5AVXB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avxB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avxB02
3KDPB 1HJBA 3SWFA 5AW8B 1FOSE 5APUA 5CMZA 3MD0A 1FAVA 2JJLA 3HE4A 3VMXA 1H88A 1IO4A 2WPRA 3IR9A 5AVUB 3A7OA 5AVVB 3TNUB 2WT7A 5APTA 3O8ZA 3M9HA 2XV5A 4AQRD 4AYCA 2Q7CA 3A5TA 2YO3A 1HBWA 1CI6A 1GZLA 1MFZA 2XZRA 1X8YA 2W27A 2BASA 1JUNA 2WTYA 1G2CB 3VMYA 3VYIA 3TNUA 2P67A 3LIDA 1MV8A 3V4WA 2YO2A 2R3CA 5AW3B 4XE5B 2Z5HA 1A02F 1DH3A 1H89A 2H7HA 5AW6B 3HTKA 4RETB 3M9BA 3VN0A 1NWQA 5AW2B 5AW4B 2C9NY 3TYYA 3WGVB 4HYTB 1GK4A 4C7NA 2ZXEB 1T2KC 2P2UA 5APWA 3V5BA 3B8EB 5APVA 5AW5B 5AW7B 1SLQA 1GTWA 3VTPC 3P8MC 4I2LC 4JYCA 1NAFA 1KQLA 3NMDA 4RESB 5APYA 4I6MC 1CZQA 1S9KE 1GU4A 2Q5UA 3KQGA 3M06A 5AVYB 1SP4A 2E42A 3M0DA 1GU5A 3NTNA 1FOSF 5AVXB 3P32A 4LC1A 2QM8A 2XU6A 4GT1A 1YYCA 4AUWA 1S9KD 1GD2E 4DZOA 1HUCA 1MUUA 2R32A 3I5CA 2WPSA 3NFQA 5AVSB 1CSBA 1JNMA 5AVRB 3V4QA 3LIEA 3L35A 3HE5B 5AW0B 2E43A 3OAKA 3L36A 3UIAA 3A2AA 5APQA 2C9LY 2WPQA 2P7JA 2WWWA 5AVTB 2Q3IA 5AVQB 5AW1B 1A02J 2R5DA 3A3YB 5AVWB 5AVZB 2WT7B 3P7KA 4JYBA 1OXZA 3VMZA 3M91A 3WGUB 2ZFCA 1CI6B 2VRSA 1GK6A 1OWAA 2W6AA 4B86A 4C46A 2N9BA 1H8AA 1HWTC 4KHXA 4EOTA 2QM7A 2Z5IA 3T97A 2IPPA 3TK1A 3L37A 2YNYA 1T2KD 3NXSA 2R5BA 3HE4B 4GKGA 5AW9B 3MGNA 4C7NB 5APXA 2KP8A 3M0AA 4M3LA 1J2JB 3HE5A 5APSA
chains in the Genus database with same CATH superfamily
4HA1A 3TH3T 3DJ9A 3GSUA 4MS8D 1MIML 1KD1Q 3O2VH 3UYPB 3QIBB 5KSBE 4I7ZB 2OYHA 2LE9A 2BOCB 3NCBB 2CDFB 2EDRA 3O3EB 3NIDB 2VIRB 4LLYA 1GZHA 1JTOA 3ESVF 4QTHB 2WPVB 2AJXH 2E9WA 1JGIA 3QVAA 4HUMB 3ZDZF 3FCTA 3LZOA 4ABQA 1J1PL 3RFZA 1IGYA 2GT9B 4PRIB 1LO4H 1QLRA 2RTTA 3CWBE 1WO2A 2VUYA 4TYUA 3JCUE 4N0CD 4LSQL 3IBOA 1NBZB 2CH8A 4R5XA 5DVPA 5A2BA 1O0VA 1P4LA 2WNKA 4G43A 1F58L 1VERA 3S5YA 2WLJA 4K8RC 4KVCL 5BJTA 4MXWH 3TDKA 3PHOA 2CBOA 4AE1A 1O9WA 1XR9B 5SWSB 2NT0A 1WFNA 2DKSA 3CD4A 4IS6B 1CPUA 5IVOA 1KCSL 1T1WB 3EDJA 4JM2B 5DK0B 5MEQB 2FYUD 2JJVA 2LTQB 1NBVL 4E41D 5KWYC 3TURA 2YXRB 3CFCL 3U48A 3AE4C 1JHTA 4PG2A 4JO1H 4Y4KB 1QI5A 1DR9A 1RJYB 2VAAB 3DDGA 4J5VA 3CXHK 4M6OH 3KZ8A 4WKZB 1JF1A 2Y4SA 5M94B 3KQGA 3AVEA 4JPQA 4MA8H 4Y19B 4XB7A 3D71A 2IFMA 4LSUL 1PP9D 1QFUH 2W95A 4JQXC 1GCYA 4JZNB 4QYAA 4ZAKD 3FMGL 4LLHA 1L3WA 3WFDH 1T4WA 4OZIB 4PH8A 4XCYB 1GD2E 1VFAB 1HUCA 1OTTC 2G2RA 3LRKA 2WPSA 1NIBA 1UACH 4PJ0H 5AVRB 2P47B 2XWJA 2D31A 2BNQA 3FS9A 1CWVA 3MI6A 4W9EC 3VU1A 1U3YA 2A9BA 4WHCA 2EADA 2QMKA 4KJYB 5AD0B 1YQVH 3P9WB 1FU1A 1MFBH 4XN2A 3PWPA 2BW4A 2QQLL 3OKKA 5EC1A 2HFGL 4JPSA 4WSKA 1SYSA 3ETBJ 4FHJA 1HNFA 2K9JA 4LCWA 5EZLA 3RGHA 3TP4A 1FAIL 4JRXA 1ADQH 1J87A 3DO4A 3G5ZB 4JFZL 3FRPG 1D6EA 2C3WA 2XZCH 4TULH 4XMVA 1HNYA 3RDJA 1MREH 4MQSB 3QFJE 2ODHA 3KEDA 4HMEA 5TD4A 2B14A 1LTXA 1SQXE 2VR9A 1WISA 3M7OA 4WQOA 2A2QT 3SKJL 3FRUB 4HIIA 3TBWB 2PP9A 2DJMA 5K93A 3PXJA 4PRBA 1J8RA 3TK1A 3ZE1B 2JJSA 2VZSA 2BHZA 4OF7A 2CKBB 2F0CA 2FZ3B 4H5SA 3IFNL 2R56L 5IESH 4YL4A 2DMGA 4P8QA 1A3LH 4ZX3A 1IGTB 1R6VA 5EZIL 5KBKA 3GSOB 3FNKA 3CC7P 2JKJA 2RN0A 3ALPA 4YDNA 5T5FH 1J5IA 3CX5J 5C0GA 3VI4F 3D48R 2QLYA 3TX4A 4AYDC 4MAZA 2CE6A 2GVYA 4PJDA 2KDYA 5D4JA 5H37A 4WWNA 1E9QB 1CGUA 4D9QE 1JZEA 2K70A 4UT9L 4O9BA 4W9LC 1E9OB 1KJ3H 4WKXA 2CO1A 4V2BA 1O75A 3U0PA 3AECC 1NIFA 3C9NA 2YKKA 3SPGA 4PJXE 2HMIC 4HXBH 2JQAA 4N24A 1FYTE 4AGNA 5H35A 5E2VH 2HODA 3X13B 2KLSA 3KCWA 5B66E 4XXCC 3CVCA 2YD2A 3SE9L 2N56A 3NCEB 5MENA 4TT3H 4OD3H 2Q6WA 3MV9A 1LK2B 3GXIA 1M1JC 5D1QC 4LSSH 1AO7B 1HQ4B 2FSEB 2V3FA 4X50A 1SLQA 5F9JB 4JEGB 3QUXD 1DJSA 1FH5L 5D7LD 2CJUL 2Q1EA 3HE7C 4N5UA 1EIBA 4NZJA 1CDBA 3D2UB 2ZT9C 4HEPG 4DGUA 1KBPA 4U1LB 3T04D 3ULUF 1HJ0A 4GQ9H 2E56A 4JFHD 3VXMA 3W81A 1YNKH 4FYQA 2X4SB 5CN3A 3HPLA 4AYFB 1JDCA 3DO3A 5KSUB 1YECL 3MRRA 1CS6A 2VABB 3IM1A 5KSBF 1N4XL 1JV5A 5KLVJ 1G2CA 1XAKA 2CBTA 4DZOA 1GKEA 2EXWD 3CZLA 1CC3A 1EUUA 4NC1E 4E5XA 3KPEA 1SYVB 4MKMA 4V1DA 4M3HA 2VXSH 3T0EE 1ZLLA 3EJPA 3KZIH 4KHXL 4MCYA 4LCIL 4JQ0D 4HIQA 4NCDA 1ZK5A 3W57A 5JPNC 1PV3A 2F53E 3AY4C 4CC4C 1KC5H 4HS6B 4WHTB 4WIQA 1KCKA 4PJIB 3P7KA 4JBSA 3DSNA 1A9BB 1SQ2N 4YXKL 4NC0B 4XX1E 5EPMA 1TNMA 1F6AA 3BATA 3PQYB 2X4QB 3AQYA 4X4KA 2ZNXA 3UOAB 1T80A 2O5XH 3OTTA 5TPWL 3AT0A 4JZJA 4U05A 1G7JB 3CDZA 4L4VD 5JIHA 3U4EA 3WNNA 1G0XA 5EN2A 2V7QJ 3CDGB 3VU2A 2MQCA 2DQ6A 4HPHA 1NU1E 5I17A 4XOEA 5F9OL 1XF5A 2C9RA 3I75B 3VXRB 1VQPP 2BSTA 3L6FB 4NJAH 4NKMA 4GT7A 2YRBA 3WV0A 1OTUD 2W9DL 4X4XB 3EQ2A 2QEJA 3NQIA 2ED7A 4MD5B 3STZA 3VI3E 1AQMA 5IF0A 4M5ZH 4RA0C 1IM9D 5IVNA 4UM9A 1FAVA 2E74B 2D03H 2EDMA 3FOLB 4LGRB 5HYEA 2IIJA 4RISL 2C9PA 5CJ8A 4KZ0A 4A7SA 3CLQA 4PLKD 4PJ9A 3FWLA 2HT3D 5I0VA 4KUZL 4XE0A 3UP6A 2FJHA 5IBTL 4X6EA 3ZQWA 1EJFA 1YHPA 3IVKA 1UM5H 3ABKB 1NA8A 3INUH 4JPIB 4S2SA 2E3VA 4OV6F 5F70A 4AE0A 5SV3A 1OW8A 3TIDB 5JIMA 3IU3B 4O5LL 1O5DT 3ZYOA 1NCDH 3IAGC 5K1NA 3QUKB 4RQQB 4F20A 1NTZD 2WTRA 1T89C 4RIRA 5BS0B 3CFDB 3QSKB 3VFWA 4HWUA 2DL2A 2OTWA 1LT9C 1KFMA 4NGHH 3D0AA 1W6WA 1RCYA 3MPCA 3UTTB 2VDOH 4ZUVA 1H5BA 3C09B 2H8PA 2WLIB 1C7TA 2YARA 4JJHA 1M05B 1I1YB 3H54A 1HI6B 5FYJU 1FFPA 3CHSA 4HCRL 4HLZG 3OGCA 2L5GB 1MY7A 4G6MH 3ZHDA 1RPQA 4XNXL 5CBAA 4W81A 4S10A 2BNUB 5K39B 1ACXA 2FQEA 3U36B 2ZCLL 1DQTA 1A3QA 3ARVA 3WBDA 1QD0A 2NNRA 3VFTB 1B0RA 1NTKJ 1ZTXL 2NY7L 3BHBA 5D1XC 4D7BA 1E30A 5J89A 1AH1A 2Q9OA 5EBMB 5LGHH 2JB5H 4L1SA 4ZFOB 4OLXL 3ZOAA 4OLVL 1HEZB 1MFDH 2EIBA 4KJWD 1RJZA 4LARL 5DXWA 2MIZA 2CPSA 3S5LA 2WANA 3QPXL 4TNVF 2C9LY 1LEIB 4Z7OB 1IFJA 1JJUA 5CD3A 1J9SA 4ANWA 1CQYA 5JIQA 1CFQB 1HOCA 3O0RL 3V0VA 4FI8A 5KVEH 6FABL 5LN8A 1DSFL 5EZJB 5FGBA 3PGCB 4PD4E 4Y4FA 4MNQE 1XGUA 2EILB 3PWLA 4YBLC 4IFFA 3OSVA 4N6QA 1E2ZA 3VTAA 4OFQA 2CIIB 5FYLE 3US9A 1IGCL 5D2LA 4TVPE 2R0KH 2HPCA 4RWHA 4JMNA 4GRWF 3IXAA 3B5HA 2PWGA 1BZOA 4MJ6A 3QJUB 4HKXA 5DJ2A 1I9JH 5JNYA 1UUSA 3CVIH 3IDGA 3T3PB 2BNQD 4M93C 3CZKA 3WKML 1LE9A 3P3YA 4LBEB 2P5EE 2P5PA 2BC4A 3RTQC 4GP8B 4B9FA 1AI1H 3T4AC 3S36L 5HVHB 5C07A 3VTMA 5DI8B 3PWPD 5EU6B 4H7VA 5C09B 1YVLA 1MJ7L 1RK0A 3U9WA 3ELQA 3H1HD 4LCWD 4UTCA 1BCCG 1G7LB 1TPXC 3MUUA 4JRXD 4NPYA 1I7UB 3CFEB 5KW9L 2FWOA 4I18B 1NC4B 3WKYA 4IKIA 1H15A 3CX2A 4LEEA 4QXUH 3V0WL 1F2QA 1TFPA 3LNEA 1A1NA 3B2XA 4LHJB 1FZJA 2WVVB 3LPOA 5AOIA 5K1JA 4N2AA 1EZVX 5GRXG 4YLQT 4ZW6A 2IMNA 4UV7L 3WELA 1CDIA 3QISA 2WC7A 4L2LA 3WUZA 2Z65C 3BSGA 3LIDA 2Z31A 5FO7B 2QJKC 2VC2L 4LU5L 1EZSA 3AE1C 5AW3B 3TA4D 2XY1A 2OMWB 4MYPA 1PF3A 2OW7A 3CBKB 5FWQA 2W94A 2X44D 3FB5A 3JYBA 2WXHA 3T2NL 1AYRA 4XN1A 5SWQA 4GXUM 3SOBL 4EUPH 2FO4B 4F15C 3G5YB 4X5QA 2GK0A 3FK3A 2CR3A 2KB7P 2E8ZA 4M7JL 2KYVA 1FBIL 3TA3C 3BPOC 4JFDA 4BFNA 4FQ1H 1VFBB 3ILPB 2YGNA 3VXTB 4RDQG 4YDLC 1CFTA 4YXLH 3WS6A 2UVEA 4WHYG 1K9TA 3LHPL 3R7QA 1VZHA 3QI9B 4P06A 3S3CB 5BQ7B 1AR1C 1U4FA 3HNSL 4OLEA 4IMKA 5CSZB 2IH3B 3VI3F 3M0DA 4QR7A 5KLVD 1WBZA 3OKEB 4ODWB 1AGEB 5IVZB 4PW3A 2RGSA 2X1WL 2XV3A 3KYMB 1HSBB 4QOKD 1JDDA 2ZOOA 3FU6A 1CDUA 2Z91A 4U6XB 1S72P 2BIOA 1I7RB 5D93C 3O2DH 3SD5A 1J8HA 5HYSB 1SJHB 4LCCC 4QHMA 2AC0A 5DC9B 1GL2B 4HXAH 5GPRA 3WIFA 4Q4EA 3UBXB 4BH8A 2AJUH 5K9JH 4HFUH 4XPTH 5MEND 1XDTT 4L29B 5K9KA 4F33B 4NHCL 3MV9D 1DJGA 1FFNA 2R1XA 4KKPA 3L3KA 3MNMA 1FBMA 1KTLA 5AUMA 5IFAL 4KKLD 5C0AB 1JNJA 2X4UB 4PJFB 5DVLA 5DQ9B 3QR0A 4YXHH 1N6VA 5B8CB 2KLVA 5BRZE 5FB8A 2HX7A 1Z9MA 2J1ZA 3VXMD 1I9IH 3EJZD 3U7AA 3SBPA 3SPIA 4UQ3B 1MFCL 1CJYA 1L0PA 1AY1L 5D7JC 3UO1L 3QJFB 3X2QB 3M8OL 1URQC 3VXSA 3KR3H 1ZWIB 1MCQA 1BQSA 2ZP0T 4N2NA 2NSQA 2DWSA 3B7SA 15C8H 4LLUB 3CFUA 4Z7AA 4TUKH 4ZSOE 1GHFL 2YMXH 4JPKL 4PBVC 2W0FB 5ALBH 1IGIH 4J28A 3CJJA 1PZ2A 3G71P 1ZJBA 3PF2A 4GSDL 4RKUJ 3ERXA 2CLZB 2AXFB 1SOQA 3QQ9D 5LG1A 3I9GH 4IRZL 4GKGA 1MJJB 4XNZB 3I2CH 3MGNA 4ODXA 3JV6B 1AZVA 3TIEA 3N5AA 2A3TA 1J2JB 1ZHKA 4JHWH 1MLBA 2ADIB 3HZVB 4WY4B 2GJRA 3LKQB 5HYIA 2OXHB 2K1MA 3SJVE 2VLKA 4XCFL 3K6SB 5JXEA 3FO2A 4LVHB 5DMKB 1ZLVK 2IYOA 1LWUB 2Z92B 3LEXA 4JO2L 4WK0B 3IXTA 4YDKH 2R8SL 2AJSL 2H6UA 2VN7A 1BXXA 1E7VA 4IQHA 4UT7H 4MHHI 3EYQC 1J11A 2JJTC 4UYQA 4OV5A 4XVJH 5I8OL 3BVNB 1KXVC 4NKDB 1WTLA 2YAMA 1F4WH 3NZ8B 4O2EB 2I1KA 1IZKA 3H55A 3CXHJ 5DK2B 4DEPB 1DCLA 1MG3C 4X6DB 5FIEA 4RGNE 1N73B 3WXVH 4X5WA 2NY4C 1KTCA 1NUGA 1I9EA 3WS3B 4J3OD 1J7VR 32C2B 1P4IH 4UM9D 3DTDA 1A6AA 2W0PA 1BGYE 3SGDH 3NA9H 2VWEE 4PJ9D 3S96A 3VNZA 1TLKA 2OK0H 4Z3HA 1GCFA 3QH3A 4HKBB 3ZTNL 5CLZA 2NSMA 1P6AB 4GIFA 1NDGA 1WT5C 4RRPA 4W9KC 1JPEA 3C08L 2IADA 3NRQA 2W80C 2C3VB 3LXUX 4XWOD 2ZWZA 1LEKB 1XR8A 2J57A 3EO9L 4A38A 3E0GA 1QQDB 1SRDA 2HN7B 3SE4A 5AG9A 5KVEE 3HMWL 5DUMH 1ZE3C 1BPVA 3MYZA 5JQ6L 4AVKA 1DVFA 5JUEL 3AE6C 1I1AA 5DZ9A 3WTWA 3ARWA 3CU7A 2XKNB 3V4UL 1K6QH 3Q3GA 4P9HL 2H8PD 2W60B 5TTRA 1TVHB 3UAJA 5I71C 2WIIB 3WXWH 2X6MA 4JN1H 5EIIB 3IDIA 3TYFB 4GXVH 1F4XH 4NLAA 1RUML 5FEBA 1BQHB 4UB8E 2NY1C 4OLYH 3KPLB 4EZMA 4G5ZH 3GC3A 1KELH 1AKJB 1PEZA 1A4BA 1HWTC 1IQDA 2BSCA 3TJPA 4L8CA 2NY6D 3BAYA 3QRGH 3BKYL 4CJ1A 5F7NC 2KZJA 4GXUN 4ZQKB 5DD3H 3HR5A 4UF7C 3EH4B 3TZVB 2OMUB 1KCWA 2XY2A 4M7LT 2VL5A 5CEXA 1U30A 2R23A 4N2BA 3KNBB 4RGOL 1RHZB 2J1YA 3O11A 1Q0YL 4E41B 1SEBA 2VDOB 1DVYA 4A66A 2H3NB 2WSKA 2BCKB 3WMPA 4LL1A 2B1HH 2LAAA 5IHZA 2J21A 4F7KA 4Y4FD 5DGRA 4XVTH 3KGUA 3E3QE 3BCCG 5EORL 1JZJA 1ZIBA 3MLRL 4MD0A 4UDUA 4MHHG 4OZHB 5D8JL 5FUZH 5JW5B 3FYIB 1YRKA 5LDUA 2AXCA 2DMBA 3APDA 1TTFA 3NK4A 4L37A 2ZAGA 4ZAKB 4JFVA 3QORA 4BA0A 5E2TL 1FL5A 1HBWA 4FRWA 1CI6A 5HYJA 1T4KB 1KULA 2A5UA 4BKTC 5ACLA 2OR7A 2IDTA 4BE5A 4TTDC 4X0KA 5CINH 3GUFA 3MX0B 3EXLA 3ZDYB 2PF6A 4XT1C 3II6A 2H45A 4JKLA 4AC4A 5C07D 1IBDA 3UJJH 3VD4A 1AOHA 1HILA 1K4DA 4I9WD 4IGBA 3EDFA 3ZT7A 3QEUB 5B1KA 1C5BL 4EKXA 3RKPA 2JEEA 2CUIA 4Q9QL 5IKCA 2HG5A 1TG8A 1WAAA 4BFKA 5AOLA 4U1JB 4JDVA 5H37H 2FQFA 3AITA 3L75G 2F58H 4DGVL 5K1VA 2AEWA 1AA0A 5IMKB 5SWZE 3QEGL 4WJG3 2X0VA 3GF8A 3S3DB 5DO8A 1SEQH 2Z31D 3I6KA 1CE1H 2V8LA 3BQVA 3O3DB 5KJRH 5DJAA 4LLVB 4ZMTA 3WUUA 2E27H 2VLME 2YGPA 4FZ8L 2WO3B 4H44B 2G4EA 3RIAF 2MH4A 3FQXB 1IL1A 5IEHA 3L71G 3L3DA 1WD9A 1QHOA 5DZVA 1UKQA 4PMFA 4JFDD 4XBGB 3QUZA 4WWOA 3K5SA 4NN7C 3AUWB 1OWWA 4AG4L 5APQA 1DBJH 1BYPA 4MDJA 3HG2A 1LO3L 1R5VA 4HEMA 1BOGA 1JRHL 2CO7B 1IEAB 3LH9A 3RVUC 1QR1B 5FPIA 4L4VE 5J13B 5B7EA 3RVVD 2PYEA 3VFVA 1RIVH 4XN9A 1PMYA 1XZ0B 5DD6A 2DBLH 3HHMA 2EEFA 4NPFX 4HBQA 5M7QA 5GRVK 4UQBA 2QDWA 4L3AA 1J8HD 3LKPA 5JPMA 2V7QH 3BRGC 2XTLA 3TBSB 4M7ZC 3LIZA 1Z3GH 1M53A 2IBZI 1Z2KA 1SLUA 1FDLH 4KGJA 4MWFB 5HHME 2ETWA 1WMKA 3T2OA 5FAAA 4FQXD 3QXAA 4UOJA 4E9YA 2HRGA 3QG7H 3D18A 4AK2A 2JWAA 4Y5XC 5T1LA 5AW9B 2VXTH 1W9XA 3AQXA 3MCKA 3UC0H 1SOKA 3L73G 3ZDXF 1PLGL 2J2ZA 4R8WL 3A67H 3DSFH 3QUXB 1KJMB 4JL2A 2YXVA 1WBXA 5D7LB 3PP4L 2DQDH 4IOSA 4CMHC 1BLIA 2D4DA 5HJBA 3MRJB 1JZ6A 3EGDB 3VXSD 1FRGH 3VXNA 1OAZL 4MKTA 2BWQA 3MUJA 4MQ7A 1ZLUH 3DRTB 1EMTH 3GZOA 2WYZA 1IKFL 3DV4A 5C9JB 1QLFA 2Y7SA 2N7SA 4NM4L 3PV6A 2W27A 2C7UA 4AQ1C 5HVWA 1DL7H 1RF1A 5LUMA 2O01H 2V9UA 5C3TA 3V2AR 4TLUA 4Q6IC 3WN5C 4DKAA 3V9CA 5KOMC 2IDUA 1QHQA 1NOLA 1UGKA 1IEHA 5B1CA 3TNMA 4KY1L 1ZP0C 2EZ0C 1HS6A 3Q2NA 2VLKD 4PV8B 2GJ6E 4AM0A 5JXED 2EP6A 2EE0A 3F6LA 2XZAH 2AJVL 4YDJA 3ZPDA 1J1OH 1FO0L 1QTPA 2E8YA 1T8ZA 3SFEC 3GIZH 2FQGA 3MNVB 4ORZC 4HULB 3MJ7A 4DK5A 4ZXBA 3S2CA 1HGVA 1IT9L 3DX6A 1PLAA 1VZGA 3DJSA 4JBZA 1RVFH 3OMAB 3MCYA 4XVOA 2NY3C 2DKMA 3F7PC 4L9LB 2NW2A 2XACC 5FK9A 2YHGA 3AEBC 3GSNL 4L1TA 2H1XA 1FGNL 1UUNA 1ZEAL 2IDCA 3A5VA 2FHBA 3MRFB 4OVVA 4CC0A 2Q9IA 3S88L 4N0YL 5LAXA 1DLFL 4W9JC 1E4XI 3MJ9H 4CU8A 4BSVA 4EOWL 1TTRA 1KT2B 1U3NA 1CXLA 2C9VA 2F54A 3S4SG 5C0BA 4GMSH 5DYOB 1AXSA 1KQSO 2H4EA 1ORQB 4U1HB 4LPVA 2EO9A 2PYFB 4AIZA 2PCFA 1R3JA 3MLSH 3L36A 1IM9B 4ZOBA 1ACYH 2M8RA 5I1JL 2WPQA 1LNUA 3DJZA 4LBAA 3JWDH 4CADA 1N68A 1KNOB 3GRWL 4NZ8A 3VQ1C 4E68A 4P23A 2KSJA 5I0WA 4OLUH 3KLAB 5CJOH 2A06G 3U1SL 3VGGA 1B4JH 1BREA 1BZ9A 4W9DC 2BNQE 4DP2X 3N1MC 4BXLA 2ED6A 3NMEA 3LXBA 4HUXB 4Z0BH 2IBZG 1GY1A 1L0XA 5ITFA 3CX5E 1SQBG 4OI7A 5F1OB 2ARJA 4LCWE 1DVFD 1YAZA 3MCLL 1I1AD 3GSUB 4PJ7E 5DTFA 3T6QC 3L1OH 1T2KD 1KGYE 4NZUL 5FKPA 5GS0C 1BA9A 4N3UA 3UAJD 4DCQA 4A39A 1GJWA 5BZWB 5I1DB 2OYHB 4G59C 1LL1A 5TDOA 3NGBC 1GGUA 4DTGL 1JWSB 1U93A 2FX7H 3RIFK 1NGPL 4MTMA 2KT6A 1CF8H 4G6AC 3LQAC 2FBJL 3IMRA 3HI6L 4W9GC 4EE2A 1JZIA 1SMAA 1AZUA 3HE4A 1IGYB 2EKSA 1QLRB 3KHOA 4YVUA 3RFZB 4LDOB 4X7CC 1F8TL 1KB5L 1RZKH 1I8LA 1CZ8H 1VAHA 3OG4B 3LZNA 1P4LB 4OVUA 2Q7CA 2NZIA 3B9KC 1BV8A 1PS3A 2YN3A 2VZUA 3CI9A 2CPCA 2DQTH 5BJTB 1KYUA 4NZTH 5TK2A 1GYWA 2I7OA 5A6MA 4MA7L 2TRYA 2XKSA 2WSFJ 1ZMEC 4XPFL 3VGAB 1ET5A 4Y5YC 1Q9KA 4MA3B 2GPZA 2J72A 5AZ2H 5JO5A 2WWOA 3T1FA 1ZS8A 2EIDA 3HS0C 4NRZA 1JHTB 2J44A 3QDGE 5EO9A 4JFWA 1RE4C 5A2KH 4QT5A 2B59A 1KEGL 2EIEA 1ZLVH 5DJ8A 4WGWB 3ECBA 2PPCA 5B5EE 1JF1B 1DBAL 1L0LK 4X42A 5HJDA 2HFEA 3BPCA 1MI5B 5D96B 1DCEA 4GOSA 4RAUA 4AYSA 5KANI 5KLVE 2APSA 2Z4QA 4YDIL 5DZNA 5BRQA 2WQYC 4PVBA 1GGCL 4QOKE 5DS8A 3QORD 2OJZH 4ZMVA 1FLRH 4J3BA 4GOFA 4YX2H 4RMUA 2G2RB 4MMZA 4U3CA 2IFFH 4LRNH 2IWKA 3KPTA 5MENE 1JNNH 1ONQB 3G6EP 2WKLA 2D31B 2F7IA 3G9VA 3MV9E 1NCWH 4I4WA 1URLA 3O2VL 3V5KA 4AYBA 1RLBA 1GGIL 4IGBD 3SKOA 1PKQE 3DMMC 4I0CC 3F00A 2ZTBA 1B9ZA 3PWPB 3OKKB 5EC1B 3LIEA 2HTLD 2HG5D 3VXME 3MLUH 4Z3IA 5EZLB 2AJXL 3IPBA 5E9DB 4AYMC 3WSQL 4JRXB 5DURD 2A73B 3IAOA 1LO4L 3FU3A 4ZNCA 1KILC 2QTVA 3P69A 1QUPA 3TO4A 4WO4C 5FM5O 2VUKA 3WNMA 1KEML 3L9BA 4MXWL 5D4IA 4HIIB 2J71A 3IFOB 4YHYB 5BU8B 1TZAA 2LW3A 3BT0A 1IBZA 3UJTL 4Z7UA 3LS4H 3FQNA 3GPEA 1F4AA 1NCCH 4B86A 1Q1JH 2BVPA 3ARYA 4OJYA 3REWA 4GW4A 5HHQA 4H5SB 3N0PB 4OGZA 2FGZA 2RCSH 5E6UB 1VFUA 4JO1L 3STLA 1EXHA 2J1XA 3V8OA 3T97A 2JXMA 2UUDH 3QUZD 1R5SA 4IL6H 2YXFA 3L74D 1EANA 5C0GB 4NQCE 4M6OL 4OFYA 1AVYA 1RZGA 4L9DA 4PJDB 4PRPE 4MA8L 2BJML 1QFUL 2Q3XA 2VCOA 3DV6A 3DHJA 3ULUC 4M7LH 1HTYA 2FJFA 3ETBF 4K7PY 4JG5A 2PCPB 3B56A 3WFDL 1NOAA 5CMZA 2PYED 5DC4B 2JJLA 4F80A 5CZKA 4YO0A 4QTFA 3U0PB 5JOEA 5ISZA 3ELAT 2IGFH 3C9NB 2QVAA 1UACL 3L9EA 2I5YH 3TJHC 3SWYA 1DFBH 3WTUA 5KJ7A 1OCCB 1OZTG 1A6WL 5KZCD 2VRAA 4OBRA 5H35B 3CCHB 4LHUA 4QDGA 2HODB 4FA8A 3O6MH 1GW3A 5I5RA 2W81C 4KXAA 1YQVL 2XBTA 4N2IA 4GIAA 5CN1A 1I8UA 4GFXA 1CYXA 5IFHH 3I6GA 4FXGB 5T1LD 1ESOA 2Q6WB 1CXHA 3TBTA 3C60A 3B5NB 1L0YA 1ADQL 2ZWKA 2L04A 1CTMA 2XZCL 5KANG 5AW2B 1V54B 3FTUA 1TJGH 4M1DH 1MREL 4IOSD 5L88H 2WXGA 3H9HA 3KLDA 5C0CE 5E7BA 3ZKNC 3RWHA 4P4RB 4YHKL 1NTKE 2X2UA 4M4PA 3HPLB 3UPAA 4PJ7F 3SHSA 1SMOA 1P5VB 4Z9KB 3Q8FA 1FZMA 1JV5B 5KAIH 1CZQA 1NDTA 1ZMYA 5IESL 4OIIH 1Z6JT 1PTZA 2L7QA 1A3LL 3OJDA 4LKCA 4P49A 1CXKA 2FT7A 1S7TA 3V0EA 4E5XB 1S5LX 2C0WA 2R7EA 5I1LB 4E9LA 4V1DB 2AQPA 2VLJE 3O41B 1CLVA 3P32A 3MAWA 4TRPL 3PY9A 3BZ4A 1XX9C 1FL3A 4K9JA 3NCMA 2HYNA 1WITA 1LTAC 3C6SA 1JFHA 4P5TD 1L7IL 1DDHA 3P0YH 2DWXA 3CVDA 5IV2A 3CC5A 2DLFL 4ODTL 2NDFA 5CIPA 5DQDL 1ZVNA 1A4KA 3QP3A 4X4MA 1F6AB 1KY6A 4ZXBD 2B1OA 3K6IA 5I15H 1ZSDB 2AQQA 2BVEA 2PFXA 4MA1B 4P5MA 3EGXA 3QDME 4HXBL 4UTAH 4QAMB 4JZJB 2KH2B 2QPUA 3U4EB 2PN5A 5E2VL 5EN2B 4BFRA 3CIQA 4EBQL 4D7PA 3V4VB 4PGJA 4Z3TA 3LJ3A 3MMEB 5I17B 3MU3A 4BE6A 1FP5A 1XF5B 2GBUA 2PAJA 4UINH 4OD3L 4OLZH 5L4IA 1HH6A 2HWZH 3TVMC 2F54D 2BSTB 4LSSL 3OSKA 4AXWB 4BXSV 2DYRB 2X6CA 2NY0B 3S35H 5C0BD 2YOCA 3VCLA 2PTVA 2WXPA 4KKRA 1IQWH 1ECYA 3BZDA 3STZB 3HFMH 5CHNB 5IF0B 5HHNA 3W37A 3K4DA 4Z76A 2WMPB 4GQ9L 3L72J 1YNKL 4PY8I 4XPAH 1I3UA 4P23D 2F7RA 1GVIA 4PJ9B 5J1AA 2B8OT 3WTVA 4CGUB 4B9PA 5E9NA 4WEEA 2FJHB 4DEWA 4DCKA 3TN0A 1P84J 4X6EB 1JD9A 3Q05A 1ROWA 4GW1B 2K7PA 2X6VA 1J0IA 1VENA 3NCXA 4I2XE 4S2SB 1PFIA 2V6HA 4LEXH 4BQCA 2RMZA 5BOZG 1XCTB 5C07E 1OVVA 2IQAB 5GGSY 1G1IA 3C8VA 1HCZA 3VH8G 3MLZH 3PS6A 4MASA 2B88A 2WTRB 3IDMA 4RIRB 5HDQL 5KVFH 3VFWB 3FULA 2TRHA 2OTWB 5DZJA 1QSFA 1NCHA 1UYWH 2A9DA 4HOMA 3FPYA 4ZUVB 4F8TA 2A4CA 1H5BB 5JTWA 2B20A 2H8PB 2A9CA 3VWKA 3UZVA 2O5XL 4YBQC 1D5MB 4C58B 4MB5A 1HC1A 3PWNA 1FFPB 4NNPH 3GWJA 2WIMA 1T3JA 1IE5A 5CBAB 3B7TA 2BHFA 2BY3A 2AW2A 3SDYH 4NDMA 3RDTA 1G6RL 5HGHA 1CGSH 4KK6D 1UOLA 3NMDA 1HHGA 2L7EA 3BHBB 3QWOA 5D4QA 2NY6B 3PJLA 4NJAL 4H1LG 2A45I 2WKOF 4UZGA 3OW2O 1MQKH 1FLTX 2WXOA 3ESPA 4ZS7H 3L3IA 4XP6H 1RJZB 1M1XA 3S5LB 4M5ZL 2QM8A 2XTJD 5C08A 2D03L 5H2BA 4YAQA 4XCCL 1E2WA 3ZGIA 5C0IA 3AE7C 4QYOB 2AF2A 5I1AA 2CK3H 3ZYIA 3ZMEA 4N22A 2HFED 1KXQA 2ZWYA 1XGUB 1GSKA 3AAZA 4J3OF 5JQHC 1EFXA 5D2LB 4ELMF 3D30A 4KROC 1X7SA 4PJHF 2HPCB 4DP9X 4YTPC 3MJWA 4NAMA 4ATWA 2XETA 4MJ6B 3L2NA 5F44A 1CD0A 1OCWH 4ENZA 1UURA 3L8QA 5JNYB 4DP7X 3DX1A 4KRPC 1E5ZA 3KYKH 1CR9H 3FQYA 4FEMA 1H3TA 1LE9B 5LAPA 2LGNA 3OBAA 2BC4B 4JDTL 5AB1A 3SEPA 1XGRA 2NNAB 2F08A 4NGHL 1NAYA 1OGTB 4C7RA 2VDOL 3E2HB 3ILQD 3GHGB 1E4KC 5GIRA 3DI3B 1MEXL 2VERA 5EZPA 4WVZA 5FA3A 4G6ML 3RJDA 3I74A 4LVOC 2XQYG 4X8CA 5DLML 1SQQG 3TO4D 3HN8A 1JSYA 2Y6SC 4J3VA 4ZPVA 3H0TB 1HJBA 4HB1A 3CZFB 3OD3A 4J7RA 3CXHE 1M71A 2BNRA 2A6KA 3ECQA 1U2CA 3AWFA 3UCRA 4O2CA 5FECA 1GAFH 5MERA 1UB6B 2HLAA 4P07A 4DNLA 5LGHL 2JB5L 4UCFA 1JXFA 3QQ3A 1OIOA 1MFDL 4XHJD 2CDGA 4DVRH 5E5LA 3L1FA 1XF3A 3LIZH 1AXTH 4AQEA 1T66D 4N6RA 3H2QA 3ROOA 4XGZA 2VLKE 5DRXA 5EDSA 5KVEL 4OFYD 5IMLA 2Y0DA 3E7JA 4JFDB 2OTUA 1IAMA 4JREB 3RILA 1Z0MA 3JT0A 5DHYA 2VISB 3NEEA 4DP1X 1GOGA 1GYUA 2M5AA 1XGTA 3IJ7A 4P48A 2R3SA 3TGUJ 1GTFA 1MNUH 4NSKA 3SDCA 4PTUB 4M8QA 5ISZD 3IMWA 1I9JL 1N8OE 1OSPH 1NMAL 2FIKA 3F7YA 1TXKA 3IRZA 2X05A 3MRIA 3GMQA 5KJ7D 3R7RA 1MCJA 2WAQA 2WWMD 4LHUD 3BASA 2Z91B 2A45G 3AREA 2KNCB 1J8HB 4KUCF 1AI1L 2YD4A 4QHMB 1GC1H 3A24A 2YD9A 3WIFB 4FXKB 4BH8B 2R2EA 5K9KB 1FFNB 2CUHA 2R1XB 1A7OH 3K5BA 3C60D 1KTLB 3L3KB 3RBXA 5D6DA 1BOYA 1WS7A 1D9KC 4HLJA 2OP4H 2OQJA 1A22B 3FOMA 3VSQA 3H1KG 4TN9A 5DJDA 4KJMA 3H56A 1UEMA 3WIHL 1UT9A 2XWZA 4QXUL 4K3EH 1TQCC 5FB8B 2WXMA 5F3BA 2DAVA 1KPRA 1CTNA 2YS4A 5AALA 3D6GA 1BZ7B 4ONHA 3V2PA 5HTSA 4AK1A 1I8MB 4PG9A 4XO8A 4ERSH 5I73C 2V9TA 3VXSB 3ZE2B 2A4ZA 4CSZA 2FD6H 2ZXQA 2FAUA 2R4RL 1XXDC 4JKKA 4F58H 3WFHB 1TZOA 3MRPB 3Q8BA 3J07A 4WFED 5HXMA 1VCBC 3B1UA 2BS9A 1XGPA 1BWMA 2C34A 2OMVA 2FECL 3GKWH 2FBWC 9CGTA 2Z35B 3LKSA 4QEGA 3TF5A 3C5SA 3VGEA 5L4MA 4F8OA 3RX9A 1SVBA 4ODXB 2DQJH 1WA0X 2HRPH 3MODH 4MAYB 3TIEB 2BCCD 1X3DA 5BXFA 3K71A 3DTXB 1MJ8H 1BCIA 3C2AH 3L72D 4YXLL 4HC1L 3RZCA 1M42A 1F13A 3BE1H 1T5XA 2WQVA 1JTTA 4ZX5A 3FO2B 3WFBH 3OL2A 3L5JA 4K3DH 4ALAC 1NFKA 2GC7C 3IXTB 1P84D 43C9A 3KYNB 3DI2B 1JOIA 2GFBA 3HZYA 4BFGA 5BW7C 3BYTA 3GSVB 4OV5B 4R84A 4GH7B 3CLEH 4FABH 2BY1A 1UCBH 3NSXA 2NYYD 3NBNA 4HXAL 3FRPB 4OF5A 4HG4K 2G5RA 2FBRA 4Y1AE 3U7YH 1DQIA 4HFUL 4XPTL 2GY7B 4FTVA 2OFQA 4AQRD 2E5EA 3OMZA 3WE1A 2ZJSH 2M8XA 1L0LJ 2E76D 2IGTA 2P8MA 4X5WB 3CQPA 2RA1A 5I0DA 3QDAA 3FB7A 1E28A 1OAYL 3KBFA 1D5XA 4YXHL 1NWPA 3V0AC 3P4NA 1SFDA 5HHXH 3V4WA 1Y1UA 5DGQA 1A6AB 1MDAA 1N8RQ 1I9IL 5E5UB 2Q87A 3UIYA 3OKLA 3QH3B 2WKGA 4N26A 5GJTH 4F7MA 1DVXA 1SF3A 1VZIA 1NDGB 2BVTA 3L4YA 3TN0D 4TUKL 2ZCHH 2YMXL 5F1KC 2P2UA 1IVLA 2OYIA 1IGIL 2CWRA 1LHZA 1JGUL 3NJMA 3BIBX 4XVUC 1EGJA 3WLWC 5E1AA 3N40P 4XNUH 4F5CA 2HPTA 4ES9A 3W0WA 3FTVA 3I2CL 4XN5A 5E8DH 1X5HA 2IFGA 4IFMA 2IWGA 4LPCA 4XI5D 3P3UA 1DVFB 5GTIH 2R0WH 1I1AB 2YJLA 1QSFD 1GS6X 3ISWA 3MXVH 2EABA 3VXUE 2FWUA 4YDKL 2CSPA 3NFNA 5DZLA 5I19L 3AE8C 3VWKD 5BMFL 1Y18A 1KWGA 4JM2F 1U8PA 2X3CA 1PSKH 5CBOA 2VDLH 2N1TA 3OQ3B 3QG6B 1FFOA 1RZQA 5C7ZA 1Q4NX 2WCGA 5H94A 3RDTD 5I1IH 1I7ZA 2XA3A 1RK1A 2R2CA 1U3HA 1XF1A 5AKVA 4IRJA 4L8CB 1IC4H 1E65A 2L4OA 2N01B 4OZFA 1Z9OA 4UIMA 3HR5B 3WXVL 1NUNB 2ZFCA 2ORBH 4OWFA 4LF3A 2V33A 4HGKC 5DUJA 3DPDA 2VL5B 2YXMA 4PRAB 3D52A 2R23B 4PV1D 1P4IL 1QFOA 2X1XR 5FXCH 5C08D 3TNNB 3TBVB 2DQFA 1CK0L 3A4AA 2XFGB 5IB1A 3W1ZA 2F2HA 1SGKA 1SN2A 3NA9L 3QNYB 5D1ZA 1CLZH 1ZR2A 4CU7A 2OK0L 2E9BA 3SPCA 4N9GA 2VN4A 1KTRL 3FQRA 1YQ3C 4HOWA 1T22B 1F11A 1EFXD 4HCIA 4EIJA 5DQJB 2WW8A 3FT3A 3UO8B 2KP8A 1MXGA 3GLEA 1MOEA 4L37B 1WHOA 1MCOL 4HLEA 1FL5B 5ID1A 4OTXH 5HYJB 2NXYC 1J0YA 1E4WH 1VF5C 1CVSC 4UDTA 5D7IE 4CSSA 1AJ7H 3FUFA 5DUML 1NFDA 1RE3A 4X0KB 1KB9E 5C3IA 5GZOC 1T6WA 1EERB 4UBDD 2DIBA 4HCFA 5C2BH 2UYLA 4S0HA 4OM0L 2WYIA 4R4BB 3OLGA 3M17A 4DFIA 2P48B 1K6QL 1HILB 3V6OC 4IGBB 2BM3A 4PUBH 2J73A 5T8IA 3VNYA 3ZE1F 1SJEA 5HDBB 3WXWL 5AAWA 1FGVH 1BVZA 3J8F7 5DJTB 5GRUH 3DX7A 3C6LA 3IJEB 4GKNA 5I75C 5D5MB 4RO0A 4XPHH 5IKCB 3TGUD 4RNRA 1F4XL 1X6NA 3ILEA 4JDVB 4LSRL 5DURB 2IBZX 1OW6A 1PG7H 2IOMA 1RZ8A 2WLYA 4OLYL 3N6YA 3IKKA 4G5ZL 1F18A 1AE6H 3ZYZA 2BNRD 1GMJA 2HR3A 3IPFA 4DK6A 3QRGL 2UXGA 4RWYH 4S0SD 1LTJA 3I6KB 5D9SA 3H1LG 1KCUH 4JFPA 4OI9A 5DJAB 1VQ6P 3OPZH 1URZA 3QCVH 5ESQA 3SGKA 1AHWB 2VKXA 4WNJA 3ZL4H 5KBNC 3S6CA 3UBFA 4GMTH 1FE8H 3OKNA 2X2IA 1EJ6A 2H3XC 5BRPA 3LEYH 1KBVA 5I5MA 4BFJA 3IU4L 5F97E 1D7BA 5JMRA 5FUZL 5L2JA 2WBXA 5FA4B 1ZHLA 2KI7B 1X4XA 2C4FT 2QQQA 2YGOA 3CHRA 4R96A 4XMLH 1CBVH 4P4KA 4M8VA 3SDCD 4NZRH 5DMGC 1JE6A 1H0DA 1NIAA 4JFEA 1U42A 4Q97A 4LKXA 2PYEB 4TQEH 2ZG2A 2RBLA 4K5MA 4N86A 1LP9B 1FNGA 1TSHA 2ZICA 3LXAA 5DD6B 3T8XA 3AB0B 1U3ZA 3ARED 5CJ0A 3FCSB 5EFWB 3D7PA 5I74C 3IGUA 3BZ5A 3ZKMD 3UJJL 4W68A 2CJSA 2QA4P 1F97A 4LDCA 1PAMA 1DO6A 3D12B 3QXAB 1QFPA 3LN4A 4QHLA 3D18B 4NYLB 5EC2A 3RVTD 5T1LB 3U6XA 4XMZA 3QAZB 3MCKB 2PW2A 5DWUL 4R2GD 5DUBA 3R1GL 2J2ZB 2J5UA 1WBXB 5E4IA 4I3RL 5HY9A 3L17A 2FFDC 2XLLA 1EUTA 3Q6GH 5CIPH 3RU8H 4IBTA 3VUAA 3NFSH 3SGEH 3TYGH 3EAKA 4FG6D 5B39G 3KLHD 3R19A 2P4AB 5IEKA 3VXNB 4HWEH 4DT2A 2EDOA 1XSOA 1P84H 5DRNB 3L16A 4OGQD 2E27L 1A4CA 1QLFB 2VMEA 1SQPG 3PV6B 4ZDHA 3G5XB 2QSQA 4JQXA 1L0LD 1KQGB 3ARGA 4XWGH 2H41A 1BEYH 2AJZA 1L4AC 1RF1B 1M8OB 1MAMH 35C8L 3IGAA 2BP8B 1NJ9B 5DJ6B 5JW4M 4QRAA 1TJIH 3HRZC 4R7NA 5AENA 2ICWI 2I7SA 2FT8A 1K8IA 3EG9A 3RZCD 3TNMB 4JJ5A 4F2MA 4AM0B 3IJ8A 2QADD 2ENQA 5AAMC 3NSYA 1UWYA 5BCAA 1BMGA 4YDJB 2HT2D 4JDZB 2HA1A 1RIVL 1GY2A 3MXWH 1X5XA 1JCKA 2DBLL 1MWAA 4UB6E 3M46A 4ZXBB 3OKMB 3FZUD 3DX6B 3ARDC 5D7HA 2JKRM 1S9YB 4EF3A 3WFCH 3UBHA 5HDLA 1XQ4A 1YI2P 1DBBH 1Z3GL 5FK9B 2NW2B 4WY7H 1MVFA 4YGAB 1FDLL 4YHNA 1RFDH 4FTVD 2AEIT 5GS1A 3ALWA 4GS7B 1NKGA 4DFHA 2XTJE 1EPFA 5LAXB 2Y0CA 5FOBA 3QG7L 1Z9NA 3EBGA 3MRGA 4BSVB 2DQUH 2OCFD 4CMMB 2F54B 4NQEA 2VSKB 4U7SA 3UC0L 3OJ2C 4J2QA 5C0BB 3DSFL 1QTSA 4Y9CA 5C86A 2YWZA 2DQDL 2ZUQC 5D7IF 4AIZB 2PCFB 1R3JB 7PAZA 1ET8A 4U1GC 3V7MA 2P8LA 2K0RA 2Y9ZA 3P4MA 1TCMA 4Q8BA 1IC0A 1FRGL 4ODVH 3UTOA 4AJYV 4CADB 3NFQA 4RFEA 4P23B 2NRGA 3QW9A 2O6FA 5AW0B 1FAKT 4WSGA 2AK4A 3EOYG 4YR6B 5DJYA 4FI7A 3JTSB 4HUNB 1SXBA 4LFHD 1LTIC 3H1JD 4YDMA 5J12C 1DL7L 4HS3A 5IWLA 2O6DA 2QRXA 3W0WD 3B5GA 3HG4A 4MQXD 5ITFB 4PJBB 3LHAA 4S1DD 3ROLA 1GL4B 2DQGH 2P1YA 4TS6A 2K37A 1GGYA 3VFNB 4BRJA 2K1AA 4P59H 2ARJB 5AB0A 4I0PA 1YQ4C 3RK3C 4JR9H 5DTFB 1JGLH 5KYXB 3P73B 1H6EA 1EXJA 2XZAL 2CUMA 3LD8C 5F0MB 5IK3B 3BUTA 3SYAA 1E50A 1O6TA 5TDOB 2R1WB 3GIZL 1OCZB 3D06A 3ZUNC 1U93B 4RFNB 3FQUA 3FTWA 1W72A 3GI9L 1EZVD 1YMHA 4P2OC 1P7QA 2N1TD 2X2YA 4NO2A 2EKSB 3HE4B 3MRNA 5KAQF 3CQQA 4Z7UE 2B3IA 1RF0A 1ND0A 2QJPC 1GYVA 3DX9B 3HE7A 1R9FA 1U3HD 2Y5TA 2W83C 1RULH 2WQAA 2QJYB 3PGFH 4IRJD 4PCKA 4HK0A 2NY2D 3CLFH 3L9RA 3SGJC 4AQ8A 4BRYB 4C59B 5KVMC 3T0DA 1BX2A 5DJCA 1FNSH 3DYOA 1CURA 5HDWA 4PJCA 3WTYA 5FYJD 3VG9B 2P24A 4GMSL 4L3CA 3O8XC 4APQA 3VSTA 1Q9KB 5D1ZD 4NAJA 5JO5B 3T1FB 1ZS8B 3MLSL 4NRZB 5T1MB 1ACYL 3QDJA 4G7RB 3T3PF 4U1SA 3JWDL 5EO9B 4GUCA 1BHGA 3Q5RA 2Y07L 4LSPL 4M00A 1RU9H 4PLJD 4QT5B 3UYRL 1D5BA 5DJ8B 5CJOL 1EQWA 2Y7NA 3ECBB 1T83C 4LLQA 4XE5B 2D73A 2HFEB 3BPCB 4KXZH 4RAUB 1B4JL 2AQ1A 1T5KA 3BUYA 3AY4A 3M9BA 3SDXE 1G7IA 4ANXA 3QYMA 3HUSA 2J7LA 5DS8B 4Z0BL 1I82A 4P2QA 3ARFA 3KH4A 5CEZD 3H1IJ 1KFAH 2CQVA 2XI9A 3EYUL 4XAWH 4HUWA 2EAEA 4MMZB 2B5IC 2R0ZH 4HETA 2PXYA 3MN8A 3HCVA 2ZUYA 3MUY1 4RH4A 5DUPL 2ITCA 1TO4A 4G82A 3L1OL 4JYCA 1L6XA 4I4WB 3V5KB 4LOVA 5I24A 3SKOB 5DVNA 2X70B 2X88A 1EO5A 5JHMA 3RPKA 5LO7A 3SOTA 5JIDA 1KDJA 3C6LD 2FX7L 4B9CA 3K0YA 1K2DA 1MUJA 3LCYA 4HD9A 3ZT6A 4J1UB 4HX1B 1XV8A 2Y1AA 3ZGHA 4EDXA 3IK2A 1RZKL 4MMXA 4YSQA 1HCFX 3ORJA 2R32A 1CZ8L 3OAUH 5D2NC 1S9WA 3S1KA 3JVGA 3G4SP 1IZJA 5I6LA 1Q90A 1EZLA 4KPHH 4NZTL 1U58A 3EH3B 4I1LA 2AJ3A 2DDQH 2VR6A 2LXBA 2DEWX 3FQ4A 5JW4N 3GB7A 3GF3A 1NAMA 3GBNH 4HAGA 1V7MH 4TUJA 4QHUA 3FQNB 1DFXA 4XX5A 4IBQA 3RWEA 4EN2A 3AG3B 4GW4B 3CUPB 1X5KA 1U0QA 3V2RA 1NDMA 1AS8A 4FLHA 3U2SA 4PP1D 4ZFZA 3L72E 4F3FA 3NACH 3T97B 3I9IA 2JXMB 1R5IB 3LDBC 4YL9A 4CN4A 5LCVA 3Q0HA 1RZGB 1VKXA 1GOFA 1TF4A 1KJ2B 1FDOA 1X9RA 3DV6B 4N2OA 4P4KD 4HG4J 1IMHC 5E5MA 1G4RA 1TKWA 5KAFH 2EDFA 1T89A 2FJFB 4TQIA 4PJAB 3V9EA 1KIPA 1MCPH 2OJZL 3MROB 4JFED 2J25A 4YX2L 4HQQH 2GSMB 3FFCE 2PWHA 1T1XB 2KUTA 4XNYH 5HGGS 5ISZB 2IFFL 4Y1SA 3ARTA 3TT1H 1JNNL 2ICCA 1KWKA 1AS7A 1XCQA 2UZYB 1NCWL 1QNZL 3QZWA 3UTZA 3SWFA 2DM3A 4P2RE 4HHWA 1W2KT 1NOFA 1NL0H 3QK0A 4AJ0A 4OGYH 1VSCA 4N1HB 5ITBH 1M1KQ 3QNXB 3I6GB 5CJ4A 3MLUL 1HESA 2HSIA 3TBTB 2EDLA 1NKZB 1TO5A 1B3JA 4JCWA 3MCG1 3ZR6A 3M7FB 3TOPA 3CFNA 4QKXB 1AQ8A 1UTDA 4KNSA 4WW2A 4NAQA 4RCAA 3H9HB 3AT8A 1U8HA 5E23A 3RWHB 5C71A 2K3RA 1JZHA 5JLZA 4Z1PA 3LS4L 4PR5A 4ZW7A 1NCCL 1KORA 1Q1JL 2ISDA 3QE5A 2Y9RT 1BJ1J 1LE5A 1N5YL 1S1CX 2BY2A 2EDBA 3ARGD 2RCSL 3JXAA 4LKCB 4KXBA 4D0CA 1UM4H 1S7TB 1N7LA 2R7EB 1YYML 4IEFB 5E2JA 3TH2T 2VDPL 2LLGA 4IKNA 2GHZA 1GGBH 1OTTD 3N7NA 2V7NB 3ATEA 1KV4A 2CCLA 2XV6B 4P05A 1FL3B 3FT1A 2K6ZA 3I85A 3C6SB 1DDHB 2YAOA 3K7UA 4U6HA 4HMCA 5GGVH 3RTQA 3WY2A 2NXZB 3Q8AA 5IV2B 2BVOA 5CIPB 5KSAC 2OTJP 3T4AA 1FA4A 1NLBH 2PWDA 1A4KB 4NXKA 2EYSA 3VMNA 3NJFA 5FR3A 3H2WA 3MV8A 1PIXA 2IGFL 3BQUA 1FVCA 2MSPA 2I5YL 4K5NA 5L2KA 1DE4B 1DFBL 2FVNA 4P5MB 5F71A 3EGXB 1TT6A 4F9LA 3B2VH 2P9RA 3O6ML 5TE6L 3D5OF 1Z9PA 3KD4A 3CK0H 4QRRA 3IE4A 4JHAL 5C08E 1UA3A 1EGJH 2HAZA 5CP3A 5IFHL 5HHOA 1YAIA 2EE6A 2P46B 4G7SB 4KVPA 1WK0A 1ZT1B 3SDXF 4NQED 4U4BA 5IJCC 2E76B 2V9RA 5E70A 2V5TA 2K9FB 1TZ8A 1KXQE 1TJGL 4M1DL 4UQDA 5HHNB 1WBYA 5L88L 4Z76B 2AAAA 3EJCA 2CHDA 1T21B 3N44F 1PNDA 2NZ9D 2HXAA 2XWBA 2J1WA 1WZMA 4PJGA 3CMOL 4PGDA 2AK4D 5IOPA 3GTTA 5T33L 4KWUA 3DO7A 5C7XH 1ERNA 3TN0B 2WTOA 4OIIL 4GODA 4XNMB 1MG2C 1CN4A 2JKLA 1RIHH 3H9SE 3B8SA 4XXDA 2AVGA 2VDMH 4EZJA 1SFCC 5L9DH 4CSTA 4I88A 1AGCA 4D8OA 2QGCA 4N0UE 5ICZA 4I0PD 5DMIL 4GG6E 1SFHA 3H42H 3VWJA 2C9QA 5T3XE 1U4EA 5FYJH 3V4PH 2I69A 1S9XA 1DD3A 2EH8H 3BDXA 5B3NA 1WT6A 3ARZA 4LSTH 4Z3GA 3BFWA 1QSFB 3S3PA 4AJWA 5I1GL 1Q9WA 1V8HA 5EU3A 9PCYA 4FDWA 3F58L 2EVJA 4EI5A 5D1QD 5I15L 1P7QD 4WV1B 3RJOA 5GTHE 3UZVB 3GLMA 3D87B 3PWNB 4L5FE 2XKMA 2PCXA 5CLXA 3BYYA 5LHDA 2OBGA 3QEHB 5FFOA 4NZDA 3HE7D 2G5BA 2MJWA 3TL5A 3X1BA 1BD2A 3FONA 3P77B 3H1ID 4YK4B 5I26A 4KXCA 3BKCH 1OZUA 4NDMB 1JRHI 2Y0SA 1GJIA 3ME0A 1IFHH 5HGHB 1OARH 3L54A 5GS2D 4OZHF 4UINL 3ZE0B 2VJXA 2HWZL 2ZX8A 3QWOB 5GJSL 3C5ZC 3KWWB 3S35L 5CEZH 1VIWA 4PJ8A 3C75A 4PJEB 4APQD 3MV01 3NJVA 5E6ZA 3HFML 3L3IB 2N1KA 4NUJA 1M1XB 1ZPLA 2VR5A 2RD0A 2XN9A 2APWA 3QDJD 4YAQB 3MRMB 5TFSH 3FTXA 4HGMA 5DO2C 2UX7A 3HUJE 3RNQA 4XPAL 5I1AB 1S7WA 2E42A 3L3GA 3QIWA 4FTDA 3ZDYF 5B3JE 5D70L 5KN5A 3D4CA 3U30B 1NSNH 2J8UA 5CGYC 3VDAA 4BDVB 3AAZB 2YSTA 3RUGB 3VX0A 1DN0A 1EFXB 2QIWA 1NTDA 2XG4B 1WEJL 3ULSA 1XGQA 4KV5E 3QIUA 2F19L 5CCGC 2JI3A 3FT4A 1KN2H 2JQMA 1WAEA 3ARFD 4P2QD 4LEXL 1MFAL 2B0SH 1AANA 4Y28J 4JZOB 1KLGA 2PXYD 5B1JA 4LRIA 2APFA 4XTRC 3A3YB 4HUVA 1YPZB 2O1KA 2WBKA 3RVXD 4CNIA 1XGRB 3MOBH 4KK5C 2QQNH 1DUZA 3WGUB 1S7SB 1TQUA 4R4FH 2NUPA 2BW5A 4P2YA 2VLLB 3IGFA 2XPGA 2E9IA 5IQLA 3IAQA 3B37A 5D7KD 2UWEA 3UP1A 4A7GF 4NNPL 4TV3A 3I02B 1CICA 1FJ1B 3WHXA 3KHUA 2A4EA 5EUOA 4OI8A 5ALCH 2ZZUT 3QBTB 4MLSA 4ZPVB 1Q90D 3SDYL 2OI9B 2Z9TA 3FSZA 4N85A 4PRHA 5AB9A 1CGSL 2BNRB 5FECB 4O2CB 2P5WE 1L0LE 2ZXBA 5IB2B 2Q7AA 1MVUB 5JA9A 4PWFA 5DCCA 2A0LC 3QR2A 5SV4A 1WT5A 3QQ3B 4XP6L 2VQUA 2CDGB 1F00I 3IFLH 3JWNG 3OB8A 1TEGA 3P3TA 3T08A 1WP6A 3EYVA 3JV0A 4UV4H 3FQ1A 3GW6A 3BO8A 3PXLA 4XBMA 5F0LB 4ZBJA 4A7PA 3SCMA 5JW3H 3P1VA 2LLNA 4E9VA 2YAQA 3AXLA 4K4KA 5TGBA 4YBHA 5IMLB 3PUUA 3J2PA 3KLQA 4FLQA 5F7MC 5IP4A 3SYCA 3B43A 2M5AB 3QQ4B 3GS0A 2XWCA 3SDCB 3GSRA 2AQ2A 2CIKA 4X2UA 4GXFA 2VM3A 4HIXH 2WBJC 3SPVA 1A02F 1QBMH 3TTSA 1OCWL 3BP5A 1IKOP 2FIKB 2Y2YA 2ZXAA 1OAXH 3F7YB 3MRIB 3GXUB 2KERA 3P9MA 4HZLA 3X14A 1PJ9A 3KYKL 1BCCJ 3GHPA 3DWTA 3AREB 3DHUA 3GBDA 3HA0A 4M4RA 2WM0A 3CWBG 1C16A 2P80A 2D3NA 4JFTA 2RFXA 1EEYA 4ZODA 2R2EB 4DETA 3MUZ1 2AXTH 2AERT 3LEVH 1MRCL 4HCGA 2X2JA 5BQDA 4AQZA 4R7XA 4HDIA 2GJPA 2D2OA 3EYSH 1UJ3C 3OGOE 5KYYA 1OGPA 1XO8A 4JO8A 3FOMB 2Q2EB 3K3QA 5AG8A 5E1QA 4GAJL 4YEEA 3OXSA 3RY6C 4R2GB 4Y2DB 4FQHB 1KPRB 1OEZW 4FCHA 4YSSA 4GG6F 4ONHB 1WFUA 3GQFA 1GAFL 1UA6L 1GYAA 4P9HC 4PG9B 4OKVA 4TTGA 2JKNA 2AZUA 4LESA 3W0WE 1A6PA 1MWAH 4OZGA 2UV3A 1PYWA 5DD0H 1IVTA 1VQ9P 2I85A 2E59A 2VOTA 4HU8A 2BVYA 4XP9H 3LIZL 1AXTL 4J8RA 1XGPB 1DLHA 3SPJA 2OMVB 3IRCA 1HVVA 2YUXA 3LKSB 5AOZA 3US0A 3C5SB 1A7BA 2Z6FA 1FG9C 2UY6A 2K3TA 2ERJB 3K71B 3A4FA 3U1QA 5BXFB 3ILDA 3RTQD 4B9ZA 3BW9A 1LVEA 3ESMA 4X9HA 5CR8A 1IB5A 1EZVE 1T5XB 3L3JB 2CGRH 4UOW0 4XNZC 1MNUL 3HRPA 1USDA 1LWRA 2QADB 3C5JA 2XVKA 1OK8A 3BQUD 1OSPL 2ZF9A 3QIBC 3SO3B 3TJEH 5L2KD 4I7ZC 4QXWA 2IANE 3U46A 43C9B 3TWCH 1BZEA 3PHSA 3HZYB 4WI3A 3QFDA 4LASH 4NQDE 1R3KA 3HUJF 4AIOA 1DEDA 1T2XA 2NOYA 2JP3A 1ZA6A 3BWSA 1R19A 3MYJA 1GC1L 4QRRD 5B3JF 3QH9A 4KQ0A 4FXLA 1NGMB 1BJMA 4FTVB 4NKQB 4IOFC 4QRSA 3PWVB 2GUSA 1A7OL 4LOUD 3RWCA 3WMQA 4KV5F 1INDH 2P8MB 3LZFH 1NBCA 2OP4L 4H0HB 4H0LD 1DANU 1YY9C 4ECNA 8CGTA 2HPOA 3I6SA 3FB7B 3MZWB 1E28B 4LAJH 2VSCA 3IJHB 4K3EL 1ZKAA 2EDYA 3E1F1 1JFQH 2WOYA 3EYOA 4FQQB 5DFTA 2LTQC 3OKLB 2EEXA 4ERSL 4QHNA 1CFNA 2I07A 2EUZA 2FD6L 4Y4KC 4F7MB 2LQRA 5CZVL 1PKOA 1ZT7A 5CCHC 1ASQA 4PRNA 1FC2C 3HHSA 4WWPA 2CLRA 4F58L 1J1XH 2X4TA 2BHUA 2OYIB 1NUFA 3HKZA 4XCEB 3GKWL 5CWSA 3VN0A 2BK8A 4NQXB 1FNEA 5E1AB 5F0JB 4BA8A 3ATAA 4YHMH 3JC22 1SVCP 1KC8Q 2QFRA 5GS2H 2DQJL 2HRPL 2QHRH 3FUJA 3MODL 5CBNA 3ML9A 2XNDH 2P7TA 3QUMH 4PI0A 1MJ8L 4XCNA 4DO6A 5AW7B 5F7BA 3JWNC 4FEIA 3BE1L 4L8DA 1UT2A 4WI7A 2YMOA 4EIZC 3IJ9A 3NAAH 5HPMB 4M6NH 2R0LH 4Y9FA 5E5RB 4BFIA 4EQ2A 1P7HL 4MJIA 3MRKB 3BT2H 3W9EB 1TTAA 4Y9BA 2BDNL 4J4PC 3APCA 1U8PB 2L91A 3S8GB 1BD2D 2N1TB 5TISE 3EJQA 2IXQA 1WWBX 3M9QA 4JFYA 1K5NB 1VL2A 2J55A 4GUPB 2OZ4A 4PP2B 3SY6A 2AEQH 2D3JA 2KS1B 1U3HB 2VDMB 4HJ0C 5J8OA 3IFMA 3UJIH 2NY2B 4ZMQA 5EF2A 3ABGA 3CSYB 2O01N 4PJ8D 3CXDH 1Q94A 2IJ0C 4LF3B 4XXWA 1XTLA 4JKPH 4YSOA 3S0PA 4H25A 5I8KL 2XN9D 3V4PB 4KZDH 3LKOA 2BWDA 5CMAA 2DQFB 2WK2A 6PAZA 4KKCC 2NLJA 4NKOA 5D1ZB 5I16A 3QIWD 2QVTA 5B22A 3R4YA 4R7DA 4N9GB 2GY5A 3FQRB 2JKIS 3V7AE 4OLWL 5EF1A 3PABB 2GIXA 5F7DA 1SLXA 2ZCHL 1SHWA 3FT3B 3AMKA 3QIUD 4JQVA 3U2IA 3SDDA 2VJ8A 4KKAD 2YQ2A 5ESVA 1EEQA 2EVIA 1OP9A 1J1EB 4ZW5A 4WDIA 1I9RH 1LEGB 4JHVA 3BDBA 2H6PA 4XNUL 3VMOA 3MUDC 4L4TB 4AITA 5HD8D 2FHCA 1N0LA 5ID1B 4UDTB 3MV7E 2BP0A 3I9PA 5E8DL 4A2EA 1NFDB 1U8JA 5T1DH 2OL3A 3S9DB 4F92B 1JNHA 2UYLB 1KXTA 2R0WL 5FGRA 1X4ZA 3Q2LA 1JCCA 4PWJA 5F7YC 5GRYA 3MXVL 2X1OA 2FB4H 3B4SA 4POZC 1IIKA 3GIVA 2W88A 4M5YH 1SJEB 1CI3M 1T04A 3SN6N 1SQVG 2Y7LA 4N8CH 3DX7B 3C6LB 3B4NA 3EADA 2NY4D 3ZO0A 1B4LA 3OXRB 4GKNB 5LCVH 1CICD 1PSKL 4RNRB 3NEOA 3CPWO 2VDLL 3ZLQC 2DWDA 5B7FA 2Q3EA 1DVTA 3ZTDC 1RZ8B 4I1RA 2EKJA 4PRHD 3EO1A 5KSVA 3SQOH 3WL9A 5E94A 1IC4L 3VXPA 2UWJE 3LB6C 1LTJB 2V2XA 3Q9PA 4DQOH 1MIMH 1SBBA 2ORBL 1BJ1H 5D9SB 3RI5F 2DTMH 4JFPB 3O4LA 5F96L 1KYOD 5ESQB 3BCCJ 1VLXA 3RIKA 1IBHA 2YPVA 3O2WL 3SCMD 1SUJA 1CLZL 2WCPA 4F2ME 1UASA 1CUOA 2Q86B 4KQ4H 4RZKA 2AQTA 1EHLH 4Z3FA 4RSYA 3BUDA 4LSQH 5CCKL 2MNJB 3U2JA 3CCLP 1F58H 2JTYA 1PDKA 2BRRH 4R96B 4KVCH 1K85A 4P4KB 1I85C 4G8FA 4HZ1A 1Q9LA 2VJ0A 4ODHH 1H0DB 1PCSA 4XO3A 1D5IH 3VFSA 4Y99B 4JFEB 3K8KA 3N55A 1AS6A 1IRAY 3QZPA 3PHQB 3S98A 4Y89A 1KCSH 3CCSP 1AJ7L 1RSFA 1FNGB 1JXJA 1MHEA 3TPUB 1H3WM 3FB6A 2H9GA 2HTKC 5C2BL 3VFRA 2NY1D 1Y0LB 2P80D 4FC3E 3L75J 1ZLEA 3JWOH 4PUBL 4BQBA 2QMJA 5H8DA 4W9CC 1KFNA 4LLMA 4UQ2B 3LN4B 5GRUL 2PO6B 1ILUA 2CMRL 1IGJA 5A2CA 4AQEB 4XPHL 5J0BA 5I66A 1XMEB 1KENL 1RUAH 4H1LB 1NGYA 1AD0A 1QP1A 4Y5YA 3ULVC 1G87A 2AK4E 3BGFB 1AE6L 1HWGB 4X5LA 1OP5K 3WTTA 4L8SA 4RWYL 1RE4A 3L71J 2E74C 1BM3H 4DOHE 4WI6A 2G3AA 4JG1H 1KCUL 5KS9E 1AACA 3QCVL 3HFFA 3BP4A 2LAGB 3M86A 2IDSA 4RMRA 1FE8L 4ZDHB 4AGQA 2QQLH 3S36X 3ARGB 3N42B 5LWYL 5HYSG 4KNUA 3IGAB 3GMLA 4DESA 1FAIH 3K81A 3LEYL 4JPWH 4QTIL 3JZ7A 2C8NA 1WFMA 5AOKA 4IKKA 2NYKA 4AWJC 3QT2A 1K8IB 2IPKA 3VD2A 6PCYA 1P5UA 3BH8B 4JJ5B 1L0NG 4YQXH 4XMLL 1MFMA 5D1QE 1ZCRA 3LPFA 4NZRL 4ZW3A 4IMLB 4WTZG 3SE3C 2AZAA 1E5UI 2GJJA 4IK7A 3VI4A 2YBRA 1BAGA 5EZOL 4ZG1A 3H1IE 1FWXA 2YGVA 4K7FA 1PD6A 3U9UA 4IRSA 1MWAB 4K3HA 2Y06H 5A3IC 2G8YA 2P42B 3C09C 1S78C 5EZIH 4PJCE 4R4ND 1SLWA 1KILA 2XSKA 2IQ9L 3DETD 4QHKI 5GS1B 1SOXA 4GT0A 3KMDA 3QDJE 2FGWL 5DEFA 1EAPB 5FLUA 4NQEB 1T5WA 3QZLA 3A4DA 3PLNA 4U3FJ 4GKZA 4WI5A 4CBPA 1UD2A 1PJWA 2BFGA 4N2CA 4XO4A 3RX5A 3SE8L 3T3ME 3RU8L 3D3VA 4FGMA 3NFSL 2P8LB 3TYGL 3P4MB 2XQYK 4J3XA 2AQRA 4HWEL 4KO6A 4ATTA 3FGAD 1AGDB 1IBBA 4QRUA 3TH4T 5DJYB 4FA6A 5FYKU 4GT1A 4OQTA 1QLED 4HJ1A 1HIML 1BEYL 3AM8A 2E4FA 2J5WA 4J6RL 2WSDA 4HIPA 3ZSSA 3L35A 3ROLB 1L9SA 2DV6A 5EEYA 4CN1A 2CJUH 1OE1A 4FQJH 3CZJA 4BHUA 4I0PB 3KPNA 4YHIB 1NTMG 3ECUA 4IDJH 5ACMA 3OVUB 1P7KA 4GIOA 1VQMP 4KVNH 4MJID 1RZ7L 1WCQA 1YECH 4EXPX 1GOHA 1X7TA 4P46A 4PW9A 3MXWL 2GABA 5HVHC 4KRLB 3FQUB 1OWAA 1U36A 1P7QB 4NO2B 4UI2A 3WFCL 1DBBL 1ND0B 4WY7L 5HGDA 3AJ7A 2FXPA 2K4WA 4O4YH 4I18C 2Y5TB 4AUJA 8FABA 4WTXA 4HK0B 1QSEE 1WJ3A 3L9RB 4K9EH 3GXDA 3L4CA 5A40E 4FQIH 5L7XH 4HS8H 5EULV 2SEBB 1LO5A 4XMXA 3PJSK 5DJCB 2WGXA 3QUMB 1M7UA 2A74B 1W8NA 4J39A 2OS7A 2P24B 1R17A 3FU7A 3L70D 4L3CB 4APQB 1MW0A 5APSA 4G71B 1UVQA 1FOSE 3UCQA 4E42A 3NABH 5LJYH 2JO1A 4U1SB 5DHMC 2M1KA 1ICTA 4ODVL 4Y8DC 2Q8BH 1D5BB 1IE4A 2GSIA 4ETQA 3P8CD 3NDYE 4LLQB 1FFQA 2C1OA 4NS0A 3SDDD 2GTWA 3OAZH 4RX4A 5ABZA 5EIIG 1R3IH 1NLDH 2J8HA 4HKJA 5L8KB 4EI6A 1G7IB 1IFMA 4D8PA 4QNPE 3HUSB 1T3UA 3W9DA 4P2QB 3ARFB 4TSAH 8PAZA 1BQHG 3BCFA 3QI9C 1C12B 3IWUA 4PS3A 2DQGL 1QHPA 1OALA 3I9AA 4HUWB 1UB5A 3ZZ1A 4BFBD 2PXYB 1IC5H 1IAIH 3HCVB 2GSGA 5F7EH 5D1XE 4JR9L 4Y5VA 1JGLL 1KYOH 2ZWNA 4FFZA 3JZYA 4YWGH 5KS9F 3CZGA 5GGTA 1N67A 1QL2A 4CVZA 5IG7A 4KUZH 3BJ91 1GL2C 2Z0BA 2FECI 2YKLH 4B5ZA 3QFJA 1K2DB 2FYUG 5IBTH 2I9LB 4GOEA 1MUJB 1FC1A 4D0DA 3GXNA 1JY2O 2WXKA 5I6PA 3APFA 3OG6B 2HT4D 1V55B 1ZE3H 4MMXB 4Z7VB 5B38G 3DIFA 3NTNA 3MNDA 4O5LH 1S9WB 2ZKYA 1U8QA 5B8CC 2HH0L 4L3EA 4QAWA 1PP9G 3RNKA 1FNSL 1HXMA 1U58B 4ODSH 4YSCA 3O4LD 3EOAA 1ES0A 2GITA 2J5LB 3GB7B 3MLXL 1ETA1 4TUJB 4WTQA 3RY4A 1N2RA 3RWEB 4HHGA 2CO4A 1BIHA 3MTRA 2J56A 2FDBP 2X6BA 2HLFC 1NDMB 3DLQR 5I8EA 3U2SB 2V2WB 2QTEA 4KJQC 4F3FB 4BUHA 4HCRH 3CCRP 1M2VA 2ZOKA 2D8KA 3QUYA 2W8ZA 5K5GB 3L81A 3Q5YA 5DFVD 4XNXH 3WNOA 4WNQB 1VKXB 2EECA 1IAOA 5L2KE 1PL5A 4XRCA 5CJXC 1ZS2A 5E5MB 5GS0D 4WI2A 1IFPA 4LGSB 3G04B 1ZTXH 3DVGB 1KIPB 2CRMA 1FYTA 1SM3H 2Y5QA 4WY4C 1NCGA 1LILA 3M1BA 1H6FA 1JS4A 1KFAL 4XAWL 3VM7A 2XXGA 4LARH 2R0ZL 4LVHC 1YJNP 4ASVA 1LWUC 1XCQB 3QZWB 3UG3A 1N59A 4FFTA 2ZXGA 5JZ7C 4U6YA 4C57C 2VDQH 3O0RH 2P8PA 1DSFH 1WCBB 1PIGA 3QJQB 4WGKA 4JW3A 4A2GA 1PZBA 3OR7A 1IGCH 5DHEA 5EO1A 5J3HD 5TQ2H 4DEPC 2OM5A 3GBML 1CGWA 2FNWA 2XFXA 4PJGE 3DYMA 1QFWH 1N73C 1WZ1H 4PY7A 5HGAA 3OAUL 4WW2B 1HWHB 2OSLB 5EEZA 4XP1H 2CDEA 1A6TA 4H2CA 1U8HB 5EWIH 4KPHL 4JAMA 3GF7A 3GSWA 4X6FA 4AL8H 5EU5B 4WFFD 4AV0A 4PR5B 1LE5B 2H32A 3OPUA 5F7AA 4UILH 3T0EA 3AWEA 3S37X 1OM3H 1MJ7H 4OKDA 4D0CB 3NJLA 3AW5A 4Z7NB 2X4RA 4ZD3H 1GKOA 1OP3K 4ELKA 3LW5J 3FFDA 3NACL 5I0YA 1U57A 4H8PA 3C8KA 3EXJA 4L1BA 4EUPG 3KVPA 4U3FD 1Y6NR 1D7CA 1BXUA 3BKMH 3EGSA 5GGSA 1HL4A 5IROA 4XPBH 3NZHL 4U6HB 3LV3A 1PY9A 3QWQB 2BVOB 1MCPL 1TVBA 2E7CA 3L5HA 4HQQL 3ZL2A 2EYSB 2HJKA 4AKQA 3T65B 3SGDI 5GISH 4MS8C 2Y69B 5B21A 3DGDA 4IRSD 2FEDD 3MV8B 3L45A 1E4KA 3P2BA 3BQUB 4XNYL 4DH2A 3TT1L 3T6WA 4HT1L 3O6FA 1FOSF 4H8HA 3ZVVA 5C6WH 4HUCA 4ZYKA 3BXNA 2EH7L 1KILD 3IRPX 3MOQA 4I48A 4WRLA 4M7JH 5I9QB 1QLEH 4QRRB 5DEGB 3EFOA 1F56A 5IBUG 5ANMA 3VI3A 1JNMA 2OMXA 5ITBL 2PWFA 3X11A 2UZPA 3VXRA 5HHOB 4JKWA 4HWZA 5I28A 3ETTA 4N0CC 3AS0A 3VRLF 1QWHA 3ET9F 4Q4IA 4ELMA 2ITDA 4FMFA 2FBOJ 4H0LB 3O81A 4MX7B 4FFYL 4P2CG 2J20A 3CMAP 3TZVC 1WBYB 2WLKA 3D3VD 3DECA 1F3RB 1PNCA 3EDEA 4GYBA 1BQLL 1I8KA 2XWBB 4Z95H 2XYBA 3BEWA 4PGDB 2CJ3A 2KBGA 3BIKA 5IOPB 4HHAA 4W1TA 3DO7B 1ODAA 4NJ9H 3ULUD 3N04A 2WQ8A 1VPOH 2YIHA 2YRPA 1OSZA 1UM4L 1LK3L 3I6LD 4XXDB 1JPGA 2OZ4H 3KG5A 3Q2VA 1GGBL 2XWTB 4ZAKC 4C83A 2YKPA 3TJHD 3IDNA 2WAHA 5ICZB 3GMRA 4C7NB 3VWJB 1C9SA 3AE9C 2B08A 1FZAA 3DBSA 1S9XB 5IUSA 5E8EA 2VRQA 5LNGA 1AY1H 1NLBL 3UO1H 5JHAA 1YMME 3RVWC 3QXUA 4P46D 4WUUE 4WEMB 2K4AA 1IO4A 2LU3A 5DS2A 1HDMA 2FJUB 1EC5A 3CHPA 1EEZA 4OCRL 3UABA 4JPKH 3CCQP 4PWEA 1BCCE 2AABH 1S5LE 4AYCA 5HI4D 3S3JA 3CCEP 3B2VL 4WJ5B 4WU7B 2G5BB 2FLBT 3F6JA 2K8QA 1BD2B 3FONB 4GSDH 4OFKA 1Y6KR 1ZHBA 4ONOA 4KITB 3L5XH 3CK0L 4IRZH 3VMYA 2YD5A 1BVNT 3ME0B 3OMNB 4U3SA 2JKVA 4KFZC 3WTSA 2GM4A 4ZMZA 3BZFA 4M56A 5I82A 4PGEA 5B39B 2I1JA 1J9CT 1W0VB 1XVSA 2WXRA 4PJ8B 5SX4H 3UPRA 1VQNP 2OL3H 1KOAA 1NEZA 4NUJB 2LVCA 2XN9B 2DI8A 4JO2H 1ZJAA 3UTSB 3ZMRA 4BH7A 5BU5A 4IBWA 1O7VA 3U6XS 2Y3NA 4KO5A 4H44C 2WQUA 3RNQB 1S7WB 3QIWB 3WTXA 2XDHA 1NTZG 2VLRE 2EC8A 5I1CL 5I8OH 3OB0K 1J9RA 2J8UB 5K59E 3U0WH 4RX4D 3UH8A 1DN0B 3Q06A 2WINA 3ULSB 1XGQB 3PIQA 3QIUB 1RIHL 3EO0A 3VFUB 2R69A 1UXWA 4AMWA 1ZSHA 2FT6A 1H8LA 5FW6A 1A6VH 5L9DL 5A2FA 3VD7A 5A1AA 4Z18A 1Q7YQ 1EDKA 3H42L 5L8LB 5M95B 5BZDB 3B6SB 5HHPB 3DVNB 5FYJL 5A2IH 1ZRTE 1S7VA 2EH8L 4M5SA 4XN8A 1EAOA 4Z3JA 3QWRA 3L1GA 3QJTB 4CNIB 5FHBH 2YPVH 1Y07A 2O30A 5HHVH 3P4OB 3FUDA 3RWJB 2F8XC 3QFJD 1GW4A 1SQXD 2YR3A 2FYZA 2CLVB 2XPGB 1G7MA 2D2CB 2CPUA 3LRSA 2G75B 2UWEB 4MZIA 2GUVA 4N6JA 4JFOA 3WN6A 4LPYA 3JTBA 1CICB 4H4NA 1RIUL 2AEOA 4AOFA 2OYLA 5EUOB 1TMQA 4Y7MA 3BKCL 4OZGE 1MHHB 1UG9A 2Y23A 1IFHL 4FYTA 1TENA 1OARL 4L3ED 4PRHB 3QUXC 3WEAA 4YXDC 2CA3A 2I60L 5JQ6H 2MWCA 3NSDA 3PDGA 5CEZL 1P9MC 5JUEH 5DRWA 3HJEA 2Q1KA 1G43A 2R29A 3FH8A 3LQAH 5TJHA 2EXYD 3NYKA 4H26A 4IFDK 3S7GA 3VVVA 1UFUA 3SKMA 3EYVB 5LKNA 3A0HH 1LP9F 4D9QD 5TFSL 1N5AB 2OJ1A 3KL3A 3SCMB 1OGAA 1OHQA 3QUYD 4U0QB 3IWVA 4X9YA 5TGBB 1NSNL 4ETYA 1RUMH 2BERA 2QELA 2OYPA 2FO1A 4MXVF 3H1HG 2WPRA 1GA2A 3MLPA 3KVQA 1FYTD 4G8GA 4ZRGA 1KN2L 1A6ZA 4AJVA 3GSRB 2B2XL 2CIKB 3FUMA 1E3ZA 3GXTA 3SPVB 2JK5A 2B0SL 4PS7A 1U8OA 1YUHB 2Q20A 3BP5B 2QZ5A 2IV9A 3P9MB 4FKHA 2ZXDA 3OHXA 3X14B 4PY8J 1Q0YH 2W07A 1IC7H 4M4RB 2E5YA 2N59A 2Z5HA 3OMIB 2VDKH 3ZK0A 2EIMB 2QQNL 3WLBA 4D9LL 3D4YA 3RBZA 4L9LC 1EEYB 1U7JA 5EORH 5BRZA 5HJ3A 1G84A 1U8IA 1YA5A 3HG1B 4GNKB 2B1AH 3A0OA 3HAEA 4HDIB 5AOMA 4QCIA 1GJUA 5FGCE 4Z77A 4AENA 1RUQL 1CD8A 1TTCA 1H8SA 2HP4A 2ZSVB 3G08A 4UUJA 4UANA 3LVEA 4ZOCA 4AUYA 3OXSB 3PJSA 1BEXA 5ALCL 2BCMA 5H37G 3VTPC 5TE7L 2V2TB 3ZL1A 1T1ZA 3QRLA 4G83A 3BFQG 4OKVB 3IN2A 4UIKH 4LLDA 2HFTA 2AP2A 2AXGA 3T0ED 4XFJA 5KVGE 3T6VA 3IFLL 1PYWB 1KBKA 1UZ8A 2BSRA 2D7QA 4G2AA 3UBGA 2UX6A 4KH9A 2X12A 4J8RB 5KLVG 2HT3C 5JW3L 2XKUA 4N5EC 1KG0A 3POCA 2VQ1A 4NERA 1FUNA 3D08A 4K8RL 3EBIA 4UNIA 3V4QA 3SJVA 3D39E 5IROD 1X5ZA 2E43A 2UY6B 4KRPD 1HHKA 1ROCA 1NPNA 4KJPC 4PV9A 3F2LA 1QWUA 1UIIA 2ADYA 4H20H 2DMCA 5EOCJ 4C56E 3GZPA 3QEGH 4K07A 1KIUA 4ZFFB 2XUWA 3FTSA 2Q3IA 1LDSA 1S9KC 1E6OH 1PW3A 4HIXL 3C5JB 4XBPA 4J3TA 3VFMB 4BJLA 4W9FC 1QBML 3N4XA 1NU1D 3EFFA 3M91A 3U25A 3ZR5A 2X4OA 4UQ9A 5IT2H 5LLIC 3O6FD 1OAXL 3U46B 3BN3B 1JB0J 2OYHC 3OKOA 5I6NA 1UFGA 5LXGL 1V7NH 3QFDB 3AE3C 1R3KB 1GZHC 1JHKH 2Y6SD 4OQTH 2I24N 3FO0H 3ULUH 1U7MA 3RFZC 4KX7A 4NBZB 3APMA 2JLLA 4JY6A 3H25A 1JD7A 3LEVL 5MEOA 1ZVYA 3L48A 4QRSB 3RWCB 4E5XG 4P0DA 3EYSL 3ASNB 5C92A 4RDQF 4BIKA 1M7LA 3G5VA 5APXA 1G9MH 5F6IB 3QJXA 4PJBF 4R5VA 3S97C 3P8CE 1ZLWH 4EI2A 3EYOB 3VGAC 4LSDA 3KLLA 1H3PH 5J6SA 4F7EA 4QHNB 2XG5B 3JCUH 3PFQA 2I07B 4PG2C 5IHWA 4LVNB 2WT7A 1MWAL 5F9DC 1ZT7B 4EDFA 4LHQB 3BP6A 4M5TA 2CLRB 5DD0L 3BCCE 2X4TB 4YNYA 4DERA 1FCCA 5F3HA 4FKKA 2OTKE 4JLRB 1PGOA 1KTJA 3ENEA 4Q6KA 5D96C 1I75A 1BFVL 4TXVB 1N9PA 4X8JA 5CWSB 1FNEB 2KPWA 4OCYH 4EZLA 5KYNA 1L4IA 1M9WA 4MDRA 3IMTA 2P7TB 4GRLA 1BGYJ 1OW0A 1N6QH 1N6UA 1I8AA 5C1MB 1CO1A 1U2HA 1WTGT 4L8DB 3KAAA 4CILA 5FM5M 2J43A 3A22A 4MJIB 3ZU8A 5EB9A 1ZXQA 2W90A 3C9IA 2XXCB 3TJEL 5J56B 5AW5B 3TWCL 2NNCA 3ZZLA 1L3NA 2NSXA 4PTTB 3ZDZE 4LASL 2IXQB 1GU4A 3GSXA 2WVUA 5SX5H 1UWXH 5BOPA 4K7PH 3L75E 3S34H 2FFDA 2DQHH 1CFVH 5CP7A 2IO5A 3UAFA 1M6UA 1ZLSH 4HGWA 2OA9A 1ETJA 2EICA 3LPGA 2XNAA 3LZFL 3CHQA 4NN6B 5E1IA 1Q94B 2ESVA 4YHYC 4H25B 4KTGA 4FF9A 2WVTA 4PD4D 1QRNE 5DJ0A 4RA3A 4U0RB 1NFIA 1FO0H 1P6WA 1R3HA 2JJSC 3EHBD 1FZGA 1JFQL 2A99A 4FFZH 5L8RJ 5FYLD 2WLLA 4TVPD 1L4AA 3CMGA 1TZIB 4OR1A 5GGTH 3SO5A 4P57B 3DROA 1IT9H 3L71E