AQRA 3TEWA 4LAQH 1ZLUK 5KBMA 5CZKA 2IPTL 2OL3B 2NXZD 2K3RA 2DIEA 1HSBB 4GQZA 3VD9A 3PJSK 2BZCA 3MROA 4HZLA 1NKOA 1IGCL 4MMXC 2KZIA 3RL1B 5D6DA 3P0YL 1PX8A 4UCFA 2OYOA 1SUJA 3QEQE 3E3QE 3C9IA 5D72L 5IB1A 1KBGL 1XMWA 1AANA 2H43A 1QPKA 1LT1A 2W0FA 3E6FA 1XWVA 2OYPA 4W4OA 3RPIA 3OB0H 4QTIL 4LLWB 5IOPA 4HSQA 1OF0A 3MZGB 4JDVA 4ORGA 1PP9G 2YGVA 3N40P 3VXUE 5IJKA 5EU6A 5KAQG 4M7ZB 5IB3A 1FL3B 2FBJL 3BD3A 3F7KA 5BV7C 4N2EA 4N2CA 4AQRD 8FABA 1LJMA 5DC9B 1CLYL 3AXLA 4C57C 3OXSA 5E7BA 2PTTA 3GRWH 5PCYA 4PJ6A 2Q3ZA 2ITFA 2HJKB 4PJXB 1AXIB 4XN7A 2P8MA 3L48A 2Q6WB 4HIQA 3U0TA 3HR5B 5F97E 5FUCC 1Q4NX 2HSIA 2A0LC 3ARTA 3TEUA 2WP3O 2BCKB 4PV8A 4P46A 3VFVA 3CXHH 2NY0D 2PPDA 3FQTB 2BO0A 3TXAA 4FFVD 2E56A 3L1OL 2V2TB 1T2QH 1JMXA 3PLNA 1AY1H 1TJXA 3DXAD 4EN2A 1HYSD 1RIVH 1QEXA 5C39A 2OFQA 3NP3A 4C47A 3MJ7B 3WFDL 3O3AB 3TVMD 3D85A 1K6QH 2GC7C 1NSNH 1FL6B 2DLFH 2Y5QA 5BUAA 3QZOA 2Z35B 1G94A 4JFPB 4ZMAT 4PGEA 3RK3E 5AKTA 1VACB 3L7FA 2YXQB 5C0EB 2VMFA 4O00A 2RMZA 3C6SA 3T0EC 3MNZA 4X6FA 1VDGA 4AZ8A 3SY0B 2A9BA 4R26L 2R2BB 3MN8A 4N1EA 3LQAH 2AFNA 1QTSA 3EO0B 2PRRA 4X7SH 2NUPA 4P23D 5DJ2B 2XKNA 3RVWC 5J5EA 5IWLA 4PSPA 1HYRC 2RIKA 3WTXA 3V7MA 3PWVA 3JV4B 5CMZA 2XVBA 3GHBL 1Y07A 3ZDZB 5EA0L 4Y1AE 5D1XA 4NNYA 4OTXL 4ZNEA 1ZXQA 5AYUH 4EEEA 3EYOA 3GUFA 4LNVA 3GB7B 4UV4L 3X2QB 2LVCA 5AVQB 3HMWL 1BM3L 4IL6E 4FGMA 4L2YA 3FQ2A 4O4YL 1ZR4A 3ZTNH 1CPUA 1LGVA 4M7JL 1J8HA 1EO7A 3DTDA 5FCSH 1SYVA 3FULA 3AW5A 3VMXA 2GI0A 3KE0A 2F7RA 4G7RB 3LRMA 1YEEL 4FQXD 4C7NB 4F7TA 1RY7B 5F7DB 2HG5D 1RAMA 4R3SB 1LWJA 3GSVA 1AXSB 4JJOA 1YEJL 3T2NH 4GKZA 2CKBH 5CJBA 2R1XB 4X6BB 3UTQA 2W0LA 2X1QA 3CIQA 1X3DA 1V7NH 1YECL 2IDFA 4JO3H 4QO1B 2BCCJ 1I1FB 3W0WD 2Z1PA 3D25A 4WI5A 1MCSA 4NJAH 3WJJA 4FLQA 4PS4L 1E6OH 2JJTC 2B8OT 3II2A 2V8MA 4HFWB 1JJUA 1A8ZA 1TOXA 4HPOH 1ZANH 1WT6A 1OHZA 3MNWA 1LP9F 3NA4A 4FABH 4I9WD 3RZCA 4Y2NA 1NU1J 4OU3A 1W8EA 1MPAH 2EILB 2Z31D 3SGDH 1EXUA 4DPRA 4ZTPL 1YY9D 3NCEB 1MREH 2PCFB 4V11A 5C0CE 3MCKB 2AV1A 5CSZA 3IDGA 4XP1H 5GS1A 4MA7H 1IZKA 1TO4A 1P7KB 3PJSB 5LWYH 2OMWA 1B90A 4WI0B 1KZQA 4ZXBC 3PWPD 2DEWX 3EBIA 1S5LH 3MRIA 5F0MB 4F7MB 4P4KC 3N06B 3U2SA 1VQNP 4MVBD 4J3OD 2VDRL 4Y5XB 4NO3B 3T0DA 2BP0B 2Q3IA 2P1JA 1R3HA 3RA7H 2JQMA 4ELMB 1ZVYA 2WXOA 5GZNC 4K7PY 5A16A 3U1PA 3UYRH 4M3KB 2XWCA 4W9JC 2IDSA 2C1PB 1FBMA 1ES0B 2H0JA 2YKKA 1NIEA 1E8ZA 2NW2B 1KJ2B 1SJEB 2OYMA 1U92B 4FQHA 5E2TH 4Z23A 4YHNB 4MBRA 1BMWA 3BH9B 5D4JA 4LBAA 3H25A 2P5WB 2EZ0C 3OAKA 1I7UA 4BK8A 4W7YA 3QISA 2BCCE 2Y0CA 2PXYA 2D4DA 4R5VA 4LSUH 2WY3B 3LKQA 4A7VA 4LVHB 1HHKB 5J13C 2DLEA 4NQSB 3MRJB 1U8MA 5KTEH 2WSKA 1CI5A 4WHYH 3N1PC 3WXVL 4WEMB 4EDWL 5BMFH 5IB2B 2HKHH 1IC4L 1YN6A 3ATDA 5D70H 3WXWH 2VMJA 2QJDA 4HPYL 4YX2L 2B9AA 3UGXA 3L72D 1L0LJ 1XF3A 2NNXA 4P57A 4QF1B 4NO5A 3MV8D 1EZLA 1T3FA 2GUVA 3ZE0E 3B71A 2FFDB 3AAZB 1RUKH 4IJ3C 1LEKA 1ZGLM 2Y22A 4OD2A 1IAIM 3LQZA 5E1HB 3FN3A 2K70A 3LOWA 4FZEH 3E7JA 1E5UI 2HUEA 3A4DA 3DUHA 4PJGA 3SOBL 4L5FL 2Y69B 3LCYA 1J11A 3KXFA 3IRZA 4EIZC 4JFQB 4QAWA 1NGXA 3B43A 4OLYH 5GRVK 4PRID 3HZKB 3TYFB 4Y2OA 5KYXB 2BSDA 3US9A 2P58A 3WENA 5KJ7A 1LE9A 1DFXA 5JW4N 2OJZL 2KLRA 1D7DA 1FUNA 5DSCB 1JZDC 1U8HA 2H1XA 2HYMA 4KGJA 2BY2A 3OGCB 1MI5B 1G0YR 4LSDA 1AGFB 3DVNA 2UY6B 4NQVA 1D9KA 3WI9A 2IAMD 5ES4B 1N73B 2NZ2A 1T6VN 1SQPK 2EXWC 3KVQA 2NW3A 3N50A 2X4QA 3NFPB 3ZMRA 3H9YA 4JO1L 3ZQ9A 4TULL 2F53A 4F8NA 3O9WA 3OTTA 3FHQA 3T4AA 2R5BA 3FT2A 3AG1B 3BZ4B 3CXHD 3S88H 3CHRA 2JTYA 1L0ND 4G3YH 4AT6A 3GMNB 3MKKA 4XGZA 4N6QA 3FPYA 4LGDE 2NXYC 3KLLA 1CDHA 1NA8A 5I74B 4XZUB 5IVNA 1LO4H 3FU7B 1CDUA 1ILUA 2BOCA 4LCWA 3FQ4A 3GBDA 4NDMB 4Z18A 4EOWH 5I8OH 2XICA 1A6UL 2OSXA 1KN4L 2FATH 1L0LE 2VDNB 4JG9A 4QXVA 2I9TB 1SQPG 2IQ9L 1ZHLB 4UTAL 1BQRA 2V7HA 2HT3C 2Q2EB 3GJFH 1YN7B 3IBOA 3GKWH 1JTPA 3MODH 4HU2A 3M1OA 4I0PD 4TUOA 3QJHB 4LSQH 1E4WL 5HJBA 4MD5A 2VLLB 4MJ5A 5JMOC 4WY4B 4ANWA 5J7CC 3MJ9A 5C9JA 1AFVH 1YEGH 3WY3A 5APYA 3LDBB 3T6XA 1AHWA 4O02A 1I9RH 1DYZA 1TKWA 3IFMA 2WZAA 4JVWA 3DX8B 4M7LL 1A3QA 3PGCA 3ZHFA 2O6DA 4XNBA 2X9ZA 1PL5A 3C5ZB 1G0DA 1H3TA 3AXIA 5HHMB 1RF1B 2HFED 7PCYA 2YQGA 1KILE 3P11L 3BHBA 4YS4A 1IBGL 5CM1A 3U82B 5CKAA 1CO1A 4H44D 5JHDB 3OA7A 3B5NA 4X98B 2A06G 5I30H 4JCWA 3VFOB 3QRGH 3H54A 3PAVA 1LT9B 5E79H 3R4RA 5EEWA 4KZEH 5HDLA 5I1IL 3TIDB 2ZIDA 3KBEA 2WJ7A 3TPUB 3ATAA 1WGVA 1BXAA 3RHWF 2D3JA 2CIIB 2BVTA 4MWFB 3HNTH 1M7XA 1XR9B 2NXZC 3MOAL 5ID1B 4B9ZA 4YTPC 3ARGB 3NSCA 2YWYA 3SO5A 2WSCH 2P2UA 1VGKB 3D0VA 3HBQA 4FEMA 5CMAA 5EZOL 5D6CB 1ZLSL 1A7PL 1LMIA 2Z9TA 3FQUA 5L4JA 3S37X 3FN9A 2QSCL 1JWUB 2AK4D 3H9SA 4GLRI 1BVKA 2IF7A 4JFSA 5ANME 3PXJA 4WU7A 4YSCA 1QBML 1U3HD 4XN5A 2XZRA 4LGSB 4K9EH 1LWUB 3CPUA 2SEBB 4RMVA 1GMIA 3IT8D 2C34A 3IKCB 3LS5H 2ZAEB 2ZFCA 2GTWA 2O1AA 4IIQB 1ZP0C 1GC1H 3DGGA 4Z7VB 3QEHA 3OAYK 4OH2A 5HI4D 1ZHNA 4NERA 1MG2C 3LNGA 1I1YA 5JXED 3ULUF 4JJ5A 5DEZA 2ZVNB 2M8RA 3SGEH 3HC3L 1BFSA 2R32A 4HQQH 5TJWK 4EI5B 2EACA 5LGHH 3VB8A 1RUAL 2NY0C 1L3WA 2M26A 4FFVC 3QG6B 1JHLH 2YAQA 2O6EA 1HYSC 5JLZA 4LCVA 2NY5L 2CALA 2R15A 3O3UN 5BS0E 1JXGA 4MAYD 5C7ZA 3SKJH 4DKFH 5C0GA 3D39E 2DQHL 3T2PA 4XP9H 1GGTA 2VR7A 1WWWX 3TVMC 4JHWH 3GHEH 4K2UL 4TLKA 1N86A 1A7NH 4C56A 5MEOB 3S9DB 2BASA 2WTRB 3QDMD 1NTZE 2O5XH 1LEIB 3VVVA 4XNXL 3CDZB 3ROOA 1A0QL 5SWZE 4S0HA 4PRHA 2E76B 3DBSA 3Q43A 2VLRA 3DO7B 1CBVH 3G6EP 5T1LB 3ZMEA 5LO7A 2ITCA 3JCUH 3C8VA 4OD1H 3QUZB 4X7CC 4CSTA 1FJPA 3HR5A 4P23C 1JPGA 1JDDA 4OQTH 2E7HA 1MVUA 1M71B 4HLJA 3U6RA 4ZTOH 1HAUA 1J0ZA 1MH5A 4JPSA 1CZ8L 3LPFA 3LVTA 3QUMH 2XWTB 2ZYIA 4F15B 5L4IA 3IK2A 3QIBD 2ESVA 2YGPA 1JZ3A 1GL4B 3F5WB 4YDLB 4PJ5E 1G5AA 1W15A 1K8AQ 4PV9A 3BOVA 3OJDB 1T20B 1UKSA 4JRLA 5EEZA 1IBFA 2F68X 2Z7ZA 4HIHB 5ERWB 5CU9A 4ZMPA 2DW5A 2GJ6A 5KLIC 2E27H 4KVNL 2MMXA 3KAAA 5FOJA 2Z35A 4FG6C 4UUJB 4FQXC 2CLRA 2FO1A 1Q9LB 5I18H 3NCFB 3ZQWA 4YAQA 1VESA 1V3MA 4Z1PA 1SOSA 3NSXA 2E8YA 3SJVD 1KTLB 5KZCD 1FSKC 3V9FA 3A4AA 2YA2A 4X5WB 4FZ8H 3DRQB 1AQKH 4GI6A 5FGCB 5HJ3B 4HB1A 1MCOL 3MSPA 1BZOA 5G4OA 3VFMA 3W37A 1GY1A 4RFEB 1NYHA 1R75A 3FTSA 4W9KC 5FYKH 5CGTA 2MCG1 1SEBA 3C75A 1HEHC 1QI5A 4DAGL 1H9VA 4PS8A 2WMMA 3VE0A 1JGVL 1URIA 1U8CB 4J8RA 1ZVNA 4JRYB 5IROD 1P84I 3EHBB 2EQDA 5ACZB 1Y18A 2DQTH 4RGNE 5F89B 2Z31C 1YY9C 3KPQA 4Y16D 1O9ZA 5EF2A 1LO3H 3IKKA 2HG0A 4CBZA 5C0FB 5IEKA 2NPLX 4BRJA 2P10A 3MJ6A 4LMQI 1KB9H 2GK0A 1MCRA 4RMTA 1VENA 2BP5M 1REIA 2CO7B 1T5WB 3B7YA 4PB9H 5AUMA 2FJHA 5EIIG 2IAAC 3BYTA 5DUJA 1UEMA 2Y6TE 5IZ7A 2RQ8A 4MVBC 2MJZA 2JLLA 3G5YB 1HWWA 2PYEB 4NZFA 4QLRA 1EHAA 3VW3L 3WEMA 5KSUA 4B95C 2G3MA 4P04A 3L70D 4ODSH 3OKDB 3NRQA 4R2GD 5KVDE 2H47C 1GW3A 4PY8J 5JOFB 4PJ0E 3Q0HA 2XA8L 4JM2D 3NIGE 3L5WB 4WU5B 1RK1B 5I66B 1OHQA 1Z9SB 4M7KL 1KFGA 4NQDB 4TUKH 2YN5A 2H7HA 2YD9A 4Q14A 1MF2H 3T08A 5SX5K 3ROLA 1BBJA 2J57A 4NHCH 5E8NA 1OPGL 3T97A 2Z34A 2J88H 5I0WA 4XCFL 5D7KE 4DZOA 3O4LB 3KH4A 3L4FA 1JDAA 1BQUA 1QBLL 1KBWA 4UDTB 1JXFA 1FE6A 4WI3A 2P47B 1AI1L 1F8TL 3I56P 5C92A 2NRGA 3RX7A 1WCQA 4F7MA 2B14A 3UG4A 4O58H 1RV6X 1WEJL 3I6GA 3QGVA 3ECBA 2GTZB 4G42B 1NEUA 3H1HJ 4PG2C 3APCA 4PJEE 5LCVL 5ITFA 2XYBA 1GS8A 4Y2DB 5D7IF 1X5XA 2XPGB 3QORD 2HLAA 3BPOB 5DVOA 3BAJA 3TCLB 3SYCA 3JTSB 4XPAH 1XF5A 1BBDH 4K3JH 3SPCA 3ZN6A 3ZIMA 4NP4L 4R6UA 4MNQD 4S1DC 5TE4H 3VH8A 2FX9H 2JCCF 2J1WA 1P2CB 1Z5LA 2V8LA 4Q9RH 4L0YA 1BSIA 3NFSL 1HI6B 3BUYA 5GGVH 3CSPA 4PUBL 3EBAA 1Q0YH 1SN0A 1QSVA 2VLJE 3AEDC 1MFBL 3QZWG 4GRMB 5DEGB 1S9WA 3ILEA 1FVDA 1R5SA 3FXEA 1WZLA 3L2NA 4N0RA 2FX7H 4WI2A 1CGXA 5SWSB 3MMEB 2VSCA 2YK1H 3A22A 4I2LC 4MA1B 3V4PL 4JKPL 3U83A 4NPYA 1UKTA 1YEIL 4GRWE 2AS5M 1RH5B 4L4JA 2GUOA 3TV3L 2PWHA 2BVOA 1WK0A 4XPBL 5GGQL 3QZBA 2IAMC 5ECGA 4HIXH 5C08D 1RERA 1SJHB 5EDSA 3M1CA 4BWTA 3VO0A 4YO0A 2WZ5A 4KKPA 5F7UA 1CSBA 4MAUL 2OI9B 1YJNP 4ODUB 5E1AB 2Q87A 5I1HH 5JZ7D 4JFEB 2L7EA 5AW1B 4NN5C 3Q3DA 2H32A 4PRBB 4F7EB 3Q5PA 4MSWB 3ZBMA 3L73J 4MJHA 3QIWD 1RJYB 4PD4H 1YEHL 2EEFA 3HPJB 2X7LB 3GD1C 3B9EA 1SQXJ 3GSOB 2KUTA 2DB8A 4XBPA 1PZBA 3H1HE 4XMWA 5F9OL 2MTPA 4ZX6A 1VEPA 1FLTX 2KS1A 2K9FB 1PU0A 3F7VA 3KPEA 3ECVA 5ETUA 2XFXA 5I24A 1L5GB 3SDXF 5EIIB 1DVZA 4DESA 1PX4A 3HUSB 1U33A 2ZAGA 2ZX6A 4I0PC 1OKEA 1NBQA 3FH7A 2E7MA 4NO0D 1OK8A 2W9LA 4KJPD 2HMID 2C9QA 3CNKA 2V7QH 4M4RB 5K1NA 1L9OA 2WIIA 5JXAL 1PZCA 2ZSWA 3NFPA 3LQAC 1G1OA 3NJLA 5T3XH 1F3JB 3KHOA 2AQPA 4MQSB 1BX2A 2Y3NA 2LAAA 2ENSA 5BU8B 3MJ8B 4K94L 2AF2A 2YBGA 3RWIA 3U7AA 1OARH 1FZCA 2Z93B 3K2IA 4QTHB 1HOCB 4UQ2B 1S2EA 5DK0B 3QRBA 4K71C 4AV4A 1KB3A 3M6DA 4G1MB 4GQ9H 2IBZD 1K73Q 2X4RA 1ASPA 1WVZA 3CH1B 4HUWA 4HUXB 5D5MB 4YR6A 3TYGH 1ZD6A 3L5HA 1JTHB 3QZPA 4IU3A 1E9QA 2OX5A 3C08L 4H44C 4EI6A 4KK9D 4ZW8A 4UB6E 3IDXH 5AEAA 4GAGL 2OM5A 1SM3H 1OCWH 3IETB 3WS6C 3W9EA 1CFNA 1MIML 3TX4A 3DVGA 3FUFA 3K0YA 3TGUG 1S9XB 5GRYA 1ZOYC 4PTTB 3MRKA 3VWKB 2BP8B 3LIZA 4OGYL 2VLLA 3DBXB 3GMMB 1VZIA 1IGIL 1KIUA 4UZUA 4IGBA 4RX4A 4ZODA 1SQXE 3G6AA 1TJGH 2X0WA 5FV2A 4ONGL 3CX5K 5IMKB 1OCRB 2J4WH 4EDXB 3IMSA 1EEYB 3EW3B 4NT6A 5FYKD 1A4BA 4NQXB 1PPJE 2HUHA 3MUUA 3LY6A 1C1EH 1JDCA 4ZFFB 3KPSB 5FB8A 2XKSA 1IFJA 1IE4A 2DQGL 1KGWA 4UOW1 1FOSF 4P2OB 1U3HC 3H8NA 4OGQB 3V52H 1AXTH 1A9VA 3QZWB 3D06A 4H7VA 4J4PA 2ZXBA 3MR9A 1PG7L 4PJXF 5B7EA 2Q7YB 3OKNA 3APNA 5TJHA 2DWSA 2F58H 3HE7D 2HA1A 2QL1A 2KZWA 4WY7H 5HI4C 5HJGA 4Y1TA 4AYFA 4OZGB 4KPHH 5F7AA 4NKIL 5D1ZA 1KB9D 3EFFK 4QRRD 5F7NC 1BEYL 5JXEC 4I3SH 4HK0B 3IAPA 4IKJA 2FEJA 1UWGL 3H7BB 4IRSB 4S1RH 3ZT6A 3L71E 2CCLA 4NUJA 1S7XB 3T0EE 5GGRY 1GYVA 3QCUH 4XC3H 3NAAL 4AIZB 5C7XL 4GG8B 3UTPE 4LLQA 1S5LX 1LO0H 3NP4A 7FABH 3IMRA 3K71B 4MAYC 1PEZA 2P7JA 1JP5A 5F96H 3C6LA 2AEJA 1H3PL 4BH8A 2VZTA 4WWKD 3KPRE 4C59B 5KSBB 4XN1A 4XR8C 3FUHA 4PJBB 2OZ4A 4Z7VA 1T7VA 1UGNA 5CSBA 2ZONA 3PAUA 5GHWH 3BKCH 1ZXKA 2WQYC 1YAIA 3ZYIA 3A23A 3HB3D 2RCSL 5BZDB 1TEGA 4JY6B 5FO7B 4BZ2H 1FGVH 5GJSL 3DJRA 5FUZL 1LJ2A 3STZA 3R06B 4NAJA 3K72B 3SWYA 3Q2VA 3CLFH 5CLTA 3SKUD 1LDSA 4ZX5A 4Q56A 4Q6KA 1AZZC 3FUKA 4UNUA 1T83A 3IXTA 1KCVL 5T33H 4DW2H 3F7QA 3FU9A 4AH2B 3LEXB 2EVIA 2YXWA 1SY6L 4Z5RA 5FECA 5JPMB 5MP6H 1F1AA 4UOW0 4HUVB 2A1WH 1KJMA 5DRWB 1BGYJ 1GVIA 5KOMC 2BC4A 1MRFL 2BSCA 3NJVA 5MI0B 3T5WA 4ZSOE 2YMXH 3BZFB 4N8PA 1U3NA 1JPSH 3RUGE 2AVFA 3IDIA 1PFOA 1SQQD 1AC6A 4JM0A 4XNZC 5C0IA 3NZHH 4DPBX 4L29A 2BSSA 4MLIA 2WSFH 1KULA 1JNNH 1BOGB 1G9NH 1P0SE 1RZQA 1S7SB 1S8DA 4B9YA 1GYCA 1RIUH 3FFOA 2JKTM 3B2MA 3T6ZA 5DJ8B 5TE7H 2IV8A 1BCCD 3AQXA 2C3VA 2WNKA 3BGMA 2M3BA 1MFAH 1DDHB 4H1LA 5F0PB 1VKXA 1XF2B 1DP0A 4BXVA 1I7RA 3BWSA 1PLGL 3ASOB 1OSEA 4PJCA 4U31A 3H1KD 4J6IA 3CC5B 4PJHF 4QOKD 2WTYA 1TZIA 2KSEA 2ZKHH 3HPLB 4DKEL 3ZT5A 3OR6A 4PGJA 1Q38A 1TVBA 2AJVL 2XN9D 3S34H 5KAQF 5GZOA 1QBAA 1JZJA 2KZBA 5IROC 3U36B 3GMQA 3HAEH 3MLVL 2AJUH 5KUKA 2VRKA 1OW6A 2AVGA 2YR3A 4XC1H 1QFWL 4Y16C 1N5YH 5EFIB 5CEYB 5ABAA 4KK8D 5FYKU 2W65B 4QCIA 1RU9L 4PD4D 3TNNA 1IILE 3PYCA 3VD5A 4GB9A 4UAOC 4HDIA 3ALWA 4YSPA 2HLEB 5KANG 3LZRA 4M8UA 1QLRB 3GSXB 1PZ2A 5DS1A 4BK5A 5SWQB 3D1MC 3L74J 2ERJC 5BVPH 2G60H 4J3WA 4NWUL 1VERA 2R9HD 3WCYA 5JW4Q 1I31A 1LYQA 4OZFB 4QHUB 5HYIA 4ELKA 2ZOTA 1V7MH 4RFEA 4NLAA 5GGUA 4JB9L 1TYEB 3SWKA 2BDNH 3PL6A 2VH5L 1OZUA 4M6OL 3WLBA 4R2GC 1HZHL 4X50A 3BD4A 4ABWA 4I18B 4N0CD 3HS8A 4JM2C 3LMJL 4XMKL 2DJ4A 3QPXH 5FUOL 1QO3A 3QEQB 1MLCA 1MHPL 3NCJL 4KTEH 4WI7A 5F89A 3INUL 4YXKH 1QZNA 3NTNA 5J9PB 5HVWA 3FTZA 3ZL4L 4I77L 3U9PH 5DURD 3EFFB 1E90A 2X9YA 3DYPA 3VG9C 4AE1A 1XF1A 4Z3TA 3K6OA 4AI7A 4JW3A 1ZDQA 3MLYL 4DFHA 2ATPA 3HN3A 1FE8L 2EDFA 3O8XA 4DUWA 5C97A 4OJCA 3NCBB 4UI2A 3UC0H 3V0GA 2ARJA 1M2VB 2WXPA 4WFFD 1KC8Q 1RK0B 1EXJA 4FFYH 5J8OA 5D1QD 3U0PA 2VXSL 5E99L 3RY4A 2FXOA 3OB8A 2ZUUA 4IOFD 1F58L 4LKXB 4NQCA 5DS8B 4YFLI 1P5UC 5D4HA 5F7FA 1DBJL 3QAZC 3QORC 3IFLL 2HRPH 3RTQB 2O01H 2LTQC 3A6BL 1ZS8A 1NGPH 4AITA 1Q2NA 4G9FA 2DF3A 5BQ7B 5B1JA 3TZVD 2N9YB 4N4YB 2FYUD 3NSJA 3L74E 3DHUA 3FB5A 1QA9A 2WMPA 5GGSB 1J1OH 3QDAA 3I9PA 2P5EB 1OAQL 5K39B 3O4LA 4YDJA 1ZIBA 3POHA 1F90H 4OLXL 2BCCG 4LIQH 4NRXA 4OB5L 4AGOA 3FB7A 3G6DL 2KYVA 4N78E 4K9EC 4EPSA 4QXUL 4E36A 5JQ6H 3O2DA 1GU5A 3MLPA 5LGJA 5T5FA 1GC1C 2JCWA 4KXAA 2VMEA 5HI3D 1PG7W 1BJ8A 3PIQB 4RFNB 1ZSDB 1F11A 3UPCA 1FZOA 2CR6A 3KLSA 3BIKB 1GW6A 4EMZA 5IEHB 2W81C 1XGTA 3Q48A 2L5GB 3ZSSA 3WU2E 4Y88A 1LP1A 3FCSB 3QZLA 5F6HJ 2J12B 5JZ7C 1XL4A 5L2KB 3JTSA 1INEH 2XPZA 4FD0A 4ZQKB 1YEKH 1NLBH 2FQGA 1FNEB 2ZD0A 1EQ7A 3II3A 5C1MB 1W91A 5LN8A 2GK2A 3QIWC 4LRIA 4QRAA 2ZT9B 2V2WA 3AE3C 1AVYA 1HL9A 4KT0J 4JDEB 1JGDB 3GSRB 1Z9PA 5M1BA 3KPPA 3FXDA 4PBVC 5F1OB 2FZ3B 4N68A 1L4AD 4PPTA 5ENWA 5FIEA 2G3AA 4JO5A 3L6FB 2W9DL 5ALBH 2F74B 4I2XA 3MMEA 5KVDL 1UQSA 4YXWH 4WFGD 2FIKB 1MCDA 1NH6A 2J25A 5K1VA 1Q90A 2I25N 4P5TA 4KJPC 2HMIC 4N2MA 1FNHA 2OTUA 2Q0ZX 4ZZKA 1FJ1B 1ZT7B 3EJRA 5HGAA 5IMOB 4JQXA 2LOEA 1CQKA 1ZHKA 2VQTA 3VD4A 1WAPA 2VQUA 2JJVA 5FKPA 5DZVA 3V4PB 3SZKC 3ATEA 1V54B 1CGUA 1BJ1J 3BP6A 3G5VB 2AEOA 4XXCA 3GSOA 3D70A 1EFQA 2FVNA 2C9RA 4FG2A 4BWUA 1J5OH 1M9WA 5CINL 2QEXP 1MJ7H 4KK9C 4W9IC 2LR2A 1FL5A 4Y0GA 4EE2A 3O6QB 3V2NA 2Q5BA 4GMTH 4HKXA 3PJNA 2J8UE 2Y2TA 2XKUA 4ONHA 1L0LG 4OZIB 1KDIA 2FWLB 2MPVA 2QGEA 2B5IB 2B39A 4Q2ZB 4H2AA 1AZVA 3KEHA 4QRQB 3RRQA 1NTKD 3QCTH 4JO2L 2KSJA 5G4NA 1KCUH 4IBUA 1F3JA 1NUNB 4X5LA 2W95A 2JH2A 4WUKH 4EJ1C 2QFPA 1PLCA 4KQ3H 3N5AA 1MKMA 2FAUA 3WKYA 1DUYB 2P43B 2D3VA 1AE6L 3LW5H 1FAIH 3GMPB 5I5MA 1AR2A 3AY4C 4FP8L 4P5KA 4IJTA 4D3CL 3DX9A 2X6CA 5F21B 1ZS2A 2OYIC 3K4ZA 5CCGD 3DXAE 1P4IL 4POZD 3WUWB 3FX0A 4POUB 4QXTB 1Z9OA 5BOJA 4KHTH 2YBRB 1CFSA 3HE7C 5ICUA 4NPFX 1PIXA 4UT6L 4PRPB 4BKLB 3FB6A 1OSZB 4IMKC 4N2AA 3RGHA 4EDFA 4LOVA 4O5LL 1NGQL 2O6PA 1JGLH 3VWKA 5G4MA 3ZDXF 3NQKA 1ZT4B 4P46D 1TTBA 3QAQA 5DYOA 1ACYL 3RAJH 1IM9D 3DGDA 4HOXA 4URKA 5ISZA 3DIFA 3RWJA 4N3YB 1NTDA 1EO5A 3FT4A 1A6WL 5GRJH 1FS0E 2NDFA 4CADA 1MFCH 1T8ZA 3S1KA 3WIFA 2L7QA 5BCAA 4Q74A 1HTLC 1MHEA 2YNYA 4NQXA 4W9LC 1LNUB 1MW3A 3VWJA 1IFMA 1J8RA 3KDMA 3MGAA 1QFHA 4U3SA 4OZHA 4S1SH 5JR1L 3C6EA 3MYJA 5E2WH 3OJ2C 4JL1A 4LLDB 1G4MA 1IVTA 5AVRB 1TQBB 4NLHA 4WWKC 3NZ8A 1PNCA 1RUPH 1Q0EA 5BJTA 3S3PA 5DMIL 2VDKB 3CCHA 3CFCH 1MY7A 3MJ9H 4ES9A 4FI6A 5IV2A 4XFJA 2YXMA 4N0YH 3CFJB 4O02H 3FWNA 3HB3C 4U1MB 5B39G 3RNQA 4BD4A 4OCWH 1R0AL 5CN1A 5L8JB 1MCHA 3X12B 3LKSA 4JO4H 3RJDA 4RMBA 1NOHA 1FFOB 4M6AA 2IWGA 4NXKA 3MV9B 1JF1B 5HGHB 1X7SA 2B16A 4G7VL 1CFQA 4B9CA 3U1QA 4CW1A 4F7CA 4L3ED 4P2RB 3KYNB 3T65B 2AZUA 2AXJA 1RJZA 3N40F 35C8L 3NJNA 1FYTB 3EYFB 1GGYA 2DD8L 2VDLB 2D03L 4FQLL 2B7DT 2GFBB 4HULB 1UXWA 1LP9A 2IMNA 3NRPA 1HKLL 2C0WA 5BV7L 1JN6A 3NT0A 4GLRH 3QSKB 2ENPA 2Y5EA 4I9WE 1A6AB 2WOYA 4R5XA 3UZEA 4ZOEA 1NAMB 1XFPA 3BGFC 1NTZG 3RWDB 5C09A 3X3GH 3PLYA 1ETJA 3L72J 2MKWA 3MAWA 1EV2E 3NBNA 1GZPA 5GGTA 1ULVA 1F2QA 4IRZL 2LABA 2QSIA 3EO1A 1GIGL 3QQDA 2FSEA 4U1LA 5LDUA 2ID5A 2OYHB 3DNKA 3UERA 3VXQB 4OKVB 3PWPE 1SZNA 3LQMA 5AAMA 1QUNA 1VLXA 3NJFA 1KPVA 5K59F 4YFLF 5HGDB 4LBEA 4HMEA 4MB5A 3SKOB 1QQDB 5DUPH 3SDYL 4I85A 4OFYA 2XQYK 4KK8C 2JJUA 2O5ZL 3QJXA 1KILB 2J58A 3N2JA 2XY1A 4YHZH 1IGTB 1NHLA 1SLVA 2OK0H 1HXYA 2FLMA 2WINA 2ICWJ 1TFPA 1ODAA 4XBGA 5EO1A 4D94A 5I2IA 4I3RL 3BWUF 1JZ7A 3ATFA 5DJDA 5IVXF 3B5HA 1FQ9C 4Y4FA 2ZG2A 3UJJH 2ZAIA 4YZFF 2VM3A 2R9HC 2EIZB 4GKNA 3V0HA 1I7TB 1KFAH 3MLSL 4XVJL 2RJMA 4LQFL 1OVRA 1YNTF 3CVHA 3CPLA 3CXHJ 1ZJBA 1OVUA 2P8PA 3VTPC 5F7KC 4M56A 4E9WA 2ZJSE 3EYVB 4G6FB 4E9SA 4F2MA 4YSEA 1HHJB 3VFRA 4P2QA 4AMKL 1BXXA 2IANA 2XQYG 4PJ8B 1UWEL 4HKZA 3HE6D 4CVXA 1R5VB 2L3BA 3F12A 3KS0J 1OVVA 1MCLA 4WHTB 1SEQH 5KWYC 4ZJ9A 2Y36L 2X4PA 2EAEA 3U0WH 4TUUA 1YZZA 1HCFX 4JPQA 3CWBJ 3HCVA 1IM3A 2J2ZB 1AQ8A 2WXNA 1BLIA 4MS6A 3LRKA 1ADQL 1PZ5B 4YC2B 3KG5A 1UOLA 3IGAB 2WUBL 1XB6A 4W6YB 2WLMA 4F91B 3I6KA 2Y25A 5A6IA 4Q0XH 1R24B 3IN2A 3QUXA 2YOAA 3QXUA 4XAKD 2EDYA 5E8OB 2GSMB 4RNRB 5E9AA 3HC4H 2DQIH 1S5IL 5LKNA 3Q13A 5D1QC 3J07A 4ZYKB 3SHSA 3H1LD 1HJBC 3T2OA 3IJSA 4PRIE 4IOFC 1I1AB 2DYPA 3OMNB 1RE4C 1UB6A 5KG9B 2E47A 3QNXB 4JN2A 4ALAL 1EMTL 3CX5I 5H4YA 4DVRH 5KBKA 3D2UB 5I5JA 3P4NB 4HS3B 2VYRE 3V7AE 4OGXL 2FWOB 3TZVC 5AW4B 3CZKA 3H4FA 4OBSA 3Q06A 4K5MA 4PJDE 1YJWP 3DETD 1P84H 1FNGB 3R7RA 2CRYA 4LASL 1Q82Q 1K8DA 3CXHE 2C9XA 2Q76B 5T1KB 1BD2D 4YHOH 1L0NE 2PR4L 2ZX8A 1L6ZA 4HZAA 1D9KD 2HODA 4XPFL 5BVJB 1BF5A 3B9KB 3QNYB 4HGWB 5KN5B 4ABVA 3BVNB 2LT9A 4PY7A 3VXPA 3MLTA 3MUY1 5HI3C 4KHXA 2JIXB 1DQQA 4XX1E 3VFTB 1UOVA 2ALAA 5JMRA 4CGUB 3EYUL 1EA9C 1F3DJ 2VITB 1H15A 4IK7A 4JE4B 4OAWB 5DJCA 4DO6A 2JDIH 4R4FL 2EYSB 2YMKA 3CFUA 4LO9A 3STBA 1YY8A 4GBXD 4ZUTB 1RZPA 2X53A 1EFXB 4LCWD 3QG7H 1PY4A 2QJKC 1HNGA 3ABKB 2CE6A 4XNMB 3VFNB 1SDYA 1CXFA 1X5HA 1KV4A 1PLBA 3E8UL 1NLDL 1KFNA 3OBAA 5EU3B 2X6VA 1AR1D 1U3YA 5IW6B 2QPFA 4J39A 5DEJA 5A6LA 5K9OB 1NC4A 1L4AC 3U46B 2FJUB 2FSDA 2Z4TA 3TEZA 1UVQB 5L0QC 3OW2O 5IF0B 1U95B 4GRLA 2CPSA 1AOZA 4TN9A 3ZE2F 3Q9QA 2GUSA 3HBZA 3QJTB 1NBVL 2IIJA 4NJ9H 1X5KA 1N64L 2IEPA 4K8RH 1KTDB 4APQB 2ZE0A 1Y1DA 3W2DL 3WUUA 1KPUB 5BU5A 3L13A 1E4JA 1X7QB 3MKGA 1ZLUH 3SY6A 5I1CL 2AEQH 2VN5A 5H2BA 2BVQB 5BUPA 1CD1B 1UA6L 2IFFH 1QABA 3D33A 1T1YB 2JJSA 5D2NE 1TCRA 3F6LA 5KJ4A 1IC5H 3QHFL 3NCCB 4W7ZA 4XB7A 4RGNB 1HZKA 4H13B 3KLDA 3WYRA 1UADC 1A65A 3IFNH 3QFDA 5IFJB 5CD5C 5F6IB 3H1HG 2AK4E 2F74A 1B2WL 4M48H 3HJ0A 1ZY9A 1ROCA 1TTGA 3JTTA 1KPRB 3SO3C 3VD2A 4L37B 2BNUA 3G5ZB 1G9NC 4LARL 2Z1KA 3NZSA 1KJ2H 4KTYA 4Z7UF 4WSJA 3M1BB 5E9NA 3UTSB 2YD1A 4F9PC 2WT7B 1I75A 1XGRB 3LEVH 3PABB 4NPEA 1IFHL 4GSRA 4J7RA 5KUMA 4BINA 4AQ1A 2H9GB 2AEPL 2VE6A 5KANI 3QUKB 4M8QB 1ZV5A 1W2KT 3I9IA 2YQ3A 4MXVF 1E5CA 1M1JC 3KYKH 1A22B 3CN2A 2DM7A 5C6PB 4GFTB 4XMZA 1PZ3A 43CAA 5IJKC 1EO8L 5LQBH 4D0DA 1S5LE 1U8JA 4LU5L 3G5VA 4L9LB 4DTGL 1EHXA 1EDQA 2VSDA 4OZGF 3BEVB 2YAPA 1NCDL 2VO8A 3TLRA 3ZUCA 5EF3A 2FR4B 3K8LA 5CCGC 4POZC 4OR1A 5BRQA 1N2DC 5EUKA 4DEPB 4Z95H 1Z0MA 3O6QA 3FO0L 4KJYB 1PTZA 1RL1A 1KT2A 3BVVA 1QHPA 1AKPA 3SPGA 3THMH 4F8LA 2EDJA 5I6LA 2NTFB 4WNQB 1XV8A 4DGVL 3NIDF 1X5LA 3QDME 4OT1L 4P46C 3FHAA 3UMTA 4D8PA 3MRDB 2FXPA 1I3RA 4XTRD 4BSVB 1GSKA 4MXWH 5C6WH 4PJEB 1JF5A 5DI8A 3WHXA 5I26A 3I75A 4OCXL 1PCSA 1SQXG 5BZWB 3BUBA 1FNSL 2ZG1A 4K3GA 1P5VB 2GJZB 4Y5YA 1WTGT 5KJRH 2XIBA 4QJ5B 5KSBF 3CZEA 2Q9OA 1EDHA 2Y6SD 4GT0A 4PJBF 1SFCA 1PPJG 2G9HA 4LNRB 2APBA 4IOSD 2RD0A 1UA3A 1XGPB 2R59A 3W1ZA 5DD5L 5F1KC 3V55A 1T2JA 3VMPA 3NJXA 3WUWA 4ATWA 3CN0A 3MACL 5ADOL 5GISL 2VLJB 4GAJL 2KIKA 1N67A 1NINA 3BKJH 2FKWB 1KQGB 2BRRL 5IWLC 1QLFA 1T5XA 1G6RB 4WRLA 4D6TD 1E7UA 3QIUA 3POCA 5HYJB 4KO5A 4J3TA 1JS4A 3BIAX 3TO4A 4Q8BA 3II6A 3QCVL 4GRWB 4GY4A 3GJEB 1A14L 3H9HA 2ADGA 2ZOKA 4PP2A 4B9KC 1F2XK 3AB0B 4TQEL 3SSGA 4RIRA 5AW9B 3L71G 2VLKA 5MENB 4ZG1A 4W80A 2VDNH 5FM5M 3MV7B 1ZHBA 3IVKA 3QRFM 2BVPB 3H7LA 3E1ZA 1RZKH 7TAAA 4JY4B 5AW0B 4HHGA 2X2IA 4OLUH 4O51B 3W9DA 4LLDA 5E9DB 3V95A 4DN4L 3U4BL 4NZUH 3NGBC 1ET5A 3FSVA 1JE6A 4HD9A 4YHLL 2AAVA 1P84D 3ZU8A 3DK2A 1P4LB 1HE7A 4PTUB 2MOVA 1M6OB 2F1BA 1FFRA 3UAEA 1I8KA 1E3XA 3EADA 3O6ML 1ETB1 3VXOB 1FFOA 1W9XA 4S2SB 3RTLA 4ZD3L 2AQSA 3AWFA 5IJBC 3MREB 2WSCJ 3PAYA 4YOKA 1CE6B 1FCGA 1KXQA 5AAPA 2G30A 2FHCA 3F64A 3FQ1A 3T65A 3DTUB 5DWPA 2V5RA 3FAWA 2YZ8A 1AKJB 3GUTA 1A3RL 4A2MA 1D5XB 4MHHG 1SLUA 1IK7A 1FYTA 2QQKL 3S8FB 4KKLD 3K8MA 2OMVA 3TTSA 5GS1C 1ZOXA 1DJIA 2GFBA 3SDCB 4TVSa 1Q9WB 3L70E 5DVNA 1AGCB 5FHAH 2D0GA 4EIGB 5F0LB 1KYOK 5AAWC 4FKHA 1E40A 1NAMA 2VSKB 5E6UB 5JO5B 3HNVL 5B5EH 3CZLA 4ZUWA 4WEBH 2K8MA 3X13A 4JPVL 4LP4A 4PCSA 3SBWA 3GPEA 5AALA 3SDDB 1DE4A 1FO0A 4HXAH 2V9UA 1DVSA 3QHTC 1IAKB 1BFOB 4MXQD 4TUJB 5BV7B 1V55B 4D0CB 4E41A 1F1GA 4O9BA 4KTDL 2E5TA 4FX5A 4LL9A 4XAWH 3SQOH 2YPKA 5E79E 1NEPA 2VW6A 1PS3A 1TTRA 2YEQA 1LGHB 2QA4P 2Z65C 3HE6C 4K3AA 5D7IA 1RVFH 1MCEA 2ITDA 1U8OB 2HCZX 3E1IA 1S9VA 5EPMB 3OR7B 1NCNA 1YMME 1W72A 1G1CA 1YPZA 3D69B 1SHWA 3KYMB 4XPGH 1SVZA 2GQHA 1XCXA 3BEWB 4AV0A 3E1F1 2APTA 3PHLA 1E6JH 2IGTA 4WI6A 2GCYB 3GW6A 4MNQE 3MUGB 3T1FB 4JFHD 2F7OA 1JOIA 5HPOA 2X3BA 1SQVK 3P32A 1HUCA 3RPBA 3VI4A 4TSBH 1CU4L 2BIPA 4OCYH 5CUSL 2MPAL 4NZRH 4IIZA 1NCBH 4UB8H 2APSA 1I9IL 3EYVA 4Y9EA 3K6SA 2HVJB 5EUOB 5AWNL 1C5BH 3L3HA 4JREB 5DJ0A 5HHOA 5F71A 4XBEL 1K04A 2YKPA 1SDAB 5I1DA 4LHUA 4N87A 5I1KH 1IL1A 5D7SH 5FF6A 1BFVH 5C08E 3LH8A 3C5JB 2JKVA 3ILPA 5L8KB 3I5CA 3TF5A 2OTPA 3DETC 1E4XH 4HJTA 5CILL 2K8QA 4NHUB 5E0FA 1LO2L 3M17B 1ZVSB 3S7GA 3T4YB 5APTA 5DJYA 2OLDA 5L9DL 1YC7A 2Y0SA 5CJ4A 4YIQA 4X4YB 1WBXB 5HHQA 1K9TA 1TLMA 5HVHB 4DFIA 1D9KC 3OHXA 4RBPH 3DUSA 3P8CD 1ORSB 1ORQA 4MX7B 5FYJD 4G72B 1CE1L 3GIVB 1BYPA 1PSKL 4GW4A 5F70A 3ARSA 1X9VA 3T0AA 3V6FB 3IB4A 3QR1A 1BE3D 3O9WC 5E6IA 5J06A 2QQLH 2J59M 3HI5H 3T4AC 5EBLB 4JRXE 3TNUB 1IT9H 5DFWH 1L9NA 5KG9A 3P9MB 4X8JA 1VPOL 4QKXB 2E6JA 4HW6A 4WUUB 2ZUYA 1EK3A 3I50H 2IXQB 4GBXC 3FMGL 4B9IA 1HILB 1UUSA 2WYHA 3P30L 1X5MA 4PIBA 5FW7A 1WIUA 2ZYGA 4X7TA 5LAXB 3WL9A 1QFWI 3JCUE 4N2KA 5FA4B 4LF3A 3ARRA 3OLGA 2O72A 4EUPA 3KZIH 3ML9A 1AR1C 4IKKA 5EO0B 1DEEA 2AQTA 3N42B 3FCGA 1KB9J 1ZV9A 2IX7C 4ZSOB 1J05A 3RUGB 1MI5D 1U2HA 2J8HA 5CNHA 1UM5L 2EDEA 4HHAA 2IBZE 1J0KA 2IWKA 2X9WA 5BQDA 5DD3H 4YEFA 2BPBA 3G9VA 1HHIB 4YQXL 1J0JA 1AHWC 3WIIL 3FOMA 3MBWB 5B7MA 3U6XS 1RHZB 4LAQL 3O3BB 3HG1A 4NYLB 2C4XA 1YHQP 2E7DA 3NQIA 4JDTH 4TOYH 3UBHA 5KAFH 4XE0A 4W70A 2Q7AA 4BCXA 5I8CB 2G3ZA 5HYFA 1GXEA 3VNZA 1LE5B 3UTTB 3E38A 3AT9A 1WLHA 2I07B 2DI9A 3DK0A 4PWEA 3S4SB 4Y4HA 2AMGA 5FYKE 1KFMA 2NY1B 3P54A 3RU8H 2FY8A 3LNHA 3ZL1A 1KCSH 4OJYA 4G82A 3EDKA 1E5AA 3NEEA 2H8PA 3EDFA 5DJUB 1KYUA 1N0LB 3IN6A 3HZMA 4DJMA 4PVBA 4WO4B 4OM1H 4WY4D 4RX4D 4WKXA 2ZP0T 3SDAA 4KOBA 4EZMA 2GG1A 3GRWL 1TCMA 1WAAE 3IDYC 2ZYAA 3WNJA 3M91A 2YUVA 2R23B 3DURB 1WISA 3OAYH 4QRUA 4K0OA 1NC2B 2MQ0A 25C8H 3FO1A 4GJTB 3QYMA 2A6DA 1X7QA 1YEDA 2OMXB 1L9QA 4XO3A 3T8VA 4DGWC 5I76B 1WCBA 3C5ZD 1KB9E 5HHMD 4HJ1A 1KCRH 3ECUA 2ZUSA 1T2QL 1SQQJ 1AY1L 1WPCA 3F84A 1L0YA 4HHWA 4QHNB 4YE4H 2OYLA 1RIVL 5ESVA 4TVPH 3EDJA 3S48A 1OL0A 1K4CA 4JF7A 1BHGA 1KGXA 2VJXA 3LHPH 5B8CB 5BVJA 1K6QL 3MBEA 2E6QA 1NSNL 2DLFL 4NWTH 3CD4A 4R83A 1OPOA 3ARGD 5GTIH 3P02A 5IVZA 1J1DB 3P77A 3BQVA 3ZE0F 4Y8DC 3DUUB 4XTRC 2R2HB 2WXFA 3UJIH 1Q94A 3ESUF 4X7SL 1KJVB 3Q1MA 1NOFA 4TPRH 3SYPA 2NCEA 1F00I 5EZLA 4B9JA 4JPKH 1QTPA 3C6LD 2R2EA 2JKNA 4M7ZC 3SIKA 3MRBB 5AYUL 2X1PA 1FIEA 2Y6SC 1NCUA 1E5WA 3O3EA 1MFMA 1JK8B 1CL7L 5JW3H 3WTVA 3NUKA 5HGBA 4ODHH 3IMVA 3WIAA 3GSWA 3SCMB 4B86A 3P73A 3DO4A 3BATA 2KI6A 4UDUB 2QLVB 3F7YB 1E4KA 4NUQA 3WFCL 3NN8B 2NRDA 4EI5D 1PDKA 2Z8RA 1CTOA 3MOQA 2H0FA 3T2NL 3VMYA 4YSOA 2CKBL 1ZPLA 3MRNB 2Z8VC 1SQQE 3CCSP 1RZIB 4UT9H 1B2YA 2QPEB 2YRPA 2LVEA 4JO3L 1V7NL 1FG2B 2VDQL 4KNTA 1ZLEA 4BRYB 1E28B 4NJAL 1MFDH 1E6OL 1MJ8H 3UYPA 3Q7JA 3D9AH 3OF6A 5JORB 1BCCE 3H3PH 4LCUB 4ES8A 4HPOL 4QY8B 1ZANL 1IFIA 2P80A 1DSFH 3WEOA 4F9LA 5EV7A 4ZFOB 4FABL 5F7MC 2QMKA 4U4BA 4PJHA 3PP3K 3H1KE 3C09C 3FRUA 5HD8D 1SQPD 4QOKE 1MPAL 1R3IH 4HG4J 2E76D 2DY2A 2FECL 4OF5A 3ZTCC 2YPVA 5T1LD 3CC1A 1MAMH 5F3BB 5C07A 3FSOA 1KSRA 3Q1EA 4NRYB 4I5BA 3QUZD 4XP1L 5FLVA 4MA7L 4NZTH 2BJMH 3RWGB 1GTWA 2WVVB 5D2LE 2ED8A 4YGVA 3AC0A 5K9QI 5LWYL 4LOFA 1U8QB 3MRLA 3WY4A 4PD4E 2JI3A 2SODB 4U1NA 2N56A 4G1EA 3A0HH 4DK6A 5CR1A 4RH4A 4R5TA 3G6JE 1JWSA 2BWDA 3DVIA 2VXUH 5DHYB 4FXKA 1HDMB 2DWEB 3RA7L 3T9WA 3VGBA 3TT3H 1JPEA 3AMLA 3WNPA 3UYRL 4X4XB 1QW8A 5C0JA 3MV7A 2AEIT 4HT1H 3EFOA 4KKLC 3BUQA 1YDPA 2WQWA 3D4GA 3FKUS 2BINA 2VDMB 3B9DA 4H25B 4UMGA 1RSFA 5B3NA 2OA9A 4N0UE 2ZX7A 2RGSA 5E2TL 3BW9A 3SQBB 1M6UA 1OGAA 3WG7B 1A7QH 5T3XE 3NSYA 9PCYA 5JDJA 1AP2A 3K1DA 3I9GH 1JHTB 4RAUB 5DQ9B 5DJ6A 4CNIA 1E8WA 4LSUL 1RHHA 1NGZA 1U8NB 2AJSH 3O41B 3VI3E 5KTEL 5JHDD 3B7TA 2BZ7A 1WQVT 1T0NB 3QJFB 1E9OB 1SQ2N 2OXGA 4FQPA 4P59H 4XP6H 4OH8B 1HL4A 2BSRB 1E79H 2UZIH 4E5XB 3OXRB 5BMFL 1FJKA 2HKHL 2WKLA 2XN0A 1M53A 4H26A 4MXQC 3WXWL 2ZXCA 2DLTA 3E8VA 1BQ5A 1F6AB 4JRYD 5D70L 5B3JE 5AVXB 4K8RC 3D4ZA 4UQEA 3EXLA 2AV7B 3EHBD 4BELD 2AQQA 1OCZB 4QRSA 3QDHA 1EEZA 3ARDB 4WFFE 3UJTH 4B5ZA 2ZG3A 4QLWA 1DN0B 5L2JB 4Y9GA 5CEXA 2FDBP 5D1QE 1VAHA 1RUKL 4U1SB 4L73A 1RQVA 3AEBC 4WIQA 5LNEA 2HT4D 1D3CA 5BOZG 4I48A 5D93B 4FZEL 1KXTA 2KERA 3O8XD 4RDQG 4QEGA 2ZCKH 2PPEA 4XXDA 3MV11 3QI9B 3HA0A 2DRUA 2C8NA 1TXKA 4X9GA 1Z6JT 1YO4A 2P3YA 1A2YA 4ZI8A 4NXSA 4K23H 3L3OA 1D5ZA 2AERT 2PYED 4Y5XC 3C9NA 4OLYL 2FYUE 2NR6A 2EDOA 4LVNC 3WO3B 4MCZB 3RWEA 1UXSB 2V3DA 2YPLE 5I1IH 1X4YA 1ZAGA 1T4KB 4MJIA 2UVFA 1M1KQ 2YAEA 3P9LB 1TENA 3WKQA 3D18B 3QYCA 5AOJA 2VABB 4X5RA 4NQDD 4C4KO 4IFMA 3V5HA 1JF6A 2YXFA 5DK2B 2I60H 5IHWA 1AGEA 2X70A 4AXWA 2BIIA 4PJFE 4Z7OB 4PRAB 5FHBH 3ZHKA 1CG9A 2R69H 4G8EB 3FC8A 1N8OE 3OM3B 3CDGA 3O4LD 3JV0A 3L4TA 4A66A 4FXGA 3S88L 2Z7WA 4G3YL 4LVHC 1KIRA 2G75A 3QS2A 4QAMB 5IM7B 1GS7A 4MJ2A 5GGTH 3GQFA 4YXHH 1BV8A 4TVPD 1LO4L 3EYQD 5H37A 1ETZB 2IADB 4EOWL 1DBAH 1EERB 2CBOA 5I8OL 1V3JA 3NIFB 2EDBA 3JV6B 1LTSC 1NTKJ 4OLWH 2FATL 3VAEA 4Y2DD 4Y28J 3WMSA 1VRSA 5KLVK 1CWVA 32C2A 3GKWL 1PEWA 3MODL 5AD0B 2FFDC 5IW1B 2X2YA 4LSQL 4PVMA 1N19A 4GO6B 3AQYA 1XVSA 1UD2A 4LSTH 1IEBB 1L0NK 1QSFA 2DQDH 2VR4A 3N1QC 1NFIB 2KOGA 2J73A 3KPNB 4WFGE 4QTFA 1AFVL 1YEGL 4F58H 3GSNB 1WHOA 1ED3B 1P6FA 4EKJA 3IF1B 4G6MH 1AG0A 2CXKA 2IH3B 1I9RL 2ZNXA 4QRTA 5I1AA 2N9BA 1FG9C 3ABZA 3KVDD 4FQ2H 4A2LA 3QFJE 3Q2NA 3C5JA 1XAKA 3V7AG 4F57L 3J8F7 3LAFA 1J5CA 1EZVY 1E65A 1QRNB 4OF3A 3HUJE 5EZIH 1UB5A 2CHNA 3LZFH 3UAJA 3QQXA 3RILA 1PL3A 4X6EA 2V37A 2VJ0A 3BRTB 4P5TD 5I30L 3QRGL 1OP9A 3GZKA 4EVNA 1IQWH 1L0NG 1N73C 3IJHA 2HFGH 1OGSA 2Z31B 1CXIA 3C1LA 3OAZK 1ERNA 3GSUA 5LBSA 2YD4A 3TO2A 1OW7A 1V3KA 4JFED 5KSVA 3HNTL 2EE9A 5EBLA 4M1GH 4XX1G 4CC0A 1I8IA 1LTAC 4LLMB 1R3JB 3BAXA 5DC0A 1DQJB 3AE7C 1AQHA 1W5CE 4JFZH 1UG9A 5I74C 1FA4A 1FI8C 3DOSB 5A3ID 5DEFA 1UZ8B 2Z4QA 3PGFH 5DGRA 3KCWA 4X80H 3HG2A 2XWJA 3DX0A 3NTCH 4IKNA 2GKIA 4XRCB 4EKXA 1I3GH 1DZBA 1UJ3B 4JK0D 1RZKC 2GIMA 4OZFH 1KJ3H 2UWJE 4PGCB 3LYRA 3RL2A 4K9EL 5DFVD 2F54B 5EU6E 4D7PA 1L9SA 1AQDB 3C2AH 3HHMA 3LS5L 2FH8A 4JZJB 1GC1L 4DP8X 1SBSH 4WY4C 2R1WB 3QDJA 4CVWA 3BQUB 2KP8A 3LDBC 5I73B 2ZYRA 5FXCH 5CCGE 1URQA 5AW3B 4HQQL 3LPWA 5E5UB 4Z0XB 1ZGLA 2K9JB 1G2CB 3C5ZC 4PJ9A 4WW2B 1P7QA 4NX0A 5LGHL 1RF1C 4BFRA 1M7IB 1PF3A 4L8SA 2WWMD 3T6VA 4DH2A 1JHLL 2XPYA 3MRPB 4WTWA 5K1JA 2YO2A 4OJEH 5M94B 5I8EB 2DTMH 2QKSA 3SKJL 3M86A 3UDWA 1I4FA 3IFPB 4PHXA 2JE8A 4B0MB 4DKFL 3ETTA 4KHXH 4XP9L 3S4SA 4JHWL 3GHEL 1RZ7H 1A7NL 4HBCL 2W92A 5DVKA 3DGCR 3VSTA 1KYOI 3VWKD 5AOKA 2O5XL 1T6AA 1EZSA 3GXTA 4UINH 3RNKB 4F8PA 3HS0A 2CH8A 3JVFC 3RQ3A 4PJEF 2OSLB 2Y1ZA 1ZIAA 1LVEA 3ARGC 4ZPTA 1AH1A 1I3UA 3MRHA 3HLKA 4N20A 1CBVL 1KXVC 4X4ME 4EZLA 3R7QA 1EAJA 3QJSB 3WO4C 5GGVY 4OD1L 1O0VA 2V5YA 3MRRB 2OMXA 4OQTL 5EOTA 1K4DB 4N2OA 2VLMD 1BLNB 3KPSD 2AMUA 3MA7B 1XH0A 5EOQH 4ZTOL 1TU2A 4PREB 5IHBA 3TA3A 3QUML 4CU8A 3H42H 4WJ5B 1QR4A 4P2OD 1YHPA 3C6LC 2XNAB 4OGQD 1N6QH 5CP3A 5D1XE 1LWUC 3TFBA 5A7BA 4ZNEE 1W8OA 1YUHA 1I8LA 4MDJB 2BNRA 4IIQC 2DM4A 4L3EE 2LV4A 4RWHA 4F37K 3VVWA 5D7JA 5B8CA 1NDGA 4KTGA 2N01B 4TQHA 1J8HE 2E27L 2R0ZH 5F9WB 4E9XA 5M95B 4XCFH 3BUTA 4GRWF 1GW4A 5AW5B 3I6LD 1E4HA 5I18L 1OY3B 4FS0A 4IRSD 1A4JB 2BNQA 4EI5C 1U58A 3CFIC 1OAKH 1AD9B 4L8BB 4M3LA 4RSVA 4AENA 4AX3A 1AJ7H 4DGYH 1I8MB 1HGVA 2BWIA 2R2HA 1U8IB 1AQKL 4FZ8L 4PS3A 4DVBA 2UZXA 2BVYA 3WUVA 1F13A 4G9DA 1CGYA 3JC22 5DHDA 4OFKA 4ZDHB 4LIQE 4WDIA 1HXMB 1WIPA 4MZRA 1PAMA 5FYKL 4KDVA 1A1MB 4NKMA 4EQ2A 1GY2A 5ESQB 1T21A 4FLRA 4U33A 5E4IA 1KWGA 2UXFA 5F3HA 3MFFB 4PWJA 5IQOA 3BP5A 1CD8A 4EAEA 4WWOA 3A21A 3G04A 1NUGA 5ICXA 4WHYG 4P49A 1ZLLA 3QJQB 5HD8C 5B22A 4UQBA 2DQTL 2E76C 2BEQD 2Z5IA 2YHGA 4BFKA 1E50A 3QFGA 1LO3L 5FO8B 3ZVVA 1EJFA 2NX5B 3QUZC 1G7MB 4O2FA 3MFGB 4GSQA 3H2WA 1NTMD 1FFNA 2R29H 1LO5A 3KWWA 1USDA 4PB9L 3MRNA 4F15C 3V4PH 3UC2A 1GGCH 4WFHD 2FB4H 1G9MH 4YDLC 1Q9KA 1JK9B 3BI9X 5IVXA 2YA1A 5GGQH 3R0MA 4GO9A 1E28A 3KWVA 1R5IA 2DQCH 1DVFA 2E46A 1J9TA 4N8CH 4RMQA 5DF0A 2FWUA 1YNTA 4G8GB 3FU0A 3LW5J 1QVOA 2IYPA 5C8JA 2XU9A 4RMUA 5D2NB 2VOTA 4TUKL 3FQXA 1Y47A 4TV3A 3HFFA 2ZNWA 4XVSH 1FFPA 2VDQB 1MF2L 4ZW5A 2KPWA 1TLKA 3TGUD 4NHCL 1SYSA 2HVKB 4NC2B 4Y4FD 4PG9B 2J88L 1XIWA 3DRTA 4HV8B 2WYIA 5CP7B 4R4LA 3ZX1A 2XZQL 3KLHD 3ULSA 1CFBA 4OCNC 1G7QB 5EOCH 5TGBA 1JD9A 1W6LA 4ANXA 1URZA 3EG9A 3X3FH 1OOWA 1XBDA 3PL6C 1GK4A 2BY0A 3RVUD 2BW4A 2CPCA 1USQA 3TCTA 3L16A 4O58L 4GXUM 3BWAB 4RO0A 4PMFA 3I85A 3EHBC 1RPKA 3N85H 1A4AA 5DHXB 4XAKE 5JIIA 1UZ6E 4G5AA 4KNSA 4RJTA 1IM3D 1SMAA 4LHJB 3REWB 4PRDA 4NGHH 2EYTA 3H1LE 4XPAL 1BBDL 4K3JL 4BQ9A 4Q9CA 5J11B 1RZ8B 2HT4C 1IX2A 4QRPB 2W1NA 3PFUA 4H88H 3F2LA 2HX7A 3FRPG 2QDVA 2FX9L 2CLVA 4LL1A 4MD0B 5TE4L 3O8XC 3CX5D 4OZ4B 4Q9RL 4PJGE 3L70G 5I9QB 3KYOB 4HIJB 5GGVL 1Q0YL 3PV6A 4JZNB 4E9LA 2H3NB 3ECQA 5DUBA 1OAJA 2EE3A 4GAGH 2J6EH 3UFIA 2FX7L 3KEDA 4ICWA 2CWRA 4OF8A 4NQEA 1MIMH 1R3LA 5EUOF 1G7JB 4F27A 4R0LA 5KJ7E 1FBIH 1EEUA 1LTGC 2DQEH 2TRYA 3PPEA 4QXGH 4ZS7H 3HZVB 3CSFA 1P6AB 4HIXL 5KTBA 2I24N 1CDIA 5I0ZA 2WO3B 4YWGH 1KBKA 2VDKH 4GUPB 5I1HL 2IH8A 3EOBA 4ADGA 4MQXD 2XWZA 5FA3B 5FCUH 3FW6A 1OO2A 1FP5A 3VMAA 4J23A 1BF2A 4IDJL 4M62H 2FUQA 2B59B 5AZEH 4Y4KB 1MWAB 4GI8A 4PR5A 4UQ3B 4WTXA 4BSWB 4LCWE 3WKPA 5L6YH 1TZGH 3REVA 4X6CB 4LCCA 4Y2DC 3BESR 1ZA3B 3Q44A 3CG8A 3EUUA 3KCPA 2DBLH 4NCC1 1RIHL 5EC2A 4Z78A 1YUKB 3RTQD 4OIIH 2VDLH 1SUHA 5BRZB 3P9LA 4AGMA 4XNZB 3ZYOA 5E2UH 3EOAB 4XCYA 1QVFO 2AI0H 2HFTA 5T3XL 2EKSA 2VQ1A 1J7VR 2X3CA 2FEEL 3OAWA 4N2LA 1N5AB 1NAMH 3N42F 3LPOA 3ARQA 1M7UA 2P5ED 3WEAA 2W88A 3RUGF 1NC4D 2VC2B 3Q5TA 4RQQA 2AKRB 1OARL 3FL7A 2UZYB 2OTWB 4Z8FH 4ZMTA 4FKKA 4C55A 4CJ0A 5KS9E 5I5IA 3MDJA 3AFLA 4GQ9L 5DFTA 3TYGL 3FT3B 1FO0H 1S1CX 2EECA 3RKDD 4OQ1A 3U7YH 2PW2B 3O6FA 1R3KA 3KPLA 3CFBB 4P5TC 3H1IJ 2WKOA 5F9JB 3HKZA 1C5DB 3IDXL 1SM3L 1OCWL 3R4DA 4W9CC 5H94B 1GMEA 3QO1B 4PWKA 2XACC 3VXMA 2LHAA 4N8VG 3N41B 5L2KD 2OI9C 1BF8A 1S7WB 2NLJA 3I02A 4JFXB 4O2EB 2GSIA 1EGJL 3IXAA 4UAOB 1QFOA 2MCMA 2OMYA 2A9CA 5IR1B 2GY5A 2NYZA 2V17H 2YRBA 2M83A 1TJGL 2ZT9D 3JZYA 4Z7UA 3RL0B 4UTAA 4L8DA 2J4WL 2WB1A 2ERJB 3GC3A 1ET8A 4OVVA 4UMSA 2Z91A 5A3IC 1XQ4A 3Q2WA 3QQ3A 1XTGB 4C83B 1C1EL 2C1OB 3H9SE 3ML8A 3UIYA 2XHNA 2ITAA 3EO9H 3TIEB 4U6YA 2YOCA 3ARYA 3V52L 1AXTL 4L74A 3B2XA 3CXDH 4Z3FA 1ZLVK 4RSYA 3HRNA 1UTDA 1YITP 4O2CB 1QX8A 4MZ2A 4W9ZA 3VGAB 2LE9A 4D7BA 1AYRA 4JKLA 4FFWD 2F58L 1PD6A 4R8WH 3VA6A 1CFTB 5KSAB 3TBTB 2IBZG 2WM0A 3KNBB 1ID5I 3MRGB 2IFMA 3Q2CA 4KPHL 5GS3A 4J5VA 3TH4T 4I3SL 1MJUH 4XN9A 4B3EA 1JGIA 3ARFA 1XXDC 4AC4A 5APQA 1CTNA 3ETSA 1BVLB 4S1RL 2GITB 1TITA 1B0GA 2WWMC 1AQTA 5K9KB 3EOYG 1A6ZB 1GJIA 4ODXA 3MGTB 5HDRA 2FH6A 3QO0A 3WNOA 4FJZA 1LO0L 1QMUA 7FABL 2FE0A 3OPUA 1TDQA 5CWSA 1HJ0A 2Y9YA 2BSED 4M1DH 5TDOB 5IFAH 1GA2A 2FX8H 1H5BB 1YMMB 3B2DC 3QXAB 2AZAA 5I16A 5F96L 4KK6C 3DV4B 3RURA 3QAZB 3WFBH 1FNFA 1U2CA 2I27N 4AEFA 4YEEA 3BPCA 3VWKC 3QEUB 5CZRA 4Z0BH 5F93C 2GB2A 1TZOA 1AQDA 3CFDB 3TF4A 3UZVB 3ARBA 4HWZB 3MI6A 2Q8BH 5DRXA 4U2ZA 5GHWL 3BKCL 3UAFA 4B60A 3LN5A 4AGPA 5F8RC 4BZ2L 4ZQTA 2VLRE 2ODIA 2EVFA 2YXRB 1FDIA 3AEGC 1SP4A 3CLFL 2G0KA 2P4AB 4J3VA 4A7SA 5DS2A 4WKZB 3GS0A 3FWLA 2X4NA 5ITBH 1NJIQ 3U9UB 5CCJA 5FW8A 4D6TE 3DSNB 4U1IA 2J72A 1XCTB 4P2OC 4DZBA 4Z77B 5T33L 4DW2L 4OGQC 3AREB 2X4OB 4M43H 4IBLT 4N86A 1DX7A 4PEEA 4PGZA 2J71A 4XMKH 5FUOH 5MP6L 3G3LA 2C3GA 2A1WL 1MHPH 2VL5A 2YRLA 4J27A 4HK3J 4JGNA 2HR3A 4PRPD 5I8KL 2X4SB 3VRIB 3PQYA 4GYBA 4ADJA 5K5YA 5EU7C 1JCCA 3WLWD 2YMXL 3BASA 3QIUD 3T6QC 1JPSL 1OAXH 4MKTA 4PRNA 1MV8A 4RGMC 3NZHL 1A3ZA 4MJ6B 4K7FB 4MNHA 3FTWA 3L8QA 4MRCA 1G9NL 1JNNL 4IRSC 4N8VB 2WLLB 3X14A 3KPMA 5TE7L 2BH0A 1M3JA 4KO9A 3TGXA 1PP9J 1EZUA 1MFAL 1VADB 3A4FA 4MA3A 1P84E 1FZKB 3OWRA 5I1JH 4JRXB 1F58H 4BZYA 1W0VA 2VB5A 4ZX3A 2WC7A 4LPCA 3ZDZE 3ZYZA 2ZKHL 5D7LA 4KO6A 4WBAA 2IQAB 1HQRB 3CQQA 3WFHA 4LMQE 2NZIA 4WWIA 2BVUA 4QUOA 4FA6A 2AJUL 2HJFB 5E8PB 2HLFD 3GBNH 3B4SA 4XC1L 3D3VA 3GXPA 1S9KD 1N5YL 4GKGA 3LKRA 1IQDB 2HWZH 1C12A 4J8QA 3GHGA 3WS3A 2FT8A 5F9DC 1BIIB 5AL8A 3MV9D 1CD9B 1D5MA 2ZWSA 4CN4A 2YC1B 1OM3H 3HD7B 3MZTA 1WF5A 3B34A 4P2RD 5KYYB 3UG3A 5BVPL 2VZUA 2G60L 5AAMC 5JPMC 1FYTD 3TJHD 1KIQB 1V7ML 5JW5A 1FLRH 3CMOH 1HXMA 2HLOA 2BDNL 1VJSA 3SPVA 3OKOB 5MI0C 3VGGA 1D6EA 3SKMA 3VDBA 1BCCG 3RIFK 4OLZH