5AVZB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avzB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avzB02
5AW1B 1MUUA 3HE5B 2W6AA 2Z5IA 5AVVB 4RETB 4M3LA 3KDPB 4I6MC 5AW6B 3MGNA 3M9BA 3NTNA 1CI6B 3A7OA 1FOSF 2Q5UA 5AW8B 5APUA 1GU5A 1S9KE 5APQA 2XZRA 1OWAA 5AW0B 1A02F 3B8EB 2P67A 2BASA 5AVYB 5AW7B 1HBWA 4I2LC 2KP8A 5AVZB 1S9KD 1HJBA 4C7NA 3TK1A 5APSA 2WPRA 1FOSE 4LC1A 1GK6A 2WPSA 3T97A 3TYYA 2WT7A 3VYIA 2W27A 2YO2A 3SWFA 1H89A 1MFZA 2YNYA 4XE5B 2Q3IA 1GK4A 3VMYA 1NAFA 1DH3A 4GKGA 2Q7CA 2YO3A 2WWWA 3L36A 3VN0A 2E42A 3V4QA 1GZLA 3TNUB 4KHXA 1GD2E 2R5BA 1IO4A 4JYCA 1FAVA 2N9BA 5AVSB 2P7JA 5AW9B 2JJLA 3HTKA 3NFQA 5AVQB 5APXA 1CI6A 4AQRD 4JYBA 1JUNA 5AW4B 1HUCA 1YYCA 3M06A 5AW2B 1SLQA 1J2JB 2QM7A 2XV5A 2ZXEB 3OAKA 3V4WA 1SP4A 5AVUB 2WT7B 1MV8A 5APVA 2IPPA 3HE4A 3A3YB 3VMZA 2WTYA 1JNMA 2E43A 3LIDA 3M0DA 3A2AA 1GU4A 5AVTB 5AVXB 1CSBA 1H8AA 3HE5A 2R32A 4B86A 3A5TA 1T2KD 3NMDA 2C9LY 3WGVB 3V5BA 3I5CA 1X8YA 2H7HA 1CZQA 4RESB 5AVRB 5CMZA 5AW3B 5APTA 2R5DA 1G2CB 2R3CA 3O8ZA 3NXSA 3LIEA 5APWA 4HYTB 4C46A 4C7NB 1A02J 3P8MC 3P7KA 1T2KC 1HWTC 3L35A 3TNUA 2WPQA 4AYCA 3VMXA 3WGUB 5AVWB 3KQGA 1OXZA 4EOTA 2C9NY 3M91A 3VTPC 4DZOA 2XU6A 2Z5HA 2ZFCA 3M0AA 1H88A 2P2UA 1KQLA 3IR9A 3P32A 5APYA 3HE4B 5AW5B 1NWQA 3MD0A 3M9HA 4AUWA 1GTWA 2VRSA 3L37A 3UIAA 2QM8A 4GT1A
chains in the Genus database with same CATH superfamily
4ODWA 5D96B 4F7TB 5E2TL 2AXJA 2GK0B 4GW4B 5LCVL 2HWZH 1EAOA 2EDMA 2O1AA 4D9QE 8FABB 1OSZB 2M83A 3ZBMA 1J1DC 4PB0L 3ZTEA 4AM0B 5I18H 2O3JA 2F1EA 3CWBG 1OB0A 1Q86Q 2WGXA 3LNDA 1BFSA 3FCTA 3CVIL 2CWRA 5I2IB 1FJPA 1FFRA 4MNQB 5I8CB 4JFUA 1IKOP 5LG1A 5K9JH 3M45A 3GIVB 1LLAA 3FRPG 1J9TA 3TCLA 4B9PA 3ARFD 4AEHL 3EGXB 3QUYD 4WW1B 3RY4A 2XX0A 3RK3B 3OB8A 4C8XA 4Y5YA 4L48A 3A4EA 1E9QA 4ZW6A 3JWOH 1ACYL 3RB7A 3KNBA 2G4EA 1SQQG 4ZS7L 2WIIA 1FGNH 5EN2B 4YLCA 5C08A 1RZFL 4HGWA 5D5ME 3AY2A 2WWKT 2H88C 1KZUB 2QKSA 1BGYD 4Z7VE 1URLA 3N42B 1AHKA 5ESVA 5TDNB 3BKCH 3U9PL 3N42F 2CSPA 4WV1C 3VFWA 3O3AB 2VM4A 2FB4L 1XTCC 2Y22A 3FBKA 4FQIH 2VXSH 4NQCD 2CBTA 4AGPA 4QJ5B 5E08H 1NMAH 1LEKA 1N10A 4J7RA 4GT0A 4XAKE 5DEGB 3RL0D 1SDDB 2NSMA 1U3HB 1DBAH 2NT1A 3EGSB 5DHYA 3RDTC 2SEBA 1VADB 1JUNA 1WLHA 3HR5A 3HE6C 3QFJE 3QJOA 5AKTA 4DF9A 3F7VA 3HB3B 4MDJA 4X7TB 3OSVA 4A66A 1LE5A 4G7VL 4MJ6A 1U8LB 2VSMB 2UZIL 1GYAA 3DBXA 2K9JA 3O2DH 3IJEA 4P49A 1J18A 3MRDA 5J11C 5JPNB 1G7HA 4QYOA 3BP5A 3LH9A 2HXAA 2NY2D 3L7EB 4R3SA 5FYKH 5AD0B 4P5TD 1YJ9P 1KULA 2CKBH 1KILE 5TQ2L 3SQRA 1NGXA 5C0AB 1JGLL 4Y4HB 3SKMA 3HZKA 3TBYA 2CLRB 5JPMB 1HXKA 3MLSH 4JHAH 1PZ3A 5B39B 3UEZA 4H13C 2JJTC 3VGFA 1UOLA 4NM4H 3FT2A 4MXQC 4XN4A 3T2QA 3V6OA 4IQHA 5EMYA 4AYMC 2E9IA 5CBEB 2PW1B 4IFFA 4GKNB 1IC4L 2D3JA 3MFGB 4WO4A 1G5AA 4HAGA 4CMMB 1GTFA 4ELDA 1U95A 3KYOB 3ZT5A 3L4TA 5CP3H 2BH0A 3D69A 3EXJA 4PBDA 1TZAA 2AK1L 4N0UA 3VMAA 5KAQG 2AEQH 4AQAB 2IGFL 3TA3B 1UIIA 1MFUA 1R3HA 1KYOE 3DOSA 3MRJA 5ITBL 4ADIA 3RK2B 4Q56A 3CXHI 5AAWA 3QUXA 4L5FH 4OD2A 4NPFX 3BCCG 2Z31C 5EFWB 1ZDSA 3PREA 1DQJA 3KYQA 4PJEA 4IBWA 1D2OA 2CDGA 3I02A 2HZHA 5B66E 3JV4B 3TIDA 1R5IB 4YHKL 3C5ZB 3BWSA 2XZAL 3AE1C 4PTTA 5IEHA 3QIUC 1HC1A 3FB5A 3ABMB 5ISZA 2Z34A 5F3HA 3VGAB 5CEYA 1LDPL 1Z7JA 3HC4H 3ARZA 3IETB 1MCKA 4GINA 2VLKE 3D09A 4C4KT 4DWHA 2Q2LA 5ADPL 4FJYA 3JV6A 5JHLH 2E6JA 4G6MH 3HKZA 4OZFG 1JNJA 3TO4D 5IBUB 1O0VA 2OSLA 1J8HD 1XHHA 2CXKA 2H26A 4PRPA 2R7EA 4D9QD 4A7TA 5JHDA 3CCHA 4NQVB 4ODXB 1UB5B 4JM2A 1NTZJ 1IFHH 1MCHA 4E9TA 5K9KB 5L8JB 1VF5C 1E2WA 2Y36H 3BWZA 1S3KL 1RXLA 1KPRA 3LQAC 5A2CA 1OHQA 1LXMA 3AE7C 3FFDA 3QDHA 4OFYD 2ZUWA 2AV1B 2WXQA 3L9RB 5L0QC 1MEXH 2RKLA 2XC8A 3V6FA 5EZOL 3ZDXB 3L3KB 4AK1A 2Q8BL 4EVNB 5D70H 4HUWA 2DI9A 3MUDA 1R9FA 2ICEC 3WIHL 4GI8A 3ZDXF 2C3HA 3AM8C 1KTDB 5I1DB 3QUMH 2V37A 4X5WA 3AWGA 1H8AA 5JNYB 4NKQB 3IXTB 3OXRB 4YHOH 1CDCA 2A1WH 1BVLA 2YPKB 1UG9A 2GUOA 1A02N 4L4VE 2IYPA 1UZ6F 3SGEH 3ESUF 4YXWH 2NNCA 1JEKA 5TF0A 3TU6A 4M5ZL 4N25A 3P7KA 4Y2DC 3GBLA 8PAZA 3L9BA 2ITFA 2X7LA 4LQFL 2X4SA 4RAVA 4KZEL 4U1MA 4KJWC 3UPCA 5SWZB 4ZFZA 3NAAH 1DQQA 1PBYA 2JEEA 4W7ZA 4Y4KB 2A9NL 1ZIAA 3VWJC 1W6WA 2PO6A 3NJMA 4P4RB 1KNOA 4K8RH 1NKNA 1T66D 4OJAA 5DK0B 3N04A 2OYIB 1R5WA 5C0IB 1HHHA 4Q74A 1A2YB 4R84A 1JV2A 2VL4A 5ENWA 3VFNA 3DV4A 4ONOA 1FL5A 3SE8L 4D6TG 1BFVH 1XB3A 1QZ1A 3GMLB 3FH5A 1KILD 3NBNA 1ZMYA 3RBXA 3VXSB 1FVCB 2AXCA 1INEL 3Q1SL 3QUZB 4XTRD 3L75E 4G2AA 4NNYA 5HVHC 2M5AB 2A77L 3QQXA 3BC9A 1OAKL 2VQ1A 3IDIB 4JANA 4F7KA 1Y07A 1JUFB 3MJGX 1JFQH 4XO8A 3N43B 4IU3B 3MV9A 3NVQA 4OCWL 4JQXA 3L9EA 1YEHH 4NDMB 3PAZA 1DFBH 1H5BA 2VDKL 2VR7A 3AB0B 3F5WA 3S4SB 3UADA 1UWFA 1Z0NA 4NHCH 4ETQA 1IL1B 2R39A 4M7ZC 5IGXH 4UQ3A 3T4YA 2M1KA 3LIUA 4ATWA 1SXBA 2F19L 1NUNB 4MMZB 2A83B 1I1FB 4PPTA 5FM5O 1GS7A 1HCYA 3WXVH 5KWYC 1WFTA 2L7EA 2AKRA 2P5EA 4MAZA 1DH3A 1HI6B 3DYMA 3ARGB 1TT6A 3D87B 1CFNB 4JB9H 1KBGH 5J3HD 3E1RA 4BH7B 5MENB 1KMIZ 1X5IA 4IRZH 5F70A 5MEPA 4GKSA 1KYOD 2YEZB 3E38A 1DVUA 3BUDA 2AJUH 4Z5RA 1CE6A 2OL3L 3FAWA 3K8LA 4NPEA 1D5BA 3J8F7 3CL3D 2FVNA 2YXWA 1E4KC 5EBWB 1O6SB 5I24A 1RUQH 1TKWB 1BIHA 4PP2B 4ZPTB 2PUQT 1MDTA 1LO5A 3LAFA 1YZZA 4MA3B 2H2PC 4JZOB 1RVFL 2H1PL 4JY6A 1JFHA 4LE8A 4K5PA 4DJGA 2YRBA 1YEJL 3RX7A 4CN1A 4QD2E 3MLPA 1EEYA 2WSSH 3GSWA 4JZJB 5HDLA 3QQ3B 3TONA 4EZMA 5IMMB 3X13A 3BJ91 1HEHC 2BC4B 4OLXL 3TSIA 3S35H 4JDZB 3ILQC 5D71H 3HG4A 2YN5A 3GSNA 4FQHB 2CCVA 4QRPE 3CX2A 3P9LB 1VL2A 4NZTL 4I2XA 5GZOD 1T6BX 2XN9D 1CICC 4M6OH 1L0LK 2P8MA 1EDLA 3USSA 5FYKU 1YLBB 1FHGA 4MAYC 3TCXA 2XXFA 3O0LA 3U2SA 3WS3B 1I1YB 2JWAA 3TPUA 2QKIC 4M5SA 5K5YA 2YKQA 1BOGA 2O5YH 4KTDL 2VN5A 2E86A 1RUPL 4LPXA 1HXYA 3VFUB 1IGCH 3P8MC 2P47B 2IPTH 4HCRH 5KVFL 1G87A 4PRIA 5FUOL 4J3SA 4FQ2L 5EIIB 4QJ4B 5B5EE 3GJFK 4LAQH 3M1BB 5HHXL 5IVOA 2MKWA 3RUGA 3VGHA 4E41B 3RU8L 1F97A 3EO1A 5JXAH 2DAVA 2JF1A 5LNGA 4HIHA 4MX7A 1E5CA 4A55A 5ILTL 3T2NH 1NM9A 5CO1A 4M1CC 4F9PA 2XPZA 2XZCH 4H5SB 3ULUC 2VDNH 3Q2CA 4DW2L 4NUPA 3L5XL 2APFA 3PJLA 2FJSA 1AJYA 4JY5H 3DGDA 3TV8A 2KS1B 2PYFA 1IEBB 5C92A 4F8OA 5CLWA 2BOCB 2VDPH 4BDVA 3FOMB 4L4VD 4UYQA 4ORZC 4W6YB 4XVSL 1N6UA 1A1OB 4HH9B 4X5XB 5CJOL 3UBXI 2GSGB 4A2LA 1N2RA 4XC1L 4R90L 3R4RA 3T3MB 4CC4A 2ARWA 5LGHH 1USQA 3I84A 3NDYE 4YHIA 3SGKA 4Y2OA 1IT9L 3QXAB 2L04A 3P30H 2DBLH 3VGGA 1REIA 2F5BH 4WK2B 1A21A 4AH2A 4XBEH 3DSNA 1W0WA 1TPXB 3W0WA 1B4LA 1LDSA 2AK4B 4D0CA 2BHUA 3QRGL 1PDKA 2J72A 4LSVL 3MIWA 1PKOA 1PY9A 2AV7A 3RNKA 4AYFB 1DL7L 2CR6A 2W65B 4RCAA 3F7YA 1SQXK 2V2WA 2HSIA 2W60B 5T33H 4BSJA 5D1ZI 2OJZL 3FTGB 2JXMA 4R7DB 1YNLH 2PTTA 3WTVA 1FZEA 5ALBH 3S3BB 3AE8C 3H6PA 2OTJP 2VUOA 3OXSA 3EO9L 4PREA 4GAGL 3MV8B 5DS2A 2IWGA 2LXCB 3IGAB 3MLWH 4DZBB 4B53A 4OTXH 1FVDA 3PGFL 4NM8H 1A6UL 4LVOB 2QM7A 5GIRA 2BERA 2CNZA 1GYUA 2E59A 2EEFA 2VDNB 3EG9B 4PJ9A 2V2XA 5H37G 1OLZA 3O6LH 3RX9A 5DJ8A 2HODB 1AQHA 3WIFB 2LAGB 4M7LH 1GU4A 4X6CB 1RK1B 2MIZA 1ZXKA 2WUCH 1OP3H 5FX3A 4HUVB 1RERA 1MY5A 1N0LA 2VDPB 3QXDB 3WKMH 1DVFC 4HWEH 3V5KB 2FEJA 4X6CF 1ZS8B 2Q0ZX 4IEFB 2WIMA 4NGHH 3KXFD 3ARBA 4F58L 3AADB 2VM3A 4ODTH 2QSTA 1T83A 1YMMB 5TK4A 1UGNA 1RZ8A 5IY5B 1QX8A 1SLXA 4M5YL 2EKSA 2CG9X 2O6FA 3MXWH 3OTTA 3L17A 1MCNA 3N85L 2NY3C 3EAKA 4U4BA 5ACMA 3U0WL 1KTCA 2JVUA 2G9HB 3ATEA 3NTCL 4JR9L 3D06A 4Z95L 3U7YL 3MODH 5GS2H 1J0JA 2J8OA 1QWNA 4OQTL 4XX1E 3SKNB 4UM9B 2DYSB 5LBSA 5E94B 1SQBG 1SMDA 2ENQA 2DY2A 3QQDA 4ZW7A 2OMUB 2IDUA 1TETH 1J1OL 2XA8L 2XBDA 4ZAKA 2YEQA 3N0PB 1SLUA 2GJ6B 2BSSB 5AQ0A 1X44A 5EEXA 1CE1L 4K2UH 3K0YA 3EJZD 4LSDA 4ZMZA 4Y5VC 1K8DA 2QPSA 3UTQB 4NRYA 2XVLA 1W8OA 3KPSB 3OM3B 5BV7H 2FWOB 2IH9A 2ESVB 3CIAA 1HHKB 5DMKA 1J48A 3WJLC 4PB9L 1MXGA 1VSCA 3FL7A 4IBQA 2OK0H 5IUCA 3PHSA 1E4WH 3A24A 3PDOA 4NP4L 1I9IH 1ONQA 4I1RA 2RFXB 4HSAC 3S6CA 3TH4T 4X4YA 5E00B 3CSGA 3B7TA 3GPEA 4IM8A 3LEYL 1KIQA 2B5IB 1XIWA 4K71B 3JV0A 1F4XL 4F2MA 3ZKNC 1NM4A 1KC5H 3WDIA 3T9WA 5A6IA 1M56D 2KB7P 3WNKA 3U7WH 5F8QC 4JFDA 1KLFA 1CFVH 1E27B 4G71B 4P59H 4UBDC 4K7FA 3SPIA 1CFBA 2ITDB 4XRCB 5EO0B 3WO4B 1NAMB 3U46B 4YTPC 2D2CD 5D1XC 1NANH 3IU3A 5EEWA 3KZIH 2WWMD 3MOAL 4WFFE 1ZHNA 2X4OB 3IN2A 4WFED 3NCYP 4IL6X 1J8SA 5AUMB 4OLWL 3OPZH 4X9BA 2QVMA 4XMKL 2O01H 3CX5H 5CFAA 1LT9A 2OTLP 3RWIA 1B0WA 3AROA 5SWQA 3TVMA 1HZLA 3WFCH 1GZLA 5ICZA 2V5TA 5C7XH 3TEZA 3MUJA 4GKOA 1MAKA 3INUL 4DIXA 1Y0LA 2XWDA 4PJDB 5DJXB 4R7VA 2HVJB 5EDSA 4ZNCD 4LNRB 3L3GB 3MXVH 1XR8A 1XCQA 2R1WB 1HQ4A 4DVBB 3CWBD 1UB6A 4PJDF 1WFOA 3ZIMA 3NFQA 2X4QB 5DZPA 2GQHA 5D7JD 1PIXA 3S2CA 2Z91A 5T1MB 4L3EA 1MRFL 2XHNA 3DA0A 3IDXH 5IW6B 2EICA 5AKRA 2ARJB 3QNZB 3HZMA 4TQEH 5H35A 2EILB 4PJAB 3WN6A 3AWEA 5BV7B 1ZIBA 1A4JA 1NCDL 2UXGA 3ZDZE 1GGTA 3VFTB 4MNHB 2VR3A 5E99H 4WW2B 4GMSH 2DEXX 1NH4A 4QRSA 5ICXB 1SQQD 3RBSA 1UCBL 3Q8BA 1WBZA 1G9EA 2PTUA 5FHAH 4YHZL 5IV2A 1TQVA 4JKNA 4LDCA 2Y72A 2ZUUA 4WW2F 2CIIB 3LX9A 5F7BA 4P04A 1AYOA 1MWOA 3UC0H 1GY2A 5IROA 1FZFA 1FUNA 3EYUH 3ZN6A 3L1OL 5D6DA 5I17A 2R0KH 4OM0L 5HXMA 1CDIA 4GI6A 2XN1A 4GXVH 4PSRA 2Y0DA 1I1AC 4AY0A 1U41A 4ADJA 2EE3A 3B5NA 4PMFA 1EV2E 4PJBE 1UWYA 1IM3B 2D7OA 3FN0L 2DLTA 4P5KA 5F2FA 4TVSa 2BNRD 5E8DH 3MP7B 4NQSA 5DJ0B 3P3UA 5EUOA 2J8UA 1HVVA 3TN0A 2OXGA 4WY4D 3LW5H 1HE8A 1Q9KB 3FFCD 4P23C 3SCMD 5CSGA 3ZE0B 4F8PA 2QM8A 1AR1C 1OV8A 3KPLB 3ML8A 5AW1B 2UXFA 1BHGA 3HNSL 5IWLA 1YVLA 3G4SP 1FJ1B 3TLRA 3ZE0F 3H3PL 3KPPB 4PJ5D 3U30C 2VDMH 3P0VL 1QEXA 1IQWL 2WPGA 3S37X 1IGYA 1PZUB 1RUML 5L6YH 3FO2A 1KTJA 3QP3A 2YAFA 1TQCC 4EUPA 1RHFA 2BCKA 3C09B 4WBAA 3I9PA 3UYRH 4JVWA 1NAYA 3JCUH 1EJFA 1IFMA 3BW9A 2FUTA 3GSUB 4MJID 4U6XA 5C0CB 2BCCJ 3OJAB 5AKSA 4H1LA 4NKIH 3UZVA 3T09A 3KR3H 2WWNA 4ZXBA 2C0WA 3EGDB 1OW0A 4PBVC 4X6DF 1MI5A 5IOPA 1VEOA 2Y69B 1LP9E 3II3A 4K3JL 4TVPE 5DWUH 1XH3B 2APVA 3DX4A 5L9DL 4NPYA 3DJ9A 2O6EA 3BO8B 3UJIH 3CH1B 3TASA 3ZLQC 4AX3A 1FZOA 3S0PA 3R4YA 3D85D 4UTBH 5GZND 1EWHA 1QG3A 4G43A 4JFSA 3VXRD 2IBZI 1N7SA 35C8L 1WWBX 3P73B 4NC1C 4ISVA 4AIZB 5JXED 1SFDA 2G2RA 3QW9A 3D3VD 3HHRB 4J6RH 4QGTA 4RWHA 3VWKD 4ZMYA 2NYKA 3VD5A 3P69A 2PCPA 4YSTA 5FECA 3ULVE 4Z7QE 3SQBB 5IW1B 1LK2A 3OR7A 3ZMNA 4UAHA 1TU2A 4AMWA 3BCCD 5KSAA 4KKQA 4OCYL 1Z6JT 4B95C 1OLLA 3IJYA 1B2WH 1LO0H 1DEDA 5IVXE 1NCJA 3RL2B 5A2FA 5BS0D 1U8HB 5DUMH 4BH8B 3QZWG 1XWVA 2VDMB 3QEQD 4IGBD 2A6IA 1COBA 2X2UA 1BZ9A 3WY4A 2R27A 4QWWD 3ZOAA 3A2AA 4HQQL 1T0PB 3RTQC 4MCZA 1FYTD 4EN2A 2IPUK 1A6PA 2NXZD 1A7RL 4WFFD 5I75B 5IHLB 3Q3GA 1B4JH 4FFVC 8FABA 3J07A 4WY7H 3AW5A 4KMTL 2DQEL 4HAFA 1JMMA 4KROB 1K8IB 4NQDB 4FMVA 1X0TA 1VPOH 3US9A 4MNQA 1HJCA 1INQA 4M7JL 3QJQB 2C4FU 3NJGA 3GMNB 3OKOA 5CJ0A 3LPWA 4OCNC 4PRDA 4QRQA 2JO1A 1JJUA 5D5MB 4P2RE 1ACCA 2QHRH 4EZKA 5I6OA 3C08H 3K91A 3G6DL 4S11A 2ICWB 3K8KA 1F58L 4YAQA 1JD7A 2W59A 5EN2A 3H1IG 4PS4H 4BZ1H 3GNML 3G7TA 4WGKA 1A7PL 4XN1A 3QDJB 5IR1B 4EIJA 2YAHA 1YECL 5CJXC 2P26A 4ZFFA 4XGZA 5E8PB 3RAJL 1L5GA 6CGTA 4H8UA 3GRGA 3BD3A 5KJRH 3F7RA 1DJSA 1ZHLB 1MKFA 5TDNA 4HKJB 3ZGIA 1EJOH 3LRGA 3LV3B 3FQWA 3FSOA 3QFJB 3FK3A 3L3OC 2ZCHL 4K23H 4LF3A 4M48L 1AFVL 2NYYD 2IZ0A 1VA9A 4ZS6C 1L7IL 5IFHH 2AVFA 3VXUA 5I66B 3K2MC 1PF3A 3EJRA 3VXMA 2D2OA 5B66H 3MA9H 3QORA 2BINA 1JY2N 1GZQA 2WGNB 3S3JA 1ZV8A 3WLBB 4ZDHB 1G7MB 2NUTA 2ZXBA 2VIRB 3R2PA 4HS8H 1AXTL 5D7IE 2NSXA 2XIBA 4BQ8A 2W0KA 1U8LA 1JGVL 4ASVA 1ZV2A 4J23A 5B7FA 3GKWL 1EBAA 3CVDA 3JTSA 5A16B 4DH2A 3C8KB 3FJTA 2Q7CA 1U58B 3OKNB 5AD0A 5J6HA 3L7EA 12E8L 2WWWA 1BZ7B 1T7YA 2CR3A 5F7HA 1XR9A 2EO1A 1Q38A 2ERJC 2FYYB 4D6TD 3PAYA 1JV5A 2FATH 4W81A 3SZKC 3BP6A 4Y4FD 5IEKA 1AZZC 3NCYS 3EHBB 4L8SB 3BQUC 2HTLD 2Q3XA 3LPPA 4MDIB 1AGCA 2G75A 1N73A 2IOOA 2O6CA 5CBEA 5E5MB 5IJKA 4GKNA 1WG3A 4NI3A 5IB4B 3L5IA 2HPOA 4MZIA 5B1JA 3EH4B 4OR1A 1JNMA 4Z76B 1MQKH 5GGUA 3ROLA 1A6TB 2W80C 3U0TB 2C26A 1F3RB 5ACZA 1ZP0C 1ZA6B 4AEIL 1S9VA 1KQSO 4BKLA 1RJLA 1RIUL 2QQNL 2AVGA 4BE5A 5KAFE 4A2FA 4OY9A 1TJMA 2IFNA 2HRPL 4ERSH 5FK9B 1KB5A 3NA9H 2KT6A 3CDGB 5GJTL 5DUBB 3NCFB 1T20B 2R3CA 4LLHA 4LLQA 4KQ4H 4BE6A 4WFHE 1V7ML 3QHTC 1XGQA 5I1JH 2H3NA 1LMIA 2GHWB 2DIJA 1TU3F 2GM4A 3KLLA 2JIXD 1HVXA 4IW4C 1D7MA 1A7QH 1OB1A 1I8LA 1WS7A 4XO3A 2L7JA 4CVZB 2OAAA 1ZCRA 4OLYH 1C5CH 2WITA 2QDVA 3D39B 1U8JB 1SQBE 3UIAA 3RE0A 4LMQI 5TISE 2AABL 4E9XA 4JO8A 1FGVL 3B6SB 4IFDK 4R2GC 3TFKC 1G7JA 1QA9B 5JQIB 2F54B 1MQ8A 3CCVP 2XN2A 4YHML 1PGRB 3ESVF 3IFOB 2EDRA 3VXPA 3R18A 3WLWC 2D73A 1CI6B 1CR9L 1UB5A 1KLUB 2QTEA 1RIVL 4NEHB 1KPVB 3S34H 1E9PB 4BYHA 1CFTA 2FNBA 3GMQB 2L0DA 4PRAA 1EHAA 4PRHB 5K93A 1PLBA 3TJHD 1HQRB 2APTA 2HFEB 4LLVA 3V0WL 5JHMA 2YOCA 1J0HA 2AV1A 1AQTA 4UB8H 3L9RA 4I7ZB 4BUHA 1HBWA 2H32H 3H1KJ 4Z8FL 3L3KA 3RIFF 4P2RD 2WPRA 2WYIA 3GJEA 3NFSH 1ETA1 4EVNA 4U1IB 2KPWA 5AOIA 2MEJB 4QOKB 3CD4A 2PXYA 2PYEA 2TSBA 4HK0A 4AIOA 1JTHB 4HLEA 3K5SA 2BVEA 1E6JH 1M7IB 2VLRA 5I1DA 4GKGA 4AVJA 3CZEA 4APQC 2VDRL 3TF4A 1I8AA 2WZ7A 2V3EA 4XT1C 4PWEA 4UILH 3OXRA 4GRWH 3II2A 2E76D 3D6YA 5IB2B 1XXDC 3RX5A 2Z1KA 1N9PA 1ILUA 3ZT6A 1CYWA 3FO0H 2WUBH 2OMXA 5CCHE 4GMTH 5A6LA 1YMHB 4RZKA 4KRPC 1BD2E 1ZVNA 1SHMA 3GS0A 3SYQA 4ORGA 3AVEA 4A7UA 3BFWA 1F86A 4UU9A 1A7NL 2G60L 5DURD 4EOWH 1UKSA 5GGTL 2XV5A 1OTSD 4AE1A 4LLYA 3L3HB 5C0FB 3QUYC 2JELL 3B9KC 4U7JA 2UYLB 2XU9A 1LE9B 1N5AA 1RD6A 2AEPH 5EBMA 2D7PA 2EVJA 1DVYA 2GK2A 3AUVA 4AJYV 2X9YA 1WA0X 3MA7B 3X1BA 3VI4A 5F1IB 5EB9A 3MTUE 2L7QA 2B8OT 4XAWL 2ZONA 2P48B 2CNYA 4WV1B 4BFRA 3GMLA 5HVGB 2VMEA 5HHQA 3QPXL 1YN6B 2FO4B 4Z7OB 1XD0A 4ASWA 4LEXL 3HZYB 2XKSA 4NUJA 2H32B 3IDNA 1BGYJ 4ZRGA 3ESNA 5DZJA 4QHMB 5CR8A 4AQZA 4LCWD 2YD0A 4Z7OF 4UTAH 2FL5B 1A9EA 1VCAA 3RDTB 3BH8B 1BIIA 4LSRL 1ZOXA 5HJ3A 1MW2A 1QKZH 2AAAA 3FULA 4CSTA 5T5FA 2FD6H 1B9KA 1PNCA 1S5IL 2BX5A 2O5ZL 5SX4I 1B4TA 4WGWB 4ZNEE 1PLGH 2YD7A 3WOVA 2G2NA 4M3JA 3RL0C 4NDMA 2CHZA 2JJSC 2LFGA 3VGDA 4TNFA 1F11B 1YYLL 5E9DE 5I8KL 3S4SA 5J11B 2AQNA 3V6BR 3WHXB 4GRWB 4L1LA 5DMIL 1T89C 4FP8L 1O9WA 3DPDA 3O9WC 4IJ3C 1L7TL 4HOWA 2WVRA 4MQ7B 1UATA 4GRWF 4GSXA 4IKNA 3ARED 5C0NC 1IK7A 1R3KA 2AI0H 4I6MC 2ZOKA 5FA4B 3B4SA 5G2NA 3MX0A 3BRGC 4H13B 2GFBA 4Z3JA 2X3BA 3NTNA 4PY7A 2BMKB 2Z0BA 3TYGL 1KXQA 4W9GC 2Z1PA 3VACA 4J39A 2WXGA 1HGVA 1XZ0A 4WFHD 3B1TA 3SE3C 3LQAH 3M7OA 3QIBA 5SWSA 2Y1YA 2AJVL 1UC6A 4MA3A 4QRPB 3L2LA 1BSIA 3OKLB 5KJ4A 1HSBB 2HVKB 5APSA 1H19A 1GVIA 3LN5A 1QUNB 3QQ3A 4H8VA 5IMMA 1AD0B 3GSQB 4N6RB 2ZOLB 3AE6C 4Y28J 3KVPA 1SQBD 3S4RA 2D0FA 3UJTH 3RTLA 2P44B 1QVFO 2FGZA 2Y7OA 5K9QI 5B8CA 5ETUA 4QT5A 4Y1SA 4V1DB 2Z31B 4X4XB 5INCB 4CVXB 3KYAA 4D3CL 4MLIA 1I1YA 3FQYA 3DGGA 3K72B 4YR6B 4IOFC 1WTLA 1S9YB 1TO5A 5BVPH 1F2XK 4OJEH 4QF1A 4JRLA 5EU6A 5D7LB 3SBPA 4MB4A 4C56D 3MLZH 3ISWA 4ZTPH 3IJSA 2JB6B 3AITA 3DVIA 5APXA 1JDCA 1RF1C 3QIUB 3CVHL 5CGMA 4BQ9A 3M1BA 3D0VB 4K9EC 2VKXA 4N85A 2IH8A 4E41A 4JFED 1K6QL 3FMGH 5GPRA 2J73A 4KPHL 1SQXG 1OL0A 2FLMA 4BKSC 2R9HC 3IT8D 4H5SA 1A1MB 5IVZA 4CGUB 2Q7NA 3IF4A 2R29A 3BSZH 4RDQG 4DGVH 1VF5B 3CXHJ 2AZAA 3GLAA 3TO4C 5GRUH 2KS1A 3BKYL 4CMHC 2EAEA 3QI9A 5EOQH 1DQLL 2BIHA 3O45B 5L0QB 3MKGA 3T77B 5D4QA 4KI5D 2PPEA 3H3KA 1QNIA 5I0VA 2VW7A 1BD2D 1PX3A 4W9KC 2FTAA 1BMWA 2IAMD 3DXAA 4FA7B 2Z5HA 1CFSB 4IRSC 2BSDA 2ICEB 1WWWX 3PABB 2PR4L 4ILDA 2C9AA 4QTHA 5DYOB 5DHVH 1JZJA 2UWEA 3MD0A 4OGAC 4X99A 4G6JH 2XPYA 1JZGA 4W4OC 2P8LA 2XXGA 4EBQH 4W9DC 1AJ7H 5CEZE 1Q72H 5IQMA 1JXDA 4CSPA 2AK4A 3H1IE 1IRAY 2VXTL 5CEXA 3CAFA 4R6UA 2EUWA 2I8DA 3QISA 1EHXA 1G7PB 4AYFA 1JNHB 1S7XA 4G9DA 3DK0A 2DMCA 2XICA 1LTIC 2QV2A 5HI4D 2CM5A 1CGYA 2W60A 2XJLA 2EYSA 5AAMA 5E4IA 2BXYA 4LP4A 3ZHLA 3GO1L 4YK4B 4B7IA 1HTLC 4Y2DB 3C6SB 1NCAH 4MA7L 3SDXE 4ZZFA 1IJDB 2VCOA 4YDMA 4Y9GA 1EEUA 1OT2A 3ECBA 4ZODA 1BVZA 2YOAA 3LZFH 1JVLA 1JK9A 4UT6H 3APFA 2SODB 4MHHG 2W83C 1JWSB 5IFJA 3VWJB 3CCMP 2YGVA 2E7LA 1X3DA 2AEMA 1BXXA 1WAAA 2X41A 3F8UB 3I9AA 4BBWA 3QBTB 1WMKA 4Q9QH 5E9DD 4C4BA 5JDSB 2HODA 1HU8A 1TCRB 2BIMA 2OULB 3QB7C 1E40A 4YDNA 1HDMA 3MNWB 2N9YB 4I18C 2KLSA 4IBYA 4HUVA 4WWNA 3CVIH 1OVRA 3QXDA 3I3DA 3X11A 1YUHB 5HVHB 4BWWA 4WI0B 4RRPM 1VPCA 4AEHH 4FLOA 3MR9A 1CJYA 1YMMA 2B4CC 4Y19B 5H2FE 5DRXA 2WXFA 1AZUA 4Z7NE 2GTQA 2OMNA 5DHVB 4XTRC 1ACYH 1B6UA 3OQRA 4YPJA 5I9QC 5KS9A 3CCUP 3RIFK 1RZFH 2IVFC 2AQTA 5L2JB 5JA9A 1SXCA 1ET8A 4M7ZB 5L4IA 1PIGA 3ETTA 4PGBB 4ZQKA 4UM9A 1S3RA 2Y6TE 4E9QA 3LNEA 2HLAB 3VXNB 5I5RA 1EAJA 4ZBJA 1LILA 3WSQL 4P4KD 3K1DA 4ZZKA 1HSAB 2RH0A 5FUCE 3U9PH 4I0PA 4GQ9H 5DQ9B 5IMKB 2QQKL 5I82A 1U2YA 3KPSA 1JZ5A 1HHKA 3WJMA 4RIRA 2OZ4L 3ULUH 5KBKA 4LHUB 5J3HC 1J9CT 1BGXH 1VRSA 1KEGL 3WXWL 1GGIL 4JX0A 1G94A 1ITBB 3L3IB 1D5RA 3DVGB 3KWWB 3X3FL 2WLKA 4D7BA 3RKDD 1BX2B 4XNXL 3TO2B 3T5WA 4F7MA 2W90A 4Q9BA 4TSBH 4MNGE 4G7VH 4HIEB 4JO2L 5TH2B 4BZYA 1QRNB 3MLXL 3P32A 4X7EC 4HU8A 3NMEA 2CK2A 1Q94A 2VL5B 2KNCB 4N2AA 1A4KA 4U1LB 1QSFE 3HPJA 2PWFA 2I1JA 4XRCA 5TQ2H 2OP4H 5F7MC 1NAMA 1LK3H 2OTUA 3H1JE 1JGLH 3P3RA 1CICB 2W8ZA 2X4OA 3RIAK 4MAYB 4JQ0D 2E46A 1E6OL 3ARFA 1TQUA 1DBML 5AALA 2BNQB 3SJVE 2QKIB 2R51A 2Q7YB 2BEZF 1I85A 4U3SB 4RWYL 4HMDA 4ABQA 3QZPA 3C5JB 2C3GA 4F2FA 1ORSB 4MSWA 4Z7WE 4L23A 1IC4H 3L3GA 4OIIL 2K9FB 4XCEB 1JB0J 1NL0L 3OX8B 4DVBA 1G9NL 3QJVB 4ODVL 2IPKB 2FSEA 3DECA 1HYRC 5T1MA 1JNLH 4W4NA 1GMEA 2AK1H 2EUXA 1GMIA 2YMYA 1CZ8L 4EIZC 2IGFH 2OMTA 4J5VA 2WHVA 3L3JB 4U1KA 1WIPA 2AQPA 2RBLA 4RZCA 1Q2NA 4NQCA 5I8EA 2NTFB 3GIZL 5CEZD 3QEUB 1WQVT 3MGAA 2A7BA 2B1HL 4PJBB 4Z78B 3ULUF 3H1ID 1OP9A 4LASL 4CN6A 2VR6A 2ORBH 1UFUA 1W91A 2CIIA 3OHXC 3VXQA 3TBTA 3V4UL 1AS7A 4G80B 2CJTA 4MWFB 1LWHA 2KDGA 1JPGA 1K73Q 4YHKH 5M7QA 2EDLA 2XZAH 5EO1A 4RBPH 3TYFA 5HYJD 1TUPA 4RAUA 4YPGB 3AU1A 1IM3A 1JPEA 1EXUB 1LDPH 4YDJA 4P5TA 4TQHA 3A0BH 4HEPA 2YGOA 3V4PA 3D18A 4S1SL 2ENPA 4AJ0A 1Z1WA 1IC7H 2ADIA 3CLFL 3CSYB 3FXEA 4R26L 2BDNL 3ZE1B 3HPLB 4HHGA 1OTUC 4GOFA 5E8NB 3SPHA 3PIQB 3ZHDA 1U2HA 1JDAA 2G3MA 4POYA 3ZE1F 2OV0A 4NBXB 4R4BA 5E5UB 3D4ZA 4X4MA 3KJ4C 5DC2A 1R0AL 1XBRA 1I53A 4UM8A 2W9EH 3CZFA 1S3KH 2F8OA 2HH0L 1OSPL 2XWCA 5MEOA 4ZD3L 1V3MA 2EP6A 3SIKA 1V54B 3GMRB 5D93C 1UA3A 2QTVA 2WO4A 4TQIA 3Q6FB 1LP9B 1NJ9B 3NESA 2KZJA 2NY6D 3RI5F 2Q8BH 5C0CA 1OAYL 1JWMA 3PWLB 3V5DB 2JMRA 3UIYA 4BQCA 1XF2B 1ZT1B 2NX5D 3WIHH 3RL1A 3LKNA 5KSUA 4BWTA 2VT0A 5FR3A 5M95B 2HFGL 2XV6B 5F8RC 3C5SA 5APYA 3FONB 4L1DA 3C6LD 5CP7A 4BELD 3UH8A 3ENEA 1S7TB 4J8QA 1GAFL 4OZIE 1TZOA 1DVFB 5B3JE 3CH1A 1L9TA 4BSWB 1T2QL 2KUTA 3BAWA 3CN4A 4JFXB 4UDUB 3KDPB 2E5TA 1OW7A 5AW6B 3CUPB 3D4CA 4M5ZH 3P73A 3SKOA 4KFMA 1QLFB 5F88A 5T1KB 3KGSA 2OQQA 4LRIC 5IVXB 3D52A 3DVFA 5DCCA 5FGCE 4OT1L 4F91B 4LQFH 2NY3B 1A5FL 4KZEH 4NO3B 3PV7A 5E6YA 3P9MA 1WCQA 2MSPA 1XGRA 3NN8B 1CIDA 4D2NA 1PTZA 2XCMC 2R44A 1CT8B 2A9NH 1FE6A 1AIFB 1WBXA 2SPZA 3FSZA 3U25A 1J8HA 2KLUA 3OAYK 1D9KD 4ZUUB 3GTVA 1U8HA 4BH8A 1O5DT 4W1TA 4X5RA 5EU7E 4HXAH 4Z3TA 4PVMA 2BK8A 3SE8H 1E43A 4MLSA 3QHZL 3ETSA 5KZCD 2W9DL 1FG9C 2HA1A 4HDIB 2EDXA 4OFYA 2NY0D 4JG1L 3Q1SH 2LVCA 2BJML 1H0DB 2ADJB 1OAKH 3VE0B 3V0JA 1AD9A 1AVYA 5CN1A 1HL9A 4GXUM 3BFOA 4OIFA 4X7SL 1GL4B 2J57A 3LKQB 4OCWH 2DLHA 4X9IA 5B3NA 2VDKH 1YHQP 1FFQA 4R5VA 2DMHA 1MCLA 5DEJA 5JOPE 3GMNA 2R69A 3H32A 2ED6A 4R4NC 5A3ID 3RY6C 3VFVB 3RZCD 1R5VB 1CVSC 1G1JA 2F19H 2GC7C 5D5MA 3MRHB 5T3XH 3UTTD 5KANI 2O01N 3Q1MA 1UGKA 3IAOA 3EDEA 5D1XB 4Z7VA 32C2A 3GRWA 3LPFA 4W9LC 2DMBA 2E43A 1QR1A 3B5HA 5F9WC 4B3VA 1BV8A 4CU7A 5GS1C 3VQMA 2VAJA 2OL3H 5EEVA 2XWXA 1XCTB 3NSJA 4FTVD 3ISRA 5EH1A 5LN4A 4HX1A 1Z9SB 5KVEL 1U21A 3RNQB 3GI9H 4WGVB 1HXMB 1RVFH 1KIRA 2H1PH 3PWPD 3CG8A 2MHAB 5KOMC 1N8RQ 1YEJH 3GZOA 1F02I 3L7FA 4DGIL 5CHXA 3FQXB 3DPBB 3BXNA 5I6XC 1VENA 2P5WE 1M7DA 3OC5A 4OLXH 4AUUA 2EYRA 4GUOA 3DX6B 2H0PA 3CWBJ 1K04A 4B9IA 2VJ8A 2ZKMX 5D7JC 5A7EA 2QFPA 1KILA 5FKPB 2HJLA 4QO1B 4LSUL 2CIKA 4F20A 1NKRA 1GW3A 3V9FA 4LLDA 2CDEB 3C8KA 3FU5A 2Y7NA 2ZF8A 4NN6C 3BUIA 1O6VA 1UURA 4KTDH 4S1RL 3EQ2A 2VDKB 5CLTA 3MHZA 1SQQJ 3JSSA 5KVFH 2FRGP 4FQ2H 5K1VA 3IPBA 1GL2D 5AW8B 3UO8B 4F24A 1S9KE 2FYYA 1OFCX 1J9SA 5HHXH 3FUKA 1AKJB 4N2OA 5KJ7E 3RU8H 4IKIA 4EAEA 5CGYD 5ILTH 4HWZB 3Q13A 5FM5M 4G9FD 5JOFB 1FZCC 3VSUA 3BLBA 4KY1L 3G5XA 2KIKA 5E5MA 4P23B 2OL3B 1QGKB 4POZD 3GXPA 4OZGF 2OMYA 5IB4A 3PWNA 5AOMA 2C8NA 1QBBA 1RJZB 2YO2A 3KCPB 1NTKE 2ODHA 1TNNA 4V11A 5KBPA 3CBJB 3U30B 2YMOA 4FFYA 4WY4C 3K5BA 1ORQB 3N5AA 3SCMC 4IIQC 3UCRA 3INOA 4U1NB 2POHA 1N19A 1TQCB 1G7QA 2NUPB 4XVSH 3BCDA 4XXDA 1KEML 4JPWL 1W6LA 3JWNG 4R90H 4XC1H 4AITA 4C59B 1JZ3A 3N55A 4IIZA 4LP5A 3PP3H 4RGOL 1E30A 3TOPA 3S2AA 1MCPL 4X5LA 1IT9H 2ENSA 3OC8A 1F42A 2FX7L 5ESQB 1KG0A 1V27A 2CUIA 5C3IA 1EHLL 1N6VA 2VLKA 2OMBA 2VITB 4OGQB 5GZOA 2DF3A 1JXJA 4JRYB 3SSGA 2QPUA 1VQPP 3QRGH 4QI3A 5AVUB 4G8GB 4DJMA 1V10A 4LSVH 4M1DL 2DRUA 2IPPA 4GP8B 1OP5H 1DL7H 4FJZA 1RHHB 4FGMA 3REVA 1ES0B 4FQJH 3FU3A 3W11D 4YHPA 3UGUA 1SYSA 3GSOB 5LG6A 1RZIA 2OJZH 4JHBA 4B41A 1A9VA 2BIOA 4EN3C 3MRPB 2A6JA 1G9NC 1P4LA 4TLFA 4N8UA 4ODSL 1QA9A 1HYSC 2AQ2A 4GAGH 1IBZA 1G2CB 3CFBB 3TNNA 4IL6H 1QRKA 3GLEA 3OJDB 1YEIH 3TEYA 5EBLB 1XGPB 1KPVA 4XPBL 3DUUB 1A6UH 2AITA 1HQRA 1BQHG 2R2HB 3HI1A 3SDDA 1Z5HA 5IKCB 5JOPD 2JB5L 2CPCA 1HILA 2C7FA 4RFEB 1QVOA 2R1XA 4GI9A 4WTZA 5DRWB 3TZVC 3BCCJ 3SYPA 4UB0L 5GGRA 2BSRA 3OA7A 2F7PA 4OFDA 3RTQB 4CW1B 2HJFB 2BNUA 2MCPH 1ADWA 2P4AB 3CIQA 4L4VA 5GHWL 4F58H 2RMZA 1KXVA 1TTGA 1MPAL 4TUKL 4HPHA 2B08A 3BHBA 4W68A 4MKTA 3RGVD 2VXUH 5D55A 3BYYA 4Y9CA 5IESL 2X40A 3ULAB 3RVWD 1SQXD 4M5YH 5G5DA 2P3YA 1GZHA 3KPNB 4GP5B 5IB2A 3KLAB 5CILL 3N85H 1SJEB 3PQYE 4WHCA 5HHVL 3NTCH 3RI5K 3U7YH 4JR9H 1MFEL 3UP6A 4KUCD 3U0WH 4PGDB 3MRBA 4U6VH 3CZGA 3T0DA 3LRSB 2MQ0A 4KHXL 3H4FA 4QXGL 3CHOA 4U7MA 4YE4H 4MS8D 1C5DA 5JQHC 2XA8H 1J1OH 3LHAA 4RRPA 5T3ZL 1A47A 4M8QA 2P5WD 2YN3A 2WLLA 1V3KA 1FOSE 3BUYB 1CE1H 2K70A 2EEXA 1QTYT 1TQBC 2J59M 2FJFB 4TSCL 5L4JA 5PCYA 4FQXA 4KX8A 2DL9A 2G5RA 2W9LA 4PB9H 3O4LD 1OAJA 4NP4H 3KHOA 2LVEA 2WLNA 2DWTA 2JH2A 3B83A 3LMJL 3MA7A 3ECVA 5F1IA 2ID5A 4KV5F 3LEYH 5FYJD 1VQ7P 3V7MA 1F4XH 3DRTA 1AANA 1JZIA 3LSOA 4HG4K 3NFNB 1AGEB 3ARVA 4KDTA 4YSEA 2FO4A 4TUOA 3BZDA 4U1SB 5HYSB 5E0FA 5IHUL 2E5EA 2VERA 3QNXB 4NQUA 3PWJB 2NYYC 4X4KA 4M7LT 2OR7A 4XN9A 3UAEA 5KJ7D 5KLVE 3FU0A 4Y1AB 4O9HL 1NPUA 5FS5A 1JF5A 5TFSL 1GYWA 1MCWM 1LVEA 3ZY7A 5HGAA 3MOAH 2APWA 2WY3B 5F89A 5LO7A 2WT7B 2B9BA 2OMVA 1XB8A 3CK0L 2ZNWA 3MZGB 3NUKA 3VXTA 5T1DL 4KAQL 3EYFB 4OLWH 4XMKH 2ZUYA 1UD6A 4JGMA 5EO9A 3AC0A 1AZVA 1NTKD 1WFNA 1BM3L 1P5VB 3DNKA 5C70A 3AE5C 2VWEE 1JZHA 2FBWC 4OJCA 1JI2A 1KCKA 4W9HC 5B4MC 1JGDB 3QH9A 2ERJB 1ZT7A 2ZIDA 5JO5B 1ADQL 4NCDA 3BLKA 4A39A 4ALAL 3DYPA 4P2OB 1I8KA 2DDQL 2VE6B 3STZA 1ZD6A 1P7QA 4LKCA 4N1EA 5I1KH 1UEYA 3BQUB 4X6EA 3MV7E 4Z3FA 5K69A 3CC7P 4N0YL 2OI9C 4P0DA 3VCLB 2APSA 4D6TJ 2ADFL 5KBDA 4RMWA 1GH7A 2ZG2A 3FH8A 1NCDH 3VYPA 4EE2A 4Y4FC 2Z8VC 2A73B 4QRPA 2IXQB 3FU7B 1HKLL 1IEAB 1CFQA 1UCBH 3VTTA 3LEVL 1ZR4A 1FH5L 3MJ6A 5BJTA 43C9A 4JW3A 4PD4K 5K33A 2CR0A 2QL1A 3MGOB 4EDXB 4JPIB 3L1OH 1CLOL 2LQRA 4E5XA 2FHCA 3NP3A 1DLFL 1TSHA 3Q0HA 1N7MH 1JPST 2ALWA 1JSYA 2CA3A 1G6RL 3CFKA 1MLBA 1U8MB 4L2LA 4N90D 5INCA 1BJ8A 4YOKA 5TF1L 2B1AL 4L37A 3K72A 1SY6L 4YR6A 3WYRA 5AOKA 3SGEI 1P84E 3ZHNA 3HG5A 4PR5B 3GF7A 2YPLE 2NRGA 2EIKB 4R96A 3QIWC 1LJ2A 1IIKA 2A6KA 4ZFGL 1K9MQ 3MLUL 5KW9L 4TOYL 4WQOA 1GK6A 3H3PH 1IQWH 1BF5A 4ZNCA 1RUMH 5HHMD 5DSCB 4R2GB 2FQDA 5T5NF 2D3LA 1JY2P 5GRVL 1R47A 3VVVA 3PNRB 3JVGA 4LPTA 4JQIA 3CFUA 4F57L 4JO4L 5FO8A 1KWGA 5KS9F 2OS7A 4N2EA 1DEEG 4GUPB 1SZNA 2IADA 1ZTXL 3T4AA 5CM1A 4Y16B 3DMMC 3HRNA 5DD6A 2NTSP 1S7UB 1KZYA 2O72A 2CO6A 1CDBA 4U7SA 3CFEA 3L73E 3S5LB 4MBRA 1DQDH 4NAJA 2D3NA 5GTIH 3DJTA 3NK3A 4N8VB 5L9DH 3KPRB 1ZLDA 3TJHC 5CLYA 1JI1A 5BQDA 5CD5D 1MELA 4XPFH 4J2XA 2J8HA 1IQDA 5BZDB 3AM8A 3O6FC 2Q3ZA 4G7SB 1FLTX 1OMIA 1Z66A 35C8H 3VP8A 3Q3DA 5DVOA 2KXPB 2YFNA 1NU1E 5HGBB 1EK3A 4APQB 3RFZC 1ZGLB 1ZSDB 5FYLD 3SDXB 5C6WH 1DUZB 2Y6SD 3SODB 4EZJA 2VLJE 1FFPA 4YPCA 3F7QA 3WKYA 2K9YA 5JDJA 3SDXF 3N2JA 2JQAA 3GXIA 4OCYH 4CILA 2BP0B 4KRPB 5C71A 2IBZE 3FFCA 2ZT9C 1K3IA 1W8NA 2OYHA 3TP4A 4HZLB 3B3IA 2HKAA 3L35A 1RI8A 4HP5A 2ZOUA 4JCLA 4UOW1 4WHTA 3ZRCC 4OLZL 3IE4A 3KLDA 3B9KB 4HQQH 3GKZA 4MD4B 5KVGE 4G6KH 1FZJB 3GMPA 4HUMB 2FFDA 3U79A 3H56A 4NLAA 1TXKA 1M1JC 4Z0XA 1MVUB 2QSCL 3BOVA 3EJSA 5FV1L 4KMTH 2F74A 2DQEH 4MJIA 2JJWA 4Z7NB 3OJVC 5TJWK 2DLEA 1E8XA 5DHDA 3VI3F 1G1OA 1OWWA 1YC7A 4BA0A 3QHFL 5EULV 1YA5A 2V2TB 2EO7A 2JQZA 4J4PD 3RGBA 4M7JH 4AC4A 5BVJB 2VLLB 1AC0A 2N7BA 4GG8A 3HLAA 1ESOA 5DZ9A 1E90A 4F8QA 5HPMA 3G6DH 5I19L 1OE1A 1QO3B 1RZ7L 1TYJA 1F58H 3D85A 1NEPA 5GZNA 3RL0B 3PWVA 3VXRA 4LSQL 2XFXB 4NRXB 3POHA 4OI8A 4PGZA 3RPBA 2XNDH 5JXEA 4H2AA 1YECH 1AQDA 1FN4B 2GIYA 5TJHA 3FH7A 3VWKA 3O9WB 2D8KA 4IJ3B 3IVKA 1IBDA 4K9EH 2X70A 2HLAA 5D4IA 2L3BA 2KI7B 5DQJA 1G4MA 4A68A 1TZGL 1X5JA 4DEWA 3MFFA 3PFUA 1U36A 2ZCHH 3MRGB 3T0EE 4M48H 3ZKXB 2JFCA 5CAYB 4TYUA 1JZ8A 4OKVA 4MNGB 4F7EB 3VN0A 3CN2A 4FC3E 4LIQL 2BEQD 1ZOYC 4LFHG 4DGYH 4G3YH 5BS0A 5I15L 4P3WA 5BU8B 4G83A 2EXYD 1OIPA 3CXHH 4P07A 4XMXA 4OLUL 4IGBA 3H4HA 3L45A 1JGEA 1KB9E 4YHYC 1A22B 1QSFB 4FFWD 4NT6A 3KWWA 1E9OB 1XF5B 5LCVA 1AXTH 1T80A 4L8DA 4R4FL 3GKWH 2IALB 5CBAB 7CGTA 4BSVB 3SJVB 4L4JA 4OZFA 4NB7A 1SBBA 1Y1UA 3BISA 2EDTA 3CZJA 4QRRD 1J9RA 5AVTB 2DJUA 4WNQB 4K3EH 5CKGA 4AKPA 2ZXDA 4Z7WB 4LARL 2EEDA 4DERA 2BVYA 4DPRA 2GJZA 4JFVA 2OYLA 4GT7A 5ID0B 4H0HB 4Z7WF 2W0PA 3A0HE 1YEWA 3BKJL 2Q7YA 1EZVI 3BVXA 1N8OE 1Q0YH 2OYMA 3ZKSD 2WQAA 4BHUI 4HIJA 4HJEA 4RMQA 4WU7B 3CXFA 1Y8AA 2Z92A 2PPFA 1BMGA 1SJVA 2YRZA 4FLRA 5E2VL 3S8WA 1T2KC 1RF1B 2XPGB 3QEHB 4XCEA 4JFHD 2ZYGA 3VMXA 1MZYA 4ANVA 4HOZA 4UMGA 5I8OL 1ED3B 1H6TA 3CDZA 1QQDA 2WXLA 3VDAA 3HBQA 1BAGA 2J2ZA 1RUKL 3R8QA 3GGWB 5K39B 4AEIH 3TDKA 3O6QB 4I9WE 4ZUSB 3WMPA 1RIUH 4Y88A 5DO8A 2QQNH 2KZBA 1Q9OA 1CXFA 3ASNB 3MLYL 3QZMA 1MUUA 2N1TE 3RWGB 4NO5B 5GJTH 3KXDA 5KVEE 5LGJA 5D2LE 3AMLA 5CUSL 2G3NA 4NCC1 1NTMG 1R17A 2L4OA 1V7MH 5F9OH 2HAZA 1MH5A 3HAEH 1N4XL 4M5TA 3RY5A 3ZR5A 3ZDWA 4CMHB 1E5YA 3RVTC 2I26N 1XBDA 4EI5C 5I0ZA 4FADA 2ATKB 2IF7A 1N64H 2HT4D 1CXLA 1SQPJ 2OW6A 2B88A 3G3LA 3QARA 4FNLL 2B4CH 4UOZA 3CVCA 2MTAA 4IRSB 5IQ7L 5KVMC 5C09E 3ZDYF 5JW3L 4KC3B 2RCSL 1TLMA 2XY2A 4J2QA 1VGKA 3FQRA 3TCTA 5F7FA 2AABH 1M05A 2DJMA 1FGVH 3L2MA 4ALAC 1GOGA 3PIQA 1ACXA 1JVKA 2EH8L 5KOVC 3QNYA 3BH9A 3K7UA 2E5YA 2FJGA 1M71A 1RIVH 1TZIA 1SQVK 3KJ6L 5TQ0L 1MWAL 2OTWB 3EOBA 4FG0A 4BRJA 2B20A 1PAMA 4OF3A 3VYNA 5BW7A 5J57B 3DETC 3FHAA 5F9JA 1EDJA 3ILPB 5DTFB 4JFFE 4GKZA 1UM5L 1L0NE 2HRGA 4IBTA 5HI4C 1QI5A 2Z64C 3BIAX 1RHZB 5CLXA 4Z8FH 1IVTA 3HS0C 3GF3A 4OZIB 1KIUA 3RPKA 3SKUD 4EPSA 1HINL 5F1SA 1NC4D 1SXZA 3BDYL 3CSTA 3W2DL 5GGRY 2ZWZA 5B3JF 1E4JA 4PJ7F 1VQMP 1K5NB 3VB9A 1AVAA 2H6PA 2VDRH 4Q2ZA 1M4KA 2WM0A 1WHPA 1Q7YQ 3RWFA 4JDTL 2VAAB 2FYUK 2KOGA 1A0QL 1OQXA 1W8EA 1KC8Q 1TJGH 1XSKA 4I18B 4J3OG 1NANI 3IMTA 5FGCB 3HNVL 3K6SA 1JHTB 1DVFA 4AZ8B 1NKGA 1FO0L 4PJ0H 3D9AH 3AEBC 5DJCB 5J5EA 3TT3L 4UDUA 1W2KT 2JIXA 4WEBL 4GQRA 3BRDA 1GHFL 1PL3A 3LNFA 5KBMA 1I7RA 4NKDA 5T1KA 3MCYA 1ZJBA 5DLML 1WCBB 2K78A 4ZFOL 2FT7A 1G1YA 4PWKA 1A7NH 2G60H 4HLZG 5K59E 4IK6A 3HCVB 2G3ZA 3FSAA 5GGTH 5FO7B 3IB4A 5IK3B 4NO3A 3BPOC 2NPLX 2JELH 4GUCA 1SOXA 4O2CB 4PG9A 5E1IA 1DX7A 3VMPA 4AQ8C 1G6VK 4GEIA 1AHWC 3M0DC 1OGTA 1NDMB 1GS8A 3KLSA 2OR9H 4L3CA 4HS6B 5E9NA 1OW6A 4GXFA 4XAWH 4LVHC 3HE5B 3WAKA 3O3EB 1TFPA 2R2BA 1B88A 4HDIA 3DOHA 4LEXH 5DVPA 5E6IC 1KBPA 1EEQA 4TPRL 2ZOTA 1EDYA 2YAMA 4MA1B 2J58A 4ZKPA 2ZKWA 2ADJA 2ZPKL 4AYEC 5FDWB 2EABA 1UT9A 1IAMA 1TENA 2F58L 4H8PA 4LSRH 4P2RA 4PJCA 3HKFA 5E4EC 1S5IH 2FIKA 2PAJA 5EPMB 2NR6C 1TZHB 1N68A 2YMTA 3CFQA 3VMOA 1SFCD 2VDRB 3VD1A 5L8KB 2QGDA 2YXFA 4NLHA 2EIJB 1Q9WB 2CK3H 5BUGA 1IZNB 1QYGL 3CC4P 1N59A 1RE3C 3VFVA 1X5KA 4PJHE 4PLJD 1L7TH 3OLEA 1WICA 3FAXA 4XMVA 5LBGA 4Y89A 3MCG1 4I9WD 5DUJA 3T2OA 3VMYA 2DPKA 3KYKL 5A2BA 1DQTA 2N1TD 3OKMB 2OJEB 1WYJA 2YR3A 4IJTA 3TYGH 5JIIA 4QPEA 2XN9B 1JYWA 1D5IL 1Z9SA 4I1NB 4KVCL 3F85A 1GZPA 1K72A 3LEXA 6FABL 1BZQK 2AJVH 1T3JA 3FTXA 3FXDA 1DE4B 2HWZL 1WSST 5D7IA 5T3ZE 4OBSA 1MREL 3TL5A 3V8CA 4WEMB 2WXPA 3OGCB 4JS7A 1HH9B 4JN1L 4LU5L 4XCCH 4EUPG 2AEIT 5FO2A 5LWYL 3VFPA 3N3EA 3BKML 1YDPB 3LNGA 3HHSB 3B9DA 1XXFC 4JZNB 4D3CH 4LCWA 1DZBA 1MCFA 3WS6A 5CGBA 3TGUG 4WUUE 3OHXB 5E5RB 4FKEA 2CDEA 1AACA 3GUFA 5FWQA 2H7WA 3JWOL 5TK2A 4RX4D 4AL8L 4MJ4A 4LPWA 4ICWA 4NZUL 4H8HA 4URTB 3D25A 4WO4D 1VJSA 5F1OB 3RHWF 2DJ4A 1WITA 4OW6A 2V4LA 2CLZB 2ZF9A 3F7PC 3CVHH 2BWIA 4HKZA 4OJFL 1CGSL 4UT9L 3DVNB 4XPGL 1FNAA 3FT0A 4PS3A 4NQXB 1XAUA 2ADGB 2WZ5A 5H37A 3AREA 4FQ1L 3FO9A 3BEVB 3IR9A 3PU7A 4BQBA 1TSRA 4KPHH 3S98A 4AXWB 1ZJAA 2LT9A 4FQCL 4D0BB 3SGJC 4FQIL 1S2EA 2HT3C 1NMAL 1H0TB 3QUXD 1NOAA 1P53A 2IJ0C 4NPDA 2K8QA 3KJ4B 5JZ7D 1RJZA 1VFAA 3FU6A 4PJ8D 1UD8A 4XNYH 5EBGA 1DBAL 2WBKA 5FV2A 1K9TA 1G7LA 3NZ8B 5E79H 3U9UB 3OMAB 1L6ZA 2IWKA 3AEAC 1X7QA 2X4PA 5D93B 5MHSE 1DQLH 1TQSA 1A7OL 4H7VA 2VJXA 2YIUC 2Y07L 4BFKA 1QVGO 3UBXB 4NP9A 3GHGC 4NAMA 3K6NA 3QCTL 4O2FA 5ISZD 1MCWW 1QW8A 2YXQB 3IFMA 1FCCA 4JLRB 1GKOA 1E5ZA 2EDWA 1Y6MR 2Y0CA 1U8IA 2CKBL 2PR4H 2QMJA 5ESQA 2X6AA 4XX5A 4Q4IA 1PD6A 3D08A 3IJHA 4U31A 4F9LC 3N0AA 1FNEA 4R5TA 2VITA 4XVUD 3MLSL 2X28A 3DURA 4QDGA 1BZDA 4PRPD 3WEAA 2VXTH 3JUYA 1JY2O 3PL6B 2P24A 3PUUA 4NM4L 4TLTA 5FYJL 5ITFA 1MW0A 2A99A 5JHDD 4LEEA 4JM2D 1XF3B 3O6ML 4AZUA 1F8TL 1JXGA 4C7RA 3C6LC 2AXTH 5EZIL 5MERA 4MCNA 2WBJC 3OQ3B 4JFPB 5D1ZB 4GUQA 2H47C 2J1YA 2WJ7A 3P4OA 4C56A 4AVKA 3B34A 3CVHB 1UXSA 4FZEH 3GO1H 3QGVA 3MRPA 5SV3A 5IMLA 4NO2A 2C0XA 2Q2EB 4HKXA 1JYVA 1F4YL 4LCYA 3GMMB 1BCCG 3TM6A 3VSQA 4HC1A 2AXWA 3CFBA 1KTBA 4JFEA 1DJXA 2YLHA 3FCBA 2AEQL 3OJDA 5DI8B 1V8HA 4AYBA 2H8PA 2QVTA 4QY8A 2R2HA 4R0LC 1YY8B 3D2UA 5AW2B 1NGZA 2Y5TA 4RFEA 2H1XA 3K2KA 4KK5D 4A2HA 2JKLA 2WTYA 1KTKE 4XMZA 3NCCB 4CU8A 4Z6AT 1D9KC 3RKPA 3BRFA 3WELA 4M3KB 2CHDA 4P8QA 2VJ0A 3QXVA 2RAMA 5CCHA 4LGDE 1FQ9C 4I48A 5I1IL 3NCBB 4YO0B 1IVLA 1BD2A 3AXLB 5E1AA 3FYIB 3V5HB 3IDYC 2CGYA 2IAMA 5LAPA 2QG4A 2NY0C 3HC4L 3FB8B 3JTBA 5E6UB 1P9MA 4C58B 1DO6A 5JHLL 1SJEA 4G6ML 3C9NB 2HT2D 1SEQL 3AEGC 2GBAA 1U8KB 3R0NA 4K55A 3LRSA 1M2VB 4FYQA 1IGIH 4XBPB 3MBXH 3DJZA 4JDVB 3KQGA 4AGNA 2XQBL 3RFRA 4QLWA 3W1ZA 1CIUA 2PGDA 4EI2A 2Y36L 3WSQH 3G6JA 5B39G 5F9WB 4LCCA 1YJWP 5A3IC 1KYFA 5GS1B 1EQWA 2P1YA 1FVEA 2QGEA 2QQKH 3TH3T 3SDCD 4IBSA 2R8SL 3AE4C 1CGVA 3KM2A 2OZ4H 1PZ5A 3L3DA 4NHUB 2XWZA 1NWOA 2KBGA 5D70L 3FUDA 4QAWA 1GGIH 1TZ8A 3WXWH 1R24B 1G4RA 4J28A 5IB1A 1NTME 1YPZE 3X3FH 3MGNA 1L9NA 3SPCA 2DJSA 3QH3B 2FHFA 1FL3B 3FQUB 2WBWB 3PNWB 4DP1X 1AGEA 3QUML 4ZNEA 5TDPB 4PJFE 5AOJA 3MLXH 3QDME 4GBXB 1THCA 3PAUA 5I6XB 2J56A 5E9DA 1AXIB 2A1WL 3UTZB 5DFTA 3P8CE 1H15A 1E8YA 3TV3L 2P5ED 4EKJA 4CUCA 4XPHH 4NUGH 5HDWA 4AOFA 3FRPB 4IOIH 2Q86A 3IGUA 2WT7A 4PV1D 1ZW0A 1E6OH 4X8XA 4DCQB 1DBMH 3SWFA 1OF2A 2VXQL 4FFZA 4RWYH 4XE5B 3L70G 4E36A 4IS6B 1HOCB 2UVEA 4NN6B 5EUKB 4ANXA 4R7LA 1NCGA 1IFGA 4XHJC 3NAAL 4ZTEA 4OQTA 4ZOCA 3DTUB 1N5YL 5JO5A 1G9NH 4AK2A 3W67A 1QBAA 1UEMA 4WWKC 3LKOA 1KYOK 4ODVH 1X22A 2VYRE 4GODA 1AXSA 1EDQA 1K2DA 3KL3A 3MYJA 3NJFA 4P2OA 2R23A 2VE6A 2P7JA 5F7UA 1TLKA 4JO1H 4KY2A 1KFAL 5IBUG 3UZEC 1QFWM 3UC2A 4OAWB 1D6EA 4P4KA 4IKJA 4Z18A 5E9AA 1LD9A 4L8BB 4MFHA 4BFIA 3FCSA 4UDTB 3EYOB 1NYHA 4NZRL 5JW4R 1UXWB 2DWEA 3FU7A 3E6FB 1RQUA 1A64A 4FDWA 4K3DH 2ISDA 1M90Q 5FFLA 1E3XA 2B1HH 4B5ZA 4ZPVB 4YVNA 2VISB 5BOZG 4WY4B 2YSSA 3I9GL 3J7HA 4IIQB 4LASH 4N2NA 1JFQL 4U1HA 1HCFX 1M1XA 4LIQE 1P5UA 1QEWB 1V3LA 4PJ5B 2YPLB 3MBWA 4J1UB 4KH2A 3RX8A 4GRLB 1IO4C 1ZR2A 3DO4A 1A9BB 2IANE 4PIRF 3TBBA 3S88L 5TDOA 1BVNP 4ZOBA 1T6WA 1C16B 5GSRB 1L0LJ 3PUCA 2GYSA 4IOIB 4LFHD 1EPFA 1KBGL 1URIA 2XBZA 3QZWA 2XN0A 1URQC 3BDXA 3BIKB 3BLPX 3CLFH 4IRZL 4KK6C 4PR5A 4R26H 5BMFL 1OXZA 4RMSA 4LPCA 4WKZA 4YGVB 3HLKA 3BZEB 1K4CB 3FXIC 3ZYOA 5F1NA 3CCJP 2WZ0A 1R0AH 2QSVA 1J11A 1UJTA 2HH0H 3R0MA 1OSPH 3P77B 3HUJA 3F04A 3ZKMC 4NKOB 4EN3B 2YGNA 1EJ6A 4ZD3H 1MLCB 4KXZH 1NPNA 5CZKA 2WLIB 1FC2C 4JUSA 2Q10A 1FL6A 2OARA 3W39A 1DHKA 1QWHA 2XTJD 1OTTD 2OZNA 1BZEA 4BFBD 1OAYH 1AO7D 2AXGA 5D2NC 3AU0A 3D3VB 3LH8A 3MCLL 5DHMC 5EZLA 1R5SA 4BKTC 4Y16A 3QFDB 5KAQF 5IG7A 2HFGH 3W0WD 3PFQA 2AJZB 1KELH 3S5LA 5HD8C 1BLNA 2CE6A 3TZVB 2QE7H 1GAFH 5I23A 2X4TA 3TK1A 4UT7L 1PIFA 2DQJL 2VLJB 2BP3A 4AL8C 1T2QH 4KNSA 1HHJA 3AT0A 3QEQB 5GISL 2IPTL 4HCRL 3TF5A 4FQQA 4I9XA 5TPWL 4APQA 3IN6A 1FE8H 1E2VA 2IDBA 1U3ZA 4KKAC 1T0NA 4OZHB 4BGDA 2NY7L 2Q3AA 1T4KB 4IU2A 5I5JA 2FR4A 4I8DA 2F53D 1XSIA 4OT1H 4R9HA 2H2SD 3DI2B 4AM0Q 2F7QA 3RGVC 4OZHF 2XRAL 3S4SG 5CCGC 2ZVOB 1A5FH 4KKRA 3T2NL 2GITA 3LN4B 3F7LA 1NTMD 1MKMA 1XD1A 2VRAA 5BZWA 5GS0D 1KSRA 3WU2H 2J44A 4PJ9D 4S1QH 1SQXJ 1YYML 1VDFA 1AGDA 1D5XA 3RWEB 2WQVA 5DVKA 1JZ2A 4AQRD 5EOTA 3WEMA 5F0LB 4JY5L 5EU3A 1DANU 4DFHA 3B4NA 3QHZH 4JJ5A 5FCSH 3ABGA 3CCSP 2WSCJ 1S4IA 2JDIH 2W9DH 1ASQA 4MS8C 5HYQB 3ARBD 2MKVA 2WLYA 3F12A 4R7XA 4L9DA 3DTXB 3OKYA 1FZJA 5C39A 2BJMH 1NEZA 1YEDB 3FQ1A 2WTRA 5LGHL 1CSBA 3LXCA 4GYBA 3H55A 2YKOA 4KO5A 3PG2A 2H89C 2VO8A 1ZVHA 3OKEB 2GB2A 2ZX9A 4X7SH 1SYVB 2F5BL 3TGUE 2NX5A 2DWSA 3PGCB 3MUHL 3VM5A 5I76B 2V2TA 3EBIA 3LIZL 4JKPL 3WNIA 3AG3B 4FEMA 4EI6A 4BQ6A 4FNRA 4JFQA 2FIRT 3H1HG 1MUJA 2PP6A 1NIAA 4NNXB 3O3BB 3L95B 3UBHA 4KXBA 5DVNA 5EC1B 1I7UB 3EJYD 2BRQA 5ALBL 4ZMVA 2X2YA 3IAGC 5H2BA 2CRZA 4XNZC 3LYRA 1YHPA 4WSKA 1ZLVH 1TVHB 3U6RA 1FNGA 3O9WA 3EYVA 1UASA 2WLHA 1KJ2H 4PLKC 4HS3A 4QCIB 4AW4A 2BVOA 5EIIG 2X3AA 4ELME 2X3CA 3SWKA 2WKLA 4JRXE 1PD0A 3UAJD 3A67H 4J3OD 2HN7A 3SOBL 1JCVA 3H9HA 3MRQA 3MJ8B 4DGIH 1U8PB 4UCFA 4YDLC 5KSBE 5KSVA 2A9ML 2BOBB 3O6LL 4JFDD 4ZQTA 5ECGA 1TEGA 2IAND 3U4EB 1AS6A 1RULL 2R83A 3O81A 1JZDC 2K0RA 5CWSA 4BZ2H 3WFDL 1ODUA 1GJWA 2NLJA 3QUKB 1MCQA 2BZ7A 5DFAA 3WKML 1QSFA 2ZWSA 3X1FA 4NQEE 1AY1H 2VLMD 2P46B 3H7BA 4U4IA 3FT3A 2NW3A 1E9OA 2BRRH 1XF5A 2NQCA 2JCCB 2FWUA 3MDJA 1VACB 4LSUH 2M3EA 3K6FA 3UTSD 2JCCF 3LXUX 4HBQA 3VG0H 4M00A 1GYVA 3ZL4L 5KUKA 2EKJA 3IAQA 5KYUB 3L71G 1NDGB 2Z4QA 3HS9A 4XP9H 2WQXA 1BJ1J 4FXKC 4LOUD 4MMYB 5C8JA 2J5LC 1TCMA 3AS2A 5I1GL 3RZCA 4R4MA 5HGDB 4Q7DA 2CO4A 1TETL 2R0WL 2G2PA 4JK0D 5FO9A 4E68A 2RGSA 4HJIA 3IPFA 2KPNA 4KQ3H 1BCCE 2EIMB 4MD0A 5EU4B 4KY1H 2GSIA 5ALCL 3VNZA 2XWTB 3WD5L 3QIWB 3NZUA 3TFBA 4I85A 1I7ZB 4ZO8A 2OK0L 1PZCA 4N2CA 2HYNA 5D2LB 1JPFB 2K3TA 5D7KE 1LP1B 5AAPA 2FJHB 4KJPC 4L9LC 4MQTB 3OZKA 1T1YB 5K39A 5IROD 1V7NH 2C1OA 2GUSA 2X0UA 1KC5L 2XG5B 5TD4A 2V7HA 5C0EA 3LS5L 1E3ZA 4U3FE 3V6ZA 3KWTA 6PAZA 1KEMH 3B5ND 2AJXL 4JPWH 4L05A 4GW5A 4RGOH 3PE9A 1SQQK 1MCPH 2CPBA 3NDZE 4K5NA 3ZYZA 5AW3B 2FX7H 3LVEA 5C09B 1U91A 3NCJH 3DMMB 1EHLH 4O02A 5DS1A 4RFNC 4C46A 1UH4A 2P80D 5D1QE 5J1AA 5MI0C 3TN0D 1H6FA 4N0CD 4TUJB 4DP0X 7TAAA 5D2NE 5AVWB 1A3RL 3CFCL 4U1JA 4IRSA 5D6CB 5JIMA 3WFCL 5L4FA 5C7XL 2HG5D 4XPTH 5IB5B 2WXNA 3O6FB 5HI3C 2FYUG 3M86A 1FLRL 3D51A 4QXTA 2YZ1A 5L88L 3O8XB 4Q52A 3RFZB 1CDJA 4HJGH 3D50A 3EIFA 4RGND 1GL2A 4JFFB 2CXGA 1RMFL 1S46A 1TTBA 1N26A 2JKSA 3EFFB 1KPUB 1DTUA 2K6WA 1J1EB 2IQAA 3NH7L 5TE6L 3GMOB 4ZMLA 3L4ZA 4X0KA 1F6AA 1TMQA 2Z35A 4XPBH 5CZXD 5DA4A 1IC1A 3ULSA 2B7DT 3TGUD 2ZT9B 1MI5D 4H44D 4LBEB 1CN4A 4XVOA 3UTOA 1LTJA 1KQGB 2JB5H 3I55P 2VQUA 4PYGA 1QLED 5LDSA 4PTUB 1ZY9A 5CCGE 1MFCH 3KGRA 1MFMA 1WP6A 4WFGE 2E7MA 1FFNB 3FB6B 3K6OA 5KG9B 1XSOA 2ZCKL 4OZIA 1NGMB 4X80H 4PRNB 2EIEA 1QHPA 3L4WA 1T0MA 5CJQH 2RQ8A 5JIQA 5DURB 1PY4A 1M1JB 3C2AL 2QV4A 4HVBA 5SX4H 2GY7B 3EJTA 4MXVF 1HHIB 1T2JA 2D7NA 5IESH 4GW1B 5G4MA 1F0LA 4BCXA 3JQOB 2VAAA 2WXMA 4QHMA 2GAZA 5KVDL 2OBGA 4OM1L 3L70E 4AZ8A 5HHVH 3LQZB 5JA8B 3SDAD 3NACL 2D9CA 5DJCA 3O11B 2A06E 1WFIA 5FYKE 2K7PA 4IRJB 1U8OB 3WE6B 4J4PC 5T3ZH 3WFEL 3KS0J 2I07B 1WCBA 1CLVA 5FAAA 5HJGA 1N8ZA 1KN2H 2P8PA 5LXGL 1S8DB 4HJGB 3PHAA 5L6YL 1GXEA 1K4DA 4TSCH 3C60C 2WXJA 3EZJB 4UB6H 2J1ZA 3KLQA 2QPEB 3OV6A 2CGZA 1Z9LA 2Y1ZA 3LMJH 3W81A 4HS6A 5F7YC 5CMAB 4NKIL 3VRIB 4MNQD 3HE5A 1QASA 2MNJB 4OVNF 3FQTB 3DI3B 1KGWA 2YMXH 3V9EA 5IHUH 3KM1A 5CMZA 1JK8A 2B14A 3ZDXE 4OBRA 2R5DA 3T6XA 3V7AG 4YHYB 2GCYA 3RK3D 1CTMA 4NS0A 3MRKA 2EYTB 4OV6F 3WUWB 4O9HH 5TFSH 1T1WB 3R06B 4MASA 4UTBL 2B15A 2WB7A 4GIFA 1LO3L 3E9TA 1BCCD 2EXYC 1ZLWK 1J86A 3BD4A 2QEJA 3MQIA 3KPOB 4J6RL 5FPIA 3RVVD 1S5LX 4DAGL 3QO0B 1UA6H 1UZ6E 1IM9A 5AW5B 2N0MA 3L5WA 3G5VB 5FF6A 3TS8A 1BG1A 4L1BA 3L4CA 4QRFA 4P48A 3EUUA 1WK0A 4HHWA 4YS4A 3NIDB 5IJDC 4ALAH 4HEPG 4MJ5A 5CJ4A 2DDQH 5J4MA 3LB6C 4IMKC 3NT0A 3NIDF 2DD8L 2XT1B 1FS0E 3OAZH 1YQ2A 4JAMA 1IGML 3VTMA 3X12A 3N40F 5I16A 2P5WA 1DSFL 2OMZB 3CPLA 2X87A 4N0YH 2ADFH 1VKXB 3HB3D 2WP3O 3U2JA 2MQCA 5JORB 1UM6L 2V8LA 4KKLD 3LRMA 3WFZA 5C07B 2YBGA 1NOFA 1B6DA 4YIQB 3O4LA 3NIFE 1ZLLA 1FH5H 2QGCA 2BZCA 4W9JC 1HH9A 4WUUB 3MRRB 4XI5D 4AMXA 5D9SA 3TTYA 1BE3E 1IKNC 4FMFA 3O6KL 5C0AD 1CLOH 3VXSE 4Y4HD 2YZ8A 1DLFH 4Q6IC 1HEZB 2AQSA 2P1JA 1G6RH 3QULA 2H3KA 3VFMA 2FT8A 4URKA 2GKIA 3J2PA 4MDRA 1FZAA 5TF1H 4OUUB 1BFOA 1I9JH 3NJLA 4LCIH 2QHRL 1SY6H 3C08L 4DEPC 5KJ7A 2VR4A 3OHXA 7PAZA 1S7QB 3K80A 4FXGC 2V17L 4EI5B 2X4UB 3GBDA 4PD4I 3ZL2A 3LCYA 1X5XA 2FBJL 4PS4L 4RNRB 4NBYB 4ENZA 4UV7L 3OZLA 3IE9A 2VO5A 3W5MA 1UJ3A 4ZFGH 1PP9G 3MLUH 4IMLB 1CLZL 1C08B 4TKWA 5AZEL 4JFYB 3TWCL 4TOYH 5I1AB 4NQXA 5KJRL 4N9OB 4NAQA 2ADGA 2HT4C 1EJOL 1SLQA 3NCWA 3N06B 3TA3D 3BEVA 4KI5F 3TIEB 4NC2B 2DN7A 4A38A 4AXWA 3EDFA 3FB7A 1FZKB 1XQ4A 3RK2D 2HFFB 4CBZA 4I13B 1H0TA 1PGOA 4FQLL 5ABDE 4F57H 4JO4H 3WBDA 4PD4D 1TQWA 3COOA 3WGVB 3V5BA 4APXA 5GTHH 5DJDB 1ZTXH 2DQGL 1D5ZB 2Y0EA 1SOQA 2YD5A 3IFLH 3Q6GH 4FXLA 4P57B 4E42B 3L70D 4NXKA 2K37A 1ZXQA 3MCKB 4DUXA 1B0GA 3Q06A 4QRTB 5ICUA 3MJ9A 3C5ZD 3NRPA 1NGWB 2N1KA 3VXOA 5FYKD 1HT6A 3HS0B 3G6JF 1MZZA 1CW5A 2LABA 2XX1A 4FG6D 3N9GL 2KZWA 2NXYC 2X12A 1N18A 1ND0B 2ATPA 3D0LA 5AENA 5DJTB 1G6RB 3ZZ1A 4JBZA 1N67A 3CBKB 1S7WA 1T04A 4YJZL 2FATL 4M93B 3PL6A 1GTWA 3DX8A 3FFOA 4HFUL 5HYIA 3ZDMA 1P2CB 2JR8A 2LU4A 2XI9A 4DT0A 4HALA 2EO9A 4NENB 4HMEA 4NFDA 1I3RA 2X09A 1QPXA 5D1ZA 2H9GA 3M17A 4Y5XC 3L2NA 2FY8A 2WVVB 2EADA 3MJ7B 3EOAA 2MCAA 3SO3B 2Q6WB 1LTXA 5I74C 3WN5C 3GMMA 5DS8B 6TAAA 3L8QA 3GZPA 3IDMB 4QGYA 1V05A 3CFDA 5F7LB 3BPOB 3RJQB 4KK8C 2PYED 1BVKB 4G8EA 2G30A 1EIBA 2VLRD 1AHWB 2C34A 4ERSL 5J56B 3NA9L 1WIUA 3KGUA 5C0RH 3JWNC 1OO2A 1BDCA 4F5CA 3N44B 3H25A 4LVHB 5I1JL 1Z9NA 3N44F 1T22A 3W9EB 3QHFH 4XE0A 3ATBA 4C83A 5E6IB 3PQYA 1KT2B 2Y9RT 4AJWA 1UKQA 4NPJA 1UQSA 2A6DB 3AWFA 3L71E 2ZXAA 3GSNL 4XVTH 2VW4A 1C5CL 3AXLA 1WAEA 4GQZA 4HD9A 4O5LL 5I19H 4HIIA 4CNIB 5E4EB 1BF2A 3FB8A 3RJDA 3P02A 1FH2A 2ZKXA 3LZOA 3HD7A 5SWZD 4ZMWA 4LSQH 3W3BA 4YXLH 1F45A 4KMQA 4Y4KD 2O30A 4Y5YC 2EEAA 1U8QB 4YSPA 4B9FA 4LNVA 1NBZA 1BYNA 4TQ8A 4N5UA 1QLRB 25C8L 1NFDA 1XGUB 4FOMA 4X6BB 5E2UH 5C86A 5K1JA 1NFIA 4XO4A 1TZGH 3FN3A 2HLEB 5C0BB 3S34L 2C4XA 3FWLA 3UZQB 4XMTA 1IFIA 4B6ZA 2ZUXA 1JN6B 1A6VL 3VXSD 1ZK9A 4NWTL 1UOWA 3MROA 3QUZD 2KYIA 4F37F 1AKPA 4PW9A 4PY8I 3DOIA 3OR6A 3QDMB 4NHUA 1JOIA 1VIWA 3MV8E 1KORA 4X7FC 3SPVA 7PCYA 2BSTA 4I3SH 2O93L 5BVZA 3L74G 2OYPA 5KTEL 2DYPA 1R1CA 3QH3A 4F15C 3S96B 4UF7C 3LNIA 3KEDA 4HJ1A 5TDPA 2I60L 4I3RL 2HR3A 4GBXA 5DXWA 4X6CE 4MA8L 3C8VA 4AQ1A 2IG2L 4QKXB 3WY1A 3KL0A 2WN2A 4Q9RH 4K15A 3GI8L 1L4IA 3ARGD 1XF1A 3GHEL 5HJBA 1JWUB 5MEND 4KWUA 4LARH 2EE6A 5HYEA 2YD6A 3O41B 2G4GA 1R3LB 1ZRTE 3EADA 2YK1H 1YY9C 2CO2A 3DX7A 3VFSB 4XMPL 1JCDA 1RZPA 3K8MA 1ERNA 4XWGL 3BKJH 5GGQH 3TBWB 1A14L 4NPKA 2BOLA 4HISA 4EOWL 2PFXA 1EERB 1AMYA 2WQWA 3MV7A 4N5ED 5E2VH 5DJ6A 5EFIA 3QQ4B 4GNKB 4K8RD 4OWFA 1OIOA 3UPRA 5EU5A 1DLHB 4LLMB 2H0FA 3V6OC 5I8OH 4KNUA 2E8YA 2BVUA 1EZVE 2CLVA 2QR0A 2GJ6E 1E4XI 1RUKH 4WO4C 1CD1B 1KBWA 2JKXA 3MRCB 1OAZL 2WXOA 1NWPA 3B2XA 3FRUB 3BP7B 4WAFA 1SHWA 2X53A 2ZE0A 4BFFA 5CR1A 2ESVE 1JOCA 3H1HD 2DMGA 3UDWA 3MYZA 3M7FB 2WMPA 5HY9A 3C87A 3E6FA 5CUSH 1PAZA 4PGEA 4N3YB 2VDQL 2VSCA 1KXHA 4ZPVA 2VISA 1N4XH 2VGLM 1PGQA 2YXRB 5EIVA 1RY7B 5E03A 4LVEA 5AAWC 2W92A 1O7VA 1SQBK 4BXVA 2YIUB 3QG6B 3DHMA 1F3JB 3GHGB 3VW3L 2AQRA 4GRLA 5TGBB 4FNLH 2B2XL 5IQ7H 5CD3B 1XMEB 1RZJL 1CG9B 3PXLA 4DO6A 4IHOA 4PUBH 4E41D 5JW3H 2RCSH 5GSRA 4Z1MH 1OM3H 5MEQB 2WYHA 2F7OA 2QEXP 1BQKA 3MUGA 3VFRA 1TTFA 3SE6A 3F6IA 3IKCB 2BSCA 3HC0A 1KD1Q 2YGQA 3CN3A 1TVDA 1YCSA 2F7RA 4YGVA 5AL0A 2EH8H 4QHLA 1L2PA 1ETB1 4GLRI 2OQJA 1XF4A 5F7EH 4PJDE 2WBJB 1BQLL 5TQ0H 2HTKD 4XHQA 5LBSL 4ELKA 2AP2A 3RWCA 2YXMA 4IOSA 3BRVB 3G04B 3QCVH 4G1MB 2YJQA 3RYMA 4F3FB 4H8QA 4JM2C 2OJ1A 2UUDK 4LLUA 4WSJA 1YNKH 1UM5H 2C3WA 1IJNA 4MVBD 5C2BH 5A2AA 4Z7UB 3L71D 4X98A 2X4RB 5HJDA 3G9AB 3PPEA 1OEZW 2CJ3A 1T8ZA 2IDTA 2WCPA 3MTXA 4Z7UF 1QL1A 4KO7A 3L75G 3BDYH 2UZYA 4OLEA 4PGJA 2HUHA 1CURA 3NFPB 4R0LB 4YHNA 3MUDC 4PFEA 2AK4D 2ICES 3TXAA 4OJDH 4JDTH 4J8RA 3BZ4B 1A0QH 1PFOA 4WNJA 5IB3A 5DEFB 5EC2A 3P9WB 3VG9B 5BVPL 2VLJA