5AVZB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avzB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avzB02
5AVQB 5APUA 5AVWB 2VRSA 5AVXB 1S9KE 1H89A 3LIEA 3TYYA 4C7NA 2ZXEB 5APYA 4I6MC 5AW7B 3LIDA 5AVSB 4LC1A 5AW4B 4EOTA 2C9NY 1IO4A 2WWWA 4I2LC 3TNUA 3M0AA 3UIAA 1FAVA 2Z5IA 3KQGA 3WGUB 2YNYA 5APSA 5AW0B 3WGVB 5AW3B 3HTKA 5AW9B 3VTPC 2Q5UA 4B86A 3M91A 4HYTB 1GK4A 3TK1A 4AQRD 1KQLA 3HE4B 1HWTC 3A2AA 3L35A 2QM7A 4M3LA 3A7OA 2YO3A 3O8ZA 5AW8B 1OXZA 1GK6A 2R3CA 2P7JA 2W27A 2IPPA 3A3YB 1SLQA 3M0DA 5APWA 1A02J 1CI6B 5AVYB 4C7NB 1A02F 2H7HA 5AW5B 1H88A 4RETB 5AW1B 5APTA 5AVZB 3V4WA 3L37A 3NFQA 4KHXA 1NAFA 3TNUB 3MD0A 2YO2A 1MUUA 4RESB 3M06A 5APXA 4GT1A 4AYCA 1OWAA 3HE5A 3NMDA 1SP4A 3NTNA 5CMZA 1CZQA 3V5BA 3NXSA 2P67A 4DZOA 1GZLA 4GKGA 5APQA 1X8YA 2ZFCA 3T97A 1MFZA 2XZRA 1G2CB 3VMYA 3B8EB 1FOSE 2WT7A 1JUNA 1J2JB 3A5TA 3P32A 3VN0A 5APVA 4JYBA 3MGNA 3HE4A 2BASA 5AVUB 1HBWA 3M9HA 1YYCA 1CSBA 3VYIA 2R32A 2W6AA 2WTYA 4XE5B 3P8MC 1GU4A 1NWQA 1DH3A 2WPQA 1HJBA 4C46A 1T2KD 2Z5HA 3P7KA 1HUCA 2Q3IA 3V4QA 1CI6A 3I5CA 1S9KD 4JYCA 1T2KC 3OAKA 5AW6B 2Q7CA 3L36A 3VMXA 3KDPB 3SWFA 3M9BA 2C9LY 2KP8A 3IR9A 3HE5B 2XV5A 2E42A 1H8AA 1JNMA 5AVRB 2N9BA 1FOSF 2P2UA 5AW2B 1GU5A 4AUWA 1MV8A 2E43A 1GD2E 2QM8A 2XU6A 2WPSA 1GTWA 2R5DA 5AVTB 2WT7B 3VMZA 2JJLA 5AVVB 2WPRA 2R5BA
chains in the Genus database with same CATH superfamily
1GGTA 1PZSA 3E9TA 1K3IA 4LEOB 2N59A 4JY4A 5GRJH 4OLVL 3VP8A 1I1FA 5CU9A 1UM4H 1JF6A 1S72P 1L9TA 3DYPA 3QHFH 5I1JH 5I28A 5I6OA 3L70E 4NZUL 3EJTA 3APFA 4R7DA 1U8HB 1M7IA 1H3UA 2A77H 2G3AA 4HQQH 3DV6B 4POZC 2FEDC 3ZYOA 2AJZB 4H13C 2GB2A 5I9QC 4YFLF 4ZSOA 4GQ9L 3VXNA 1TVHA 5HD8C 2H26A 1CZ8H 4BZ1L 2OGUA 1U91A 1G43A 1HZHL 1DJSA 3D69A 3HOGA 3II1A 2EYTB 2WZAA 4CADA 4TUOB 1CBJA 5L8RJ 3NJGA 3V2PA 4Q6IA 4QWWC 4J28A 4WW2B 1BVKA 2CWRA 2YSSB 4MKTA 4DKEH 3OKNB 1MW1A 1BE3G 1OCWL 1T20B 1W72A 2X05A 4TQHA 4KNUA 4MJ5B 3W11D 4JW3A 4OB5L 3L9RA 4LSQL 2GTWB 1A02N 4YZFE 5DFAA 1LP9A 3WJLA 4APXB 1KGCD 3BW9B 3FUFA 4KO5A 5KJ4A 3F6LA 2PTVA 3NUKA 1NCGA 2DM7A 2GHZA 2HN7A 5CSZA 1DD3A 3S3BB 4UB0L 4Z23A 3CCMP 4V1DB 4WHTA 4AMKH 3UABA 3WIHH 4UILH 2E5TA 1X7TA 3H1IG 1PY9A 4PJBE 2UZYB 3FH5A 4WI6A 3DHMA 5FFGA 4AM0A 2XV3A 4PCTA 5MERA 5JDSB 5GGSA 1HWWA 1YMME 2P5EE 4R4BB 1SQQK 4IOFD 3U0PA 5AZUA 4HEME 1I82A 1MVUA 4HF5H 1BQLL 3E6FB 4GP4B 3B5TA 4GI9A 4Z7AA 3VMPA 1JHKH 3VSQA 3K1KC 3SGJC 1JXJA 1QHPA 3K2UL 2X42A 1IC4L 1NEPA 1U3HA 4GW4B 2JELH 2LQRA 3NQIA 4DUWA 4D94A 3MRFA 3ARBA 3HRNA 1DQQB 4OGQD 2F7QA 1OAJA 1CL7L 1D6EA 2ZCHH 3R0MA 1JI2A 1CI6A 2XICA 4MMZC 3KLLA 1NGWB 2OYKA 1PP9D 3KS0J 2LR4A 5K1VA 4PI2A 5IVZB 4A39A 4F7MA 3CU1A 2D2CC 4HB1A 5AYTA 2GJ6A 2DLIA 4RMVA 4RA3A 4XHJD 2ZOOA 2WOBA 2ZXQA 1JPTL 1M1XA 4NQQA 3A5VA 3NIDE 3UTTD 5C0EA 5IBUB 2QPUA 4G1EB 1AP2A 4OGZA 3W56A 2KMWA 3EDKA 4CN6A 1WC7A 5D7LA 4F8QA 2DEWX 5C08E 2WWMC 5DSCA 1WWWX 2Z34A 1ZMYA 5IP4A 2FRGP 3MV7A 1VENA 5F7LB 5E2VH 3BHBA 3LMJL 1CJYA 1WVZA 2Q7NA 2QSVA 1VQKP 2ZNWA 3MR9A 2LLGA 1P84E 1H6UA 2XLLA 3G5VB 2DWEB 3PWJB 4JRYA 3K8KA 4R7LA 4YR6B 4XP5L 4CNIA 1X0TA 4DKFL 1OAUL 5C2BL 1PQZA 3TA3B 4MA7H 5D1ZB 3SZ6A 4Y4HB 2APTA 4ZS6D 4ZJ9A 1RV6X 1KILE 1MRCL 1O7SA 2WYHA 3OZKA 2LTQC 4ZKPA 5DMIL 1EZVD 4BXVA 1KTLA 2EXYC 3RIFF 1WAAE 3MA9H 4Z7UA 5IR1B 3O45A 4YIQA 3GMPB 3HE7B 3OKYA 4PJEB 2EEAA 1H3WM 4H8HA 3C9IA 1F5WA 1PNDA 2ZJSH 4FMVA 1U8MB 3U1SL 2VLME 1A9BA 2VLKB 4WAFA 4GINA 3VYOA 4A2GA 2OQQA 2UWEB 3RVXD 1E0OB 1O6SB 4PI0A 5G2NA 4ZXBA 1YDPA 3KLKA 5HI5C 4MXVF 3ZJAA 5HGGS 1IT9H 2H8PD 1ZVHA 3CDGB 3STBA 1V3KA 5D1XD 5KN5A 1BYOA 4AWJC 3RDTB 4OZIF 3RX7A 2A45H 1MY7A 2CKNA 2R15A 5F93C 5I8KL 1ZA3A 1S7XA 3NCJH 3D39D 4KQ3L 4DO6A 4JO1L 2GBUA 3AG4B 3WFZA 4BQCA 1M71B 4RMSA 2OARA 1DQLL 4TNVK 4E0RB 1NMAL 4HIIA 4LLWB 1UZ6F 3U83A 4TL5A 3L37A 4LEXH 4WO4D 2J4WH 2ZUWA 4DP2X 3NJIA 5JXAH 3Q3GA 5IF0A 2FJGB 2ZAGA 2Z93A 5KOMC 2ZKWA 2B39A 1RY3A 1UCBH 2VC2B 4AC4A 3CN0A 3ZQXA 3IU3A 3B9KD 4GXFA 4FZEL 3S5YA 1QR4A 1QBAA 3VFSB 4F7CB 5BZDA 3JTTA 3QXUA 3BQVA 4KNSA 4K3AA 1K9MQ 2QADD 4LCIL 4JFEE 3LKSA 1D5BA 1CFSA 4PH8A 1EC5A 3HG3A 4BQ8A 1KYUA 2XXFA 1AC0A 1LWRA 4G9FA 2G30A 4P49A 4AQEA 4NQDD 5DO8A 3RWDB 5EO1B 3VH8G 4YHKH 3WFHA 5JW4R 2I1JA 4BD4A 5IEKB 1Q0YL 3H0TB 2Z7YA 4DN4H 5AAPA 3QJXA 4FQIL 3EFOB 4IRZH 1NCWH 4N90D 2Z5HA 1QNIA 3J8F7 5FDWB 1J5IA 4LLYA 4G7RB 4M43H 4H1LA 1BCCG 4PGDB 1B9KA 4UYPA 1KBGH 3B9DA 3EDEA 3PWLB 3QFJD 3C5ZB 4N87A 4X6CA 3V4PL 4HKZH 1Z9MA 2VISA 1AOZA 1FZMA 4H0LD 5ISZD 1RE4A 3EGDB 2V3DA 1K4DA 2MRYA 1IBZA 1B0WA 4P2QA 1IARB 2CDEB 2PCFB 1WBYA 1S7TB 4GQRA 3HI1A 2QLVB 3QDGB 4JKLA 4OCXL 3RNKA 5IESL 4U1LB 4I1RA 4Y89A 4D0DA 3MNDA 3MXVH 3RWHB 2DWDB 1PX8A 2Z92B 5EFIA 3TSIA 1INDH 4GAYB 4Y7MA 3WFDL 3KPSD 3STLB 4MGXA 1URQA 3F5WB 1IAII 4IMKA 4YWGH 2YPVA 3U4KA 1MFUA 2BS8A 2YA2A 3OC8A 3QQ3B 4LLDB 1JN6B 4IIQB 3CBJB 3EJJX 4H25B 3QJQB 4PJCF 5FV1L 5B38A 4U1JB 1X3DA 4C54A 3BE1H 3QH9A 5DJ0A 3QEHB 3OQRA 3EYOB 1B4JL 2MPVA 2VMCA 4MS8D 4JG9A 3QZWB 3QI9C 3VXPB 1JZFA 1F3RB 1P6FA 4APQC 3N43B 4FNLH 4MLIA 2OW6A 4RRPG 1GIGL 1RF1B 5JMRA 1ET5A 1IGYB 1B3IA 2XV0A 4J3OH 2X41A 4M3LA 4UOW0 5I74C 4LF3B 3W57A 4EO5A 1TF4A 4YXKH 2K9JB 3BQUC 3TJHD 4F7TA 5EC2B 4N25A 5B4MD 4ERSH 1IZJA 2I9LA 2ITAA 2W90A 1X6LA 4AEHH 2A6KB 4P57A 2EABA 3L75E 4XNZB 2X70A 3AC0A 4RETB 3MJ8B 5ENWB 4Z7WB 5CJ8A 3T0XA 5TF1H 1CDIA 2BNRE 2WKOA 1SBBA 4LCCC 2H3NB 5I76A 5IQMA 1P1ZB 5KAFH 1JTHB 3QA3A 2BVOB 2K78A 1BQHG 1VZHA 1JF5A 3JSSA 4MXQD 4BGDA 4EKJA 5DJ8B 2Q7AA 4PRDB 1PLGL 4YSEA 1YNTA 2FLBT 4NQCA 2VKXA 4J8QA 3UJTH 1FG9C 1XBDA 2QGBA 4LSUL 2I32A 2OCJA 4NT6B 4FXKC 4GKGA 5APQA 4PJAA 4XMPH 3AREA 4P4RA 1E6OH 4Y4FC 2XTLA 3D0VB 3IFNH 4YVNA 3CDZB 5DI8A 3TV8A 3WAKA 2MNWA 2JV6A 3CC5A 5D7JD 3KHUA 3F83A 5GZOD 2WJ5A 2XBTA 3GNMH 5HHNA 2R1WB 1U8PB 1FZGA 3LZQA 4JPWH 2QJPC 1HHKA 1VQ5P 4UB6H 4PD4K 3SCMB 3QZLA 4AXWA 4J6RH 5EEUA 2PYFB 2IANA 3SPIA 4BZ2H 5JORB 3QZNA 4XP6L 1IEHA 4CU8A 1CT8B 5IV2A 2Y23A 5HJ3A 5IQ9B 4AT6A 3MV9A 4JHAH 2VDRH 3A6CL 1I9JH 4IOSD 3HB3B 3TCXA 3ARUA 1DSYA 1TU2B 2P2UA 5K39A 1MCPL 4QHKJ 1T1YB 3HS0B 3OMZA 3EH1A 4KBPA 2Q8AH 1S1CX 4RWYH 3ZKSD 1B0IA 4PCSA 3Q2YA 1R75A 1C5CH 1AVYA 3I75A 4ZTPL 3TVMC 3F7LA 4NKMA 2OR9H 1NDGB 2CLVA 1PYWA 2VE6A 2EH7L 1E3FA 2YUZA 3LV3B 2V5SA 1JWSA 4UQ2A 5AVXB 4TXVB 3BUQA 4YDLC 2VW4A 4B6ZA 4OVUA 3QZMA 3IU4L 3BDYH 3GSVA 1CFQA 5AW7B 1CD8A 3HMXH 2A4EA 5JUEH 3KBFA 1FUNA 5IVXA 3WN5C 12E8L 1KSRA 3OLDA 1M6OA 4NRYB 3SJVA 2IAMC 3P4NA 5KSUB 1AZBA 3S97C 2XN0A 3ZDWA 1OW8A 4L2LA 3B1UA 5BO1H 1A7QL 4BDVA 3QXDB 2J7LA 1B4TA 4XBPA 1JERA 1ZV5A 3HTLX 3QJUB 4HZLA 2JXMA 1T0PB 3O41A 2C9XA 2JKNA 3BFQG 4LESA 5JPMB 2LKMA 1KBKA 3EYVB 2NZ2A 2BFVH 2OP4H 4YDVB 4DGIH 1F8TL 2YXWA 4LCWE 3ABMB 5ESQB 1KXTB 2WZ6A 1ACCA 2AXTH 1T8ZA 1A9EA 2A45G 2B1AH 4Y4HD 4HWBH 5D1ZD 3W0WE 1OP3H 2N01B 3QJHA 3FU7A 4MB3A 4ABQA 1FCCA 4XNXL 2X0UA 4QRRE 1MCSA 3LHAA 2MCAA 2MH4A 4KKPA 4LXFA 3VCLB 1RUPL 3HE7D 1BMGA 1DUZA 5HGHA 5CJQH 3SFDC 3OD3A 1DL7H 1BFSA 4ZPTA 1FNEA 4RGNC 1N70A 3FL7A 1AH1A 2QQLL 1SOXA 2VLKD 1QEWA 2NY6B 4G1MB 3VVVA 3VFOB 1G84A 5K9QI 3OXRB 5I82A 4I2XB 2JKRM 3MLSH 4AYSA 3SSUA 1A7PH 1G9NL 5EF0A 4Y16A 1QO3B 3VFPB 3VU2A 3FCSA 1NANI 1ZXQA 2KYIA 1ZT1B 1AGCA 1S9XA 2VITA 2RH0A 3KLAA 3KLQA 1MHCB 2VAJA 3EO1A 4DVRL 2OCFD 1XGUB 3CX5I 2XA8H 5TPWL 2EDQA 4A7QA 1KCRH 1ZDQA 1FLRL 3QGVA 5F7BA 3VWKA 1HJBA 2WINA 4C46A 4MCZA 5FYKE 4U31A 5TDOB 3RHWK 4Q9RL 5EEWA 5C0DB 3CL3D 3IXAA 1J0KA 3U1AA 1MRDL 2VDML 3HKFA 3LXAA 3QDHA 2BVEA 4DKTA 3Q8EA 1YEWA 4KZDL 3HAEH 4UUJB 3AE5C 2W9EH 1YLBB 2YD8A 3S4SB 2FFDC 3RG1C 3D87B 5PCYA 3DPBA 4YFDB 2BDNL 2GPZA 5TISH 3P9MA 1N7SB 3QB7C 4JKKA 2KXPB 3M6DA 4IK7A 5BVJB 2J5WA 5EC1A 3OLEA 4M8VA 3V5KB 5D2LF 1KIPA 2E7CA 5DQDL 1F11A 3KWVA 5FYLE 5H2BB 2WZPD 2CO7B 5APUA 1C08A 3KPMB 4QO1A 3ZE1B 5B39B 3W5NA 2EVFA 3WNJA 4JPIA 2AEPL 2VT0A 1H3PH 4G7VL 3LN4A 4PRHE 4GSDL 4PTTB 3EJZC 3C5ZD 3H3PL 3I02A 5T1LA 4AEEA 4OFDA 4XXWC 2Y0CA 4KDTA 2PR4L 2AJYH 1NTMJ 3QIWA 2B1HH 3RLSA 1DFBH 2AEWA 4Y1SA 1XR9A 3MUGA 4WZ9A 4CJ1A 5JIDA 1NINA 1NGMB 5BQDA 3QDGD 4X7TA 3BWSA 1DEEB 5IQOA 3NIFF 1LP9E 3WHXA 1TJIL 3AXIA 1C5BH 5FCSH 3LW5H 2JJTA 2IPTL 1RJYB 4YDJB 4HJ0D 2Z3FA 2BCCD 4HISA 3ME0A 4IKJA 4J3OG 3OZ9H 4J6IA 4M4RA 1JTTA 2NY2B 3TIEA 2NW3A 2C7FA 3AW5A 2AXHA 4OCRH 5AD0A 3PAUA 4FQ2L 4B3EA 3BATA 1HL5A 3DX6B 5MENA 5CLYA 2QKIA 3VXTA 1UA6H 4UU9A 4MN4C 2G5RA 4ZUVA 4M7KH 1CG9B 1Q72H 1R5WA 1TQTA 3NP3A 5AVZB 1YY9C 4KFZC 1KORA 2YD0A 2OFQA 4TVPH 7PAZA 4KXZH 4L8DB 3C2AL 2WLLB 4AQOA 3GBMH 4L8SC 4ODUA 5IB1A 1R5VA 2ZT9C 5CZVL 1N8RQ 1PDKA 1QZNA 4AK2A 5LWYL 3CVHL 3LQZB 2VDKB 3H1KJ 1MCCA 1T83C 2HG5B 4JHVA 4B53A 4XCEA 4P23B 1SOKA 1IZNB 2FYNB 2Q3AA 5F96L 4WI3A 4NZTH 3WKPA 3B5NB 4XC3L 1QSFA 1CFMA 4DQOL 2GJ6E 5KBDA 3IDNB 5ANHA 4BQ9A 1LGHB 1QKZH 4F8NA 4WWOA 4NGHL 3DSFH 5HYQB 1KGJA 4KRPB 1GYUA 4EN3A 4K8RL 4XNMB 4NJ9L 1BF2A 5BCAA 3II6A 1HUCA 5D7LE 1J5HA 2VXUL 1P1VA 1FG2A 3IDIA 2H0PA 1NCBL 4DO4A 3L1OH 1HSBB 4FCHA 5EOCJ 2AV7B 3LJ3A 3MV7E 5C0AB 3HC4H 4KQ4H 3VFMA 3LEXA 1MCOH 1RPQA 1VFBB 2XN1A 3D9AL 3SKOB 4N85A 3H9YA 4ZMOA 4PHXA 4QRUA 5BXFA 4F2FA 2HX7A 1FFTB 4AGMA 5E8EA 1B2WL 4PJ0E 1ZTMA 3IFOB 5F1IB 5ID0B 5GSVB 2EDDA 5I75C 3H54A 2J55A 3IDGB 4GG6F 2BWDA 5IFJB 2QM8A 4U4IA 3QUHA 3G3ZA 1JFHA 2WAQA 4AC2A 5AVTB 1XCQA 3PY9A 2Z31C 4X7CC 4KKBC 1NVOA 4O02H 4HKJB 3WS6A 5AL8A 3ULVH 4OM1L 1MFVA 1JBJA 2ZD0A 2EKJA 2PYEB 4OJFL 5KLVG 4WHYH 3L73J 1EHAA 5KLIB 4C7NA 1EEUA 5LXVA 1ZA6B 2YA0A 2EVHA 3NDYE 2G9KA 3O8XC 4B9YA 2I7SA 4RISL 1F6AB 1KXVA 2XTJB 4OTXL 1I7ZB 4FQXD 4JM4H 1CB4A 4UQAA 4YUEL 3N6YA 3ZL4H 4JPVL 4RMQA 1HS6A 4X6FA 5D71L 4LU5H 2X4SA 5I16B 1CXFA 5AAWC 1AACA 3CCRP 4W1TA 5FB8A 1IGFL 2WSKA 3DOSB 4RMWA 3RWEA 4NYLB 3W38A 2MSPA 4LCYB 1L7IH 1N4XH 2VL5A 4Q74A 1VDFA 2IG2H 1N0LB 3IETA 4G9DB 5CXPA 2WXRA 4L1TA 5JR1L 5FYJE 2WQ8A 2FJUB 3AS2A 2G0KA 1PIGA 4FAAB 4OLYH 2E9BA 1L4AC 4WTQA 5DR5H 4JN1H 1SLQA 4HCFA 5I8OH 2QR0B 4F7PB 4PWHA 1IIKA 3B4SA 3DGGA 3CSGA 3X1GA 1ANUA 2VDLL 5KBKA 5EWIH 1XZ0B 2ZUVA 1VQ7P 1DJYA 3QDJA 4HBQA 2R9HC 3CVCA 2MPAL 3KL0A 4HZAA 5F9DC 1NTZK 5CR1A 2ZKXA 3H8NA 2HXAA 4ISVB 2E7BA 2R2EB 4G9FE 3WCYA 2IWGA 3FFCA 3AS1A 1N86A 1UD2A 2HH0H 3MYZA 2NNAA 3D4GA 3PGCB 2BIHA 3NTNA 3ZKMC 1S9WB 2O1KA 3PWNB 4YHMH 2EUVA 4JFWA 2HFEA 4DK6A 1G9EA 1J1XH 4TPRL 4DHLA 3CFJB 4YZFF 5IM7B 4R5XA 4O58L 4G43B 2WWOA 3OKKB 3EADA 5JNYB 5DS1A 1M3JA 1DVQA 1E3XA 1UXSA 7FABL 1EHKB 1KJ2B 4P3DB 3MJ9A 1KJVA 3JWOL 1X5ZA 4P2QE 1AFOA 4L0YA 2JI1A 1EAQA 2WSEH 1U8IA 4PJBF 3HRZC 4JFVA 4IBUA 5IVOA 1JS4A 4HJGA 4G8FA 2XQYG 3HAEG 1SFCD 1T6AA 3BWAB 4BQBA 5DK0A 4TVSa 3SPJA 3TBWA 1EJFA 1QQDA 1TDQA 4UM9A 1DLHA 3BUYA 1U6AL 1QBBA 3TA4D 4R4FL 1KTCA 1RZJH 3SKUD 4WGKA 1SBSL 1X5YA 3SY6A 4OZHB 3PUCA 5DHXB 4P5RA 2OYIB 2FH6A 1GMEA 3I9PA 3L4WA 3O3AA 2I27N 3QQXA 1J86A 1QSEB 1RU9L 3WMSA 3S7GA 1O7VA 3MJ7B 4K5OA 4R6UA 4JZOA 4YBHA 5CCJA 2FGWL 2GK0A 3UJIL 1UATA 1N73C 4JPSA 3MREA 2XRAL 4RSYA 4Y4KB 5T33H 4WWIA 1DFXA 1MFCH 2YPLA 4J2QA 4I77L 3FZUC 4AENB 3VXOA 1U8CB 1PX3A 1MN4A 3FQNA 2HPCB 5IMMB 2C9NY 4B95C 3ZE2E 4P2AA 3CBRA 4A1RA 2HTLC 4MASA 3ARZA 3NIDF 4Y9FA 2OM5A 1J18A 1RK1A 3HMWH 3T09A 1N7SD 3QCVH 4JDTL 4C4BA 2XVKA 4EF3A 4PV1C 4X50A 1L0PA 1KD1Q 5F0LB 2ROXA 1F58L 1U42A 4OD1H 1KN2H 2QJYC 3U9PL 5HYJA 2B4CL 2DYPB 4WCYH 4UCFA 1W0VB 4XBGA 4HXBL 5GRVL 3LNHA 5BV7H 3FT2B 2BNUA 5IW6B 4TTDC 3TH3T 5HVWA 1V10A 3FO1A 4R5VA 1BLIA 1JVLA 2FNBA 4M1CC 4FQHB 5KJRL 2Z91A 5APWA 3U6RB 3JV0A 4KJPD 5DUMH 2WSFJ 1E3ZA 4HGKC 2GM4A 2PF6A 1G6VK 1QPKA 3RWFB 3NJKA 4DNLA 2IDCA 1WAAF 4JQIH 4XX5A 4ZX3A 4GKSB 4P3CL 4OSUL 3L74E 1MAKA 4PJAE 2BZDA 3U7AA 1F41A 4TSCL 4C47A 4RRPA 3RL0B 4Y5VC 3RWJB 2WUBH 3BZFB 4MA1B 3EBAA 4JKPH 2LABA 2ROYA 1S4IA 3V0FA 1KY6A 2IANE 2NY2D 4GAJH 1T03H 1B6UA 1PEZA 4K15A 3SE9L 4Z5RB 2L91A 1KB5B 3D7PA 4AKQA 1JPFA 3LPFA 3L75J 3MCYA 4JZJB 2GBVA 4HBCL 2YOCA 4LLUB 1WUZA 2MQ0A 4Y1TA 2ZVNB 1CD0A 1K2DB 3MV9E 1UUSA 4I9WE 4U6YB 3D85A 2NX5A 4IU2A 4M02A 5DC0A 4AV4A 4X9YA 4XB3A 4WF7A 3MAWA 3PDGA 4U49A 2WNGA 4P9HL 4NIYE 1IGTB 5EU5B 3VD3A 4XVTL 2N3JA 3G6JB 2UZIH 1I9EA 4BFGA 3WIHA 2Y06L 2L5GB 2XWJA 1BGXH 1BQHA 2BEQD 1S7SA 3C6LB 4KMQA 5EULV 2WTRA 4RGOL 2R4SL 2NYYD 3ISWA 1QD0A 3CX5E 1C5DB 5C0BA 2HG5D 1SRDA 4H88H 1G7JA 1S9KC 3VI3A 4W9EC 1YN6A 4KTEL 4G5AA 5F1NB 2EEFA 4M5ZL 4P23D 4L1BA 3SDYH 2AS5M 2BRRH 4UOW1 3SKNB 1TEGA 4R0LC 1H8SA 1KACB 1AO7B 2WCGA 3DX8B 2FZ3A 4WFFD 4XOAA 5E8PB 3T4YB 3NZHH 3B5ND 3T8MA 4K5MA 5IVXE 3KYQA 2WSCJ 2FSEA 1XGQA 1IBBA 1U3JA 5C86A 1SQQG 5TDNB 2JSFA 1HVXA 3SJVE 2ZOUA 4RAUB 3WY3A 4C4KT 4LL9A 2R83A 2ITDB 5DLML 3TH4T 3UERA 3VXUB 4KRPD 2EKSB 2XBDA 4NAJA 3CSBA 3RL1B 1FH5H 1QFHA 4WHYG 3SGJA 3W9DB 1X7QB 4PD4H 5DHEA 2R0KL 4M00A 3ARWA 1H6EA 2YFOA 3KLDA 1A7NL 5G5DB 5C0AD 1KGUA 5E8OA 4MMZA 1XB6A 5ADOL 4JCLA 1OP4A 2B77A 2WVRA 5JW3H 1EMTL 2V3FA 1GZHA 2KUBA 2QTEA 3JZYA 1A7BA 3WFEH 3ZMNA 3MC0A 3PIQB 4Z7QE 1AYOA 1B0GA 1WP6A 4Q9BA 3LY6A 1PLAA 4L76A 1HU8A 3I74A 3GZQA 4GKZA 4HKBB 3MDJA 1Y9BA 4U3FJ 4G6AC 4B50A 2WB1A 5JHMA 2D3LA 2OMYA 2R2BB 4OGXH 3EFDL 3GK8H 3CZKA 1LTJB 3OJVC 2PYED 3V5DB 5I30L 2Z7ZA 3GHBL 5DJCA 3ZYIA 1RIHL 3MOAL 5L6YL 2G3MA 2CG9X 3A67H 2O30A 2KKQA 3FRPG 3DOHA 4H8VA 4S2SB 1K5NB 3RKPA 2XTJD 2W07B 4EZKA 3C6SB 3L3OC 4JFPA 2VR3A 3NSYA 3U59A 4IFDK 2K6ZA 4JZNB 3SGEI 1ACZA 2RIKA 2WPVB 1NTKJ 3H1HD 2C9QA 2LVCA 4K7PY 3QAZC 3GJFA 3GYRA 3MCLL 2KUTA 2QSCH 3T9WA 2QFRA 2B5IC 4HD9A 4YHNA 5E4IA 4HGMA 4JAMA 2E47A 2OTWB 5CINL 4HOXA 4JMNA 3EZJB 1BDYA 4YHZH 2GSIB 3A6BL 1WFIA 2ZYDA 1GL2C 4UYQA 1WBXB 3KDMB 3WUZA 1SXNA 5I66A 1G7LA 1NCCL 1AG6A 3VQ2C 1W8EA 3RVUD 4O2EB 2E74C 5B7MA 1HYRC 4RQQB 3NFSH 3KM2A 1MEXL 5EEZA 4JFOA 4ENEC 1MCJA 1WICA 2B87B 2F58H 2VM3A 4JO2H 3RI5K 5TTRA 2RMZA 2X9ZA 3QSKB 5DTFA 5A2IH 3HPJB 4XNQB 3M9HA 1YC8A 3R4RA 5IB4A 4MNGE 4F1ZA 3OAZK 2OK0H 2Z0BA 3F6JA 1G6RH 3IKCB 3NG5A 4E42A 1E7VA 3MRNB 5A2AA 4MNQA 4I1NB 3BSZL 3UTSB 2VDPB 2ZOLB 3MJWA 5DD5L 3TZVB 3UGUA 1RXLA 4H0IA 3L1EA 4HGWB 3KYNA 1SQBE 4D6TJ 3L5WA 3GLZA 5AVRB 4JFYA 1EFXA 1NMBL 3L3JB 3TTSA 4UINH 5LXGH 2A3TA 1L0NJ 1YNKL 2NTFB 1D6VL 3GXIA 4MQSB 4WUUB 1ILUA 1U2HA 4OQTA 5KWYC 3WNOA 1Q38A 1Q9OA 3UC0H 5IK3A 2OMTA 5A2LH 1HKFA 5T3ZD 1TZ8A 4LP8A 1GZPA 4X42A 4ANKA 4LVNC 4OV6F 2V4HA 1JUFA 4XMVA 3TNMB 3INUH 1BBJA 4YK4C 5I71B 2FHFA 2Q10A 2VCOA 1KYOJ 1IK7A 4UZUA 1VGKB 2Y7SA 3BH8B 5SWQB 1ES0B 3L72G 3ARDC 4YDKL 4DQAA 3GSNA 2ZAEB 3REVB 5HYSB 4YEEA 3O2DA 2ICEC 4M3HA 2WZ5A 5HJGA 3NFNB 1X22A 3VMNA 1NH4A 1C8PA 5APSA 3RIFK 2V2XA 4NNXB 4GXVH 1LT9B 4JBZA 1BVZA 1AQDA 4FJ6A 4QXUL 5MENE 1S8DB 5IGXL 3MBXH 3MYJB 1I8MA 1ZOYC 4I87A 2V7QJ 4MAYC 3TJPA 3KCPB 1TMQA 1OQOA 1QSED 5HTSA 4MRCA 4NO5A 4D8OA 5IHLB 3BP6A 2AXFA 1NU1D 2FL5A 3I6LD 3OSKA 3L3HA 5DD0H 3CH1A 4KGLA 4Y4KD 1MELA 2HWZL 1DQMH 3B9VA 2GA1A 5LNGA 1HH6B 5JOFA 4G5ZH 2X3CA 3QO0B 4HS6B 1T5WA 3V4VB 4U1GC 2FNWA 5K69A 3CVIL 1N59B 1NPJA 2WO2B 3BGAA 4B60A 2ISDA 4BH7B 4DPCX 3K91A 2P49B 3H2PA 4NM8H 5CGYD 3AEBC 1QSFE 2OSXA 3HE6C 8FABA 4PJ9C 2FY8A 4BRYB 3QI9A 1LO5A 3LZRA 4APQA 2DYPD 4RFNC 1IEBB 2XJLA 3H7BA 3F01A 3K4DA 5DJ6A 1MWAB 2X4PB 2ZWZA 1GZLA 4MCYA 2A6IB 4ATTA 3CCHA 1MRFL 3H1IE 2JK5A 3CXFA 3LZPA 3OKEB 1MCQA 3OPZL 3ZE0E 2EILB 2YGOA 1MI5B 1MFTA 2OYOA 4CA4A 3P4OA 3BQUA 3C60B 3QJOA 5L0QB 4WDIB 1MW0A 2KQMA 2MJZA 1YEKH 4TOYL 3WAJA 2B2XL 4C55A 1UA3A 3L71G 1NEZB 2OX5A 1ILSA 1WYJA 1QNZH 4YE4L 5DJAA 5TDPA 2GITA 1ZANH 3ARQA 1RIUH 4QHLA 3RL0D 2WVUA 4O2FB 5CEZH 1FPTL 3MLZL 3NABH 1SQVJ 3LVEA 2BVTA 1LE5A 1ZS8A 5CAYB 1RZKC 2CKBA 4JM2A 4PV8A 3QG6A 4LCCA 5LBVA 1JEKA 3IF1B 6TAAA 1MW3A 4OUUA 1ZLUK 3LB6D 5CIPB 4XOCA 1E4XI 3BT2H 1SUJA 3CXHK 2H1XA 3I6GB 3RZCC 2EXTA 2WW8A 4IKIA 4FXKA 1TYRA 1WLHA 2IOOA 1PKQB 2ZCKH 3FU5A 3U2SA 1JZ2A 2ZQKA 5DHYB 4MNHA 1AI1H 4IBLT 1G7PA 5FHBH 2YGNA 4XOBA 4AITA 4OGAC 1LEIB 3ZOAA 3DJRA 4YHYC 1NCDH 3C6LD 3EBGA 3KXDA 2XWEA 1KIUB 4DGYH 3Q3DA 4OBSA 3GGWB 1WO2A 4FFZL 3OC5A 1A6TB 4XO9A 4D9RE 2Y7QA 1KB9I 4HXAH 4DERA 1AO7D 2DQIH 4QHNA 5D9SB 1I3GH 1LM8V 1E28B 1R3IH 4FTDA 2ZPKH 4IRSD 3BAIA 1OB1B 5DRWB 3QDJE 5KJ7D 4AQRD 2W95A 3UPCA 5HY9B 4ICWA 1ECYA 4FG2A 3ZDZB 5I1HL 3SN6N 2JH2A 2QEXP 2MCPL 4HIXH 4JRXB 1AY1H 3TFBA 2DQHH 3TVMA 2AI0L 3VGDA 3IDMA 3KGTA 5EO0B 1BW8A 2WXLA 4XWOC 4EI5C 3FFCE 4FI6A 2DWSA 4IFFA 4BCYA 5EIIA 1ETJA 2CRYA 1SEBA 3NJXA 2DDQH 1DQDH 4LKXB 1MJ7H 5ICUA 2ICWA 2ZOKA 5HHMB 3AE1C 3WN5A 4DO5A 4ELKB 3L7EB 5ICZB 2NY5C 4Y9EA 4N9OB 3SYOA 1LP9F 2XWXA 1SXBA 3QPQC 3IMRA 3GMLB 4HC1H 1JE6A 2XQBH 1OSZA 3GSRA 1FJKA 4U3CA 3T0EC 2OMWA 3FTVA 5EBMA 1XF3B 3OTTA 3EJSA 4IS6B 2QQQA 3OF6A 1KBVA 4XMUA 2NUTB 2PN5A 2PW2A 2WBJB 5D2NB 5DVNA 3ASOB 4JFDB 5DO2C 3VD9A 1RP9A 2X89A 4AQ1C 1F4XL 3E7KA 3Q7JA 1D5ZB 5FYKL 3EO0A 4DOJA 1T0MB 3DARA 1JYWA 4CGUB 1J5DA 1SJHA 5L2KB 1EK3A 2PLTA 2A9AA 5E0FA 4KROC 3IFMA 1EZLA 4ONGL 2FX9L 4JBSA 5EUKB 4MJHA 1XEDA 1UXWA 1PG7L 2HT3D 4WV1B 2BINA 4FHKA 2AVGA 4U6VL 3U4EA 3V2RA 2Y7LA 4PWKA 1ZLSH 2YPLE 3DMMC 5HXMA 2ESVA 3L6FB 4AUJA 3AY4C 4XBMA 3G71P 4ETYA 1FNGA 2WT7B 2YXVA 1JFQL 3BRGC 2WBKA 3M0DC 5CLZA 1CFVL 3U46B 1JCVA 5IQLA 5EZLA 4DP5X 3V0AC 2V2TB 3ZDYB 2L4OA 2ENJA 4ZO9A 4CRPA 1WFNA 3CDYA 2C3GA 4FQQA 5GGRA 3UTSD 3SPHA 3TZVD 1DBAH 1ZCRA 5CCGC 1W72L 3OV6A 2ICWI 5DURB 2ZWSA 1M7DB 4CUCA 1VKXA 3CZUB 2D4DA 1PIFA 4PJ8B 1HZKA 1RUAH 4L1SA 2O5YH 2FD6L 2FFDA 4ZW6A 4YXHH 2IXQB 1WFUA 3B9EA 1TZIA 3OX8B 4IJ3B 4WUUD 5C0ND 1HXYA 43C9A 4OD3H 4MDJB 4AV5A 3TK1A 1PSKH 3TLRA 4IGBC 5AG8A 3A7OA 1ASOA 4Z7VA 2IBZG 1YC7A 2LOEA 4AIZA 4DAGL 5TE6L 1ETZB 4BK5C 1BX2A 2A73B 3RGUA 2R0ZL 1AR1D 4PP1D 2B15A 3S3CB 3SO3C 4ABVA 3QIBB 3BKML 3AGWA 4N2MA 1FO0H 4ZUSA 4N0FB 4X7SH 4XXWA 3EYSH 2NT1A 3FF8A 3PPSA 1EHLH 1N7LA 4C56A 4PV9A 3HJEA 4FXGC 2NX5E 2HX9A 4NKIH 5H37H 1H5BC 5LBGA 1KZYA 2GTZA 2HKFH 4XMZA 2VQ4A 4IU3A 2DQTH 1NICA 4DETA 4DGWC 3ULSB 3BT0A 2VN6A 4AYGA 1OKEA 2XWTA 4LE8A 3ES6B 1U92B 4QKTA 1GSKA 4OLWL 3CWBJ 3UTPE 4R4LA 2QGCA 3RAJL 4NO3A 1NCHA 4DUVA 1DDHA 2EYSA 4FDWA 2VMFA 4FKHA 3GIVA 5KAQG 1EVTC 5C0BE 3QCTL 3GMMB 3TF4A 1BVLB 3VI3E 1T0NB 3NSDA 5BZZA 4OLVH 1VQPP 1JGUL 3TF5A 3CHPA 5FOBB 4NLHA 1FF5A 1XGRA 3RY6C 4NZUH 3SD2A 1SXCA 4AGOA 2BVPA 4CL7A 3RBSA 1FVCB 1ONQB 4L8SA 1UT9A 4I7ZB 1E50A 4DGVL 3IR9A 3UBXA 2IFMA 5EOTA 4PLKD 4GQ9H 5JA9A 1T83A 3W39A 1JK8A 4L9LC 3FQXB 3UG4A 4MBRA 4TF4A 1MI5D 1EXHA 1OWWA 1HZHH 3ZXAC 3CCVP 2C9RA 2EC9T 3C60D 3P73A 4BWUA 2FWOA 2R56L 3UCQA 1EDHA 5BMFL 5LGKA 1SF5A 2AZUA 3G04B 3V9CA 3FN0L 3WEXA 1TZHB 3QXAB 1MHPL 4OCWL 5GS0L 1N5AA 1N8ZA 1OCWH 4QAMB 1IFHL 4R3SB 1FZJB 3CX5J 4OB5H 4ZBJA 4LSQH 4GSUA 2L7QA 1KLFA 4B9GA 4UF7C 4KRLB 2ZCZA 3V0VB 3ETBJ 3FOLB 4KK9D 5BS0D 1SVCP 3PGDA 1KIRA 1ZKAA 3FUJA 3A47A 1R24A 4UB0H 1IAIL 3QUMA 1ROCA 2L3BA 4AK1A 4UDTA 1AZVA 1BOGA 5FYJL 1BV8A 1JD9A 4PJBB 4M7ZC 4S1SL 3P77B 5GGTL 4IBYA 5FFLA 2Z31A 5GS1C 1U8KB 3DIFA 2OQJA 5CP7B 1HI6B 1XR8B 2H1PL 3OR6A 2OMUA 3Q0HA 4OU3A 5LNDA 1EJOL 2IYPA 3MIWA 3ZE2F 3PS6A 3K2UH 4J12A 5IMLA 3TV3L 1IC4H 3LEVL 3O8XA 1S4XA 3PDOB 3WUTA 1UB6A 1CL7H 1J1OL 2JB6A 1QLEL 4F27A 3S88L 2AW2A 4AVIA 1ZIBA 3L3DA 1JI1A 3QQ9D 2K8MA 3IJSA 3MRGB 4QLRA 3CSTA 3B7UX 5AAWA 1OWAA 1VFAB 1KMGA 2ATKB 1IBDA 3CFEA 4NOBA 3FTUA 3UBXI 3VFRA 1JPTH 5ACZA 2DIAA 2W91A 4ZFFB 1FFQA 4JRXD 5SX4H 4HS3A 1XGTA 1VAHA 4PGEA 2K3HA 1JDCA 3FRPA 1LWHA 3A22A 2VDNL 1SDDA 4MNQE 4DOHE 2XV2A 3U4AA 1L4AA 1ZPLA 1LJMA 4NFCA 4EZJA 3TO4C 1EXJA 2L8AA 5AENA 2F54B 4PJAF 3LMJH 1U30A 4HIPA 1TLKA 1XH3B 5HHMD 4A7SA 1KYFA 3OLGA 5CP3A 1LTSC 1AE6L 1TR7A 3D6ZA 2GIYA 1OAUH 3P7KA 4DKFH 5C2BH 2GFBB 2F74B 4IQHA 3ARFC 1T2QL 5TQ0L 4HD5A 4E41A 2E76B 5E95B 3MGOB 1MRCH 1NTZG 4XCYA 5EU6A 2D7MA 5DMIH 2Y1ZA 4UTAH 2EDJA 1KILB 5C0FB 4BINA 2UUDK 1DN0B 3FRUA 4Y2NA 4FNTA 2VZ3A 4GKNA 3K5BA 3U1SH 4GUQA 1FIGL 4L4VE 5D93C 3ZTJH 2WBJD 4X9GA 2NR6C 4B5ZA 4DZBB 1SHMA 1KCWA 3R19A 4HLZG 5B8CC 4KKNA 5DRZA 2ITFA 1MAJA 4G8GA 3PWPB 3CCUP 1S5IL 4KKLC 5EPMA 4M8QA 3HUSC 2FYUD 5AG9A 5L2KD 4ETQB 5I8KH 2VDOL 3D0LA 1K72A 4KQ3H 4YDMA 1CMOA 2FEEI 4JO1H 4GQZA 1BZOA 5I8EA 1DQLH 1NMAH 2XIDA 3GFUA 3HRZA 4NCC1 3IM1A 1CE1H 3IAGC 2EDYA 3ETBF 2FQDA 1MIML 1QTYT 3MACL 3ML9A 1H3VA 3LZFH 4GXUN 4HX1B 4KC3B 2GG1A 2MHAB 1T5XB 5IVXF 3T6QC 5IT2L 2RN0A 1TFHA 2AMUA 4MMXC 3BZ5A 4HYTB 1A0QL 2I5YL 2P8MA 4FZEH 5IHZB 4GXUM 1DLFL 2GJJA 3FTYA 4X7EC 1Z9SA 2FB4L 2JJVA 4LCIH 3BGFB 1PZQA 3DO7A 5KVFE 1KB9E 3ARYA 1U93A 1MREL 4O51A 2AGJL 1NSNL 3O4OB 2QTVA 1MJJA 2PTUA 4Q14A 3EJRA 3ZDMA 1Q0YH 1XGPB 3MGTA 1J10A 1N73A 5DURD 1RJLB 1ZK9A 3FB7A 3MCG1 4FQIH 4XRCB 2GBTA 1NFIA 4R2GC 4PJ8D 4Z7QF 1N2RB 2DQEL 3I6KA 2WLIA 1M05A 2NZ9D 3GSXA 3DK2A 4QYOA 1NLDL 1UG9A 3O6FC 4W7ZA 4PP2A 4OVVA 2UY6A 1X5HA 2DLTA 3SBRA 1IM9A 3V4PH 5A3ID 5HYFA 2KZWA 4NQXB 3FB6B 3PL6D 2JLPA 4JN2B 5DS8B 2I9TB 1BD2A 1ZSHA 4ZMVA 1A1MB 5F9OL 1OVVA 3HG0A 4ZAKB 1DO5A 2UX6A 5DFTA 4ZS7H 1IM3A 2A06D 4OCXH 4G8AC 3QULB 3FQRA 3II2A 1BE3J 1NBYB 2Y2TA 3KYMB 2ADIB 1OGAD 2GCYB 5KS9E 2G4GA 1GR7A 3P2BA 2ZWYA 4FOMA 4G6FB 1P6WA 2QVTA 4FF9A 1IC1A 4OF7A 5M94B 4IBQA 3T04D 1Z0MA 3QIBD 3GPSA 2VQ1B 3MX0A 2PCPA 3WFDH 4FJYA 2PCYA 3ELAT 1W5CE 3OAYK 1YNLL 4BELD 2YWYA 1LVEA 1DZ0A 3KPNA 1QWHA 4LCVA 5DJ2B 1XV8A 2EXWD 3H1IJ 1JJUA 2J8OA 4Y5VA 5CBEA 3IFPA 1AQTA 4Z7IA 1VACA 4FFVC 3UL4A 1B4JH 1TZGL 5KYWA 5DQ9B 5FWRA 1GIGH 4AH2B 3T0WA 2ZCLL 3TBCA 2H0JA 3ARGB 1YEGL 3VGHA 1NTMD 4NQVB 2BZ7A 5FA3A 1NFDA 2GTQA 1HEZA 2FBWC 2DQDL 4ZX5A 2H9GB 2W1NA 3OMNB 3BCCG 4P9ML 4Q7DA 5LB1A 2JE8A 4RX4A 1AIFA 5CR8A 2ZOTA 2VABA 3RTQC 1N68A 5FM4A 3ROLB 1L0LE 5J89A 4U0RC 2Y3AA 2CAKA 4PR5A 3VFNA 4LBEA 3CPLA 5FO7A 3TPUA 2FLRT 2R7EA 2H32A 5ERWA 3RYMA 4WEEA 3UTZB 2Q2LA 4DIXA 1ZMEC 3KPPB 4R0LA 4FZ8L 1PLGH 4M6NL 4FG6C 4LSUH 3C5JA 1CDYA 1DBKL 3KPTA 4HU2A 5TGBA 1NAMA 1P84K 4WLCA 1OE2A 1FC2C 4DEPC 5KW9L 4LQFL 4U7MA 3H1KD 2HYMA 2B59A 3L95A 1AZRA 4HMDA 3QEQA 5K93A 4D7BA 4TLUA 4HG4K 5B5EE 2YRBA 1EGJL 3G5XB 4KFMA 5H35B 4PS7A 1NGQL 5E00A 1UOLA 3NP4A 2C3VB 1ZHKB 4XP6H 3WL9B 3IBOA 2VUYA 3GF3A 4R96B 4X9HA 2G4EA 5E2JA 2IDBA 4A6YB 2EDFA 3MOBH 5AQ0A 3QHZL 4GT1A 3CX2A 1M56B 1XF5B 1B9ZA 3FU9A 4HUWB 3A6CH 5E1QA 5TJHA 1GPOL 2VW7A 1RUML 3BD3A 4OWFA 3MV8B 4G72B 4XN1A 4P0DA 1MCPH 5LQBL 2D0GA 5I0ZA 1X8YA 1BZQK 3FK3A 4UQ3B 5KTEH 5CCHD 4YGVA 4HAKA 3NMEA 1MHHA 1OTSC 1ZSDB 2E46A 4ZTPH 4Z76A 4JFSA 1RUQL 4RGNE 1AVOA 5KG9A 1SQPE 2EH7H 1R3KB 3LIZA 4PVBA 2E5YA 3IE4A 4JLRA 1CICB 2JJSC 3F2LA 1PPJD 3W68A 1NUGA 3CZLA 4NN6C 4QEGA 4WI0A 1MG2C 3KYOA 3L3OA 4FHBD 4RVBA 3IU4H 4EE2A 4QYAA 2GI0A 1AQMA 1Q0XL 4EI6B 2ESVE 2DW3A 1XF2A 3QT2A 4FNQA 2M8RA 4JYCA 12E8H 5GIRA 4E9XA 2V7NB 1QBML 3G5WA 4XGZB 4XVSL 3LH2L 2NY3B 3VWJB 2W59A 1FZKA 2D3VA 3L73D 1C16A 1A7QH 1DVYA 1DQTA 2BMKA 2YZ1A 3BH9A 3VM7A 3ATDA 1K5WA 4X5WB 2BW4A 3ZE0F 1W16A 2O61B 4YAQB 1GU5A 1GL2A 3MRCB 4P5TB 3VP9A 1KELL 3ZKND 2R1YA 4YBLC 1CO1A 1LMKA 4Q52A 1FDMA 4JDVB 5FA4B 4X6BB 4DKAA 2F54D 4ZZKA 3SOTA 5IJDC 1J5OL 1KOAA 2V33A 1FVEA 4P07A 3U0WL 1F8TH 5I26A 1TJGL 3EGXB 3UZVA 5LHDA 2YKKA 4EUPH 5JW4N 2R23A 1GYCA 4JEGB 1QEXA 2E76D 4Z77A 4HU8A 1BCCJ 4Y19A 4X83A 3GHEL 3FU3A 4KKZA 1VF5B 2FSDA 4Z7VE 1A3QA 1VL2A 2YNYA 2P28B 4A7GA 2FQEA 1LTXA 4PGBB 2QELA 2QQLH 2V5TA 4MWFA 4C4KO 2YIUB 5DUPL 3MUJA 4B9IA 2N1KA 3VSTA 5I1IL 5E8DL 3ULUD 1PNCA 1MXGA 2Q7YA 1QVOB 4KX9A 4ONFH 1TG8A 3IDUA 1SDAB 5E4OA 3UJJL 3PWPD 1G9NH 2JKXA 3V4VH 3ROOA 1Q0EA 2P7JA 4LPWA 3HBPA 3Q06A 3VJ6B 2JJUA 3CLFL 4DVRH 1TPXC 4MSWA 4N4YB 4UQEA 3W11C 5TPWH 3EJCA 2J56A 2NY7L 1FLRH 4FYQA 2YQBA 1EXUA 2Z35A 32C2B 1UEMA 4UM8B 2BCKB 3ARDA 4GKOA 2P24B 4Q9RH 4X0NA 1WWBX 1OW7A 1HCZA 2D0FA 2ICEA 1INEL 2VDMH 2VMDA 3UCRA 4KZDH 4W80A 2Z64C 4AYCA 1BQSA 3FS9A 1SJEA 2Y7NA 4M5TA 4JR9H 2VKWA 5E2UL 1VDGA 2NLJB 3C5XA 3NXSA 5INCB 2ADYA 4UT6A 4MAYA 1SMDA 5AOIA 3BVTA 4PG2C 4TNEA 4F2MA 1BSHA 1IILE 1EBPA 4FYTA 2KYVA 1Q2NA 1CIUA 4UIMB 3NAAL 3T1WA 1A8JH 4PCKA 5DQDH 4AJWA 4BE5A 4PBWD 1JGEA 2QVFB 4PJ5A 5EU3A 3UPRA 1PG7X 1A4KA 2AEPH 1A4JA 4G7VH 4ZSOB 1ICTA 1JIBA 4GSDH 4U6HB 2PP9A 1X7SA 4R7NB 5DVMA 4OGQC 3G5YA 5DD3L 3GKWL 2TSAA 1U91B 1W2KT 4JY6B 1KEML 2PR4H 3HE6A 2HJFB 1BJ8A 4PJ9A 3IAOA 1G7HB 3FO2A 5CS7A 5IZ7A 1BPVA 3OQ3B 4ZAKD 2N9BA 1Q9LA 1BVKB 2D3JA 1UM5L 2EIZA 3DHPA 1ZY9A 3O2WL 1CDGA 4PY7B 3V8OA 4XHJC 3H9ZA 1TJIH 3E0GA 2IBBA 5I0WA 1N6QL 3OPUA 4G6FD 2WO4A 2IPTH 3L9RB 1UT1A 1LP9B 1R33A 4X7FC 3BPOC 4GPVA 2CRZA 3A0BH 2EDEA 3Q43A 3LIEA 1AA0A 4FQ2H 3UZQA 1IQDA 1TJHL 3ECBB 3KVPA 3H1LE 4Y0GA 3HD7B 4WHTB 2Y5TA 2FX7L 3LEYL 1FP5A 1SZNA 3PP5A 3J27A 1G1OA 5J6SA 4N2EA 1OT2A 2D8KA 1R3JA 1ASPA 2BWQA 4ZT1A 5T1MA 4D0BA 4ZS6C 5AKRA 3O3EA 3C2AH 4BWNA 2LU4A 3T3MB 3DUSA 4LMQI 1UD8A 1BQ5A 4ZDHA 5MERB 5ACMA 1FFOA 4Y1AB 2KT6A 4OF8A 2BY2A 4FNRA 5CZVH 2Z8SA 5CEYB 5LWYH 2BM3A 3CVHH 3ARGD 1DN2A 1MVUB 4MZRA 3K3QA 4LL1A 3X1NA 3I56P 2ENPA 2VDQL 3CHSA 3S37L 4NKDA 5IBTL 1ZPUA 3RZCA 3BKJH 4A2LA 1SYSB 3MUDC 1J0YA 2H6PA 4NP4L 4BKLB 4CBPA 2V7HB 4KZEL 1L5GA 3VD4A 5F96H 2ARJA 4PSRA 2CDGB 1G7MA 1LMIA 2IQ9L 3MRFB 4ZO8A 5CJ5A 2DIJA 4PLOB 1D6EB 4XC3H 4YHOL 3IJEA 1I9RL 3D18B 5D1XC 1CI6B 3GSOA 4DQOH 1BQKA 4YEFA 3E2HC 4Z3FA 2G75B 1L9PA 3AQYA 3S35L 4HOMA 4NGHH 5GJTL 1P7BA 1WWCA 4K8RH 4NJ9H 3O11A 4ZNCA 1QFOA 2VXUH 1NCBH 2GUSA 4QHUB 3GTTA 1INQB 3MJ9L 3TT1H 4NSKA 4HK3J 1QA9A 1WC7B 4WO4C 4KVCL 2PP6A 3CFBA 1ND0B 1IJDB 1PZ3A 4ICXA 3D9AH 2B16A 2BP5M 4W6YB 3P3RA 5IMOA 2MTPA 1B2WH 2ZXBA 4I18C 3B9KC 1J12A 4HEPG 1ZV9A 3A4AA 4CBZA 3FONA 4F9LC 4E41E 4PGJA 5T8IA 4M3KB 1EEYA 3FQYA 4JRYB 4N8PA 4N2IA 3WY4A 1QBLL 1CI3M 2WLHA 3DHJA 5EU6E 5BZWA 4GW1A 4YSAA 1USQA 1PQZB 3M1CA 3D6GA 2K1MA 4GP5B 1Q1JL 4EI5A 4OM1H 3KHOA 4R97B 1KTLB 2KS1B 3WEBA 4OJFH 1XDTT 2GAZA 4Z7UB 1AIZA 3O45B 4YIQB 5KVMC 3VDBA 3QUYB 1BSNA 1O7DC 4RISH 2WIIB 1CD1A 2LXCB 1LK2B 2PO6A 1M56D 3Q6FB 3PREA 4OTXH 3RNQA 3ZT5A 1AQHA 4NUPA 1A9BB 5F2FA 2J88H 4YUEH 4IEFA 5FF6A 3MV8D 4YO0B 4JPVH 3Q1MA 5D71H 2Z1PA 4G8GE 4ZXBB 1YDPB 4OAWA 4NPJA 2F7PA 3T0EA 3HRPA 1DCLA 4H0LC 3S96A 5JO5A 2N0MA 1RE3C 1Q9KA 1OAKL 1IGFH 1P7HL 4OI7A 1TSHA 3VI3F 3BPLC 1OE1A 5JR1H 1ZA3B 1S7XB 3LD8C 2I1KA 4LCUA 1CICD 3FMGL 2AJSL 3VFWA 2WQYC 4HIIB 1P7KA 3O4LA 4AQ1A 1THCA 3B2XA 1ZJAA 2F6AA 4EUPG 2C26A 5I1DA 3DECA 4LLQA 4U3FD 2WGNB 4AOFA 1ETA1 2VDLH 5IF0B 1X6NA 3G7TA 2CJTA 5D4HA 4NBXB 5I5JA 2WZ7A 1WPCA 2HVKA 2Z93B 4GSRA 3SBPA 4Z7OE 2MPAH 3WNNA 2NY3D 3VWJD 4ZFOA 1HSAB 3IU3B 1KCKA 3OM3B 1KV3A 3AE4C 4XVOA 3UIAA 3WHE0 2PW1A 1CXHA 3IWVA 2VM4A 4P5TD 5CILL 2Z6FA 3L72E 3LKSB 4I88A 5L8LB 3BVWA 1QTPA 2UUDH 3H42H 2YC1A 4MB1A 2FYYA 2JTYA 2XXMB 4MS8C 3V0JA 3VI4B 1KCSL 4AQEB 1NTKD 3B5GA 5CJOL 4ZNEE 5CNHA 4EZLA 4TPRH 1KTJA 4FKKA 3AY4A 5IB5B 5IWLC 1AKJB 1T1ZA 3WTVA 2Q9IA 1U95B 2C1PB 1JTPA 3JWOC 5EZIL 5HHOA 2JO1A 3M0DA 5H4ZA 4EN2A 3TJHC 5GS2D 1JGDA 1GJUA 4X6CB 1CLVA 1WCBB 1BD2E 1B6DA 2ALWA 5SV4A 7FABH 5B4MC 2DS4A 3F00A 5EBLA 1VF5D 2NPLX 1BAGA 4RA0C 3GTNA 2HTKD 5CCGA 2UY7B 3ATFA 4HWEL 1BMWA 4P2QB 4GIPD 1QSZA 3LZOA 1MUUA 1D2PA 3U30B 1YECL 1JY3P 3RNKB 2J72A 1I8IB 4QGYA 1GDTA 3MRKA 4N20A 3N7NA 2GUOB 3H9SA 2NY0B 2VWEC 4D0DB 3P8CD 1HE8A 2EDHA 3CFUA 3EDFA 5E1AA 1L3NA 1KJMA 3VAEA 4ANVA 4GT0A 1MVYA 1U6AH 4BJLA 4R4FH 3P3SA 3IMVA 4HDIB 4WW2C 4IGBA 4DN3L 1SBSH 4AYFA 4GLRH 4M56A 3BJLA 4EQ3A 5FUOL 2KNCB 1KNOA 4D6TD 1BOYA 5C7XL 4XPGL 3H6PA 1WGVA 4FC3E 4JG0L 3TCLA 4NS0A 4JJ5A 3RU8L 3QNZA 5FX3A 4BK5A 5D7JC 1RU9H 4FA8A 5GZOC 1L0ND 3MP7B 5DD6A 1C12A 2RALA 2FGWH 3UJIH 4QTIL 3SPGA 5IIEB 2XRAH 1UUNA 4I77H 4GFTB 4KNTA 1GJIA 4FG0A 3N41B 1X5MA 1NFDE 1X5LA 1P5VB 5A2KH 3HZKA 4FXGA 4F33A 3FCUB 5E9DA 2BSEA 2VDOB 1ADWA 1H5BA 3EBHA 4JDTH 2B4CC 1KYOD 4X6DE 2H0EA 2IBZY 1V54B 3BCFA 2VO5A 3ABKB 1F58H 1EQ7A 5C09B 1IB5A 4MDIA 2XPZA 4EKXA 2E56A 5EDSA 3GB7A 3U9PH 1PP9G 2B7DT 4LPYA 3ZHKA 2IFNA 2I9LB 3L7FB 5DMGD 4HXBH 4S1QH 5ITFA 2MOGA 2XY1A 4B5EA 5KSBF 5FYLD 1PEWA 1S9KE 5D7KD 3TO2A 5KJRH 2IADA 3JWDH 5I76B 1QTSA 4UNTA 1PX4A 4NX0A 1P53A 5GGUA 4P3CH 3RY6A 4OSUH 3OAYH 1XVSA 5HVFB 2X9XA 1LEKB 1YNTB 2NY4B 4MJIB 4NQCB 2WLMA 3UP6A 4TSCH 4BZ1A 1UACL 2AXGA 1XF4A 2YPKB 3D3VA 4P05A 4WHDA 4JO3L 3AREB 4P4RB 5DI8B 2JQAA 1PZAA 2DOCA 3WDHA 2EE9A 1AZNA 5TH2A 4L9LA 1F6FB 3GLDA 4O4YH 1EZVG 5HHNB 4YPGB 5LN4A 3SZKC 1OCOB 1HHKB 1UQSA 3FT0A 4P4KC 1OWRM 1KQFB 4YHPA 3WXVL 1PJ9A 2IANB 4HBCH 2QZ5A 3HD7D 2Y24A 4NFBA 5KLVJ 3VRJA 5IV2B 3CLQA 5FKPA 4P9HH 4AT6B 2W65A 4BXLA 3MV9B 4N8VB 4CC0A 1WD8A 5D1ZC 4Y4HC 2H2SD 3QAQA 3FO9A 2Y06H 5DHVB 5F1SA 4F8PA 4GJTB 5K39B 4Y1AD 4OZFH 2CM5A 3C8KA 4J3XA 3AU1A 2R4SH 3HE7C 3ZR6A 2JLLA 1XTCC 4BSWA 3Q48A 2R2HA 4H26A 1KC5L 1ZGLA 4NNYA 3I75B 4GY4A 5AB0A 4U1NB 5I6LA 1RSYA 4M5ZH 2YAHA 1ZW0A 3E9UA 4Q6KA 1PYWB 2VE6B 1SQVD 1RP8A 3AB0B 2DJ4A 3A0HE 2ZFCA 3GT6A 1GKOA 4XMTA 1YPZA 5AUMA 1ZS2A 2JFCA 5LLIC 3JCUE 3CCLP 3GSVB 1CFQB 3L5HA 5GS1A 1P84H 2X4NA 2MNJB 3FTSA 5DLMH 3IRZA 4LNRA 1M6OB 4OQTL 1X5IA 2OS7A 1QRNA 2J8UA 2OTUB 4IDJL 4NZRL 3SJVB 1JXFA 2ZYRA 4N0UB 1EXIA 4BDVB 4X8GA 4YSCA 2R0KH 4S1RH 2ATPA 3GMOA 1A7NH 1S7RA 1S78D 4PB0L 4XBPB 3CC1A 1U3NA 4AQZA 5ADOH 3O41B 4CMMB 3OMIB 4XNYL 1EMTH 1FBMA 1LYQA 2RFXA 4HV8A 4P48A 1OOAA 4QRAA 1CTMA 1CTOA 2X1XR 4Q97A 2XVGA 3GSNL 3DJ9A 5KS9F 4YN3A 1HYSD 2GJZA 3KPQA 3D51A 2ZP9A 4JRYD 3ZIMA 2W88A 3O2DL 5F0MB 1BEYH 2Y6SD 2IC2A 3HUJB 2AK1L 4TQ8A 5BOZG 3ZUCA 2YN5A 4BH8A 1E4XL 3EFDH 3QJHB 3MVSA 2WXHA 5IJVA 3ZW3A 2APXA 2WQXA 2DQJL 2ZX6A 3NACL 4OLEA 3GHBH 3TO4A 1RIHH 5F0PB 4DZ8A 2BY1A 3BUTA 3MOAH 4FQPA 1E2ZA 3GD1C 5L6YH 4Z3EA 3QUYD 4LSPL 5DQJB 4KNQA 1N5YL 3PFQA 5EU7E 3LIUA 3DJZA 5EUOA 3LKRA 4MA8L 2F8OA 1QEWB 2D03L 3LKQB 3ARFA 4M7LT 4ZXBD 3AVEA 4KHTL 3MRRB 2HJKB 3FSOA 4JPZB 3L9BA 4WJ5B 1NDTA 3MBWA 4GNKB 3BIKA 2FBOJ 2ED9A 2M3EA 5CINH 5F7WC 5T5FL 3QEGL 4Y16B 3FCSB 3STZB 3A6BH 1AGCB 5IHHA 1KG0A 1GMIA 1V7NL 1LTAC 3ITKA 3KLAB 3ZUNC 2P8LB 4AMXA 2LAAA 3II3A 1NCCH 1IV8A 5KTBA 3L2MA 4LMQE 2CO6B 4HJ0C 3HC2A 4NENA 5TD4A 2R3CA 5IJCC 1MEXH 1WFMA 3MKKA 1RHZB 3VWKB 4E9WA 2WCPA 3ZDXB 1IVTA 2HUEA 3HUSA 4ZMDA 2X4TA 1KEGL 4AW4A 1EUUA 1OE3A 1UEYA 3ZRFC 1OPOA 3PNWB 2QEJA 1NDMA 4HHGA 3C6EA 4F2ME 4PJXB 3QK0A 1AV1A 5DZ9A 3NFQA 1GY1A 4IIQC 3P9MB 3UTQA 3ARVA 3AACA 3BSZH 2GKIA 5EC1B 5DD5H 3SQOL 1KPRB 3SBQA 3VTTA 3HI5L 1K73Q 1CDCA 1EAPA 1VHPA 5D7IA 1AQ5A 1F11B 3C08L 1RF1C 4MMXA 3LW5J 1NMBH 2J21A 1AKJD 1C08B 1JM0A 4QO1B 2CKBL 3E80A 3K5RA 5F70A 1D6VH 4HH2A 4YQXL 3VMYA 3VFTB 2ZKYA 3QUKA 1HNYA 1CLOL 3OHXB 4JRLA 3R7RA 3VYPA 1XD0A 4KJWD 4FYSA 2CZNA 5ECJE 1NM9A 4XNZC 4G70B 3JV4B 1XR9B 1NBCA 3V4PA 2BSBA 2GSGB 2VXTL 3MUGB 3F89A 3MLPA 3GSUA 5A16A 4YDKH 3D25A 4LOEA 3WHXB 2NY0D 3O6FA 2V9UA 4GG8A 4ZFZB 2GEQA 4N2NA 1M7XA 2WVTA 1U7JA 1TOXA 3ME0B 4PJFE 3FT1A 2DF3A 2NW3B 4QXUH 5AD0B 5EBWA 2WPSA 1UD5A 3HZVA 3REWA 2QKIB 5CU5A 1SXZA 3EYQD 1JV5A 4QTHB 4ZUVB 3GSWA 4OCMC 1M2VA 1IFNA 2OSLA 5H94B 3TYFA 3PAYA 1OLZA 3PHQB 3TYYA 2ICES 1A6UL 2HWZH 4ODUB 4OF3A 1O9VA 5IB1B 3T2QA 1KXQE 4R4ND 1RK0A 1VQMP 3QJZA 1S9YA 5GGVL 5K1NA 4KO7A 2ZYHA 1C7TA 3W9EB 5K1JA 5GRYA 2CMRL 3VQLA 4FQXC 3KVQA 1NCNA 3MTRA 4OD2A 2CJ3A 3QWNA 2VIRB 1QFWI 2AQQA 2XPGA 5C09D 1P2CA 2CHDA 2XI9A 2E7LC 4OY9A 1KPVB 4Z3HA 1QSFB 4FEIA 3UAJD 4PGCB 5INDB 5L88L 4LPTA 3LQAC 2PGDA 5CJXC 4FABL 4CKQA 1SQQJ 1NUFA 4WKZA 4W9FC 4ZMPA 1W6LA 3QR0A 3MNVB 2A6DA 3OPZH 2FIKA 3Q9QA 4EN3B 3AE7C 2X09A 1RZQA 1EEZB 1H0TB 4YMPA 3IDIB 4TOYH 1HILA 3TGUE 2BHZA 4Z7VF 2B2XH 1OANA 3VFMB 3CWBD 3RPIB 4YE4H 1CGUA 1WBZB 4MJID 4NQCD 3PJLA 4DP9X 4ZMYA 1B0RA 3JT0A 1QR1A 3EGSA 4PG9A 4QRUB 3RTQA 5BXFB 1N6VA 1ZVYA 1G7QA 2WYZA 4OGYL 1FPTH 2BY3A 4RESB 3MLZH 4UAOB 4OZFG 1OP9A 5KANG 5TK4A 3TBVA 5CGBA 4XVJL 3F7RA 1E4WL 1X9LA 1WTLA 4H2CA 3QH3B 1CS6A 1Y6KR 4GEIA 2P80A 3ABLB 3ZO0A 3ET9F 2OXHA 4ELME 3THML 3RGHA 4NPKA 3GMNB 3SPVB 1G9ML 3ZU8A 1MY5A 2JMRA 3K46A 4ADIA 1MAMH 4R26L 2X88A 4M1GL 2RHEA 3SDDB 3RE0A 1Z3GL 2FK9A 5MEOB 1TNNA 3JQOB 3RIAK 4OJCA 4A7TA 1ML0A 4FMFA 5HI3D 3QRFM 3BKYL 3IEAA 1GU4A 3BAXA 4PJ6A 2H3KA 2WYIA 1J1PH 4RGMB 3RGVB 2EC8A 4OZIB 4NO0B 5DC9B 1U8OB 2RR3A 2O26U 2Q3XA 3BGMB 3ZLQC 5FB8B 4IL6X 1HHIA 4MKMA 5C9JA 1FNLA 4FFYA 4DVBA 1R47A 4FFZH 3ECQA 4GKLA 3ZVVA 4HEPA 5L2JA 4L2YA 3O4LE 1SFCC 1KGXA 3PHOA 1YTZI 1HZLA 1ID5I 1QLRA 3OKDB 4MB5A 1NTZE 2IPKA 3MTUE 3U0TB 2SEBA 3BAJA 5ICYA 3ISYA 3MUY1 1Q86Q 5DRNA 3ZSSA 4BHUA 5I1HH 3GF7A 2BFGA 1BG9A 1JHLL 2X10A 2UYLA 5DU7A 4DEWA 4U4BA 1M57B 1W80A 1IAOA 2DI7A 2MCPH 1DJHA 4G3YL 3B7RL 4NUGL 5IW1A 2K3TA 2M1KA 3HCVA 1JYXA 4AYMC 2G3NA 2JJSA 3CFDA 2Z4TA 3HJ0A 3JVFC 3X11A 1CDBA 3ILEA 2WSEJ 1SUHA 4FQ1L 1WG3A 2FYVA 3KWWA 3ZMEA 5IB3B 1CN4A 4M7LL 1CC3A 2NNAB 1SQBK 2KOGA 4NZJA 2EDLA 4JE0A 5LVEA 4Y2LA 4TLTA 3L5XL 1AC6A 1CVSC 5F71A 5HHOE 4L0ZA 3T77A 1IAKA 1WISA 1UH4A 4PM1A 3CE1A 1FYTA 3CN1A 1WHOA 3MFFB 1N7SC 4G8EA 4H7VA 4P46B 3ABGA 3CXHI 2JI2A 1J8KA 3IN0A 1F3JA 3L9EA 1WSST 2E6PA 3U7WL 1J9CT 4BUHA 3PABB 3S35X 4EUPA 5CCGE 1KJVB 2YA1A 4L4JA 5DK2A 1M1JC 4JVWA 3WIFB 1U8IB 2D3NA 3H9SE 5AVYB 3IVKA 4HJGB 1TQSA 5HDBB 1F4XH 5FYKH 2BCCG 4KJPC 3T0AA 3N44F 3L72J 1CGSL 4LDOB 4MCNA 5DK0B 3IJHB 2Y5QA 4QNPE 3BPNB 4ADGA 4IBWA 2N1TB 1VESA 1ZLVH 2R69A 4UM9B 1DLHB 4FNPA 5DDHA 3AFLA 1SFHA 4GBXB 2ARWA 4ONGH 2Q6WA 4Y16D 4PN6A 3JYBA 3VH8B 2X28A 1OTUD 1PG7H 2K6WA 3NEEA 1YQ4C 5F89A 1B4RA 4DJGA 4U6VH 5L8JB 2LE9A 4RDQF 3GS0A 1MFMA 4LVOB 1Y47A 1OIPA 1PY0A 2WXMA 2NYZA 4J1UB 5K33A 4E9YA 4JZOB 5FYLH 3VWKD 2NY2C 1D7BA 4TN9A 2R29L 3FU0A 4U6XB 3V95A 1XCTB 5C39A 3MREB 4BHUI 2DN7A 3N0PB 2YPLB 1JFQH 2H88C 2HVJA 5KVGE 5K9KA 4NHUA 3ZT6A 2IEPA 5E9DE 3NA9L 1PZ5B 1CFVH 3FQNB 5D6DC 3VXOB 4ODSH 1U8NA 2I07B 5HDWA 5C0RL 1I85C 2FO8A 1WMKA 4XZUB 5IB2A 3AG3B 1X9UA 1RK1B 4PJGA 2OL3L 1DANT 3CN4A 3WHE1 1SOSA 2A83B 3LHPL 3UFIA 1W72H 3OAKA 5B7FA 3ASWA 5HYJB 3SDXE 4OFQA 3RUGB 2EAEA 3G5ZB 2NYYC 2FD6H 1GAFL 4XBGB 5C7ZA 3AMLA 3IGKA 1T4KA 1AS7A 2BNUB 4YLCA 5SWSB 2MIZA 3BO8A 1MLCB 3T3PB 3NSCA 4P23C 1KTBA 1Y1DA 2DJMA 4C83B 5HBBA 1UB5A 4PG2A 1WK0A 4AZ8A 5C0IA 3QUML 4JFXA 1KFNA 5ID1A 5MHSD 3COOA 3FPYA 3MLYL 4NZDA 5LGJA 4XP9L 1KTRL 3VXQA 3H1JG 4DAGH 1TQCB 3ZZ1A 1PGOA 2CUIA 5TE6H 1M7UA 3CZFA 1K05A 3L71J 3QG7L 4ZPVA 2IF7A 4LARL 1K4CA 1NGPL 1Z5YD 2R0ZH 4H13B 2VJ0A 4A38A 2ENSA 4KRPC 1YJWP 1ZWIB 1EHXA 2FECI 5A6MA 2AQPA 3QDMB 1SMAA 2QG4A 4NPYB 3WNMA 3BKMH 1QWNA 2IQAA 3GMRA 4EDWL 1NCUA 4PJDA 2FEEL 4R7XA 3BCCE 2O6PA 3HN3A 1KCLA 3WG7B 3TBYB 5IOPA 5A2CA 4E2OA 1JPFB 4OCNC 1UADC 3MNWA 2CALA 2CLZA 4P3WA 2YIHA 2I69A 3D85B 4IU2B 5HSFA 4MDRA 3GLMA 2K6YA 4DFHA 5I1CL 1L9SA 3FCTA 3UTTA 4XN5A 4ZX4A 2BRQA 3WE6A 3RAJH 1PGJA 2IGTA 4FULA 3FB8B 2XN9B 4JB9L 1JZHA 1R5IA 1PZUB 4Z7OF 4OLUL 1BQHB 3QCTH 1UCTA 2XWCA 2HVBA 4XXCC 4Y7OC 5E5MB 2O6EA 4JKWA 5KLIC 2KQNA 4MA3B 5JQ6L 4JL1A 4PD4J 3GLEA 4YXLL 3AQDA 1JGUH 2VLLA 3VI3B 4YSRA 3CG8A 3EO9L 1DVUA 1JRHI 1BE3D 4GUPB 5FW6A 1TO4A 4DP7X 5C70A 3BFOA 2O5NA 2FHCA 1XFPA 3OGCB 2K88A 4HK3N 1LWJA 4PJ0H 3QJFB 2R0LL 3BP7A 4DGVH 3FX0A 1SP4A 5I8CA 1AVAA 3ZX1A 3HR6A 1BM3L 2ZWNA 2J8UE 4X8XA 3KPRB 4ZQKA 1RZ8A 5D2LA 1EDLA 5AZ2L 3UMNA 2BOLA 1S5HA 2HUHA 2WIMA 4JRWA 3ZTEA 3MUDA 2V8LA 1AZUA 3GZPA 3H1ID 3LTVA 5AYUL 2R56H 3T0DA 4LSTL 3RVUC 3VN0A 1ZK5A 4XOEA 3ZQ9A 5BMFH 4WFHE 3HE4A 4HWZB 1MFEL 2P1YA 4PB9L 1MHPH 4OCWH 5GS0H 1NGYB 2ITCB 1IKOP 5DJZB 2MOQA 2WTOA 3WNKA 1SF3A 4CSSA 3VXMD 3HLAA 3D39A 3LKPA 2WNXA 2APFA 2Q1KA 4YHIB 2FYUK 3L36A 2PR9A 4ORGB 4NNPL 1ADQL 1FJ1A 1IAIH 2OMYB 4WO4A 1LGVA 1KDJA 1QX1A 2DQUL 2JJWA 2OTPA 3L17A 5D1QB 3OBAA 5DJCB 4MD0A 5CZRA 3WNPA 1JYVA 2F2HA 1N7ML 1XF1A 5EUOE 4I18A 3SDDD 3B9KA 4F9LA 4Z1PA 3GMQB 4OV5A 1NC2B 4S1SH 1BZEA 3S8FB 2RQEA 2QMKA 2H2PD 4JFPB 5FKAA 1GHFL 1AGDB 4K9EC 4LHJB 3LS5L 5GGTH 1UZ8A 5HP5A 1M7LA 2H1PH 1J1EB 3RGVD 4NO0D 4NQDA 1EJOH 3RWCA 1AXIB 3GJFB 1NFDF 4NQED 5GQBA 4JAMB 1OO2A 1TKWB 1DUYA 3PDDA 1TQWA 3TV3H 3WFBL 2N4IA 2VN7A 1QFWM 5F9AC 2XYCA 4X6DF 1J1OH 1G7IB 3D70A 2J58A 1QLEH 5I66B 3S88H 2EVJA 4XXDB 4OI9A 3ILPA 4NC1E 5DD1L 3QFJA 1E40A 3Q6GL 2P46B 1AQ8A 4GRMA 2EE3A 1I4FB 4UBDD 4OT1L 4JFOB 3OKLA 1EZVI 3F3HA 5EA0L 1RE3A 3ILDA 2ENYA 2OMZA 4H1LH 5J8OA 5DTFB 4B0MM 3A2AA 3OB0H 1M57D 3OGOE 4KK6D 1KIQA 3A21A 4PWJA 2BP8B 3VX1A 2VDNH 3PH0A 2JKVA 3TDKA 1MH5A 4M29A 2Y0DA 3T2LA 4ZI8A 3ZMRA 4E42B 1J0IA 3DVFA 5D7IE 4ZFQA 3KL5A 3R18A 4MNQB 4E5XB 3U36A 4RMUA 1FE8L 3PHSA 4WI2A 1AE6H 1SPDA 3GMAA 4M4PA 1EFXB 3KPSA 5TQ0H 1T2QH 3KBEA 1ZVNA 2X1QA 3FTGB 4K5LA 1ASQA 4P46D 3T0VA 4LPXA 4QLWA 4IOIH 3QJRB 5CGYC 2DJSA 4GQPH 1I7TA 1TCMA 5KSAB 5FLVA 2IH3A 1YCSA 4NDMA 1FIGH 5FXCH 3QXTA 1NCOA 5IWLA 3H53A 5ETUB 4UV4L 1U8JB 4HKZB 1J8HA 1WQVT 1BVOA 1NKZB 2NZIA 3NCMA 4KY2A 4B0MB 2VR5A 3S8GB 3FGAD 1U41A 3T65B 3DX7B 1S5IH 5ESVB 3Q8FA 2N1TD 5DYOA 1LK3L 1UKSA 4W9HC 2VDOH 2VZTA 1JF1A 1F4AA 2V2XB 4GBXD 2WVVA 4GMSL 1FZCB 1U8HA 4LKCB 2JWDA 5E7BA 4BWTA 4BWWA 3DV6A 1UWEH 3RL0C 2VRQA 4S0SD 3H6JA 4L29A 1A64A 1YRKA 1MIMH 3MACH 2LAGB 4MA1C 3KYAA 4A2MA 2J5UA 1OSEA 4NO5B 5IT2H 1K04A 2WYTA 3BP6B 1BCCD 1T3UA 2FL5B 1NEUA 3LB6C 1K6QL 3L3HB 1A0QH 2I5YH 3CCSP 3GI9L 2F1AA 2YPLD 4OF0A 4CVZB 1FRGL 1DLFH 4JZJC 4WW2A 2KERA 3TNNB 4D9QD 1JZ4A 2FB4H 2YSSA 2Q3ZA 4WEMB 1A5FL 2WSPA 1HESA 3D8MA 1MREH 3HG1D 2A38A 3C09B 1GYVA 4MJ5A 3WIIL 2YKOA 2AGJH 3VXSE 1ODAA 5D7JA 1WFJA 1NSNH 5GZOA 4F7KA 4N2AA 3BW9A 3RJDA 4LC1A 1NAML 3VB8A 2A9NL 5HYJD 3QI9B 1LO5B 3C6LC 1E5WA 3LX9A 4OZGB 2DQEH 1ZR2A 5DJ6B 2YR3A 3H7BB 4N78D 1NLDH 5H4YA 5AYQA 4MCYB 5SWSD 3N1QC 3CCHB 3PQYD 4JQXA 3RPBA 3DOIA 2UZYA 3JBG7 3CSYB 2YRLA 1NHLA 2YAPA 3DUUB 4A2HA 4BFEA 4WSJA 5LNEA 4B9CA 5H2FE 3BQUB 2APBA 4Z6AT 3HHSB 1QP1A 4A7GF 5F9OH 1R3HB 4Z78B 3QYNA 4R4BA 2WXIA 2ZOWA 3TONA 2VR6A 4IRSC 5KJ7C 1T6BX 2OX5B 1EUTA 3G6AA 4U1KA 3IDXL 3D0AA 4XPBL 3PRJA 1LP1A 3L4ZA 5IKCA 1FH2A 3OZLA 2WPGA 1HC1A 3CXHE 3P69A 4PTUB 4XPTL 2UX7A 3QDMD 4GW4A 4JM2B 4PV8B 1NFKA 1NANH 1R17A 3QG6B 2AK4B 1DQQA 3NK4A 4GRWE 1JY2N 5A2JH 4OUUB 1YNLH 3CX5H 2A74B 1QLFA 4MXWL 3RHWF 3VU1A 3LIZL 1JVKA 5F0JB 4UQBA 3CN3A 4X99A 3D85D 2CCLA 3VDCA 3QFDA 5B66E 2BX5A 5FGCB 2IMNA 2EDTA 2KLRA 1TZGH 3KLSA 1GY2A 1KTKE 4L1LA 3UMTA 3WTYA 1MKMA 1DYZA 1SVFA 4QCIB 3RURA 2V8MA 4RNRB 2XN9D 3MHZA 1LTJC 2ZCLH 3PWUB 2QJKB 5DRXB 3U2IA 1YEGH 1S5LE 2RJMA 3G6EP 1DJXA 2WWNA 4P4KA 4Y9BA 5HPMB 2AEQL 1FL3A 3X13A 2VDRB 2R3SA 2QVIA 1M53A 2XWDA 2N0KA 1WA0X 1WWAX 3G5VA 2DQDH 2DWEA 3P9LB 3PWJA 5I5MA 4YR6A 3UBHA 1HWGB 4OZFA 2M5AB 5D1ZA 4P9MH 4Y4HA 1WGOA 4DPRA 2BJML 2Y7QB 5JOPE 3TBTB 2ADGA 3BD5A 4D8PB 4KMTL 3PGFH 4QHNB 1F45A 1DZBA 1BG1A 2WC7A 3FSZA 5IR1A 1QPPA 5T3XE 5C08A 3QWRD 3GMPA 3HE7A 4Z0XA 4CSPA 3KPRD 1JWUB 1I75A 1WZ1H 3HEIB 4RZCB 4LOUD 2PTTB 1W9XA 2HT3C 2VLKA 3TVMB 1U2CA 1PMYA 1RD6A 2UWEA 3MZWB 4FZ8H 3GTVA 4M6NH 2QFPA 2WXNA 1SEBB 4DP8X 2EP6A 3ZO9A 3TBSB 1DBKH 1IKNC 4ODXA 1CGVA 2ZOKB 1BVNP 2A6JB 5KW9H 2BSRB 4LQFH 1CF1A 4L3EA 4WY4C 1FYTE 1NMCC 3WN5B 2DW5A 4UQ9A 5GTIE 3O9WC 1EQWA 1M71A 5A2FA 4HFUL 4E0RA 3GSRB 3W2DL 3L3GA 4LLWA 4PJFF 3CSFA 1NTZJ 1UD3A 1NGQH 1OCCB 2IV8A 2OMWB 1EAOA 2Q20A 3FBQA 3TZVC 2YN3A 5EBMB 5I1GL 4UNVA 5D1QD 4JX0A 2IIJA 2FJGA 2Q86A 3QHZH 2X6VA 1YIJP 3VACA 5HDRA 5TE4L 2QQNL 5TF0A 4XR8C 3ZTCC 3VFSA 1RUMH 1QW9A 4F7CA 1NC2D 4JDZB 5C0NC 1HWTC 4H1LG 5L4JA 5C97A 3O6LL 5GZNC 4F58L 4DP0X 5LQBH 2DH3A 2MWCA 3KWTA 5AL0A 3L48A 1SJHB 2W0FA 3BZ4A 5K5YA 2CA3A 5IEKA 4UT6L 1RUQH 3H0TA 3AMKA 4LLMB 1D5IL 2WZPA 1JY2O 3RBGA 5I71C 3TTYA 3EFOA 3RVVD 1FGVL 4TUJB 1AR1C 1UXWB 5FDWA 2IAAC 5CFHA 4PGDA 1Q0XH 3GWJA 4HCRL 5D1ZI 5FO9A 2GHWB 2J43A 3SSGA 1QBMH 4XVSH 3P11H 2ESVB 3LH2H 3SGKC 1LT9C 3K6OA 3EGDA 2FBJL 3SQRA 3ARPA 1FNGB 4UAHA 2OYHC 1BAFL 2H4EA 2P67A 2CDEA 2PCFA 2XWBA 2PUQT 1KBPA 2KIKA 1KB9K 1S7TA 1MQKL 3QDGA 1MVFA 4LVHB 3MNMA 1E4HA 1KELH 4PJGE 3SE3C 1MF2L 1KGCE 5CWSA 1E4JA 5B38G 4M93B 3HAEB 4I3SL 5CJBA 1DO6A 5AVUB 4MNQD 1J5OH 3K5SA 1HNGA 3RWHA 2DWDA 3U0WH 3WU1A 1CF8L 1TJGH 4YHYB 3RB7A 2WTYA 4GAYA 1JP5A 5H8DA 1C9SA 1SM3L 1EFXD 3Q8CA 3STLA 1TQUA 1NIDA 1Z32X 2YD4A 3F5WA 3MLUL 4O2CA 4OW6A 3O0LA 3HBGA 1DP0A 3QQ3A 2CBQA 5EU4B 4O5LH 5F88B 4IIQA 1PFIA 3K81A 4H25A 3GHEH 1NWPA 4OVNF 4K7FB 4U1JA 1IBHA 2DRUA 4ELMF 5KSAD 3RFZB 3F64A 3EG9A 2XV5A 3NZSA 3EYOA 4G6KL 5LKNA 3VXPA 3VXRA 3QZWA 2NW2A 4ESKA 2P5WB 1KN4H 1UD4A 2F08A 4FXLA 1F90H 2CGZA 4Z7VB 4AIZB 5J3HD 4JM0A 1RF1A 3H4HA 2P44B 4F93B 4IM8A 1IGYA 1T80A 5DUPH 5EOQL 1RZKL 5TFSL 2X4RB 5E8DH 5I1IH 1OY3B 4LF3A 2R2CA 4ILDA 3UJJH 2EIDA 5GGQL 1JDDA 4PJDE 2K9JA 5FCUL 3C60C 5E99L 5J57B 2ZUUA 3X17A 1X9QA 4LP4A 5L0QC 2J6WA 1PP9E 1NLBL 1TTRA 1EEQA 2DICA 2DEYX 2A6KA 1Z5HA 2HT4D 2C0WA 3L74G 4C56B 4PV9B 5ENWA 3MJ8A 3RVWD 4J3SA 4Z7WA 3TPKA 2Y2WA 4W9JC 3UTTE 4IU3B 4NIKB 4I9XA 1F42A 4ZTOH 3VG9C 3KLHD 1CLYL 1UJ3B 2H3NA 1HNFA 4KK9C 1CURA 1JTHA 1OD9A 1INEH 4FQCL 1LDPL 2XFGB 3KMDA 2XG5A 3ECVA 4JGMA 1D5MB 2EYSB 2E9WA 5E2UH 1T1WB 5F6IB 1T7XA 5LAXB 2KZBA 4NT6A 1OZUA 4G7YL 4G71B 4B27A 5FWQA 2VRAA 3H3KA 4K3EL 3GDBA 3D0VA 1KC8Q 1KXHA 1WF5A 1RHHA 4JCWA 2OYLA 1J87A 5K9QG 2IPPA 4OIBA 3NAAH 1YEJL 3F7VB 3G08A 2R1WA 1U8PA 1EZVE 1XGRB 2VR9A 1G5AA 3BCCJ 1I7UA 4LRIC 2BVPB 5GHWH 2DLFL 1L0LK 4J3OD 1X5JA 2PYFA 3QI9D 5T5NF 1NUNB 5JORA