5AVXB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avxB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avxB02
4C7NA 1T2KC 1HJBA 4C46A 1H88A 3M9HA 3WGUB 2R5DA 4M3LA 1MFZA 5APTA 1FAVA 1IO4A 3T97A 4DZOA 1A02F 5AVVB 1S9KD 5AVQB 2ZFCA 3M91A 3HE5A 2WT7B 5AW6B 1A02J 1GK4A 5APQA 1GU5A 3VYIA 4RETB 5AW4B 3NXSA 1KQLA 1FOSF 3HTKA 2WPRA 3L37A 3WGVB 2KP8A 4HYTB 3NMDA 4GT1A 3A2AA 1GU4A 4B86A 1CI6A 5APUA 5AVWB 2ZXEB 5CMZA 3A7OA 2BASA 3OAKA 3VMZA 1MV8A 2R32A 3LIDA 3HE4B 2H7HA 3TYYA 3IR9A 3HE5B 1X8YA 1GTWA 2Q5UA 3V4WA 1H8AA 4LC1A 2WPQA 1GZLA 4AYCA 2R3CA 3TNUB 1CZQA 2Z5HA 3M9BA 5AW2B 3SWFA 3A5TA 5AVRB 5AVSB 1HBWA 2W6AA 5AW9B 4AQRD 1JUNA 2R5BA 2JJLA 4I6MC 2QM8A 3VMXA 4JYCA 3V5BA 5AVZB 1YYCA 4AUWA 5AW3B 3M0DA 3L36A 5APSA 5APVA 1GD2E 1OWAA 4XE5B 1J2JB 2XZRA 2QM7A 2Q3IA 3TNUA 2YO2A 4I2LC 3UIAA 3VTPC 2E43A 1GK6A 4KHXA 1NWQA 2W27A 2WT7A 4C7NB 3KQGA 3NFQA 2Z5IA 3V4QA 4RESB 2WPSA 3VMYA 2XU6A 1T2KD 2P2UA 2C9LY 2P7JA 1CSBA 5AVTB 1S9KE 2WWWA 5AW0B 3M06A 5AVYB 3P7KA 1SP4A 2WTYA 5AVXB 3HE4A 3VN0A 3LIEA 3M0AA 3I5CA 5AW5B 1NAFA 2C9NY 3NTNA 5APYA 1DH3A 1H89A 2IPPA 2YO3A 1HUCA 1CI6B 1G2CB 4JYBA 1SLQA 2Q7CA 1HWTC 2P67A 2YNYA 5AVUB 2N9BA 2E42A 3TK1A 5AW8B 3B8EB 3MGNA 5AW1B 3MD0A 3A3YB 3KDPB 1JNMA 2VRSA 1FOSE 1MUUA 5AW7B 1OXZA 4EOTA 3O8ZA 3P32A 5APWA 2XV5A 3P8MC 5APXA 4GKGA 3L35A
chains in the Genus database with same CATH superfamily
2GT9A 2O5YL 2XT1B 2YJLA 4OI8A 1OCWL 3FH7A 3PTZA 1ZLSH 1YEGH 2B1HH 1XIWA 3O9WD 5D7SH 3VXUD 2Y6SC 3FFCA 1XXFC 3H55A 1S9VA 3IJSA 5C6TH 1MCEA 2M8RA 5FYLL 2F5BL 4UQCA 2OTPA 3FU3A 3P11L 1AANA 5DF0A 4TVPD 4EZJA 1OWRM 1JWUA 1D5XB 4LCVA 3HIZA 4HIIB 5D2NE 1Q82Q 3QULA 3HE5A 4LVHC 5E9DB 1ASPA 1I8IA 2C1OA 4HZAA 2HPCB 5F6HJ 2VABB 3GJEB 3QFJB 5HGDB 1NTKD 1URIA 3IMSA 2XV3A 4XAWL 2QTVA 4GLRH 4UT7L 5JHDB 3ULUH 3WTYA 3FO9A 5ICXA 1CFVH 5FYLE 3G9VA 1IAIH 1F5WA 2CGRL 2XZAH 4KROC 2Z7UA 4X8JB 3V4WA 3LAFA 3TO2B 1RZQA 5KVDH 5IVXE 1GGYA 4DVRH 2A6JA 1AZZC 1VKXA 2X6CA 4V33A 3IDNA 4JM4H 3L70J 1TZGL 4HKXA 3KE0A 1PIFA 1R3KB 5D2LB 3QEQA 3TF7C 1P4UA 1F3RB 3HN8A 5AOZA 3T6XA 1E27A 3C5SB 4RNRA 1S5LX 2BZDA 2DDQL 5KS9F 4QT5A 2NUTA 4NZRH 3UTSD 1CW5A 3CDYA 1CJYA 1M2VB 3E8VA 4N5UA 2C3VB 5FK9B 4FNQA 1BA9A 3DA0A 3FT3A 2P2UA 4K0OA 3ZT6A 3VDAA 1ZVYA 3VFPA 5B7EA 3P3RA 5T3ZE 4LT7A 1A3LL 2H1PL 3RQ3A 2F0CA 2W81C 2EVIA 3VXRA 3T8XB 4ZMTA 3HG2A 2I07A 2R9HC 4RLDA 3WJLA 4UQ3A 4J3SA 4AVHA 4PRDB 1N8OE 1OP4A 3ECQA 3P4OA 1BP3B 4GS7B 4KXZI 3UROR 1CE6A 1RI8A 4KHTH 3TBWB 3AU1A 5DEFB 5LBVA 2FNWA 2JFCA 3OKYA 4WFHD 5LAXB 1BZ9B 2D3JA 2ICEA 4DQAA 5CBAA 4GSUA 3VQ2C 3AGWA 1TLKA 3KCWA 2DTSA 3P9MB 2XYBA 3K74B 2DW3A 1WE5A 3FC8A 3SHSA 1JPGA 1F0LA 3RG1C 3BH8A 2E8YA 3CCLP 3A3YB 3CH8A 2FECI 4N2NA 1OL0A 1FJPA 3GBNL 5I9QC 4JG5A 3P30H 2YXVA 5DXWA 1GC1H 2KHAA 3WUTA 1BQRA 3FGAD 3N1QC 4W9JC 3W1ZA 3GMNB 2Q86B 4EBQL 4IU2A 5BQ7A 1YJNP 5F1SA 5C3LD 3N1PC 1C5CL 1UWYA 3BCCD 1K8IA 3KH4A 3VUAA 3HRZC 4D3CH 5KS9B 4P4RB 1BHGA 1VADB 2BEZF 2X4UA 3NGBC 4P57A 4TQPA 5FGSA 1XTCC 3DPBB 3L5WA 4S10A 1W0WB 5DFVD 3T2OA 2FCBA 4O5LL 1PCSA 2GCYA 2XN9E 4P46B 3QJZA 3G6JB 3DC0A 4UV7H 1M1JC 1HHIA 3SDXF 3RX7A 1GJUA 2CCLA 4OQ1A 1A6UH 3KJ6H 4CSPA 5H4ZA 1Y1DA 4IRSA 3EFGA 1OAYH 3ARDB 3K1KC 1E6JL 4LEOA 1EFQA 1WBYB 3GS7A 2JV6A 4Z95H 1BFTA 3ARZA 5JO5A 1D5BB 2I5YL 2YQ3A 1RE3C 4J3OH 2YD7A 1BZEA 4OVUA 4XX1E 3H1KJ 4W9GC 4X7EC 1VIWA 1QD0A 2JIXD 4JPKH 2JWAA 4TVSa 5GGRY 2VLLA 3D6ZA 2X4TB 1JRHL 2CHDA 2ZX5A 3G5VB 1ZHLB 5DK0A 1IAOB 2PP7A 2VDRL 4AQAA 1NPUA 1AXSA 2NNAB 1NM4A 5IBUB 3A21A 3V4PH 1TTCA 4HV8A 1X7SA 4YDVB 1IB5A 3OLDA 5DMIL 2X0WA 1C08B 1BYNA 2RN0A 4PRHB 3MBEA 3ZL1A 2UXTA 1FWXA 3GSVB 3JTTB 3DHJA 4JO1L 4UB6H 2XWDA 4PJAF 1U8LA 2VXQA 4BYHA 5KSVA 5KAQG 3L36A 4PCSA 1MWAL 3BFWA 3MX0A 1O7VA 1NTKJ 3DUUA 3OF6D 1DBBH 3E6FA 1GD2E 3MNZB 1ZGLP 3P0YH 2JJSA 5KSBB 3VB9A 3WNMA 1S8DB 2FT7A 3MRGB 4ES9A 4BKSC 5FGBA 1K8IB 3GT6A 4G6FD 3TJHC 3L9BA 1XF2A 4PG2A 4XR8C 4L8SC 4XPTH 3SYPA 2DAVA 5DHXB 3TFBA 3MOBH 4JN2B 3TN0A 3ZU8A 2GCYB 4F1ZA 3NSDA 1AZUA 1DCEA 1INDL 3N1MC 1AYRA 4AVKA 5I1IL 5IV2A 2FEDD 1UJ3A 5D7JA 1BGYG 1JDDA 4JJOA 4JRXB 1NEUA 2BVUA 2IALB 4BSVB 5I23A 5JPMA 2BDNH 1DN2A 1RP9A 3EJSA 3DX8A 3ZDXF 4L29B 3D0LB 2P24B 3QB7C 4Z7VB 4EDXB 4K15A 4HIHA 3VFGL 1U92A 2H1PH 4PJFF 3NCWA 3DRQA 4ZPVB 2IQ9L 1CXEA 3UYOD 3GXIA 2YUVA 4LDEB 4OLYL 3SYOA 3EDFA 4PV9B 5AVUB 3CDGB 3WN5A 2OMXA 5CU9A 3BWZA 3MLUL 2ZCKH 2V2WB 4OD1L 2PMZA 2OTWB 5KYWB 3T4YA 3FXEA 5EZLA 4WY4A 1KGUA 1OTUD 4IBLT 3QCVL 3W5MA 3SBRA 4WY4C 3H6PA 1CFNB 3ARPA 1OF2B 3BX7C 5IJCC 1U8PB 3DHPA 1M71B 4AJWA 4ZOAA 1QL1A 1XWVA 1ONQA 3FK3A 2P28B 2HB0A 2KDGA 3CX2A 3IDGA 2E47A 2D0HA 3OAUL 4Y2LA 1R3HA 2PCFA 4MCYA 3QE5A 5C0CB 3MNZA 1BJ1H 1S3JA 3GMLA 3TIEA 5ISZE 1FA4A 1L0YA 3DUSA 4JQXA 1LJMA 1V5JA 1KZQA 2G3ZA 2HFGH 3U48A 1J1PL 5TISE 4J3OG 4FP8L 4KH9A 3TYFB 3O41A 1XF2B 5D4JA 2HXAA 1JK9A 5DEZA 3I85A 1TCMA 4KNSA 1T22B 3BRFA 5CCGA 2IH1A 2WIIA 4UYQA 2FYUJ 2YFNA 2O4EA 4M43H 5ESQB 4GNKB 4A2LA 1LK2B 3OKEB 3VI3F 2MCG1 5C2UB 3RWFB 2EC9U 2L3BA 4Z3HA 4Y2DD 3Q3GA 2BXZA 1BSHA 3CC5A 4H8VA 3O0RH 5IW3A 3SDYH 4Y9GA 5C07A 4MYWB 2B0SL 3RAJL 1E43A 5C09B 4ZPVA 4YSQA 1L9MA 5D1ZI 4Q9RL 3KPSA 4CPGA 3U0TA 4ZX4A 4XPFH 5CGTA 1DHKA 4AQRD 4BSWB 3CD4A 4MBRA 3KBHE 3IXAA 2FJFB 1JXFA 1E42A 1UZ8B 4PRIB 5DLML 2CCVA 5B38A 5CJQH 3PP5A 1FGVH 2C34A 2G8YA 3HHSB 4LPYA 2HT4D 3U6XS 2XZRA 1FNGB 2GKIA 2OV0A 2QGBA 1KXQE 2DTML 2ZG3A 5T33H 4Z76B 1SFCB 3T0EE 1KT2B 3PWPD 1AGFA 1X5IA 2IAMB 3K0YA 2ENYA 3GF3A 4FNLL 2WMMA 4Z8FH 4NAQA 4L8BB 1LD9B 3BGFB 3BH9B 3NJVA 4JM0A 3S36H 3TVMA 4EE2A 2HVKA 3HZVA 5EEYA 2AQPA 3MRRA 2NRDA 3MYZA 2BP8A 2O5ZL 3H32B 2Y07H 3L13A 3OC8A 5TJWK 3RNQB 3IPBA 4KMTL 2P80D 5C0BE 5C0GB 3V6OE 2NY1C 2YO3A 1T1YB 3GNML 4JCLA 4RZKA 5DJDB 3VRIA 3HD7A 2Q8AL 1QFUL 3F65A 4FTVD 4PG9A 4UANA 1Q94A 4G11A 1BE3D 4ACPA 4BBWA 4WFGD 1GIGL 1J0HA 3HR5A 2QQKL 2C4FU 4A2FA 3IU3B 1BREA 1LNUA 2BY3A 1T4KA 2Q76B 5DJAA 4X6EA 3TBVA 1MFCL 4NQCD 3EYQD 4AIEA 2GBAA 1T5KA 4WO4C 4PJ9B 4R7NB 2AAVA 2A7BA 2IQ9H 4F7TA 4V1DE 1MJJA 1M4KA 2NT1A 3RL0C 3BKML 3BUYB 1JMZA 3U7WL 2LE9A 4MA7H 2PYFA 1HJBA 1KJMB 3IAGC 4QMAA 2OR8A 1ZHNB 2AEWA 3WS3B 1HDMA 4X98A 3CBKB 3QUYC 3VJ6A 5B38G 1DQDH 4RQQA 1JCKA 1U58B 7CGTA 5FEBA 3HMWH 1SFCA 2FX9H 4C56D 4QKXB 1SXZA 4PJCE 4WQOA 5ETUB 1DZBA 2QLYA 1N9PA 3I6LE 5DJCA 4PJCF 4BM7A 3P9LA 3ML9A 4PJ0E 4PS7A 3LB6D 1A9EB 3FL7A 2O6CA 1SOSA 5KKZC 3P9WB 4HT1H 3RK3B 3IGKA 4LCCB 2N1TE 1CI6A 3PH0A 3NMEA 1KV4A 1B0IA 2WQ8A 4DCQA 1P5UA 3MUJA 1AHWA 5F9DC 3R06A 3OKOB 3L95B 1CXHA 1EO8H 2DQGL 1IFDA 1AKPA 4X4YB 2OULB 1GZLA 2P5WE 2LV4A 3MLSH 3V4VB 2CDEA 2Z5HA 3CH1B 3QDJE 3IB4A 1CIDA 2ZSVA 1J1DB 1I3VA 4UM8A 4RSVA 3DIFB 1RUPH 2X9ZA 4P2OC 3TOPA 1HK6A 1N0XH 4Z23A 2CJTA 3GMOB 4MMZC 3IMVA 2EZ0C 4URTB 1JYXA 1D5RA 3AACA 2AEJA 1QQDA 4OT1L 5AW3B 1IZJA 1U8HB 1USQA 1A7NL 3WBDA 4KKAC 3PPSA 1XCXA 1ZHBB 4NUGH 2ITDB 1KB9I 1JNHA 4XI5D 3KXFA 4YDZA 4S0SD 4UNVA 3OQRA 3H54A 2VMFA 3SQBB 3KLHD 1UIXA 5A3IC 2QJYB 1IGYB 3SYAA 3WFEL 1BVLB 1XCQA 5DZOA 1MJUL 4AITA 3F58L 4IOFD 2I9LA 4D8PA 5IMMB 1PG7L 2J6WA 4UCFA 1HH9A 1DEBA 4P3WA 4PIRF 5ETUA 3V0WH 1IGIH 1AFVL 4L23A 2XY1A 3H3PH 5KAIE 1TJXA 2JI3A 3G5XA 5A16A 2E7LA 4KRPD 1MCWM 2HPCA 2PGDA 4LSTL 4KOBA 4F7MA 2QQKH 5DJUB 3VXMB 4LQFH 4R4FH 2WSFJ 1FAIH 5GZNC 1FRGL 4NBYB 3VGAC 5CHXA 4X4ZA 2WQVA 3PWUA 5GS1B 1A6ZB 1SFHA 4G7YL 1XL4A 3IKCA 1HINL 2E9JA 1KLGA 1ZK5A 5J12C 1HZHH 1NGWB 2W0LA 1MQKH 3U4BH 1EXJA 1ORQA 4AGLA 3IETB 2E4FA 3DO4A 1K5NB 4H20L 3RA7H 3UTTB 3GMOA 4WKXA 1MHHA 5AL8A 3VI3E 3IE4A 2APBA 4Y4HB 2XWBA 3SGEH 4HKXB 5D2LA 2R5DA 2K3RA 4KY2A 1KGYE 2Z35A 4FTVB 1G1IA 4MAUL 3UPCA 2AV7A 1UKSA 3BKMH 4XP4H 4WZ9A 3EZJB 4NQXB 1QNIA 3S97C 3WFCL 7FABL 3FQRB 2B87B 1KPRB 4FQIL 4N0CC 3HRNA 2Q8BH 2XZCL 4OJFH 4OLUL 1K9TA 3SDCB 5GS0H 3FUMA 5GRYA 2H8PB 4IKKA 5FYLH 4DIXA 3BJ91 2NCMA 3BLKA 4M48L 1O7SA 2PTTA 2FB4H 4JO4H 2VL4A 4P59L 3LZNA 1J1EB 4N8UA 2IPTH 3BLPX 5F7LB 3VD3A 2V5SA 4XWOD 5I16B 3CFKB 3KGUA 4NKMA 4BQ6A 3DGDA 4PLKD 4B6ZA 2Z7YA 3FTGA 4QXGH 2ID5A 1J1EC 4JHWL 3RVVC 2EDOA 2C26A 3QCTL 1P4LB 3L9EA 4DKEH 3LOWA 2ODHA 3LHPL 3BPOB 2GJ6D 4E41E 4G42A 1KYOK 5B39B 1BZ9A 2FJUB 2YEZB 1TZIA 1NGPH 2J44A 4DW2L 1JK8A 2MOQA 4LCUB 3GSOB 4L48A 3HBQA 4WV1B 1YJDL 5J0BA 4A55A 1J0KA 5F9JA 1QRKA 4ZT1A 3UTPE 3O6QA 4OB5H 4P5TC 3IKKA 3NOIA 3IETA 4QHKJ 3S3DB 3CUPA 1T4WA 1SQPK 4J4PA 4JANA 2YPLE 4J39A 2FHFA 2BNQD 5DLMH 2ZX7A 1B4RA 2P5ED 1TVBA 4TLUA 5HGHB 4P5TB 3HOGA 3AG2B 2ZOKA 3SPVB 3HZMB 5KTEH 1DQKA 1RUKH 3VWKB 2XU6A 4K8RL 1SQPE 4XODA 5MHSD 3OSVA 1VEPA 3U1CA 1JOIA 1ADQA 3BDYH 1TQBB 1OQXA 1E50A 2XXMB 3DUHA 3HAEA 3OQ3B 4NPJA 3WSQH 5I2IA 5INDB 3PDOA 1UIIA 4A7SA 3DGGA 5SWZB 1QBML 5MEQB 1FE6A 3I5CA 1E6OL 1CLZH 2RA1A 3KLDA 3FYIB 5DJTB 3QDGA 3KPRE 3N1GC 1QSEB 2D2CD 1I9JL 2WBKA 2ZP8A 5EIIB 5DZNA 3MV9A 2XN9B 3V2RA 4JFEE 5EZOL 1XAKA 1QPKA 2VJXA 2JIXA 2UVEA 5LXVA 1EGJA 1SFCD 1S3KH 4C56A 2CXKA 4HA1A 4N3UA 5CEZH 3S35H 3MODH 4K71C 3UP6A 4X5XA 4ZQKA 1A6TA 5E99H 3DJRA 4U1KA 1PIXA 1MFBH 4E5XG 1JZ4A 4NN7C 4PQXA 4L2YA 1W6LA 3SE4A 5IHHA 3HC4L 4CA4A 1MLCA 2DQTL 4GKGA 1OGTA 2FQFA 3K8LA 5T1LB 4BCXA 3T0ED 3S9OA 3MFGB 1AO7E 5D96B 3S3CB 3WUVA 3BAYA 5AAMC 1CICC 2F19H 3T8MA 3U46A 3T1WA 5KSVB 3K2KA 2CE6A 2V33A 4K7PX 3QWOA 1WTGT 4BQCA 2R56H 5IFJB 3R18A 3CFDA 4HWBA 4JANB 3TXAA 4ZUVB 1KQGB 2X2YA 3X3GH 3I55P 4A7TA 1WBXB 3FT2B 2F8XC 3QIBD 4FI7A 2WV3A 3FZUD 4IRZL 3EYUL 3SPVA 1BECA 2CMRH 3QIBA 3FTXA 3PL6B 3QNXA 1CU4H 5GZOA 2IPKA 1R5VB 5EZOH 5T1MA 2W0FA 3HUJF 4Y5YB 2JJTA 1BDCA 7FABH 2GJZB 1VGKB 2VWEE 4DUWA 1L9RA 5D7LD 3GKZA 2RBLA 1HL5A 3QRLA 2H2PC 5DJ0B 3TYYA 4QGTA 1XGTB 5E95B 2OCFD 3GHGC 2DLHA 3TGUJ 1CDIA 4X7TA 1DVSA 4FQ2H 5EO9A 3ESVF 1KPUA 3L3IB 2WBJA 1MAJA 1JMBA 2Z0UA 5TF0A 3VU2A 2B2XH 3GKWL 1I9RL 5D72H 4GI9A 4FHKA 3RIFF 1WFOA 5KANG 3VXRD 3ZDZF 2JCCA 5FM5M 3D71A 4NIYE 4DPCX 1IVTA 3QQ3A 3KPNB 5J6HA 5KYXB 1JWMB 32C2B 1KY7A 5EHFA 4MNHB 2OTWA 4BUQA 3IMRA 4K73A 2OMUB 1S7TB 1O5DT 2YOAA 3CFCL 3CCHB 1EIBA 5IHUH 2WKGA 4PV1C 1KYOD 5D1QC 4JDZB 1OF2A 4UT6L 1A7PH 2K8QA 3GMPA 1IKOP 4KX7A 5LVEA 2YGPA 4XE0A 1OV8A 2M26A 2Q10A 4KUCF 2BCMA 3MBXL 2MCPL 3VYNA 4BH7A 4BH8B 5KYYA 5C0CA 5DJZA 3Q6GH 3IMUA 1HSAB 4OIIL 2QZ5A 4UIKH 5EORL 3IRZA 3GTVA 2KOGA 4OCSH 4KT0J 3UO1L 5AVXB 2JB5H 1SDYA 4K71B 4FXGB 1IJNA 4PJXF 2OQQA 1N7SC 1A9BA 3LSOA 2HLFC 3MROB 3NGBB 2X44D 1T04A 4P23A 4JKPH 3TA3A 3SFEC 2B08A 2VLKE 2WWMD 2FR4A 2QQLL 3QQ9D 1MJ8L 2WZPD 4J4PD 1AIFA 2A9MH 3MA7B 3QBTB 4NP4L 4LLWB 1MCCA 1CDUA 2W83C 4N0CD 1E9QB 2ED6A 4QY8A 2BOCA 5A7EA 4OKVA 12E8H 4XN9A 4ZFFB 1A0QL 4PB9L 3K72B 1R3JB 3WNIA 1SYSB 2PP8A 1MCJA 2OXHB 5JLZA 5C09A 4AQ1A 4E5XA 1E4XI 1KCVH 1I7RA 3Q2YA 1WCQA 2ZWLT 3V52H 1A4CA 1I1YB 3TN0C 1TEYA 4I48B 3RL1A 3QVAA 4BSWA 4G7QB 1M9SA 5F9OH 1INEH 2AQ3A 3B9KC 3QDJB 4RCAA 1JTHA 4HJJL 4Z7AA 1J11A 3FRPG 3C2SA 1KZYA 1QA9B 4FXLA 4H20H 4NQEB 3X13B 1K3IA 2ZSWB 3WIIH 5GGSB 3FCBA 4FFZH 1QG3A 1RY7B 9PCYA 4ZO8A 4GKOA 5IFHL 4AYID 4DNLA 4JFTA 2HTLD 4IU2B 5BQ7B 3IT8D 3RNKA 4ATTA 5M7QA 2EYSB 4EKJA 4HUMB 3V0GA 3UIYA 4NPKA 1K4DA 2IH3A 3CFBA 3HE6B 2E75B 1RU9L 1S5HB 3C8HA 3P0VL 5A7BA 5EB9A 2EUXA 2NY7L 1ZPLA 3P4NB 1FLRL 4X6CF 2XPGA 2HJKB 1DP0A 5F1NA 4PJHF 2ITFA 4S1DC 4CBPA 4JRYA 4GAJL 5FFGA 1ZV9A 1V54B 4FNUA 1BBJB 5KLVG 4HEMA 5CIPA 5JPNA 1S7WB 1UD8A 5AKTA 4GRWH 4NI3A 4UIMA 4PGBA 3UL4A 3BZFB 2OMYA 4L4VD 4XNZC 1SBBA 3T2NH 1ACXA 2ZUVA 3GHEH 2X40A 4NNXB 1MFCH 1RZJH 2CWRA 5LNEA 4AW7A 1B0RA 4YXWH 2YPLB 3EBIA 3EOTH 2P5WB 4FHJA 4X99A 1I7TB 1SQXE 3MBED 4OFDA 4RGMC 2X41A 1B0WA 4PREA 4XPGH 3NSCA 2O26U 2OTJP 5HDBF 4G8EB 1ICTA 1T1XA 3RL0D 3LIZH 4ZDHA 1FNFA 2LABA 1P84J 2BP5M 1RIUL 3PGCB 2YUZA 3IVKB 1U8LB 4DEPC 4JG0H 2WSCJ 1XB3A 1BIIB 1CTMA 2OL3B 3QHZH 5DT1L 2W92A 2CUAA 4RAVB 1ZN5A 4Y9BA 5LJYH 5DK2A 4HDIA 5I15L 4OV5B 5E1AB 5E2UH 3ZE1F 4I4WA 5I75C 2CDFA 4K3GA 1DQVA 1S5HA 3FN0H 1U2HA 5IWLC 2F7RA 1XD0A 3VXSE 1CI6B 1FP5A 3CZLA 3TN0B 3IFNL 2MKWA 3AMKA 1OTUC 2E9BA 5J12B 1BQKA 2VZUA 3TBTB 4O02L 3AM8C 3SCMC 3NCEB 1KB5H 3ZKSD 4BSVA 3KL5A 5JR1H 5FV1L 4GUPA 5HVHC 3L5XH 1JV2B 4FQLL 1KV7A 3JVGC 3O8ZA 4Z7VA 4LLAA 3IS1X 3II6A 3IN6A 2WLYA 4W6WB 5K39B 3UPRA 4AT6B 1I9IH 4N2FA 1MIML 1YQ4C 2MPAL 3REWB 2Z31C 4OFKA 5HGBB 5T5FA 1U3NA 2F58L 4R26H 4WTQA 4RFEB 3GLAA 1FYTB 4FE9A 3TSIA 1BEXA 2CUMA 1CVSC 3LCYA 2DQFB 5KYWA 5AVQB 1BCCG 1Q2NA 5CJXC 1TTAA 2NQCA 2CALA 3O2DL 3VH8G 5E2TL 1JHLL 3B7TA 3ARGD 3QHFL 3MV11 4GLRI 4NHCL 3HG1B 3BQUC 1NCAH 3OKMB 3S9DB 1P7BA 4B3VA 5TD4A 3IVKA 3TCTA 3A2AA 1YQ3C 5GJTH 2ISDA 2BZCA 1L7IL 3G04B 4LEBA 4WFEE 3U0WL 3V0WL 3MV7E 5B66E 3V6IA 4H0HB 2JWYA 3LW5J 1NCOA 4N2OA 1U2CA 1NEZB 1E9PB 1OARH 2XFXB 1AE6H 4KFZC 1G1KA 3VXMA 3PNWB 2QQQA 4IOIB 1M6UA 3GGWA 1QTPA 4F92B 5FYKU 1KJ2B 4LCCC 1R5SA 1MIMH 3N85H 4PVMA 2WIIB 1JGVL 2DB8A 3FUEA 1HIML 3QZPA 3UTSA 1GAFH 5HI4D 1FDIA 1HN1A 4R26L 3HAEG 2Y36L 3DK0A 3FTUA 2XNXA 3CXDL 1KLGB 4R90H 3V0AC 2VB5A 1EUUA 2OGUA 2AEPH 4XVUC 4NPEA 4DO5A 1PQZA 3ISRA 3WFCH 4PCYA 3IMTA 4DOHB 1EEQA 1T5WB 4JG1H 3K6IA 5KAFE 3TO4A 3PF2A 4N1HB 3VSTA 1WTLA 4DAGH 4NHCH 2KB7P 1USDA 1NGXA 2X4NA 3ULUF 5ESVB 3HVNA 2UXFA 3KW8A 3VFWB 2OXGB 1QR4A 4Y4FC 1ZLUK 4H0LC 4EI6A 5CGMA 1J5HA 2OI9B 2YK1L 4ORZC 3H1HJ 2DYRB 3TBSB 1VF5D 1Q72L 4ZTPH 1TKWB 1M8OB 1GTFA 2WZ7A 1A25A 4PJ7A 2FJSA 5JW4N 4GO9A 1W72A 4HKZB 1CR9H 2LR4A 2IBZX 4OLUH 5BRZA 4YXHH 1KNOA 3S8WA 3DMMB 3ZQ9A 2H89C 1HS6A 4P5KA 4WFHE 1B90A 4G1MA 2IPPA 4GQRA 1FO0H 4ICXA 3U2JA 3C6LB 2KXPB 5D96C 1DL7H 2F08A 2I7SA 5DRNB 5ES4B 3BKYH 3UC0L 5J11B 2QPSA 2VR8A 3IDIB 1CYWA 5JR1L 4IBZA 4BWNA 1IC5H 3WU1A 4MMXC 2PPEA 4M8RA 1F8TL 1KGCD 2A9DA 1EANA 3CV5A 4AE1A 3QJHA 3ZY7A 4O2EA 2R2CA 3FFDB 3OV6A 3MUDA 4F15B 3CWGA 4OD2B 4J3WA 3NRPA 2OYIA 4YDKH 3BP7B 3MCKB 4CJ1A 1I8IB 4XNYL 2XJLA 3F89A 4UM9A 3DO7A 3BAXA 1A4KB 4YVNA 1G7JA 3P3YA 3QIWC 1HSBA 5FA3B 2LOEA 1HHKA 1IGTB 3RWCB 1GOFA 2AXCA 4U3FJ 3O6QB 1AY1H 1WT5A 3V5KA 5JDSB 1GTNA 1CO1A 4PW4A 3T97A 4F20A 4BHUA 1D9KA 4JFFA 1XB6A 1LO2L 2E59A 1AACA 2FYUD 1F45A 1RZFH 2AJVL 4LARH 2IV8A 2X4SA 2J6EL 1WZAA 4Q4EA 3VFWA 3CHPA 2IDUA 4LCIH 2XX0A 3ARFD 2E46A 4ACTA 2CJUH 5E8EA 3CIAA 4UQDA 5K93A 3LQAH 4KK8C 4PJ7B 1NMCB 4OWFA 1FZEA 3E38A 5F1KC 5EV7A 2BDNL 3RK2B 2WBJD 2C9SA 3LEYL 2DKUA 3QULB 3HE5B 4XZUA 5E9DA 4R96A 1EA9C 4D9QE 4F27A 2WYIA 1U9KA 1DVFD 3D69A 3ULSB 4KI5E 5CXPA 2EDBA 1UA7A 1IFMA 4WY4D 4HH9B 5BOPA 2WQRA 4OZHF 1DSWA 2VABA 1RUMH 1EO8L 2DQGH 1G7LB 2Z93B 4HF5H 5E00A 5K1JA 5AVRB 1IC5L 1WT6A 4PJBB 2OCCB 5F7MC 4ZW5A 5B7FA 5FF6A 4UMGA 5F44A 1VEOA 1UM5L 2IADB 1QBAA 4YXLL 4JO2H 5BS0B 3D3VA 4Z3GA 5FB8A 4YHNB 5F7NC 1E65A 3D52A 2WBJC 5D93C 2N7SA 1Z5HA 1OWAA 1G9NC 3CSTA 1JHTB 2VXTL 3BP7A 1AGEA 1E7UA 4Z78B 1FAKT 1IC7L 2Y7SA 2IC2A 4KAQL 1F4AA 4D0BA 3RVWD 2VO5A 3Q1MA 3WIHH 5JHAA 4B7LA 1JXKA 2KT6A 5IFJA 2IDSA 2ICEB 2V9QA 3UPAA 3I3BA 3ECWA 1LWUB 2J6EA 2BS8A 1CCZA 1Q1PA 3BH8B 2ITDA 3IDYB 3S4SA 5JYMA 5EU6D 1KV3A 5EIVA 3EGSB 3T6QC 3ZTNL 2W0FB 4J5VA 2MEJB 2O61B 1GYVA 3QZNA 1CD9B 2OTKE 4FNSA 2XWZA 4QHPA 4BZ2L 3T4AA 2YUWA 1E5CA 3H2PA 1BAFL 1Y9BA 4TNVK 4YEEA 5JIKA 4NC0B 1QUNA 2IYPA 3MYJB 3VGHA 4WAFA 3G5YA 2VT0A 1QLRB 3CFJB 2VOTA 4CMMA 5HSFA 3BKYL 2YGVA 5G5DB 5ITFA 3EGDA 2PYED 4TQEL 1SBSL 1PL5A 3TBWA 1QP1A 2ZOTA 4ZO9A 5LG1A 5LNGA 1GPOL 3M6DA 1DYZA 1V3LA 3ZDYF 5D7IE 3G71P 5GSRB 3WGUB 4FNPA 3Q6GL 2EABA 2OZ4A 5J1AA 4HUXB 5HYQA 2NR6A 4L4TD 2HWZL 1XH2A 4M4RA 1N7MH 1JV5B 3ZVVA 2P5EE 4Z78A 3K8KA 1DQQB 4AH2A 4ZMOA 1A7PL 3QIUB 2EJ1A 4XWOC 4OZIE 3CK0H 2G9HA 3OKNB 4JMXA 3MTXA 4L9LA 2XWEA 3NEOA 1JO5A 2A06E 2ZYAA 2JVUA 3S36L 2OS7A 4X7SL 5AUMB 4N2LA 2PWGA 5JTWA 4PAZA 5BVJB 1BOGB 2WZ6A 5E6ZA 3QEUA 1KTDA 3Q3DA 4HZLA 4PRPE 3ZGIA 5GTHH 3LSOB 1MCFA 2UZXA 2YAOA 3FQRA 5JIQA 2IDBA 2NW2A 4DZ8A 4HEPA 2UVFA 1V10A 2A77L 3TF4A 1H15A 1JF1A 2HLFD 2W90A 1I8KB 4HKBB 3BE1H 2FL5B 3UYRH 5I76A 4NENA 1O75A 3M9BA 1B4LA 2MTPA 4PUBL 2F7OA 4J4PC 2B20A 3BDXA 3H6JA 1EDLA 3VYOA 1YQVL 5EO0A 4ZSOB 3UGXA 2ERJB 5FKPA 1U91B 1UOWA 2Y22A 4JN2A 1M1XA 3WFBH 2BS71 3QUYD 3BAIA 2GM4A 3GXUB 1TSHA 3CFJA 1A22B 1IEBA 5EF1A 5I6OA 3PP4H 2NYKA 4JRXA 3DTDA 4LSQH 1J2JB 3OG6B 1IGCL 4PMEA 1Y18B 2GJPA 4PJAB 3IDYC 3E1F1 5DD5L 1F56A 5LGHL 1V55B 1TZIB 1JTHB 1RHZB 3A4EA 1A4AA 2VR4A 2AABL 4G8IA 4H8QA 1BCCD 2YGQA 3RU8H 5J1AB 2NY3C 1NUNB 1R19A 1DQLL 3GHGA 4EMZA 3ME0B 5AD0B 3D39A 5HVHB 4U7SA 2RCSL 3Q5OA 4XCFH 3MGTB 2WB1A 3ARFB 3BCCG 1TVBB 5HGHA 4X6BB 4O2CA 2I1JA 8FABB 4GW4B 5B7MA 1SQBG 5CCHD 2CXGA 2A74C 1SF5A 1KDIA 5FO9A 3N1FC 4PHZA 1IEHA 1BXXA 4QNPF 4JFYA 1AV1A 2QKIA 5AL0A 1ZGLA 4QRTA 1SLQA 1I3UA 2CHXA 5ERWA 1E8ZA 3ES6B 1YN7A 2P67A 2NNCA 3FO0H 1PL3A 5D6DA 4YHYB 2FYNC 4QRRE 2D8KA 3NIFE 2G30A 2A9NL 4UNUA 1E5WA 5FKAA 2J1KA 3IJ8A 1PZ2A 3DX8B 1MUUA 4WW1B 1RZJC 3E1IA 2IOMA 3GSXB 3EH3B 1JTOA 3MLUH 2CBPA 3P4MA 4JFWA 3WJLC 3K5RA 3LQMA 1VQ7P 3UAJC 3E3QE 1MCPL 1RY3A 5C0AA 2CO4A 3UCQA 5I8KL 1G6RA 1J7VR 2J5LB 2V9TA 4PRHD 3WN5B 3RKPA 4ZS7L 3CPWO 2FNBA 4RAHA 4I7ZC 3CK0L 4J3VA 4PREB 1A47A 2G60L 5AOMA 2XXGA 4JG1L 1FQ9C 3D08A 1KIUA 1VACA 2DLTA 1A6VL 3LIZL 2H1XA 4LPVA 4NIKB 1ESOA 1AI1L 1GYCA 1UD5A 3EW3B 1RK1A 4UB0L 2DLEA 5DVOA 3FQWB 2KNCA 1ROWA 2KP8A 2DW5A 4HYTB 4OGAD 1BF5A 3NJLA 3NIDB 1VFBA 4XC3H 4OH8B 3PHQB 3LD8C 5D1XE 2Q6WB 3V4PL 4IEFB 4KVPA 2P7TB 3QXDB 4H8UA 3MRDB 1CGUA 1KGCE 1MF2L 4AOFA 2IBZG 1EEYB 3HHSA 5C08D 1L0NG 2UZPA 4WO4B 5CHNB 4I4WB 3WKMH 3B2DC 4P0DA 4Z1MH 4ELKB 4KQ0A 1OAZH 1QSFB 3SBWA 3BIBX 2MH4A 2FBJH 3BWAB 4K9EC 4XN1A 5EBLB 1OAQH 4BQ9A 1BBDH 3H53A 2OM5A 3EOYG 3ENEA 4MB5A 3TEXA 2ICWI 2WPGA 5D71H 1UWGH 3WUWG 1IJDB 4AUWA 2EYTA 3AQYA 3G6AB 4LNRB 3W38A 2ZXXA 3O2DH 2JSFA 3ZKNC 3AREB 3QFDB 5EFIB 5HJGA 5AKSA 3EJPA 4OJFL 4DUVA 3KM2A 3KPSB 3TBCA 5KW9L 1XBRA 5KVGH 2N1TC 4Z7OE 3PABB 4AL8C 3BPCB 4RWHA 4FLRA 1Q94B 2R1XA 4YE0A 4GKNB 4QHMA 1MFAH 3VP8A 1ZJBA 3GTNA 1S9KE 2D9QB 1JZHA 4H8WH 5GRVL 4AV0A 5A2CA 2I85A 3EJYC 3SOTA 1T3FA 1S7TA 2X53A 3UC2A 3KPLA 5GS2D 1IRAY 3WU2H 4QIRA 4U0RB 1YEKL 4YPJA 3B2XA 4L3EA 5DT1H 1KIRA 4QJ5B 1F13A 1PW3A 4TMPA 2LXCB 1J86A 1NM9A 4D8OA 2G75A 4XP5H 1F41A 3ZL4L 4D9RD 1M56B 1CFTA 1X5JA 3NZHL 3O8XB 3EF4A 2XQBH 3NIGE 1WZMA 3DX3A 2HPTA 5E6YA 1H0TB 4WSGA 3Q5TA 1XTGB 3PCYA 6TAAA 2ZXAA 4BUHA 4HW6A 3MU3A 3R1GH 3FCSA 3H1LJ 4XNAA 1PPJG 2BVQA 3V6FB 3X1FA 5CZRA 3VXSB 1JY3N 2BLFA 2JKSA 5F9AC 2ZQKA 4DGVH 1BDDA 5I0YA 4GW5A 3U7YL 4XMPL 2DY2A 2EZ0D 5AW6B 4K23L 4TUUA 3EJCA 3ZMEA 4C83A 1MXGA 4CKQA 4EUPG 5LXGH 1J1DC 1M1JB 1TT6A 1VDGA 4UT6H 3N44F 4BQBA 5I1GH 4U3SA 1L2PA 4RSYA 3UC0H 3ZW3A 2WXOA 4K5NA 3FWNA 3GG2A 2ARJA 2W6BA 1MHEA 2O72A 4DETA 4QHUA 1IFRA 5IBTH 2E74B 1MV8A 1AG6A 3LIDA 2A45I 1IQDA 4YDIL 2EXWD 4JM2C 4QF1B 4XCEA 5C0JB 1EHKB 4JJ5A 4KUZL 4RWYH 3ZDYB 2FBRA 3B2MA 4URKA 4OFPA 5TDNA 1JY3P 1FN4A 2EYSA 1L9NA 3F6LA 4LLDA 4XMKL 2H88C 2JQAA 1BM3L 1M90Q 2YMOA 1IKNC 1VGEH 3VI4E 5CLYA 5KBLA 3B71A 1IGYA 4XB7A 4GG6E 2AXFB 4OCXL 4KDWA 4TN9A 4NHUA 5J6SA 3V5BA 2K7PA 4JKLA 5FGCB 2EXTA 4HCIA 4N2EA 3ATDA 3HHMA 4HX1A 4BZ2A 1KBGH 4DEUA 1NH6A 3M0DC 4WI0B 5GZND 5M95B 1LWJA 1E8YA 4OGXL 1F11B 3G5ZB 3IFPB 3VTPC 2MMXA 5CGYC 5LGJA 4YTPC 4JM2F 1GL2B 3MFFA 1VFAA 4IRZH 4U1LA 5E9AA 4WJKB 4H8WL 1H5BB 1K6QL 5CIPH 4FQJH 3B3IB 4UTBA 2ZOOA 4S1QH 4LASH 2PW1B 1MHPL 2XICA 3MQIA 3VQ1C 4Z7WA 3P7KA 4X0KB 4ASVA 4CUCA 5DHEA 3B8SA 4HOWA 3WELA 2L5GB 2ETWA 4CMHC 2UY6A 1CFSA 3AM8A 3J7HA 1OTTC 3KLAB 3L1GA 3CVHA 1K5NA 2H4EA 1T2XA 2A45G 4YO0B 4FTDA 3T65B 1FO0B 1QFWL 5KLVD 5E2UL 4JQIH 3TGXA 4NM4L 4A2DA 2Q7CA 1SQQJ 3ECBA 4H40A 2V17H 1S5IL 5MENA 4HKZH 3TK1A 4PJIE 1JD7A 2RFXA 4Z7UB 1EEUA 3C5XA 4WNQA 4NQXA 4EOTA 1QX1A 1ND0A 2O5XH 3BT2H 4A6YB 4R7DA 1TYJA 1ZR2A 1HKLL 3GI8H 5TE7H 1OLZA 4EO5A 4XN2A 4AYFB 2J25A 4NERA 3X14B 1W2BO 4HWBL 5SWQB 4N90E 1A6ZA 1WBZB 3DSFL 3QNYB 1O6TA 1EQWA 4JPWH 4IMKC 1OO2A 2MQCA 4L4JA 2MPAH 5DMKA 3CFKA 2R27A 1PY9A 4IMKA 5DHYA 5T33L 3MJ9A 4NUPA 3KYKH 4P4KC 1OSZA 2OQJA 3WYRA 3RWIB 2P42B 1RMFL 2HFTA 4Y16B 1FJ1A 1GZPB 3F00A 4ONGH 1MRCH 1J1OH 4YUEH 1NEPA 2EUZA 3NESA 3QA3B 2WUBL 1NKZB 4MS8D 1LWUA 1J8HA 3MRLA 4MX7A 3AWFA 4P04A 3C5ZD 4XCCH 3OAKA 3W67A 3KWWB 1FORH 2FO8A 3KBPA 4J6IA 3G9RA 2QFPA 3LXUX 1CU4L 3S4SB 1EBPA 2GK2A 1BM3H 4H1LA 4FNTA 3C5ZA 3VWKD 5J56B 1JI1A 3SDCA 5C0RH 3CVHB 4FOMA 4WI3A 5GGRB 1D2PA 3OKKA 4PRAB 1PX8A 2WCPA 3WNNA 1LTBC 3PQYB 3QJFA 5TQ0H 3C87A 5ID0B 4FLHA 3ECBB 4XRCB 1A5FH 2QJKC 1HTYA 5HHMD 5FUZL 1MFTA 3TO4D 3C9NB 3P0YL 3Q5PA 4NQED 3WUZA 5C0DB 5A6IA 2AK1L 4GSDL 2QPDB 4LKXA 1NTKG 2PUQT 2OMWB 4FFZL 4G6KL 3OB0H 3PNWA 4WHTA 3VD2A 2CHWA 1PG7H 3BZEB 2D4DA 3LQZB 2YD0A 5IEHB 2X3BA 4JO3H 2V3FA 4L1BA 4PWKA 5F7EL 4XBEH 4IW4C 3D39D 2ED9A 4GAGL 3RYMA 1DEEG 4TF4A 1TR7A 3VXTA 1CF1A 4UUJA 3VXOA 3SPCA 2VQUA 1S4XA 1NBVL 4X80H 5SWSD 2G3MA 3PUCA 3ALPA 1FZJB 1M6OA 2VLKD 1FLTX 3IWVA 2OMXB 3QZMA 1FFNA 2B39A 1I9JH 4RDQG 5D1XC 5G4MA 3WHXA 2XRAL 2WO4A 4ODUA 1M53A 5EG6C 4EOWH 2QEJA 3HNTH 3PXLA 4N25A 4ENZA 2VTFA 4PV1B 3T1FA 2FQGA 3PHLA 2B59A 4G59C 2Y3AA 2V0AA 2CH8A 3NZHH 2CCWA 2WLLB 3NACL 4K55A 3W9DB 1IGML 2PP9A 3I6GB 2LLGA 1RUPL 1YNKL 5DQJB 2MHAA 4ODWA 4BUGA 4GSRA 5E51A 1VKXB 3D2TA 4NN6C 2VDQB 4NM8H 4LLUA 1YG9A 2J12B 2F54A 2OL3H 3FFOA 4HBQA 4U1NA 1XVSA 2DEYX 2VQTA 4KDTA 2X0UA 2A77H 2NYYD 3PGFH 5FW8A 1F3DH 2XG5B 1F4WL 3EFOB 1MCDA 5K9KB 1SLUA 1G5GA 4MJJA 4JUSA 1RUQH 1MCSA 1RIHL 4ELMB 1X44A 3D1MC 3UEQA 1KCKA 4Y5YA 1MZYA 3DV6B 1IM3B 1J0ZA 1S9WA 2F61A 4TQEH 2CPCA 1BX2A 4OD2A 5DJ0A 3KPRB 3L71E 1LK3H 1N86A 1ADWA 5SX5H 1RJZB 4LCYB 4ENEC 2I07B 4OFQA 1MLCB 1OGTB 5DMJB 5T1LA 5IEHA 3HBZA 4QRBA 4RETB 5EU4A 4BFEA 5D1ZD 4QXGL 2E75D 4P3CH 1AZRA 4GRWB 2PETA 2UV3A 2HSIA 1YUHA 3V6OA 2NR6D 2FWLB 5CS7A 3W39A 3MRJB 3L3OB 5IB2B 3OD3A 3MSPA 3F12A 2JCCB 4YC2B 2BRRL 4N8CH 1MY7A 5EF0A 3PWLB 5DMIH 4Y19E 3IJYB 4HHAB 4RFOH 4X4MA 2EDWA 4TQ8A 5HYSA 3LZRA 4RISL 5HHOE 1R3IH 1BFSA 1WEJH 1H3PL 1HVXA 3IDMB 5KG9B 2M1KA 5IFAH 4Z1PA 3ML8A 1M05A 2ICWB 1YEFH 4X6FB 5EF3A 4P46D 3R4RA 5HHXL 5DD0L 3UZVA 4KVCH 3Q9QA 4LLUB 2EE2A 4PJAE 2BO0A 5ANMB 1HHJA 3CWBJ 4ZFZB 3BSZL 1I1RA 1NDMA 3C1LA 3H1JG 2KERA 4AEIH 4RVBA 5CP7A 4Z7NE 1B88A 4MJ6B 2EXYC 3H3KA 4X7TB 2YD5A 4YR6B 4Y28J 3O3BB 4XP4L 3HRZB 5SX4I 3UG5A 3U7AA 1DQMH 4DEWA 2R44A 1AZVA 2IQAA 3OAWA 2WHVA 5F70A 5IHZA 2KQMA 4YGVB 2LU7A 4PJCA 1AIFB 4ZX5A 2DH2A 1G6RB 2YMKA 1GW0A 2XVKA 3CSPA 3HCVB 5F72S 4D3CL 4DHLA 2FAUA 1H8NA 3FCTA 3ZTDC 4FADA 1CQYA 1CFVL 3HPJA 4Y16D 1FZBA 3L70G 4EPSA 1IAKB 4NN6B 2GIYA 1NTME 1ODUA 2AANA 1EQ7A 5FHBH 3BASA 2N1TA 4DP2X 1VCAA 5HVGB 4E2OA 4Z7OB 2AQRA 3NG5A 2J21A 4U6XA 4X5WA 3RUGE 3BMWA 3BPLC 1L0NE 1BM7A 4L5FH 1Z0NA 2DQHH 2WXFA 3TT1H 3FTYA 3JVFC 3W39B 3ATAA 3CC2P 4TQIA 1N2DC 3QUXD 4ZUWA 5FHAH 3QDJA 5IBTL 3W82A 5GHWH 3WS3A 1IK7A 1XGUA 1I85A 4ODTH 3SGKC 5I0WA 4PEEA 3STLA 3DROB 4LVOC 4OFIA 1IFHH 1NU1J 1RZ8A 2DDQH 4MS8C 4RRPA 1VLXA 3ZE2B 1S7UB 4DP6X 4DOJA 1Z6JT 2ICWA 2WLNA 3KPEA 4X6FA 1YHQP 3C60B 4AQ1C 1T89C 2YD9A 2NXYB 4KQ3L 2X89D 1E9QA 3MV8E 1LTGC 1V8HA 3H42H 2ESVB 4TLTA 2VLRA 1BQHG 1BZDA 3B9KA 2JKXA 3NJNA 4U1HA 4JFPA 3TNNA 3MRCB 3TEZA 2MRYA 4DVBB 3RWEA 2WQSA 4FA7B 1SQVE 3MJ7A 3X3FL 5AKVA 3VI4B 2HMIC 2EC9T 2BX5A 5EOCJ 2KZ1B 4D7PA 1IFJA 4GW1A 1IQWL 5E79E 1XBDA 4KTDL 4YHLL 1NCCH 3RIAK 4N8VG 2CDEB 3CH1A 3BGMB 2FYUE 5L8RJ 1IU1A 1K5WA 4J8RB 4JR9H 1P7QD 2FATH 2VRKA 4JL2A 3QWNA 1DL7L 2V5YA 3L6FB 3N7NA 4FXTA 3WN5C 2W0KA 3DRQB 1WHPA 2XVLA 5GGSA 3STZB 3P3SA 1BD2B 4H5SA 2CNYA 5F7AA 3TESA 4JHUA 2R29H 4J23A 4TL5A 1HTLC 1UACL 5EH1A 1UQSA 4FDWA 5JXEC 1U8HA 3SDAD 2V3DA 2EACA 5E99L 3LXCA 1G0XA 3HE6C 3O4OC 4FFVC 2NY0B 3IS0X 4UT7H 3WY4A 2PYEE 1DLHB 1TMQA 3SWFA 2WXPA 3DOIA 3HE6A 5TDPB 4PLJC 3CMOL 3IDJB 2FYNB 4ZAKC 1KUMA 2G75B 3PJSB 1NDTA 3VGFA 1JUNA 5I73C 2Y69B 4K3DH 5IKCA 2EDQA 3S4SG 4R0LB 4S1SH 3OLGA 1S2EA 1IEAB 2IF7A 5ID1A 3FPYA 2NUPB 4OVNF 3HZYB 3MGAA 4QWWD 3VI3A 3B4NA 2B1AH 2A6IB 4NRXA 4U3XA 4C55A 1WFJA 3DUSB 3CX5E 2BS9A 2NY3D 3G5XB 5A16B 1BFOA 2HLOA 2CIIB 4JY5H 5BS0E 1YTZT 1HC1A 4XN4A 4X5RA 4LB8A 3J07A 5ENWA 3TZVC 5HY9A 3WY2A 3T71A 2ESVA 4ZTEA 1VQMP 1HESA 4ZAKD 1RZ7H 4J3UA 4QRPB 1QYGL 3PWPE 2KBGA 4RA0C 1HJCA 3C08H 1MG3C 4A6YL 2KLRA 5J06A 2DI9A 5GS1A 1RJCA 2B8OT 4M6OL 5ESQA 2J1YA 4NO0B 2K8MA 1DD3A 2X3AA 1BLNB 3AREC 3M1OA 3T0VA 2ENJA 3CWBD 1NFDB 3H9HB 2CJ3A 3MRPA 4ZX6A 5ADOL 4Y0GA 1FFRA 2VDLL 1I8LA 3WLWC 3GZKA 4JB9H 3U36A 3D0AA 5T1KA 4F80A 3ULUC 1DJHA 2ATPB 3K2IA 3VA6A 5C0BD 2DIJA 2ODIA 4WI6A 4H5SB 3JYBA 3KXDA 4IFMA 4FMVA 3E7KA 1MHCA 2ATAA 3V9CA 3QFGA 3KEHA 3ERXA 3A6CH 1S9XA 4GKLA 4N9OB 4NO5B 4F2EA 1X7TA 3L7EB 1XH3A 1OXYA 2H6PB 1BGYJ 1N73B 4PJFA 5K9OA 2NPSC 1OP3H 1N7SA 2Y0SA 5LCVH 4MCZA 1N6VA 3GBEA 3MRNB 1Q0EA 1DUZB 5I24A 4PGCA 1MHPH 3QQNA 2NUPA 4LDOB 2R0ZL 2YIUC 4R7LA 1CGSL 1U0QA 3HE7B 3MXVL 4NAMA 5DQ9A 3U25A 1KEMH 1GYWA 4B9JA 4PJ7F 3V7AG 1ZLDA 3ETSA 4OGXH 1DTUA 2ZUXA 4AYSA 2BCCG 3EJQA 2DL2A 3NN8A 3HNSH 1ZE3C 3RWDA 1YAIA 4H8PA 1JZDC 3V4UL 5IQMA 3MUGA 2K70A 1SVZA 3Q5RA 3HTKA 1E4WL 4QRPA 2W59A 1NBYB 3BQUA 2WXRA 3N40P 3QORC 4BRJA 4LASL 3UG3A 2Q1EA 2BPBA 3MA9L 5F89B 3OAZK 4R97C 4ABWA 4DP8X 2N0MA 5JW4M 1YMHA 4JFEA 2UX6A 3B2UC 3I2CH 1G7MB 5J89A 2Z31D 4OLWL 5ALBL 1HHGA 2X7LB 1AQ5A 3H1IE 1GAFL 1NCHA 2IH8A 3VWJD 4E9WA 1I1AA 4CC4A 3GI8L 3S8GB 3FQWA 1ZXQA 3QQ9C 2ZP0T 2FVNA 4QUOA 3I9GH 3VGAB 4DEPB 4I18C 1RQVA 2IMNA 4XMTA 3BRTB 1GC1C 4LLYA 5D5MA 3HN3A 4HPOH 1DO5A 1ZHNA 2IGFH 4U6TA 4NZTL 4XNUL 5JHLL 4LVEA 4N8VB 2IWKA 1FG2B 3PAUA 4P46C 1DR9A 1JWUB 4B9GA 2EINB 4NN5C 3MMEA 3NIDF 3DXAB 6CGTA 1NTZJ 3K7UA 1VEMA 3FUJA 2XA8L 1ET8A 2VDKL 1MEXL 5DUPH 3RWHA 4U6HB 5TGBA 2ZJSL 3DDFA 5KVFL 4FABL 5EDXA 4GQ9H 3SDXA 1W2KT 4RDBA 2KPNA 2VDPB 2HKHH 5GRWA 1J05B 2JXMA 4OZGB 3H8NA 1DQJA 3HLKA 4EI5D 3QJHB 4FYSA 4LLQB 3CSGA 2OJEA 5EPMA 1OW7A 3HUJE 3W9EA 5LDSA 2D03H 2BSED 3UCRA 1CS6A 2ZVNB 2OYHA 4BFRA 1FVDA 3AY2A 3MRBA 2HKFL 2RH0A 1GZPA 4AYGA 1RF0A 3OKLB 1LJ2A 5GHWL 1F8TH 1CC3A 4WI2A 4XXCA 1HYSC 4PRPB 2P10A 1HUCA 5C0FB 3GBNH 4GKNA 3TGUD 4QHMB 4MMZB 1HZLA 5D7KD 4IIQA 3ZMNA 1AKJD 3ZRFC 1SJEB 3QWRA 2NZ9C 4M56A 3U46B 4KDVA 5I73B 2QMJA 1YAZA 4M29A 4H1LB 4N0UE 3HS0B 3RJOA 2WOYA 1KYOH 4Y5XA 1A4JA 5AW1B 2HTKC 3PQYE 4IMLA 1UT9A 1E4HA 2I32A 3KDMB 3NJFA 4HEPG 4LVNC 4N2MA 4P5KB 3OHXA 2IV9A 4KK8D 4DN4L 5ID0A 2H3XC 4JBSA 4FNLH 1ZR4A 5GGQH 2PPAA 2WMPA 1MNNA 3EAKA 5C0DA 1CE1L 1XHHA 5EZIL 1BBDL 1OANA 2K3HA 4D6TD 4IOFC 4CADB 3H1JE 1BE3J 3ZDZE 4Q9CA 4CU8A 4N8VA 4F8QA 4KU1A 5SWSA 5T3XE 3GXNA 4JG0L 3D50A 1S9KD 3O6MH 3D3VD 3UJTL 3QUXB 3WUWB 1M7DB 2R0WH 3EDKA 3EO1B 4L73A 1HGVA 2FGWH 2P47B 3D25A 2QJPC 4AEHL 2YMTA 3BSGA 3DSFH 4GKZB 3SDAB 3MXVH 3S5LA 1YEEH 1K73Q 3P4OB 3RK3D 2WPRA 3S35X 2WTPA 4HS6B 1LT9B 2VLJA 2Z3FA 1EO5A 3PY9A 3V4VH 5AB0A 4G5ZH 3BAEH 5FO7B 1YUKB 1AQKL 1JBJA 1NKOA 2FRGP 3O0RL 1RUAH 2IADA 5E9DD 3QO1B 1J1XL 1HIMH 4UBDC 3WHE0 1HVVA 2IWGA 4AQEB 2X4RB 1FCGA 1JPGB 3T1FB 3RGHA 4CL7A 2HODB 4XN5A 4H2CA 3WE6A 4LCWB 2EVGA 2VSKB 4WY7H 5C0FA 3FHQA 4K7PH 2X1QA 1SM3H 4Z7UE 4YLQT 4ELDA 1EXGA 2P5EB 3I6GA 3NZ8A 4KJPD 2ARJB 4XPBL 1MCHA 5FYKE 5IB4A 3M86A 2K45A 3CFTA 5JXED 1DJZA 1YYML 3P3TA 3O4LD 4E41D 1UJ3C 5D7JC 1FL5B 2BSRB 3PU7A 1B4TA 5CFHA 2YQBA 3DDGA 5BXFB 4OIAA 5JW3L 2J55A 4FGMA 3OHXB 4F24A 3LN5B 4X6CB 2NY6C 2Y5QA 4H26B 3TNUA 1YQVH 4BXVA 1HHIB 4NQTA 3LHAA 2B14A 5E2TH 2X9YA 2ALWA 3AXLB 2X6BA 4F7PB 2FR4B 1DVXA 5F88A 3N55A 3O3EB 1CLZL 2UXGA 2ZWYA 2BJMH 5ALCL 2PR4L 4KO9A 4ZS7H 4JQVA 5IQ9A 5HGGS 1D5XA 2QSIA 1ZOXA 3ABMB 2NY2C 4WUUA 4TTDC 2NT0A 2Q5BA 3K72A 3LRLA 1G9HA 3FTGB 4OLYH 2VMDA 5B1KA 1LYQA 1KFGA 1YC8A 3KH3A 4NQSA 4Q6YA 5HDQL 1AZBA 1RFDL 5CEZD 2R2EB 4KJQC 4NRZB 2XBZA 1XGZA 5JHDA 4YK4B 1MVYA 3U4KA 1JM0A 1WD8A 2C9XA 1HJ0A 1SQQK 3F2LA 5MI0C 1BF2A 4JJHA 1EX0A 3CFUA 3IDMA 3GI9L 1IE4A 2COVD 4KUZH 4RWYL 2CLVA 5DHVA 5MEOA 2R0ZH 4HU2A 3P32A 3SFDC 3U82B 3RJQB 1ZP0C 1N8ZA 3GUTA 3L35A 1W2EA 1I9EA 1UWEH 2VLRD 4L9LB 2A74B 5FA4A 3B2UD 2VIRB 4FL4B 3Q2NA 1K4DB 2IH3B 1VRSA 3CFBB 4HOZA 3HZMA 5FO8B 2EYRA 4NQDD 5IB1A 2BVPB 1KILB 1DJSA 3DVNB 4YHIB 3ARDC 3QEUB 1ADQL 2BW4A 4QCIB 2K9YA 5D8JL 3LN5A 1EC5A 5GSVB 2VERN 1KN2L 5I5JA 1Q9WA 5GGSY 3SQOH 3UTQB 3PLNA 1G0YR 5SWZD 2IALA 1JVOA 4ZXBB 1AC0A 2IG2H 1R6VA 5AW4B 3X11B 2AI0H 2Z4QA 2HFGL 1L9PA 4PYHA 1NIAA 1XMEB 1YPZE 3VRJB 1DN0B 2DF3A 2L91A 1FDOA 2IFNA 4MD5A 3CTTA 4C4KT 2J4WH 4M4PA 5HHOD 3C60C 3BAWA 2R0LH 2KZKA 3HPLA 1MLBB 1PD0A 1FI8C 3GSNH 4ZO7A 5E8PA 2CDGB 4M6OH 4PJ0H 4JPVH 3L54A 5HDQH 1GH7A 4EQ2A 1VERA 4IYKA 1CFMA 4RMTA 4I5BB 3ULUL 4Y5YC 1TU3F 2OYMA 4LF3B 3V9FA 1TEFA 4K3AA 2BC4B 1XF3A 5FHAL 5CN3A 3HRPA 3RTQC 2RALA 3CXHH 1FIEA 1M71A 3R0NA 4YSDA 2YLKA 5DCCA 1QEXA 4I6MC 3G3LA 3AE8C 5G55A 3RTQA 3RE0A 1RZIB 3K2MC 4ES8A 4U0QB 3MKKA 4ALAL 4ZKPA 2H9GA 4AGOA 3KHQA 1X9UA 4BCZA 4ZUVA 3QI9C 4HDIB 4Q52A 3W2DH 4ZNCD 2J5WA 1ZT1B 1CICB 2J57A 1SOKA 4I0PD 5CEXB 1YJWP 1EAOA 3QPQD 4GW4A 4JPSA 4WWOA 2V2TA 2EYRB 4R5VA 4ZSOA 4AEIL 2VH5L 1PNDA 4OQTA 2IPTL 3MOQA 3NCJL 1T1WB 4Q9QH 2IH1B 4QRTB 4DERA 2J8UA 3OMAB 3QW9A 4L8DB 3QDMB 3UJIL 5DD3L 2JI1A 4PTTB 3K71A 3LNDA 2Z8VC 2J2ZA 4EI5A 2H0FA 4LSRL 4WHTB 1DQLH 2B4CC 2R83A 1S3RA 3HI1B 4BE6A 4F7CB 4LEEA 1J9QA 1UB6A 1XH1A 4Y5VC 5J6GB 2BNQA 3VMOA 2DBJA 1DUYA 4PV8A 3I3EA 1UOVA 5KOVC 1LE5B 4RMSA 4S0HA 3JWOH 4PMFA 3HR6A 4M6NL 4GXUM 1SXSA 5EN2B 1XR8B 3DETD 3GI9H 5CZKA 3VMPA 5DZVA 2W9DL 5C0ND 5T1LD 4I9WD 4AM0Q 1GMIA 4X7CC 2L04A 4IKNA 1ZHKA 1U93A 1A14L 1H3GA 2VDRH 3O3DA 3MLPA 2Z8SA 1CG9A 3IDXL 1MCKA 4JFZH 4LFHG 4WHDA 1SOQA 4B9ZA 3AEFC 3C12A 4GJTB 1FDLL 2H2SC 3OB8A 5F0LB 5IG7A 3L4ZA 3KBEA 4N6RA 4K8RC 3BH4A 1OOAA 3FJTA 1IM9D 2N0KA 1KB9H 1WV7T 5C71A 3LV3B 1YEEL 43CAA 5LUMA 4U1NB 2D7QA 3QPXH 2VZVA 4ZUTA 1VZGA 2Y9RT 1NEZA 1WSST 4PD4D 3QQDB 2IMMA 4E9TA 2M2DA 4J2QA 1BV8A 5MI0B 1WISA 4MAUH 3J2PA 3KLQA 1JTTA 2D7PA 4DK3A 3NMDA 4Q9QL 2V8LA 1NUFA 1KB9D 1S9WB 2HLAA 1NAYA 5MERB 4KNUA 1X3DA 4JKMA 25C8L 4NI6A 4WB4A 1Z3RA 2J2ZB 4EI5B 1JOCA 2LT9A 3MRPB 3IR9A 4JZNA 2V5RA 2V7HA 4R2GB 4XO9A 3F7PC 1G7PB 2GUVA 1QBBA 5I6MA 2YMXL 1R3JA 1SYSA 5DJYB 3CSYB 3HNTL 4UDTB 2HKFH 2UWEB 3V6ZA 4MA8H 3SY6A 3H2QA 1C16A 3KVPA 1JPTH 4GEJA 4HLZG 3OAYK 3RGVB 4HULB 3O2VH 3KPQB 4BZ1L 5E94B 1WAAE 3CDGA 5DURB 5FIEA 1HOCB 1EPFA 4G6JH 4AVIA 3ARTA 4QRFA 3DBSA 5E4OA 3KJ4B 1PV3A 1KG0B 1FG9C 1OZUA 1U8MB 4K3HA 3T4YB 3HB3C 4EUPB 1XSJA 2B9AA 4PJFB 4RQQB 5K9OB 4PJDA 4DGYL 2IIJA 3POCA 2EKSB 2VDML 3CAFA 3LPWA 3EJRA 4D94A 3CCEP 2WT7A 3WS6C 4U6VL 1I3GL 1BVOA 2IVFC 4JZOA 3DO3A 3V4QA 1BLIA 1QBLL 1ZANH 1KXTA 3CFMA 3QFJD 3ZKND 1J0IA 4OZHB 1AKJB 1BCIA 1N64H 3QNZB 5ACMA 4GMSH 4QTIH 5FFOA 5AW0B 4MJ6A 5AVYB 3EYVA 4F2MA 3MREA 4NZDA 4F2FA 3OKDA 3RPBA 4HSCX 2ZCLL 4MHHI 1YEKH 1HXYB 2QV4A 2MJZA 3FS9A 4BV1A 5HI3C 3DV4B 2ZT9B 3FOMB 1KGJA 4F9PC 2FFDB 4FFWD 2DQCL 3O8XA 1OM9A 4ZAKA 3IJEB 3Q1SL 3ZTJG 2AERT 4TXVB 5C9JB 4XP5L 2NZ1A 5I1CH 3IN2A 3TJEH 1CZ8L 2J73A 4IBTA 4HT1L 4XNZB 2EDMA 4ZMPA 4P23D 4FKKA 4MA3B 4Y5VB 5CCHE 2XWJB 5DS2A 3TA3D 3MACH 2VXQL 4QHLB 4MVBD 3VXSD 5I1LA 2ZAEB 1TTFA 4YBQD 3M46A 3QORB 4QLRA 5GGTA 4L3CB 5JUEH 5AOIA 2F58H 3E7JA 1D9KB 5HI3D 5HYEA 1NCBH 1TQTA 2KS1A 5KJ7C 4RGND 4XB3A 5J57B 5AOLA 1QO3A 2K88A 3KHUA 2EDJA 4C83B 2BNRE 2R1WB 4OCRL 2H45A 4IHOB 4YHMH 5KBMA 5CEZL 1OAJA 1MRFL 1MVUA 4R7VA 2YS4A 4KJYB 2FJFA 2H3KA 3RI5K 1UA6H 2E7DA 2X87A 3UADA 3D4CA 4JPZB 1V3KA 3NCMA 3WHE1 2OPCA 4D0DB 5K59E 2XWRA 2AMUA 3WMQA 1BGXH 1ODAA 3AE3C 3NJMA 4LLMA 4W80A 4P2YA 2NPSB 3CN3A 4F8PA 3GXPA 1H5BC 3NDYE 5DK2B 5EUOE 2CJUL 2XZQL 3ULAB 3L71D 1YI2P 4FG2A 2VUKA 2YZ1A 3RY6C 3MRMA 4W4OA 1PD1A 3FCSB 2E9IA 2MSPA 5DDHA 2HVKB 3HZVB 3V6BR 1NVOA 4JRXD 4NRYB 1RPQA 2XDJA 2DLFH 3RWEB 2AF2A 3EJTA 4AX3A 4NKDA 3S2AA 3SE8H 4MKMA 1Q1JL 1UFUA 3D3VB 5E08H 3VSVA 1ED3A 2F18A 2LTQC 1VSCA 3B34A 3HZKB 3PAYA 3QARA 5T3XL 3HUSB 4PJEE 4NQDB 4G6FB 1GW6A 4NN7B 5E1GA 2ZJSE 5KVFE 1A2YB 3FX0A 3HR5B 3ZE0F 1VFAB 4HK3N 5JNYA 5L2KE 2YXFA 1FSKB 3ZOAA 5EEUA 1YZZA 1HX0A 1IQDB 2QJYC 4MXVE 2VUOA 4X4XA 3NK4A 1GJIA 3CX5I 5CCGC 2B1OA 4MJIA 2IGTA 2IPUK 4IS6B 3KDMA 1CDHA 3KL0A 4MZIA 3C9IA 4HPYL 3ISWA 2KS1B 3KD4A 4U1MB 1XFPA 4PS8A 1WD9A 4WKZB 4G82A 1USEA 5CJOL 5FWRA 2XA3A 4I77H 4OGQD 2Q8BL 1MI5B 3T3PE 3VD9A 3B5ND 1GGBH 2W8CA 3BP5B 1PYWB 2QVTA 2RGSA 2FK9A 3EGSA 1IFNA 5BMFH 4P2OD 5I8KH 3TTSA 2C3XA 4CADA 3BAEL 3II1A 2DIAA 4BFKA 1A6AA 3D05A 2FB4L 3ZTJH 2AFNA 2PLTA 4UZUA 5F1OB 3T4AB 1Q1JH 4KKQA 2JJWA 5E08L 1T7ZA 2MPVA 3ATBA 4HGMA 4NRXB 4PJGA 4QDGA 2ICES 1FVCB 5DVPA 1G1OA 3KL3A 2NW3A 2DWSA 1QVOA 1F11A 3G5YB 4CC4C 4F37F 4K94H 4OGQC 1AXTL 3INUL 5HY9B 3QFJA 4TNVF 3V0VB 5GJSL 1W8OA 2HT2D 1N6UA 4HFUH 2FATL 4QRRD 4Y8DC 2A73A 4P07A 5E4EC 2Z64C 1WICA 1LO4L 4G2AA 1NMCC 4HSQA 3MUHL 2XVGA 8CGTA 5KJRL 4HPYH 3O2DA 1KILD 4I1PA 1KMIZ 1D6VL 2EXYD 2FLMA 3B83A 2KLVA 3B7RL 3BEWA 4KHXL 4F7KA 4X4YA 2LU3A 3TJEL 1FE8L 1E2ZA 1SN2A 2AS5M 5IVZA 1F58L 4HGKC 4AH2B 3V7MA 5CKGA 3TO4B 1WIPA 3B7SA 3ZKMC 3V4PA 1AJ7L 3D85A 2YSSA 4DO6A 4NZ8A 3TL5A 3U7YH 3BCDA 5DEGB 4JK0D 3IDNB 1EMTL 1T2KC 4M6MH 1JZGA 3U59A 4NT6A 4ELMF 3W0WE 1NEZG 5JUEL 3SDDB 5E6RB 2PCXA 3T6ZA 4NO2B 4LSPL 3COOA 2NY6B 3PYCA 3SGDI 3NTCH 1L4AA 3L1EA 3QIWB 5IK3A 3RURA 2XWCA 1QLEH 2AEQL 3NEEA 4GRWF 4LSTH 1S5LH 1P6AB 3KR3L 4MSWA 4M1CC 1UATA 3WIFA 2OK0L 1G6RH 2WKOF 4NZFA 4EQ3A 4OFYA 1D3CA 3ZT7A 1CXIA 5HXMA 2ZTBA 3D39E 4HKBA 2FL5A 3QEQE 4JQIA 5EIIA 5IQ9B 1VFMA 3L81A 1MJUH 1O7DE 3LPOA 5ILTL 2ZYIA 3AE4C 1MFEL 5APUA 5D1QD 5EO0B 1WIUA 4PY8I 1Z9NA 4KWUA 3NSYA 5PAZA 1IIKA 5JQIB 2NLJB 2J43A 1OVVA 4HS8H 1ET7A 2OQJB 1IBDA 1T03L 3HG1D 2L7JA 3BVWA 5CJ5A 5HYSG 3RP1A 4IGBC 5DYOB 4MTMA 4KFMA 2EO1A 2HG0A 5DEFA 4LK4A 1YNTB 2PN5A 1E67A 3ORJA 3EADA 4N2IA 1E2WA 1ID2A 4KRLB 3C75A 1ZPUA 4XNMB 4KI5D 3PAVA 4DGYH 1NCWL 2YAQA 5FUOL 3IGAB 1G9EA 3B6SA 1SLXA 2MQ3A 2I24N 3ARQA 4X6DE 4RGNB 3EH4B 4HUCA 1BVKB 1WA2X 3ELAT 1QWUA 5C09D 4G3YH 5C0AE 4BXSV 3F3HA 5MEOB 1JCVA 1F02I 1OTSD 3D6GA 1JVKA 1WH0A 4K3EH 4U3CA 2TRYA 1ULVA 2DQEL 3DIVA 3CDZA 3MV7B 5I19L 1SQXJ 2VIRA 5FO8A 2GSGA 4P4RA 5I1EH 1NCCL 4OI9A 4B50A 5KN5B 4KI5C 1TTGA 5IM7B 5PCYA 3EYFB 5MEPB 2WZPA 2QJDA 3KCPA 4K5MA 3X3FH 2VDOB 2ZT9D 2WNGA 3VMAA 3VFUB 1ZAGA 3WAJA 1JRHH 3LZQA 1U3HC 1K3ZA 3K3QA 1FNSH 5D1XA 1GZQA 3LIUA 1YEHH 5BNXD 2DMKA 5FOJA 3F7RA 2D7TH 3E80A 2PTTB 2Y7LA 3TZVD 4LEOB 2EIZA 2XKUA 5IT2L 3S34H 4BHUI 2I5YH 4UUJB 3VXOB 4I0PA 1FBIH 3CZGA 1WUNT 2CDGA 4ERSH 1IM3A 3KZIH 1MRDL 1XTMA 1XZWA 2F8OA 3C60D 3D34A 4LPTA 4XC1L 4ETQB 4E0RB 3OZ9L 4HQQH 2VDQH 1Q0YL 2CO3A 1A02N 3QYCA 1X9VA 2DBLL 1JHKH 4GODA 1P53A 2CM5A 2DQMA 4J12A 4MD0A 4NLAA 4XXWC 3TJHD 3TLRA 3LNFA 1TQWA 5FYJE 3FSWA 3FO1A 3GMPB 3NCJH 4L3AA 3RGVD 1HOEA 4YSEA 1IE5A 5FXCH 5C2BH 3VFNA 3V55A 3NA9H 1YYLL 4JO5A 1MFZA 2VZSA 2WKOA 1TENA 4ONFL 3UTTE 5DVLA 3MCG1 3RVXC 3QRBA 5JPNC 5EIQA 5KSBA 4L1DA 1FGVL 2C9QA 1LTAC 2IAAC 1OAKH 3OL2A 1UXSB 1GKOA 2WXMA 4OF7A 4UB6E 3F5WA 3TEWA 1A9BB 5JZ7D 3PRJA 4O5LH 5I8EA 1BQHB 3K46A 4C47A 4ELMA 2NX5D 4KROD 1KLFA 5T1DL 2CUHA 3MA7A 4C57C 2O6DA 3QDMA 3EO0A 1WFUA 1X4ZA 3JWNG 3KAAA 3N04A 3DGGB 5DU7A 4GG8A 3JV4B 5SWZA 1JVLA 2GJ6E 3LPFA 3WUWA 5IMOB 4WTZA 3D0LA 4RMVA 2Q5UA 1U41A 4YBLC 4UT9L 1QLRA 3FRUA 2VISA 1CK0L 1NLBH 4M5SA 5DRWA 2XN9A 1ZRUA 3GLDA 5BVPL 1CL7I 3IAPA 3K6NA 3H1ID 4XCNA 1UACH 2V37A 1RVFL 3GSNL 1IBGL 4BELD 1L0LJ 4N24A 1NTZK 3TV3H 1XXDC 5DWPA 3TA4D 1PMYA 1PFIA 12E8L 4HH8A 3WKPA 4LARL 3GIVA 5FUCE 1GL4B 2HODA 5I1HL 3HE7C 3FQXB 4FP8H 2YO2A 4GAYB 4XAKE 1M05B 3FF8A 3ZDXB 1NICA 2KZIA 3BFQG 4LP4A 1EH9A 3GXDA 3QXAA 5ACZA 3EF7A 3NQKA 5JHDD 5B39G 3N41B 4YL9A 4ZFZA 1HHJB 5JA9A 3LN4A 4HAKA 1QEWA 1SHMA 1YEHL 3E2HC 3NRQA 1OVUA 4HFUL 4P2QE 2QV2A 5LQBL 3BKCH 3FB5B 1EAPA 4YR6A 1K4CB 2LXBA 3VN0A 1KY6A 4EVNB 1P9MC 1C7SA 2YD2A 3LKOA 2VMEA 5L0QC 2M83A 3CG8A 5KJRH 1L0LK 2C3VA 2GTWB 4OSUH 4PBVC 5FK9A 3ALWA 1KACB 2E9WA 1JGDB 1T0PB 3T3MB 5MERA 4P2QB 4M1CD 3A47A 1KC8Q 1NWOA 3HPJB 4JE4B 2ROYA 1RF1B 4ZX3A 1OZTG 1JP5A 4LMQE 3N0AA 1EJOL 1I53A 3GRGA 3VFGH 1QOKA 5C07B 5CCGE 2ZF8A 3NJIA 4GG6A 1QHPA 2KLTA 5DRWB 3GMRB 2R7EB 1X79B 3UYRL 1I9RH 1XF4B 2DWXA 4NRZA 1MW1A 4HUWB 1E28A 5JOPE 3ETBF 3GO1L 3X1GA 4JY6A 4MJ5B 1H88A 3QQ3B 5JW4Q 4CILA 2NXZD 3FU9A 3ARUA 4WK2B 2XNAB 4PJ5D 1Y0LB 1RIVL 3EH1A 1IO4A 4EN3A 2E56A 1LP9F 3DECA 1IK9A 2CM6A 2GI7A 4ORGB 3UBXA 5HI4C 4WU7B 5C0EA 5CSGA 4RBPH 3C60A 3Q01A 5F7EH 3S1KA 4J27A 5KS9A 2CBQA 4KK6C 3LN4B 1HI6A 5AG8A 2ZWSA 1R47A 5D7LB 1BAFH 3GHPA 1KXQA 4R2GC 4TUJA 1VPOH 2MJWA 2WQAA 3VXUA 3ZUCA 3P3UA 1NC4A 1FL3A 3GRWA 3LKOB 5D1XD 3ZZLA 3FQNA 2VXVL 4ZAKB 2HRPL 3HN5A 4XA4A 4ZBJA 3EXJA 2AK4B 3G5ZA 2OMNA 4ABVA 2A0LC 4JLRB 4LLWA 1A1OA 4HK0B 1KC5L 1LNUB 4B95C 3U4EB 1SHWA 2JJLA 5C0AB 1RF1A 2QM8A 5FX3A 3SOBH 1TU2A 2AITA 4RFEA 4DK5A 4PJ9A 2VLLB 4R7NA 2VZOA 3IU4L 4ZW3A 4QXWA 4MJ2A 1EFXB 5E5MA 1MAML 2YFOA 1OW0C 4PTUB 3U4BL 4IHOA 4KUCD 3CGTA 4D7BA 4I5BA 1MRCL 2PYFB 4MMXA 2O3JA 1UT2A 4PRIE 3CBRA 5SV4A 3OJ2C 1N68A 1MW0A 3SDAC 1C5CH 3OKMA 1OB1A 2QSQA 3L4TA 1D7CA 3OVUB 2Q3XA 4PGDB 1VFBB 4N5EC 1AYOA 4EN3B 4L8SB 1QASA 1RUAL 1S7QB 2ZYDA 4YZFE 3FU6A 3ZTNH 1PX4A 1S8DA 3MRGA 2E76D 2HPOA 5H2FE 3S5ZA 5IB1B 4YDMA 4OVVA 1N73A 4LOVA 4DFHA 2V2TB 1XIWC 5DGRA 1Y6NR 4KJPC 4QR7A 5GRUL 4XZ4A 3OB0K 4GAFB 3IFMA 3FN3A 1JNNH 4QRSB 3MZTA 3PS6A 4LGSB 2HJKA 1TDQA 4NKDB 3UTSB 5GGVL 2HT3C 3FUKA 2BCCD 4UV4L 4WEUD 4PVBA 1YY9D 4L0ZA 4GOFA 1B9KA 1CZ8H 3O11B 3DHMA 2YEQA 2P5PA 3FOLB 2OTUA 1T03H 1R46A 4WWID 2WP3O 3AJ7A 1KFMA 1NQBA 1Q9LA 2WW8A 1KTJA 4IIZA 1GZHC 2R0KL 3K80A 4CNIA 1TU2B 4S0TD 3TFKD 1LO5A 2XTJC 3L3KA 2P5WA 3D85D 3IJ7A 3CN2A 3L4XA 3ZTCC 1PJ9A 4HAFA 1FAVA 3STBA 4APXB 1B0GA 1WCBA 2AEPL 5BZDB 2PO6D 5T1JA 2YARA 1JZJA 3BP5A 1RZKL 3EG9B 5KSAA 3JSSA 3KYNA 4IFFA 3B5TA 1AJYA 3OKKB 2CK2A 4P9HL 2WXGA 1RZFL 2AJVH 2VJ0A 3BVXA 1D5IH 3WG7B 1J10A 4QRPD 4D8PB 3CZEA 5DQ9B 1ZMYA 4TUKH 2R2BB 3OZLA 3DXAD 2RTTA 3WE1A 3NFNA 4YC2C 2I9TA 1ETZB 3V0VA 3VD0A 2L8AA 1RD6A 1UUSA 2DWTA 4LOFA 3I9IA 4HPOL 3UMNA 2XJKA 4LKCB 5ISZB 2HLAB 5A2IH 3FQ4A 4Z7NB 3NFSL 1YMMA 4LEXH 3X1BA 3AITA 2O01H 2O1KA 1DEEA 1HZHL 3EJYD 4JFEB 5F8RC 3ZL4H 4OUUB 5G4OA 1KILC 1LK3L 35C8L 3EFFA 4RGNE 2HYMA 4P2CG 1JZ5A 4N22A 2IYOA 4JFHD 3GW6A 3TEUA 3NP4A 4GW5B 2CO1A 1NWQA 1TMCB 4BRYA 1S7VA 2X4SB 4NT6B 4TNWK 3NJGA 5CCKH 3SKUD 2E74D 2PPFA 3FULA 1C9SA 3PIQB 4Y1TA 4M8VA 4JM2A 2D3VA 2YLHA 1AD0A 3CU7A 1QRNE 3FONA 3ABLB 3QJTB 4KPHL 1M7IB 4O2FA 3WKML 2VLKB 4UB8E 3MBWA 3B2PA 1E8WA 4Z7IA 2OSXA 4DFIA 3EGXA 1U95A 2MCMA 3AS0A 5IF0B 3IFNH 3PUUA 2FH6A 2XG5A 3EFOA 3QUZC 3DJZA 1R75A 5FAAA 3QUZA 4ZMYA 1FZCC 4YEFA 5B3SB 1WZLA 2H0EA 4F9LC 3U0WH 5AAPA 3ULVD 3CCVP 4F9LA 4NBXB 5HPMA 3WTXA 4I9XA 3OKDB 4XVSH 3M7FB 3OM3B 4RA3A 2ZX9A 3WY3A 2WXHA 5BQDA 3FUIA 1YNTA 2P4AB 2LGNA 5DS8B 2YEZA 4I0PC 2WLMA 4GO8A 4PG9B 4PWHA 1FCCA 2WWNA 4GIPD 4ZW6A 4XMXA 3B6SB 4C7NA 3C09C 3DURA 4I7ZB 2H47C 2XZZA 2YBRA 3CXDH 5HGDA 3ETBJ 3JQOB 4G6MH 1UURA 4BFJA 5KAQF 4OUUA 1AZCA 3U2IA 2WQXA 3GFUA 3MJ8A 3GBML 3V0HA 1IL1B 5C0NC 3QO1A 2AJSL 4WWIA 5T5NF 1YJ9P 4P2QD 1Q9KB 5I5IA 2IBZE 3V5HA 4N8PA 4XOBA 2DOCA 4JW3A 2R1WA 3LZLA 4HISA 2KQNA 4Y2NA 4WF7A 5M94B 3Q2CA 4NO3A 1T7VA 4RAUB 4E9RA 3TBSA 5IROD 1QFWI 2G60H 2O61A 3KCPB 1F4YH 2R39A 3RUGA 3K6SB 3PDOB 3BD3A 3VJ6B 5ANMA 5SWSB 2FQDA 3LXBA 3MBWB 2ADIB 1PEZA 1NCAL 3UDWA 1DCLA 3A4AA 1KJ2L 4I85A 3P9LB 4FQ1L 2IZ1A 2ZG2A 3QQ4A 2X9XA 4FQXB 5C3IA 2OTLP 2J4WL 4OKDA 3MRMB 3ELQA 3GMAA 5EDSA 2DQUL 4KV5F 1X4XA 4NQUA 2W6AA 2HG5D 1URZA 3M1BB 2MQGA 1EZLA 4ETQA 3D9AL 4XPHH 5CINL 1AHWB 1KPVA 2VXQH 3OXRA 3WTTA 2WLZA 1VESA 3L3JB 4GAGH 2JTDA 3HLAB 5T3ZL 3JTBA 2V7QJ 4M4RB 4KZEL 2IDQA 4O58L 3L16A 4G9FA 1YDPB 4WTZG 5HHPA 2I27N 4C56E 2ZSVB 2KLUA 3Q5YA 3QHZL 3RWIA 4PJ9D 4Y16C 2WWKT 5C07D 3TU6A 1NU1K 1NIBA 5AZ2L 5I1DA 5I15H 2F19L 1HKLH 1AVOA 4OTXL 5GPRA 3OR7A 1FL5A 2BSRA 3MRQB 5JMRA 1PP9J 2K9FB 2YD3A 1F86A 5B1JA 1AIZA 5BVJA 3CXHE 1HQ4B 2H2PD 1KTDB 1CBVH 4POYA 2GUSA 3QRGH 3IPFA 5CILL 5D7JD 3UAJA 2ALAA 1MCNA 1MI5A 3VNZA 2NW2B 5I8EB 1H89A 1EZUA 4MD4A 4A67A 3WKQA 5C0RL 3QG6A 3SQRA 3BSHA 2AJUH 4DPRA 2FX7L 5E8EB 4QYAA 1AD9A 3LKRB 3H4FA 2O1JA 4FMKA 4ODTL 15C8H 4OAWA 4F37K 2I9LB 5LWYL 2WBXA 4LSUH 2VLRB 5B4MD 4U1HB 1IBFA 4WFGE 3ZX1A 4PJXA 8PAZA 4UTCA 2OZ4H 4JUTA 1NFIA 1QVOB 4Z7WF 2F7PA 3UABA 1MREL 2ITEA 2RQEA 1CE6B 5BVPH 1G7LA 2Z93A 3B9EA 2BSTA 3MOAL 3BE1L 2WBWB 3CCJP 3BCFA 2D7OA 3CN4A 4U1SB 4FXGC 2DM4A 5BS0A 2LAGB 2E3VA 4O4YH 4AUJA 5A40E 4XXDB 5C0AD 4AM0B 1I8MA 5E6IB 3BKCL 3VXTB 3BUQA 2HN7B 1TCRA 1OIOA 1F3DJ 2PNDA 3BPNB 4IKLA 5DR5H 1KCUL 2WSPA 2X4TA 2GA1A 2UZIL 4G6AC 5DA4A 1QFPA 5I26A 2CKBB 1TYRA 4D0CB 4ONFH 8FABA 1ZXGA 5E2WL 4Y4HA 4PP2A 1U8CB 2YAMA 1NL0L 3G6JF 1ASOA 1GR7A 4Z3EA 1A21A 4Q6IA 1H6UA 5D7HA 5F71A 1RURH 1OZHA 3QIWA 5IK3B 2JKNA 3CCQP 1WC7B 1XEDA 1JI2A 4AXWB 3H85A 1WT5C 5IQ7H 2KUTA 1NOFA 2PWEA 2FHBA 4TUKL 3WNOA 5F6IB 1OSYA 1OGSA 1NCTA 1D9KC 1OPOA 1EDIA 3GBLA 3A5VA 2Z4QB 4FZ8H 5KVEL 2P8PA 1A7QL 2GSIA 2UUDK 3AABA 3BWUF 2B9BA 3QCTH 4JFDA 3VWJA 5IW1A 5HHMB 1R17A 3OF6A 4OKVB 4PJFE