5AVZB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avzB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avzB02
2Q5UA 3T97A 5AVQB 3NFQA 2XV5A 5APVA 4I2LC 2W6AA 1H8AA 1H89A 5AW4B 1FOSE 4RETB 2P67A 5APSA 1HUCA 3O8ZA 2KP8A 1HBWA 3P8MC 3IR9A 2N9BA 1GZLA 4AUWA 1MUUA 2R5BA 4JYBA 1NAFA 1CSBA 5AVVB 2QM8A 3KDPB 4KHXA 4AYCA 2WT7B 1J2JB 3WGUB 1S9KD 5AW8B 1G2CB 2ZXEB 4C46A 3LIEA 5AW9B 4GKGA 2XZRA 2QM7A 2YO3A 1GK4A 5APTA 1GU4A 5APXA 1JNMA 3L35A 4HYTB 1FOSF 5AW5B 2WTYA 2P7JA 3M91A 3NXSA 3TK1A 1GD2E 3V4QA 3TYYA 1NWQA 1CZQA 5APWA 5AVUB 5APYA 3A5TA 2WPQA 1T2KC 3A2AA 3UIAA 2WPSA 2YO2A 4GT1A 1GU5A 2WPRA 5APUA 2P2UA 5AW1B 1MV8A 3P7KA 5AW3B 3V5BA 3VN0A 1JUNA 1CI6B 3M9BA 3TNUA 3HE4A 3M06A 2YNYA 1DH3A 3L36A 3VMZA 2Z5HA 1X8YA 3HTKA 4I6MC 5AW0B 1T2KD 3MD0A 2H7HA 1CI6A 3I5CA 5AW7B 2IPPA 1MFZA 2R3CA 2E43A 1SLQA 5CMZA 2WWWA 4B86A 2C9LY 2XU6A 2JJLA 3WGVB 5AVTB 1GTWA 3A7OA 3MGNA 2R5DA 1OXZA 1HJBA 3SWFA 1YYCA 5AVZB 1IO4A 3TNUB 4AQRD 3HE4B 1A02F 3VMYA 5AVXB 3L37A 2R32A 1FAVA 4DZOA 1S9KE 4M3LA 1SP4A 3HE5A 1HWTC 3M0AA 3VTPC 3V4WA 4RESB 2W27A 3NTNA 5AVRB 4C7NA 4EOTA 3A3YB 2ZFCA 1A02J 5AVWB 1GK6A 5AVYB 5AW6B 3M9HA 3VYIA 2VRSA 5APQA 3B8EB 3OAKA 3NMDA 3P32A 4LC1A 5AW2B 2BASA 4JYCA 1OWAA 3HE5B 3M0DA 1H88A 2C9NY 3LIDA 2WT7A 3KQGA 2Q7CA 2E42A 3VMXA 1KQLA 2Z5IA 4XE5B 5AVSB 2Q3IA 4C7NB
chains in the Genus database with same CATH superfamily
2EJ1A 2IMMA 2X1WL 1YEGL 1F11B 1NCCL 1UXSA 3BAIA 2JB6A 4G43A 4M7JH 4AQAB 5E24E 3VA6A 1JGVL 4YPGA 4JYBA 4RMWA 1VRSA 1XHHA 2JI1A 5GHWH 1WA2X 3VCLB 43C9A 4Y9FA 1PSKH 2WPVB 3D1MC 4NUJA 4XBPA 1N8OE 5CILH 2LXBA 1L4IA 2JJTA 5D96B 4L8DA 2QLVB 3EKCA 1SOSA 1QZNA 2BC4A 2Q7YA 4JZJA 4LVOB 1C9SA 5T1LD 2XSKA 1KBKA 2OA9A 2VZ1A 3ARDB 3EJQA 3BZFB 4JB9L 4OLVL 1ZSDA 3B9EA 2QQQA 1XL4A 4FHKA 4O02H 5F7KC 4ZMPA 5KJ7E 3VU1A 3TL5A 2PYEA 5CINH 5JPMA 2WQ8A 4HSQA 4LLYA 3B9KA 3Q2LA 4UIKH 5IR1A 4BSVA 3AROA 2MQCA 1VA9A 2LU5A 1TNMA 2YHGA 1BPVA 4TTDD 4CADA 3H1JE 1ETJA 1LD9A 1R5SA 4L4TA 4NPJA 4XNYH 4ZW7A 4ZXBC 2E7LC 2OMXA 5AW1B 2I1KA 1OHQA 4FQCL 3P54A 4FL4C 4KVCH 1ULVA 2GBUA 1E4WH 5D6DA 3ML9A 4L23A 4Z7WE 4DUVA 2C1PA 2XETA 3ZDZE 5ISZB 5ICUA 1S5LH 3FDWA 1FIGL 4BFOA 5GS0D 3WY3A 4DNLA 2D7TH 1NGWA 5C0BB 1IUZA 5I23A 2CQVA 1J5OH 2IAAC 2P5ED 1SQPG 1LDSA 1S3KH 2WKOA 1EMTL 4PRPD 1KXHA 4LEXL 5FYLE 1ZP0C 5CJ0A 2NDFA 4N2HA 4PJBA 4G6FB 4EZJA 4X5WA 1MLBB 5FLVA 4LEBA 4WWOA 5G2NA 5B38B 1KEGL 4HQQH 4Y2DA 5LAXA 3UDWC 3M88A 2IZ0A 1OGAA 3EYVB 4OIAA 1EFXB 4HIEA 1BFOA 1I9RH 2R0KH 2XIBA 5DR5L 3GPSA 4D9LL 25C8L 1MFCH 1JDCA 2B1HH 2VYRE 2Y7NA 1KPRA 3WLWC 4HCRL 1A02N 4XXDB 2OK0L 3V4VA 1NCTA 1MIMH 1W0YT 4DN4H 2D4DA 1QVOB 3LH2H 1G6RH 1OPGL 4HUUB 1CGVA 2A2QT 3ULSB 2ICEA 3B8SA 4DGWC 2XXFA 1OWAA 4I7ZC 5ESQA 1EEZA 4I13B 3B71A 1AGBB 3DV6B 3NSDA 2WXIA 1K5NB 4XP1H 4C56A 4BK8A 1EAJA 1KBPA 5LBSA 5EIIB 3GMNA 1ECYA 2A77H 1BZEA 3QJTB 4UU9A 1RPUA 1I3GL 5JOFB 2A6DB 1JHTA 2XV5A 1CYWA 1HI6B 2OTUB 5HDQH 2HWZL 2IBZY 2Z91A 3CHOA 4M48H 1IFRA 4YE4H 2V33A 2PFXA 1KC8Q 4D0DB 4AVIA 3EJCA 1QSED 4M4RB 1LM8V 5ICZB 2CK3H 3O4LD 3L72D 3QRFM 2WAHA 5DJ6B 2GVYA 3N4XA 3D05A 2NPSA 2KNCB 1T0NB 1U8JB 2D8KA 2DIBA 4MZ3A 3ROLA 3CH1A 3DOIA 5AB0A 2CO1A 4QXGL 1ZT1B 2OARA 2C3VA 3H7LA 1NTMD 2OW6A 2NSQA 3PP3H 4PRHB 1P7KA 4GUQA 2LFEA 1F4AA 3E80A 1KENH 1KJ2L 3QI9B 4NBXB 4HG4J 4N68A 4QHNA 4X9YA 4RZCB 3LOWA 5EN2A 3ZMRA 4IFDK 5IB1B 1FNAA 2Y22A 4GKLA 1EDJA 1W6LA 2Z7YA 2C3HA 1D5ZA 1IT9L 2HZHA 1A4AA 3IDJA 3RWIB 3H1HJ 2BNQE 3VI4F 5E1AB 3VTAA 5IVXB 4ONGL 4LNRA 4U05A 3WTSA 2AP2A 4NFDA 4GW5B 4V1DE 3CHPA 1AV1A 3P77B 3CZFB 2VDKH 2V8MA 2H1LM 3SOBH 1P84I 2VIRB 3BAJA 5IB4B 3RVUC 1NCBL 4MS8C 5J8OA 2PR4H 4XN8A 3SDCA 1J9QA 4KXZH 3B5ND 1AO7B 4MJ5A 3VAEA 1PP9D 3UTSB 1S9WB 1EFQA 2XDJA 1OMIA 4HPYH 5JW5B 2F53D 2FQFA 1A9EB 4I87A 3X14A 4NENA 2GUVA 3UJIH 3U6RB 3FRPB 3NESA 4ZMZA 1ZIAA 3A22A 4OCLC 1B0RA 1TTRA 3QQ3A 2WCSA 1B88A 3MREB 4Y2NA 3FXEA 1HSAB 4ZXBB 3TVMC 5I1DA 1FIEA 3VD9A 5CZXC 2K70A 4XP9H 3DX2A 3LAFA 3L37A 4FL4B 4G5ZL 3LZRA 2H8PD 4DZOA 1V5JA 2QSTA 3ZDWA 5HPMB 5I9QC 4YOKA 1JCDA 5KLVE 1PAMA 1NMBH 3FT3B 3QISA 1CDCA 1MY7A 4G7VH 5D7IA 5INCA 4HV8B 4KKCC 3VDCA 3MGTA 1LL1A 2G3MA 3CU7A 4MB4A 2W27A 5GTIE 1IBZA 4FFYL 4DKFH 5JPNC 1MN4A 1WFIA 4PJIB 5EBWA 1VCAA 1R5VA 3CDGB 4Q14A 3WKNA 3VJ6A 3G5YA 4IBTA 3VYIA 3ETBJ 5KJ7A 5CN1A 1T5WA 1TETH 4AH2A 2J2ZB 4HISA 4PS8A 3IDYC 3UBGA 3WFHB 1YDPB 3KPSD 4XNAA 4PU2A 3PQYD 1TXKA 2EUVA 1LILA 1REIA 1ECZA 5ETUB 3TFBA 4YDIL 3GNML 1SF5A 3OGCB 4FI8A 2DWEB 1II4E 1NCWH 1M2VA 5KSAD 2Z6FA 3GMMB 1XH3B 3H6AA 5EV7A 2BCCJ 4NZUH 5KZCB 4TVSa 1H8AA 1OK8A 3S9DB 1SQQD 4EI0A 5SWZA 3W2DL 1WFNA 1P2CB 2CDGB 3DECA 3C08H 3Q5OA 1NU1K 3VP9A 1XL6A 4PR5B 1S1CX 5CKGA 4JFYA 1F90H 5C0FA 2PN5A 3B1UA 2GBVA 2NY7L 3NK4A 2EE3A 4BIKA 4E41D 1RJLA 5AQ0A 2CBOA 3TO2A 2OTJP 1V7ML 1H3PH 4XMKH 2X28A 1LJMA 4P9MH 5DI8B 1EZVD 1A7NL 5EO0A 1PLCA 4HKBA 5BOZG 4MA1B 2UYLB 4OLZL 5ENWA 1N5YL 5M95B 2ISDA 1KDIA 1Q4NX 1OE2A 1WC7A 2VZUA 2P24A 4H26B 4NLHA 4N8VB 2DI8A 1IFHL 3GMPB 2PYFB 4D9QD 1JXFA 3MV8D 2J58A 3S36H 1ZMYA 2AQSA 4HPOL 1QRNA 2HPCA 2QPUA 2W9LA 3CMOH 4BZ1H 1OPOA 1PV3A 3FQRA 2CHZA 1XFPA 4DF9A 4PWIA 3S37X 1WJ3A 3ZHNA 1XTMA 2AMGA 3S8WA 1BBJB 2HG5A 5BRPA 3M1BA 5HDRA 4TUOB 4ZUWB 1PG7X 5ECJE 3PJNA 4PJEF 2D9CA 4TL5A 4XPFH 4M7LL 2MPAH 4G8EB 3VXRE 2YPKB 1CMOA 2HR3A 3T6ZA 3DSNB 4MB1A 3H1LE 1XZ0A 4U2ZA 4RO0A 5HHOB 3MLZL 3ORJA 4KPHL 3U7YL 1KGJA 2XV0A 4OQTL 3CFKA 2UXTA 3MBWA 4LL9A 1AGCB 4DP4X 1HXYA 4KTYA 2BWIA 1WFTA 3N1QC 4FGMA 1WICA 4OJEH 3QQ4B 5GRVK 1YYCA 1RURH 2KHAA 3MYZA 2IH3A 3S5ZA 1MI5D 5HI3D 1YMHA 2ZJSL 3B7SA 5FGRA 3IU3B 4GP4B 4AKOA 2WZAA 3FQNB 5CLYA 4PLJC 1OAYL 4DUWA 4OT1L 3ZZ1A 3BI9X 4IKLA 1KCRL 3MLWL 2I9TA 4YLBA 3AE3C 3QZMA 3RY5A 2V17H 5K9KA 5JXAH 4BFNA 2GUOB 3QQ9C 4R0LC 1EQWA 2A9BA 4QAMB 3KYKL 1JN6B 5CBEB 2Y3NA 3GSRA 1VFAB 1W91A 2BEQD 1T21B 3OXSA 1A25A 3QDGB 1GL2D 1PGOA 4OV6F 3TVMB 4EQ3A 2XWRA 4I9WD 4JCWA 1M1SA 2ITDB 1I7ZB 2EO1A 1WCBA 3LY6A 3SJVB 5I9QB 2CKBB 2YZ8A 1IC5H 4JQVA 2R0LH 3RE0A 1LTJA 1ERNA 5IROD 1NOAA 4V1DA 1C7SA 2EDKA 5DZJA 1A3RL 1CD1A 3GJFK 4XMPL 5JTWA 3MJ6A 1XCQB 3T97A 4F8QA 1MH5A 4MFHA 1JCKA 5JPNB 2R1XB 3F85A 4DZ8A 1N59A 4KKAD 5E8NA 1N3NB 5LCVH 4F8TA 1MKFA 3PWLB 3QGVA 1NDMA 4AQ8A 5DDHB 4X7SL 1H6FA 4RX4A 1SHWA 3KDPB 4HK0A 3T3MB 3IDYB 1N0LB 3V2AR 4ZMQA 1GVIA 4PD4I 3B5HA 2ITAA 1XF2A 3L3KA 4FQHB 5MEND 4WWKD 4KQ3H 1UYWL 4G80A 3G6AA 1RMFL 1J8SA 1J0KA 2HLEB 3HMXA 4JG1L 3KNBB 5TDNA 4XOAA 2ZKMX 4YHKH 1P1VA 3ULUL 4NKIL 3NPSB 4MMXC 4AT6A 2P7JA 1FLRH 2FYUE 1BDYA 5AKRA 2AQRA 3B5TA 4JPIB 4IMLB 3IGKA 5LQBL 4ABQA 4BSJA 5D2NE 1U36A 1CBJA 5D4HA 1J88A 5I8OH 3BCFA 1WFUA 4U1LA 2OR9L 4X9IA 1FHGA 3QR0A 4KH2A 1SY6L 4H20L 4IIZA 2VDQB 1MJ7H 1WK0A 2OXHA 2X4NA 1RF1A 1U8HB 5KSUB 4ZKPA 5HJ3A 4TPRH 2HN7B 2A6KA 3V5BA 3AS2A 3MRMB 1EC5A 1U8KA 1JUNA 1NU1J 1DQIA 4HB1A 1BD2E 1JD9A 3ILPB 2AXHA 1P5UA 1TTCA 2CCVA 2DZEA 2YUVA 3LXAA 3MLUL 2P26A 4LASH 2IH9A 3OR7B 4XMLH 5D1XB 4J23A 5H2BA 3Q05A 1UM5L 4PRDB 2NNAA 1AY1L 4JZNB 5HGGS 1VZHA 2X40A 4K15A 3V5DA 1KGWA 1LO0L 2I07B 4K8RC 1Q90D 3LN4A 4HAGA 5IBLC 1F5WA 2FX7H 2VTFA 1YEEL 5TFSH 1H0TA 2VDQL 4XVUC 3CDZA 5EUKB 1U2CA 1CN4A 3FT9A 3U4BH 5FV2A 5J1AB 2WZ5A 3GB7B 1CCZA 1AD0A 2MHAB 1DE4B 4FNSA 2AJUH 4QRUB 2D73A 4DESA 3AUWB 3H9SD 2UZYB 2VR3A 5HI4C 2VUOA 1JY3P 5I74C 1QI4A 4HH8A 4QRSB 5JQIB 4N5EC 4WUUE 2DQMA 5DRZB 3BE1L 1CYGA 4A2GA 1PCSA 4NGHL 5CCHE 4IS6A 2D03H 1OD9A 5E2JA 4TOYH 1RK0B 4FHJA 3BVVA 1SBSL 1M71B 3L5JA 3LIDA 3JBG7 2ZD0A 4TN9A 5C0AE 1VGKA 3MQIA 4F8OA 4NUGH 4O02B 3IGLA 2X10A 1J1EC 1ZPLA 4HWBH 1IVTA 4JPVH 1UZ6F 1V54B 5GHWL 3SHSA 2AI0H 4EOWH 1ITBB 2YS4A 1MRCH 2UY7A 1NCNA 4QRPA 2XZAH 2AK4B 3IMUA 1KV3A 1P5VA 2WLKA 3B9VA 4HW6A 5FO7B 3MRPB 4MA3B 4UMSA 3GSXB 4MX7A 1A14L 5CHNB 4FZEH 4ODSL 4ELKB 4OKVA 3HI1B 4NOBA 3GT6A 4RMUA 1QO3B 1K9TA 1YYMH 5GGVH 3PV7A 3KYNA 3JT0A 5F96H 3GLAA 2ZWLT 1VQ9P 5AW5B 1LDPH 4WFFD 4NRZB 1HEHC 3EJZC 3IJ9A 3KVPA 5E08H 1VFBA 1UJ3C 1XTLA 4Q58C 3X3FH 4PV1D 5K59E 2QQLH 2BP3A 1DQTA 1IEBB 3S3PA 3U0PA 3T2PA 3L1OH 2H6UA 1D5XA 3S5LG 3HHSA 1UOKA 2JNZA 2ZWSA 2CR6A 4KZ0A 4Q6KA 3NSCA 1FZKA 1ZIBA 1KXQE 4WNSA 4KVCL 3T08A 1P7QA 1TYJA 4JEGB 2WPRA 4LCCA 1JMMA 4UDUB 3F5WA 1CB4A 5EORL 4X0KB 5TPWL 4OSUH 5FW7A 2P44B 3ZE0F 2E76D 1MPAH 4MMXB 4RFEA 5TE6H 3NPZB 1TCRA 4K3DH 3J7HA 4M7ZC 2ZF9A 1G6RB 4LGSB 2D7TL 1KJMB 3P11H 3S9OA 4CC0A 4LIQE 1J5OL 4XHQA 1ROCA 1SFHA 2J8UA 4JN2B 3ZGIA 5K9QI 3RL2A 4U3FG 5B7FA 3VTMA 3IMRA 1GMEA 3FO1B 4HQQL 3U4EB 3DO7A 4RNRB 2LW3A 4APQA 5L88H 2OCJA 2UX6A 2VLRE 2AVFA 1NYHA 3R4DA 1RZJL 3K8KA 3OM3B 2R0KL 1I9RL 1P4BL 3BAXA 2EDJA 4Q74A 1UCBH 4JFFB 4X6FA 3UZEA 4XBGA 1MFCL 1T80A 3QIUA 5KJRL 4GAAA 3AE4C 1B0GA 1ZT4B 2WVSA 2XA8L 3H1KD 1SYSA 1T83C 1NC4A 1YEHL 3ZK0A 2JDIH 5E00A 5E4EC 1L0LG 4FCAA 3U4KA 3LH2L 1G6RL 1ZY9A 2JKSA 1QUNA 4P3CH 4P48A 4ODUA 4UT7H 3FCBA 5CSZB 5E5LA 3WUWB 5DUBB 5IGXL 4ZUSA 2V3EA 4GRWB 1BZ9B 1F42A 1M7DA 3GK8L 1AGEB 4XN7A 2YAOA 4NNYA 1H88A 1KCKA 4ONHB 2O30A 4KXZI 2PXYD 4GFXA 1R5LA 2BNRB 3ARTA 4XBEH 5B3JF 3LDBC 2OFQA 2X6VA 2G2PA 4Q2ZB 2R2BA 4M48L 2P8MB 2UXVA 3OKMB 2WLZA 3G04A 4DEWA 5IMLB 2GT9A 4HIPA 3L71D 3L3IA 4DJGA 1H15B 3VYOA 4L8SC 2WGNB 5KVFH 3AUVA 3HKFA 1BM3H 2VDKB 1FV1A 1AYRA 3TT1H 3CSYA 1O6VA 2WXFA 4HSCX 5B5EE 2H1XA 1JGIA 1E4KA 2GJ6B 4J3OG 4QRTA 4E5XA 4E9XA 3IDMB 3FQ4A 3KJ4C 1X7QA 1IZKA 2P3YA 3IKCA 5FB8A 4FQXA 4MSWA 1URLA 4CU8A 4WUKH 2DQTH 1U95A 3FU9A 2LHAA 3IN0A 1NGYA 1NGPH 1WA0X 3ARBD 2CJUL 2YJLA 3PIQA 5D4IA 5DURD 2VUKA 3HB3C 3RGVA 2ZOKB 2VDKL 2DMCA 5CBAA 1M7IB 1LMKA 2PR4L 5BRZB 2VDRL 1AHWC 3F12A 3V7AG 5CCHA 3P7KA 4X6EB 4JDVB 3CN1A 1GZPA 2BWDA 1GGIH 2HKFL 4HPYL 4ZSOB 4ODWA 4QHLA 2VH5L 3LQAC 4PV8A 2C1OA 1LP9A 2NY5C 3QZOA 4NQUA 5EBLA 3SCMD 2X70A 4M1CC 4CN4A 2DYPA 2EZ0C 2H6PB 2LR4A 2QPEB 3L95A 4LSRH 4YXLH 1JGLL 4OD2A 4ACTA 1FYHB 1RZKL 4B5ZA 1IEHA 3CCQP 4Z3IA 5DFWH 4Z7QE 2VXUH 1COBA 2ADIB 1MREH 4LVNB 3FSZA 1HJBC 1RULL 3SBWC 2ERJC 2ZXBA 5CP7B 1YQ3C 5AVTB 2VXVL 2WBJC 3P4NB 2YGPA 1VPCA 4Z23A 3DUUB 5BCAA 5KS9B 2N1TA 3KWUA 4G7VL 1NMBL 5JO5B 5GTHH 2YZ1A 3H1IG 5JHMA 2QPDB 2YKPA 4TYUA 4R96B 5DZAA 1ZDSA 1R6VA 1ZLUK 2OS7A 3CC5A 3IS0X 1SQPK 1EEQA 2H2SD 2PPEA 1UD2A 3UC2A 2AF2A 1N7MH 3ULVF 1LO3H 2ZFCA 3C60A 3WHXA 1UZGA 2Y69B 3LB6D 3NACL 1GTFA 1G5AA 1EPFA 4PG2A 1NBCA 3FB7B 3MVSA 2ZG3A 5EBMB 4DKTA 3V8CA 3DROB 1FDLL 4FQIL 3U2SA 5J5EA 3UTTE 1UT2A 3CC7P 4JHAH 5GS2D 3RBGA 1NCWL 3FUHA 3U9PH 2XZQH 3ZDXF 4JDZB 4Y1AE 4K7FB 2Q20A 5FW8A 4LP5A 4H44C 4U1KB 1E7VA 2KL6A 3I55P 3QIBD 1CPUA 4HWNA 4MXQC 5E4EB 2O6EA 3NQIA 2BK8A 2KB7P 2X0VA 3S35X 1DLFH 4NAQA 3WFEL 1JFQH 2YEVB 3BUBA 3HAEA 1Z1WA 4AUYA 5I1EL 2AJ3B 2O5YL 1FFPB 3VI3F 2FT6A 2YPVA 1H3PL 5D7JC 2A06E 4XMKL 3D8MA 2NZ1A 4KO5A 2HPTA 1S9VA 4GI6A 5EO1A 3TYFA 2TRHA 4XNMB 4HT1H 3LDBB 4IGBD 4OZGA 5GS1B 4AK1A 3TGUJ 5ALCH 3QUHA 2E59A 5AUMA 4B27A 4ZFGH 4YHOH 3BH4A 3USSA 3QB7C 5L8JB 3ABMB 5I1IL 4OQ1A 3S36L 4ZYKA 3O45B 1KXTB 4L8SB 2JKLA 4GXVL 2FSEA 3JV4A 1ZTXE 4NWUH 3EFOB 3PDDA 5HBBA 1ZXQA 1BVOA 4MKTA 3WEOA 5I19H 4H8PA 3QJRB 1EDLA 2XVKA 3KJ4B 3SDAD 3TCLA 4AQ1C 1TITA 4HX1A 1PX3A 5HTSA 4P49A 1H5BC 2WPSA 4XPFL 1UKQA 3VVWA 4AKQA 4ENEC 1D5BA 4YSRA 5MEPB 3WTYA 1AC0A 5IF0A 3FHEA 5KSBA 5IIEA 4UT6L 3LQZA 1I1AC 4AUUA 2PCPA 3RL1B 1FPTL 3U2IA 3BATA 1Q0YH 4MRBA 3GDCA 1QZ1A 3ABLB 4YDZA 2BHYA 2ARJQ 2X3AA 3GJFH 4MJID 2OZ4H 3A0BE 1QHQA 2AXJA 5HYJA 1YTZI 1MVUB 2D2OA 5E1IA 5D7LB 1G7QB 4GKSB 5FO9B 1OAJA 2V2XA 3D3VD 3O2DL 3ESUF 2VR7A 2MOQA 1BLNA 3OKNB 2W6JH 2W5PA 3HRZC 2OL3L 1J87A 4TNWK 3O9WA 4TULL 5I18H 5L9DL 5HGHB 2X1QA 3FFDB 4PP1D 1AAJA 1SFCC 2Y6TE 3IF1A 2MOGA 1S9KE 2ED8A 3H1JG 1RUPH 1D6EB 2XN0A 1KILA 2IQAA 1AP2B 4XAWL 3VTPC 4GMTL 3MJGX 2V17L 4IRSD 1VB9A 5HYSA 5E03A 1BQSA 4GBXC 1NKNA 1KGYE 4TTGA 3LV3B 5F1SA 4TLKA 3A3YB 4AEFA 5I15L 2EC9T 1TJGH 5IHZA 4LOVA 2ERJB 2Z7ZA 4F3FB 4HWEH 3A4AA 2WBJB 4XN1A 1DEEG 2BVOB 4QXWA 4XVSH 4DERA 1P9MA 2CLVA 2F08A 1J8HB 3FJTA 3MC0A 3NFSL 3RNQA 1MCIA 4UQEA 2JK5A 3FH7A 4B9FA 2WSCJ 3BKYH 3HZKB 4KKNA 1JZ7A 5DZVA 3CSPA 5IHUH 3L3OA 1PLBA 5LCVL 3MU3A 1A47A 3H25A 2C3GA 2F5BL 1UIIA 3ZX1A 2O61B 4OZ4B 1JMBA 2H47C 3BVXA 2GW5A 1JGUH 1YN7B 3ARFA 3W9EB 1CL7L 1A4KA 1CICC 2X4TA 1ORSA 4HF5H 4KQ3L 1OVVA 1FVCA 2QEJA 3KEHA 4XMWA 4P2OD 3WTUA 1DEBA 2WSFJ 2VC2H 4I77L 5D1ZD 1W72A 1TPXC 3L3DA 4X99B 1CK0H 5AENA 3NFPB 1FA4A 1SQPJ 4JO5A 4YHKL 4HMCA 4ZO6A 1JNLH 4A6YA 3BH8A 4G8GB 3WU2H 4P5TC 5F21B 3MV9E 3O6QB 3B9AA 5JQ6L 1NAMA 4FEMA 5FHBH 2OMVA 1GGTA 3MYJB 2NMSA 5C7XL 5BW7A 1NO4A 1SQ2N 4WSJA 2YRLA 3F7YB 3WNOA 4G42B 4MBOA 4QDGA 3RRQA 2NX5D 5D7JB 3WKMH 1MCDA 4PJ7A 5EF3A 3C5ZD 4OBSA 4XI5D 4NQSB 2FR4A 1RJCA 3MLSH 1MELA 2KZWA 2X4PA 2YUWA 4IRZL 2QHRH 3K72A 1JB0J 3QBTB 5E79E 3AEGC 3FFCE 3HE6A 5MP6L 3BO8B 5I75C 3QXAB 4L3EB 5BVZA 1OQOA 3HCVB 4JFHD 3UYRL 1S6NA 5A7BA 4PEEA 3T4YA 2D7NA 2LVEA 4P23A 3U1SL 1MRFL 1SXAA 3I56P 1Z9NA 2COVD 4YSEA 5AW7B 3C8VA 5DRNA 3WXVL 4KOCA 5BS0A 1N8RQ 4E42B 4FQLH 4AQ1B 3VI4B 3V0DA 4XB3A 1CR9H 4WI2A 4XMTA 4KHTL 2HTLC 1XTGB 5L4IA 4N20A 3KPNA 4YH6A 4JRYA 5AKTA 5JR1H 2YEZA 2PMZA 3IFOB 3PWPD 1I1AB 2GJRA 2Z1KA 1PJWA 1HE7A 3T6XA 3AABA 2FGWH 4G8IA 4OGYH 1WWCA 1S3JA 3LMJH 4L1DA 3C1LA 1YEWA 1FU1A 4W9KC 1IIIA 2WOYA 2WINB 2WCGA 2D03L 1WBXA 1XSJA 1E6JL 1EZSA 4HS8L 4P46D 4LCWE 1ZRUA 3MKGA 2BVPB 3TA3D 4ATTA 3O3BB 3D39E 5CUSL 2A3TA 1KORA 2BWQA 1YUHA 3T4AA 4G82A 1SQBD 2GJPA 5FECB 1T7VA 3PWNA 3Q1SL 3KQGA 4N78E 1WFJA 5KBDA 1GJIA 1NWOA 1Q9OA 3BCCE 2WSKA 1U8NB 4X4XB 3K5RA 4JKNA 3VG9C 3AB0C 2AI0L 3D25B 2UWEF 3CJJA 4GBXB 4HD5A 2DLFH 1BIIB 3VSUA 3BMVA 2VRQA 1NPUA 3NIDE 4LL1A 2XZAL 3F8UB 4MASA 1IVLA 3TSIA 3GSNA 5DC2A 3ETSA 3SY0A 1TT6A 4Y88A 1DQQA 4FZEL 4N0UE 2J43A 2HRLA 2J6EH 2DWTA 3MDJA 4HIHA 5C0IB 4HXAL 3RKPA 2VXTH 3ZJAA 4D8OA 1DANT 1E3FA 3PF2A 3ARDD 1BGYD 4LOEA 1KT2B 4U6YB 2PCFB 3O6MH 1YQ2A 4HIJA 4F7EB 4XNXL 4M8UA 1LDPL 3MCKB 1CFNB 4G83A 4IM8A 1M05B 4TV3A 3VXQB 2ALWA 3BP4A 2OMUB 3V4PH 2QQLL 4X6CB 1BYOA 1NLBH 2DS4A 4JFQB 3L1OL 1USQA 1KGUA 2F8OA 2OYPA 1I85A 1W15A 2IGFH 3ELAT 4NX0A 3FCTB 1CICB 4GOFA 4MHHI 3QORD 1JZ3A 2BZDA 2WTPA 5AAMC 1OP3K 3GRWH 5FW6A 3N6YA 3QEQD 5DVOA 5T3XH 3OKOA 5ACZB 2HRPL 1TPXB 1JXJA 4KKPA 1NKZB 5E2TH 1E79H 2KKQA 2VDOL 1KMIZ 4QRRE 4OSUL 1NHLA 1JYWA 5C8JA 4NN7B 4P5TB 3DX1A 4TSBL 1AJ7H 4Z0BH 1BCCE 3VH8B 5ISZD 4JFPA 3IJYA 2HJLA 1WFMA 4GSQA 3P11L 2FECI 3RVVC 4RMVA 3FGAD 3QRLA 4NI6A 5EUOF 5C0BD 3KZIE 1BVKB 4M1DH 3KLHD 1U58A 1OTTC 3POCA 3P9WB 3ALXA 4G6FD 3GSWB 4JY4A 4NJAH 5L88L 3UGEA 4PVLA 4KZDL 2G4EA 1XGRA 3BPCA 5DK3A 2WANA 5JZ7D 1IJ9A 1V3MA 1UCBL 3L9RB 1EFXD 3SKJH 5CD5C 5F70A 1MF2H 4MYPA 5ALBL 1FNHA 2MCPH 5KYXA 4NKOB 3V5HB 1GS6X 3RPKA 5I75B 2DQUH 4L1TA 2QZ5A 4UIMA 3PGFL 3L3JA 3RI5F 4IL6H 1IQDA 3LKRA 3BKCH 3MJ7B 3NIGB 4G3YH 4KFZC 3NCJH 4WTQA 3FTWA 1HX0A 4UT7L 3WFCH 2ICWI 1RZ7H 5JXEC 5FWQA 2HODA 2W07B 3GBNL 3R1GH 3BEVB 2X2IA 2XQBL 1EEUA 4M8QB 4R5VA 1FNEA 3UG3A 3VFUB 3KYMA 4Z1MH 3NZUA 4Z77A 1O6SB 1ZMEC 1G94A 1OF2B 2H45A 1WRGA 4QXVA 4JO2L 1LHZA 4LDOB 1NIEA 3HG5A 1MW1A 2FECL 4R90L 2CALA 1SVCP 4LHUA 3QDJB 1WZLA 1AI1H 2FX8L 2VR4A 3ZE1E 1OSPL 3FFCA 3IJHB 1JPSL 1HILA 2W59A 2K4WA 4NJ9H 5JMRA 5FGCE 1ACYH 3ZL2A 3Q8EA 3A0HH 2XC8A 2K7PA 4P3WA 2J56A 4BKLB 2HVJB 3T1FB 1QR1A 4G7QB 3ECUA 2WSCH 1PNCA 4PJCA 4PRHD 2XNXA 3SSGA 5AKVA 4HIXL 3QI9D 4QXTB 3CXDH 2H2PC 4WDIB 1SN5A 2RALA 2DQTL 2NY6C 2HH0L 1ACCA 3IXTA 5CCJA 3VG9B 3AB0B 3FT4B 5CLZA 3L35A 2CLZA 1NGPL 5FM5M 4APXA 2QSIA 4RQQB 2BMKA 5HVHC 2ADYA 3U6XA 4F9PA 3VWJC 4ZW5A 1F6AB 1CGSL 4KJYB 3TPUB 1R3LB 4HCFA 1M1JC 2I7SA 4O4YH 5GGSA 5B66H 2QADC 4GRLC 1JZ4A 1KJVB 2D9QB 1AZCA 4HDIA 1EX0A 3IRCA 4WI4A 4WTWA 1AO7D 3PUCA 1KY7A 1X5XA 3BQUC 4Y19A 4BRVA 4HJGA 4ZMTA 4N0CC 5FK9A 1XF5B 2XXCB 2EIKB 2IBZI 3D39A 3WMM0 1JERA 3BC9A 3NTCH 4OUUB 4YXLL 3IAQA 3MJ9L 1E40A 4JVUA 1BZ7B 2ZX8A 1HH9B 1NGQH 2YEQA 3BSZH 3S8GB 1X9RA 1UT1A 4FADA 3IJ7A 5LN8A 1MREL 1P84D 4N85A 1PDKA 1A9VA 1PIGA 4NZDA 1G7PA 3I5CA 4NFCA 4ZXBD 5GGTL 4YO0A 2MCMA 3EFFB 3H6PA 3WLBA 1EEYA 1KCSH 2EYSB 1PNDA 2R7EA 4GY4A 4PY7A 3UGUA 4LLQB 4F5CA 3RB7A 1ORQA 4XX1E 1WG3A 2VDPH 2KUBA 4F1ZA 4ODTH 3LD8C 3DGGB 1Y0LA 2AJZB 2G0KA 3CFCH 3KGSA 4E9WA 4WGWB 3FO9B 2FWOA 4FQQA 2R23B 3DTUB 2K9JA 3RZCC 1KXVC 1LO3L 4U49A 3DJRA 3ECQA 2V6HA 4KC3B 5TQ0H 4WF7A 2DQEL 3TH4T 3F58H 3KPPB 1CI3M 1B3JA 5B8CB 2KLTA 4TXVB 3LPGA 4Z7UE 3QUZB 3GMRB 4MKMA 3GF8A 4MNGB 1TTAA 4C54A 4Q6IC 5TH2A 4J39A 1CDIA 1OKEA 5FYKD 2M3EA 3OAKA 2FWUA 2ESVD 1IX2A 3U9PL 5HD8C 4E5XG 1FJ1A 1EANA 3L3GB 5BVJA 4LCIL 4HC1L 1L9QA 5KZCD 1I1YB 2Y24A 5C0CB 4A63A 3WLWD 4FG2A 1F2XK 1MAJA 5E7FA 1G43A 5EFIA 4AEHL 2J72A 4XE5B 2DQDH 1INEL 4HBCL 4K07A 2VL5B 2CM5A 4IKNA 4Y0GA 3SDXE 4NZTH 1AQDA 3DBSA 1DLFL 2CO7B 3WN5A 3AQDA 3MCYA 2AK1L 4RETB 4XCNB 4E0RB 4ZMLA 2ZSWA 4F9LC 2JEEA 2R69L 5BV7C 1SQXD 3IRZA 4MBRA 1EJ8A 1MCWM 1FNGA 4LSQH 1DO5A 4HCRA 3SGJA 3H3PH 4DW2H 1LP1A 1HHIB 2X6BA 2ALAA 1IL1B 3F7KA 2P5PA 1INQA 2WVTA 4A7VA 5LNGA 2ARJA 2ID5A 2YO3A 1SQVE 3DIFB 1CD8A 2CK0H 2XIIA 5JW4Q 4ZTPL 3R7QA 4ZOBA 3GJFB 4PJHA 2BFVL 5BMFL 2TSBA 2C7UA 3MRDB 3IETA 1MHPH 3U83A 2VNCA 5GZOA 5C07E 5EU6A 1BYPA 3D85B 4GG6A 1ZRTE 1RF0A 1YECH 2XLLA 1KTMA 2EIEA 3BP5A 2RKLA 5BZWA 2W83C 3CWBG 3B9DA 1NTZG 1ZR4A 4PCSA 3AGWA 3MROB 1X6NA 5HHNA 1J0YA 3OF6D 2DEXX 1JZDC 2Y7MA 1IAIL 5HHOD 5DJ8A 3CDFA 2E5YA 3BXNB 3VB8A 1W0WA 4E9LA 2H0EA 4AV0A 2OYLA 5L2JB 4YAQA 4YHPA 4K2UH 1KBGL 3OSKA 3BDYH 4PJFE 5E1HB 2OZ4L 3D0AA 4PJ9A 2Z31B 3I9GL 4ZMYA 1KJ2A 4W6XB 5KG9A 1AZRA 1G9EA 3KH3A 2DBLH 1M1JB 4AGOA 2QADB 3RVUD 3OHXB 4MS8D 3MUY1 1QEWA 4OGQC 1C16B 1G7IB 2N7BA 3WNJA 2W65B 1J86A 4F93B 3BQUB 4YXWH 2BSRB 3FXDA 1MCWW 3PAUA 1DBJH 3T09A 1G5GA 2R4SH 1KTJA 3U6XS 3UZVB 3K6SB 2QSCL 3DJSA 2VW4A 4L4VD 4W6YB 3THMH 1CGTA 4RWYH 2K1MA 1S7RB 5HVWA 3ZE0B 4Y5YA 1SJHA 3SGKC 1XH1A 4AYID 3QDGD 4HWEL 3TVMD 3TNMA 2VC2B 1UM6H 5CZXD 1OALA 2RFXB 5ABZA 4L9LC 4PREA 1WIOA 4NO5A 3QEUA 3HAEG 1GCYA 3SJVD 1MZ9A 3QS3A 3R06B 1RQVA 4JCMA 2IFNA 4L1BA 1ZVYA 2X4QA 4KKCD 5IMKB 4ANVA 5IUSA 1UVQB 4HCIA 3QWOC 2A0LC 3UG5A 4YDKL 4PLKC 2A45G 2NDGA 4YC2C 1L9NA 1QNIA 1ZHBB 5FA4A 1LWUB 5FYJD 5C86A 1TUPA 4NQCA 2O93L 2VISB 2VZTA 1JWSA 1MIEH 3WO3B 3GJEA 3DX7A 4KROC 3UJJL 4GODA 2X9YA 1GGCH 3MX0B 4LLAA 1QQDA 3L3HA 2R5BA 1HKFA 3AWEA 1WGVA 4DGYH 3FU3A 5J11B 1TJHH 2Y1YA 1MFDH 2EDMA 1E9QB 2I26N 3G6DH 4RLDA 4JN1H 4U3FJ 1SQVK 5KBKA 2MQ0A 2XTJB 1SBBA 2XFXA 1I8KB 3AC0A 2P5EE 4PRPE 2HPOA 2V5MA 3V9FA 1W6WA 4IBYA 1KQSO 3LTVA 4YLQT 2VKXA 3OB0K 4RSYA 5IB2A 2BIHA 2J55A 1JPEA 3VFVB 1JGEB 3BIBX 2IWEA 4UBDD 3WNLA 3TT3H 1KDJA 3E38A 1X0TA 4NC1E 1BZOA 3OKLB 1UWGL 2GI0A 4OLEA 4Y4KC 4AI7A 3A5TA 2ZOTA 2ZONA 2OTLP 2X89A 5I2IA 3FT1A 3RL0B 4HIIB 3HBGA 1RSFA 3ZHFA 2FHFA 3NZ8B 4G7YH 4MMYB 3UJTL 1D9KC 3CL3D 4OCWL 1MV8A 5BVPH 3X1GA 5IQNA 2C0XA 2WCPA 2Y6SC 4WKZB 5DRWB 3VFNA 1A3QA 3VMOA 2WQWA 3RGUA 1S7TA 1SXZA 1T6VN 1TZ8A 4PG9B 3TWCH 3JXAA 3KYOB 3VXSA 3STZA 1OVUA 4JDTL 2WKOF 3W0WE 4AIZB 3S98A 5HYSG 2MKWA 1OAXL 3MD0A 1A4JB 3NJNA 1QW9A 4FQLL 4PJBF 3V6OC 1U8PB 1O7SA 3K4AA 1TIUA 3JQOB 3NA9H 3GZPA 4PJ8C 1CR9L 2EXSA 3SDXA 3FQUA 4X7TB 1MW0A 2QKIC 3F2LA 1PEZA 2FBJL 4N8UA 4XCYB 3MACH 4L1LA 3PHQA 3DX9B 2QV2A 1NDTA 4DK3A 2VT0A 1L9PA 1S7XB 5IVZA 4WWIA 3OVUB 5JR1L 1KMGA 4CPGA 3RPIB 3RK2C 3T1WA 3O4LE 2FGWL 3BVUA 4PHZA 2FYYB 2O1AA 2Z1PA 3H4FA 4OGYL 1P0SE 3LMJL 2B8OT 4MDJB 4YDMA 4NQDB 5HJGA 3TV3H 4FJZA 4FFTA 1SNRA 1SN0A 1PEWA 5CCKH 3VW3H 2KLRA 4M43L 2NUPA 1YTZT 2CIIB 4NZRH 4KMLB 5IJBC 2R51A 5GPRA 1G9NH 4NI3A 3OLIA 3RA7H 1TF4A 4JM2A 3NDZE 5C07A 2I5YL 5KANI 1GRWA 4FLOA 4JJ5A 4ALAC 4HLEA 3L70G 4IIQA 4PJAA 4I3SH 1OP3H 5CJXC 2VGLM 4KKQA 3V4PB 5BOJA 3VMXA 1N0XH 2LLGA 2V3DA 4MXVE 3VYPA 1RY7B 1GR7A 3QQ9D 4TNGA 2YD9A 3RWHB 2ADJB 4JLRA 1IGMH 1JV2A 2WVVA 4BCXA 2AK4D 1FQ9C 4XXCC 1YNLH 1T4KB 4L9LB 2C26A 4X4ME 1PP9E 3UEZA 5GZNA 1HEZA 4FFZL 4Y4FA 1J0HA 1QSVA 1SGKA 2X4OB 3O6KL 3X2QB 2XQYA 2HJFB 1NBYB 2F53E 3BGAA 3KPMB 1G7MA 3KEDA 3O6ML 4LB8A 4OAWB 1N2RB 4WY7H 1UXMA 4NRYA 2DH2A 3LJ3A 3QWOB 2ZICA 4NZJA 4PTTA 2EEBA 1WD9A 3NK3A 4BD4A 2HFFA 1GY2A 1NLBL 2GHWB 1K9MQ 1Q94B 3QUGA 1ZHLA 2WPGA 3VE0B 3ZDXB 1UWEL 1HWGB 2BOBB 2IGFL 3N40P 3H1IJ 5C09D 4KROB 4ZTOH 4OLUH 1LTAC 2XPGB 1FC2C 3L4UA 1U8LB 5E8PA 4ZDHB 4M9OA 2CRMA 3D06A 4G2AA 3DJ9A 4R7NB 4XRCA 5T3XL 4B53A 1YEDB 2H41A 3NH7L 4UTAH 3C2AH 3WY4A 3QARA 3ULVL 2EDRA 3U36B 1HHHA 1QBAA 2I85A 2Y36H 4LU5L 4L0YA 4IBLT 4TSAH 4Z0BL 1AJ7L 3VI3B 3R2PA 5KYUB 3Q0HA 3NRPA 1D6VL 3F7PC 1DQLL 3MNDA 3Q48A 3TOPA 1BBDH 2OJEB 3D9AL 5TQ2L 1H3TA 4JFDB 3REVA 1ND0A 2VXSL 4N0FB 5LHDA 2AS5M 1JWMB 3RK3C 3IJEB 2NRGA 3KPSE 3PQYE 5JIPA 5JYLA 1S7UB 1S72P 1PY4A 3ESNA 2OMBA 5HSFA 4D94A 4NJAL 4NYLB 5MERB 3FU6A 5KYYB 1SQVJ 1LNUB 1QHPA 1NL0H 4FKKA 3V6FB 3T8VA 1OCWH 4Y4KB 2DQCH 2GSGA 4JFFD 1N64H 2ZX6A 4JVPA 2BP8B 1K05A 2DQUL 4AMXA 3W57A 3QR1A 1O9ZA 1OXZA 3WL9B 1V8HA 1LXMA 5I6MA 1D7CA 4B9IA 4KUZH 1CXEA 1DFBH 3EO0A 1KCVH 3IFNL 5FR3A 3V4UH 1A6PA 3BKCL 3CVHA 4Y5VA 1R3IL 3NCJL 1J05B 3WFCL 4E41E 4K8RD 1JRHH 3EGXA 5IBLD 4G59C 2SODB 3NJKA 1EZVE 1A2YB 1ZV8A 3PLYA 4XVUD 1D5IH 2PPDA 3ARGA 4PJ8B 2VMCA 4QAWA 3WY2A 3IU4L 2BIQA 1BMZA 4Y2LA 4L0ZA 3B56A 1F02I 5DWUH 1U8QA 1DHKA 3MCLL 2YFNA 1G9MC 4KFMA 5D7KD 1OARL 1UXLA 2BNRD 4D9QE 3HZYB 5AW2B 3MV8E 5C9JB 4BE5A 5HI4D 3IDNB 4GOSA 5I1LB 4ZBJA 1JO5A 1AI1L 2O6FA 3LHPH 4N5ED 4F7CB 4I0PB 2FZ3B 3MNWB 4Z7WF 4AXWB 5DD1H 3ZDZF 3RURA 3FOMB 4UT9H 5D6CA 3T0EA 1VACA 4NDMB 5BUGA 2CJSA 1NGZA 1GMJA 1QABA 2GC4C 3N50A 3JWDC 2MOVA 3APFA 3S2AA 1IC0A 5ILTH 5F7EL 4JFED 2APBA 4B6ZA 4JO8A 5D2LE 1IFGA 2MQGA 3BT0A 4UQIM 4CBZA 1BVLB 4ETQA 1VGEH 4NZFA 1ONQB 3CVCA 3TIDB 4RRPA 3GEFA 1GK4A 2B0SH 3APNA 1EQ7A 2FGZA 4X4YB 1JV5B 3BH9A 3MO1A 3CMEP 1FFNA 5IEHA 5D1QB 5I1AB 4HVBA 1MI5E 1QSEA 5C0NC 4N3YB 1JY2P 4GXUM 1ETZA 1KEMH 2YD7A 4X5XA 3TBCA 1J5IA 3EYOB 1XIWC 4KJWC 4PJXA 1Q0XH 2R0WL 4N2CA 4EI6A 3AREC 4QY8B 1R47A 4UZGA 3P3YA 3OC5A 3PL6A 2VDPB 4IKKA 4L37B 2DI9A 1TZGL 1DUZA 2F7RA 2VQ1A 4U1NA 2BP0B 1WWWX 3L4CA 4WTZA 1AGDA 5EDXA 2ZNWA 2QJYC 1AOHA 1Q9KA 3EJZD 3NTCL 3OAUH 1HOCA 1P4LB 3O6LL 2KMWA 1U93A 1UM4H 3IAGC 2LLNA 5EZPA 3PGCA 1NGQL 3BSZL 2WSPA 1H9DA 5FIEA 1JK8A 1IKNC 4FZ8H 5M7QA 2J3SA 1S9XA 3R0NA 3VFRB 3M46A 3IDGA 4YL9A 3GMQB 1K4DA 4RA0C 4A7GF 4LGRB 1I7RB 4HJEA 4JVWA 4HWZA 3UG4A 5DZNA 1KCSL 4YE0A 5IG7B 1Q9LA 1MLCB 5HVFB 1U7JA 1CIDA 3G5ZB 2HG0A 3MA9L 4ODTL 3P30H 1L9TA 4U0QB 3LEYH 4UI2A 1WS7A 3CFCL 4MD4A 4ZD3L 1JZHA 4Z7OE 1UXWA 1DO6A 2Z34A 1JCVA 1NJ9A 1CWVA 5D8JH 2F53A 3RK3B 3F58L 1QYGL 1U8IA 1KIRB 5MENE 2GITB 1CDHA 1T1XA 4DP9X 4LHUG 1T1YA 1FJKA 2J59M 4L3FA 4YDNA 3D18A 1IM3B 4UQ2A 3MRQB 1NANI 1NBQA 2EH7H 3CHSA 4WHYG 1JPGB 3DHUA 3KE0A 5CEZH 4J3OH 3UCRA 4W7ZA 3PNWA 2RJMA 4LT7A 4DCKA 1D7DA 4G9FB 4B96A 3WTXA 3UTZB 5KVGL 2DQDL 3K6NA 5EC1A 3ES6B 5DA0B 4CC1A 2YOCA 3K71A 2NXZB 5L2KA 2CSPA 3WHE0 5K39A 4OCSL 4EPSA 1UUNA 5F7WC 3S48A 3NRFA 4LSQL 4DW2L 4GQZA 4YHIB 1RJYB 4ZOCA 3D6ZA 1AANA 3T8XB 1KIQB 3SB3A 4PGBB 3K6FA 2OM5A 2K3HA 5SWSA 1J9TA 4W4OC 2NR6A 3HVDA 1LEGA 4JNXA 4P57A 3PJSA 4C46A 5E94B 4Z5RB 4OZHE 1QTSA 1J8RA 3JUYA 3MNVB 4BDVB 4ZKUA 2AV7A 2Y0EA 1OGTA 2VLJB 2Y7SA 3FQ2A 1DSWA 3DMMA 3K2KA 3PHOA 3C6LB 1WLHA 4IBQA 3U9WA 3QUXC 2J8OA 2IDBA 5ID1A 3QJFA 4BH7A 3RFZC 5E9DA 2UWEB 1V55B 1CLVA 1WHOA 1G9NC 4L75A 1UACH 1VADA 4P5MB 2OYKA 4M8RA 5GXBB 3BCCG 2CBTA 5IOPA 3V4VH 4Z3TA 4W9JC 2IDQA 3QDMB 4PW4A 3VFWA 2PTTA 3K0YA 3H9SE 3PP4H 2OP4L 3L4YA 4FXGC 5F3BA 4EDWH 3U7WL 4G6MH 3M45A 1HJCA 1WBYA 5C1MB 5F7HA 4ZFZA 5KVEE 1SFDA 1M57B 4K2UL 2JVUA 5LBSH 3O3EA 1X9UA 2DLEA 3LEXA 5C70A 1HWHB 5ICYA 3UAJC 3HB3D 1V3LA 2F54E 1GW0A 1CT8A 3ARYA 2DBLL 3ZTJG 1J5CA 3P0YL 3KJ6L 4NKDB 1FJPA 1HGVA 4KK9C 1T6WA 5D7LD 1XIWB 4GMSH 2FBOJ 2IYPA 2FJSA 5B7EA 2OMZB 2OMTB 4M6ML 1S8DB 1MKMA 4TVPL 2ZF8A 2IPPA 2N56A 2UVFA 3H53A 3QXUA 5CEYA 4X9BA 3SPCA 3UPCA 1ZLVK 2E7CA 3SE8H 4GS7C 4N9GA 5FOBA 3UTQA 4YSPA 1DBJL 2QJYB 2O6DA 4ODXB 3QUKA 4WZ9A 3S96A 3HE4B 3IFMA 2G2RB 4KMTH 3VXOA 1YJDH 3RUGE 3MUDC 1NMAH 3ZHKA 3GC3A 4O9BA 4IU3B 2H1PH 3LQMA 4PGJA 1ASPA 3JV6A 1E8WA 1Z2KA 2DKUA 2WO4A 1JGDA 2WBJD 4RCAA 5EUOB 3NTNA 3L74G 1F6FB 2B87B 1MFUA 4N5UA 3KMDA 2WTOA 4WU7B 4A7QA 1J8HD 4DZBA 3PP5A 3KPRD 3OB0H 1NIFA 2BPBA 4JJHA 4U1JB 4LE8A 4XPBL 3VWKA 2JQAA 3FX0A 5C0GA 5HXMA 2FE0A 3HI5H 4PRNB 2EKJA 3PV6A 3RGHA 1W5CE 4UB0H 4I89A 4B50A 3WTVA 2BIOA 5E23A 3HNTL 2EEDA 1E8XA 3KBFA 3TEUA 3M0DA 3QULB 2QQKH 1LTSC 4HJ0C 4PVNA 3CX5H 1MIEL 4YEFA 5KLIC 3D48R 1C5BH 1PW3A 1JPTH 3GF7A 1QLED 2CDEB 2HFGH 3FYIB 3JYBA 4EN3C 4CMMB 1UCTA 2DEYX 3CXHH 4WJ5B 4HGWB 1ZGLA 5J1SC 1LTGC 4URTB 1NUGA 2WQVA 3OR6A 4FP8L 3QIWC 3G6DL 4U6XB 4XCFH 5LLIC 3VG0L 4QJ4B 2B5IC 1EO7A 4EQ2A 3TJEL 5IQLA 2CA3A 3H1HD 4H44D 1CLCA 4LKXA 2NY1C 4MXQD 4UM9B 4A55A 4XC3L 5CJOL 4GSRA 3CCLP 3L75J 2G60L 3BLKA 3SPJA 2XICA 4BELD 2FQGA 2UV3A 1IAIM 4KAQH 4N2IA 1JZ5A 5B21A 1LEIB 1XGPB 1OY3B 1L4AA 3QYMA 3ZDYB 3V2QA 5D7JD 4TQIA 4B3EA 3RWFA 4LFHD 1IBDA 1FG9C 1G0DA 2IGLA 1YNTB 3LNGA 4WWKA 3ZYJA 4YGVA 1MRDL 5DA4A 3H1KE 2CO2A 3BISA 3NCMA 2PW2A 4G7YL 5E5MB 4RKUJ 3HW7A 3WFDH 1HVVA 1KLGA 2XN9E 2H89C 4FG6C 4G6JL 1BGXL 4L3ED 5T1DH 3SEPA 1S7QB 3R0MA 4LRIC 4PB0H 4HU2A 4C58B 3ECWA 2CIKA 2GB2A 4DQAA 3APCA 4N6RA 2W0FA 3T2QA 4EE2A 2UXGA 2YXQB 4BWWA 3TNUA 1MJ8H 3DXAB 3RFZB 3UTPD 1YNKH 3VGDA 3ZYOA 5DYOA 4BGDA 5TK4A 1Q1JH 1NTZK 3AJ7A 4CKVX 3X12B 4ENED 1I1RA 3MOBH 3I6KA 4DKDC 3VWJA 2SPZA 2JCCA 4NO3B 4X6DB 3X13A 4X7CC 2M0BA 4HEME 4IQHA 5INDA 3HHMA 3L71E 4AJYV 5CEXB 1I1AD 1SLXA 2R5DA 4DOHE 1T3JA 5I0VA 1LE5B 3A6CL 1I8MA 1HXMA 5ESVB 2C3XA 2P80D 1RE3A 3D4GA 1RHHB 5BQ7A 3ABVC 5KW9H 1AR2A 2R1WB 5I16B 4Y16B 3INOA 1R33A 3MUJA 4NZRL 4GQRA 2VR5A 1JS4A 4UT6A 1ET5A 1XB3A 4KI5C 4DEPC 2BCCD 3MLVL 3RA7L 1XCTA 4JR9L 1B6UA 3DRQA 2I24N 2YGVA 4RDQF 5KYWA 1SFCD 1ZVSB 4GS7B 2OMWB 2ZCKL 3TEXA 3CZUB 4AGLA 2P9RA 4GW4A 4I3SL 4JMXA 4OZIE 1QPXA 2FHBA 2ZKHH 3O2DA 1FLTX 5ELIA 4H25A 4GBXD 4L8BB 3N85L 2X2HA 1IGML 4GAGH 3HFFA 1VPOH 4D6TE 2OL3A 1IGIH 3GXDA 2V7HA 3VFTB 5CJBA 2O1JA 3T0AA 1SJEB 1XQ4A 1OW7A 4TUKH 1KN4L 1O9WA 2IPKA 4K71C 4U1MA 2Y7QA 3U79A 2EE2A 1NAKH 4L8CB 1OW0A 3IFPA 1CE1H 2H32A 4YZWA 2DQGH 4DPBX 1V27A 3OAYK 4KKZA 2GABA 5AYUH 3SFEC 2N3JA 1QBBA 4JZJC 4U7MA 5TK2A 3VFPB 3C6SA 4PH8A 3RY6A 3LXUX 3KLSA 5KLIB 4ZTOL 4EN3B 5C3LD 3IGFA 1JRHI 4FG4A 1CICD 1A21A 1XEUA 2YK1H 2ODHA 1A1MA 1SYVB 4OI7A 3FTGB 4OB5H 1N7SB 4KX7A 3LHAA 4YVNA 2W0PA 2AXTH 3QIWB 1NH6A 1IBBA 2Y36L 4J3OC 2BSEA 3OKEA 4NN6C 2Z4QA 2XWTA 3SKNB 2B5IB 2ZOUA 1RZIB 4ZPVA 3S5YA 2PP8A 3SKOA 1KFAL 3FO0H 4P5TD 4ZZFA 1W9XA 4WO4A 5D70H 1GPOH 3ILDA 1YMMA 1YIJP 2NY1B 3HG1B 4UV7L 5FFLA 2Q7AA 3R19A 4AQEB 2XX0A 2JI2A 2YSTA 4GO6B 5D6DC 5GJTH 1U92B 8PAZA 4RH4A 1YEKL 5DMIL 4PJ0E 2VLLB 1E65A 4LLUB 3EG9A 3WNIA 1CXLA 1E28B 3WKQA 2DQCL 3HUSA 1Z5HA 4FFWC 4QWWC 4EIJA 1MXGA 4HS6A 1OT4A 3H1ZA 1Q2NA 3NT0A 1OTSC 4OVUA 2CO6A 1T04A 1DCLA 2ENJA 2YSSA 4YHYB 5AZ2L 1QWNA 3C8KA 4MJ6A 3GSUB 4U1IA 12E8L 2VDNH 2D4FA 3P2DA 2OULB 4Y2DC 3RHWF 5F88A 5AVZB 2ZE0A 3H32B 4MDIA 3ABKB 4JDEA 4P5SA 3IXAA 2ETWA 1D5MA 1JRHL 1BIHA 1VDGA 3HMXH 4JHZA 4IRZA 2Q5BA 5JDSA 5DRXA 3RWEA 3QO1A 4LSVH 4NNPH 1WP6A 4Y2OB 5BJTA 5IKCA 3QPKA 4MNQB 3KCPB 3S5LB 4CUCA 2CPCA 4PRBB 5BNXD 2JJSC 2DDQL 2OMYB 2HTLD 3P9MB 4QT5A 4R4FH 3MXWH 1IE5A 4LCVA 3EDEA 2Q6WA 4FXLA 3HR5A 2ICEC 5IJVB 5L7XH 4QCIB 2IWFA 4K94L 2CUIA 5E6IB 4YXKH 4AG4H 4MA8L 4Q89A 2VO8A 4B9CA 4W7YA 5AZUA 2XQYG 3LHPL 1F6LL 4W9CC 4EJ1C 3WD5H 2ZXDA 3QDJD 3BGMA 3W11D 3QA3A 1A6AA 1E4HA 3CWBJ 4XPHL 1ZXGA 4R7DB 1NTZJ 5DD1L 5BRQA 2Y5QA 1PZUB 2DY2A 2EDDA 1QLRA 4WEMB 4K3EH 4WV1A 4AZUA 1OAQL 3QFDA 4AYBA 3EJUA 3C5SA 3UTOA 3G4SP 3OXRB 5DT1L 1JBJA 4JKLA 3RWJA 2QSVA 3CX2A 5J13C 4MVBC 3X1BA 5EF2A 2RTTA 3K6OA 2NPSC 2E7HA 3O2VH 5AVVB 1TZHB 4MAYB 1SUJA 2A6JA 5C3TA 1NCDH 2HFED 1GIGL 2PXYA 3H8NA 6FABL 2FWSA 4Z8FL 2F18A 4LPCA 4ONOA 4NM4H 2P52A 2B0SL 4MJIE 3QQXA 4JPKH 3OKKA 4QOKB 1A1OA 2W8CA 5I5MA 1BJMA 5IW6A 1WVZA 1UXSB 3D3VE 2JB6B 3Q8BA 4G43B 4IK6A 1O6TA 1HL4A 3I3BA 4K71B 2JTDA 3HEIB 1NU1D 1Q0XL 3L4TA 4YPGB 3FUNA 1JK9A 2VE6A 43C9B 3UADA 2RCSH 3QRGH 4NUJB 4XBPB 1OW8A 4RFNC 3G9VA 4ZMWA 5AAPA 1NC2A 1ZW0A 4L8DB 3UIZA 3F89A 3OAUL 2BC4B 2Y2WA 2Q7YB 4JZJB 2QFRA 3AE5C 5EZIH 1ILSA 2XY2A 3ROOA 5B3SB 2VZ3A 5DHYA 3SDCC 3H4HA 4KGJA 2JQZA 1AXSA 1SN2A 1ZSDB 3FULA 4I9XA 3IPEA 3D0VA 1CI6B 1FH5L 4NPEA 2FNBA 2PYEB 1HNYA 1XO8A 4HH9A 4LLYB 3B9KB 3CPWO 2K37A 1DH3A 3KXFE 3LQAL 4FXTA 5DC0A 4BSVB 5IR1B 1RXLA 2VMJA 4JRLA 3GBDA 5G5DB 5JA9A 5KAFE 1AD9A 3HC3L 4CADB 5F7BA 2G30A 1LD9B 4MQ7A 3WAJA 1DVSA 4L4TB 4P2QD 3AEEC 3P30L 5BZZA 3QUYA 2KS1A 4FMVA 3OLEA 1M56B 5EOQH 4PGEA 5JIKA 2OMXB 1A66A 1M4KA 5D8JL 3P4OA 1N10A 1I8IA 3RVVD 5I6XB 4DVBA 2ZIDA 2WXPA 3GXUB 1YPZA 2C1PB 1X4ZA 1OTTD 1U41A 2DIEA 4J28A 4XO3A 2E6PA 5IB3A 3CH8A 3QUZD 3GW6A 2P5WE 1RPKA 1NGWB 4Q9QH 3ZDMA 4M62H 1A7QL 4AMKH 4ZX3A 5CD5D 2BVYA 5C92A 3FYEB 1DQML 4PJBB 3UL4A 2K0RA 4X5WB 4KNSA 3HUJE 5C0CD 1EBAA 3KM2A 4Y2DB 5IWLA 4H40A 1OGAB 1OAUH 4YX2H 5GGSY 1RLBA 3D4ZA 3FTZA 4YZFE 2NT0A 1U8CA 4HIEB 1BFOB 4OLWL 4P06A 1EGJL 4OFYA 4JM0A 3W68A 5JXED 2NX5E 3DI3B 3HD7A 1ET8A 2WXHA 5E2VH 3INUL 3WFZA 4RRPG 1KPRB 2P42B 2X44D 3M1OA 4M5SA 3V4VB 1KOAA 4HHGA 3UFIA 1J9CT 1FOSE 1TVHA 2D3NA 4JRFA 3L72G 2OQQA 1IFMA 2IXQA 5FM8A 3RIFF 2ICEB 4Z7QF 3MBEA 4JFHE 4WW2C 2ZUQC 5JHDD 2VZOA 5ESQB 1EEZB 2YQBA 2QM8A 1OAZH 1TZIA 1FVDA 4JO4H 4C56B 1A6ZA 1F86A 2DQFA 5E4AA 1QBMH 4N2DA 1NTMG 4WEEA 3GMNB 3KL3A 2F5AL 3AEDC 2W9EH 5GS0C 4WTZG 3QNFA 4UU9B 3FB5A 2FB4H 1ZLVH 1INDH 2ZAHA 3QIBA 1JHTB 4MD5A 5HHPA 3OKYA 4K9EL 5DVPA 5EZLA 2VERA 3EOTH 2XWZA 2Z91B 3D85D 4TNEA 2E7DA 1HSBA 3OW2O 4PJ7F 4Y1TA 4TQEH 2YBGA 2F1AA 3QCUH 2RQEA 4PJEA 1NBVL 2H2PD 3PP4L 3PWPE 1ZHKA 1N8ZA 3J07A 2NPSB 3ET9F 3EDDA 4D6TJ 3UPRA 4I1RA 1JHLH 3ROLB 3CH1B 3VGHA 2NY6D 1LO4L 4NC1C 3JSVC 3P4MA 4LARL 1P7KB 4ODHL 5DJZA 4U4BA 1KZQA 3BVNA 3BWUF 4U6VL 5DMJB 4JPSA 3QWRD 3CX5I 4QHNB 4NCC2 2A9CA 3F62A 4ZODA 5KAIH 5EN2B 2V9QA 1YC8A 1PKQE 1TQSA 4JGJA 2QADD 3CXHI 3ECBA 1D5ZB 2J1YA 2OYMA 4BQ8A 4EZLA 3IDJB 4BK5C 5I71B 3GLEA 2ICWA 3BQUD 4LNRB 3SE8L 4GQQA 4RFNB 1UADC 2J73A 4G1MA 4AYFA 3Q8CA 4DGVL 1UFGA 2DIJA 1ZJAA 3B7UX 3EOAB 4RFOL 4PCYA 5GSVA 5DF0A 3FHAA 1NMCB 3F7LA 3SDCB 3MOAL 3BQVA 4KMTL 1YJDL 3NMEA 4MJ5B 1M42A 2XPZA 3FQYA 4A7SA 1OAKH 4WSKA 2WAQA 4J3SA 5E6RB 3FQWA 3FAWA 4MJIA 5EOCL 1C08A 2NQ3A 2VSDA 4H2CA 3X14B 1BGYE 4NENB 2JB5L 2R83A 5DMYA 3Q7JA 3HNSL 4WB4A 4HUXA 4ENZA 3DIDA 1QKZH 1E90A 4PJGB 1B0RB 5H35B 1VEOA 1FZJA 2Z8WC 4NPYA 5T3ZL 3QQ3B 2KYVA 1T7ZA 5I1DB 4HUCA 2QPSA 5EG6C 2H5UA 1MHEA 5J12C 2WQXA 2JKIS 1H3GA 5GGTA 2XYBA 5IQ9A 1NCOA 3IKKA 1LTJC 3IF4A 1I7UA 2A1WL 5D7IB 3MGTB 3QHFL 1KQFB 1MW3A 1SQQG 1FNSH 1X7TA 5EBWB 2FJGA 15C8L 4C4UA 1R5VB 4AVKA 1XGYH 1G0YR 2J20A 3VJ6B 2DTMH 3G5YB 2R4RL 3WUVA 3P0GB 4YQXH 3MNMA 5ISZE 1T5WB 3TLRA 1H8SA 2ZWNA 1J11A 3JWNE 4AH2B 1DLHA 1GZLA 3N3EA 1CO1A 5D7SH 1FC1A 1MFBH 5C0BE 2ZUYA 4NWTH 4N0RA 5K9QG 4KVPA 2QVAA 2I27N 2ZVNB 1A7PH 2WLIA 4WI3A 4OLYL 1ZA3A 1M2VB 2Y07H 4QO1B 4JM4L 3V7MA 5KBPA 5LWYL 1KV7A 4XO8A 1EXGA 4HC1A 1SM3L 5SWZB 4AEEA 4P9HH 3SYAA 4QMEA 4BH8A 4E9RA 4NQQA 4B5EA 1LTTC 3M91A 3DC0A 5A2BA 4JFYB 4P2OA 1DEEB 5C0FB 3BIAX 5K9OA 2QGBA 5D1ZA 2ZUQB 1RJLB 4QRFA 5T1DL 4EI5A 3TO2B 2VDMH 2R69A 3TO4C 4NHCH 5EO0B 4KDWA 4X42A 2X9ZA 3QAQA 4HKBB 5D7HA 1MEXH 1QL2A 1A6VH 1MCJA 5ENWB 3PWJA 4YN3A 5KWYC 1MJ8L 1MNNA 3P4LA 5TGBA 2P24B 1YNKL 3RGBA 2FYZA 4GSXA 1U3HA 1M90Q 1MHHA 3CLEH 4UNTA 3UO1H 1QRNB 5K9JH 2HPCB 2FO4A 2P1YA 4LCYA 4N3TA 2B7DT 3MOBL 1Z7JA 2BCKA 1H9VA 3S7GA 4UNUA 4PGCA 3FQRB 3AY4C 3A21A 2H7HA 3IMTA 4DOJA 3W5MA 4YDLB 1WHPA 3HAEH 3UAAA 3UOAB 2OTPA 1JZFA 5KSAC 5J3HD 1QBLL 2HG5B 3GXMA 3SBPA 2H26A 2YPVH 3M1BB 1UFUA 2VDLL 2ORBL 4IKJA 5DFAA 2Q87A 3CZSA 2QKSA 2KZKA 2QJKC 2ZYAA 4NQDD 4XO9A 1IBYA 5FYLL 5C08A 3OAYH 3WEMA 4RJTA 4HLZG 1C1EH 3ALPA 1XZ0B 4PRHE 5DC9B 3LPPA 3T3PF 4WY4C 3CFKB 1U4FA 4OGQD 3VFMA 4L5FE 3ZIMA 2A73A 2GM4A 4JAMA 1IZNB 2G5RA 4KZEH 1HXYB 1IQWH 3LKSB 3RWGA 4XTRC 3UPAA 3N44F 1P7HL 3LNEA 2R27A 2ZKHL 1YMHB 2C9SA 5IVXE 1HZLA 1KZYA 2B4CH 2B1OA 1TSHA 2Y1VA 5J57B 2LTQC 2ITCA 4PJ5A 4XB8A 4X98A 2B59A 2XI9A 1TJIL 1SPDA 4X80H 2I9TB 2XVLA 3VO0A 4TUKL 5DUMH 2Y5EA 3BUYA 1AO7E 1WZ1L 1YEFH 2A9AA 3GS4A 5K9KB 4U6HA 3TGUD 2IANA 3WSQL 1T3UA 1ETA1 2F7IA 4LBAA 3UTSE 5DZLA 1CE1L 3GSRB 4NP4L 4LVEA 1IC4L 1IIKA 1MFNA 4X8GA 4HULB 3OXSB 4R4MA 5AYUL 3JWOL 2A0LD 3FAXA 5A3IC 2Z65C 4H88H 4O58H 4PLKD 4K55A 1I8UA 1NOHA 1WCBB 3L17A 1P84E 4OCMC 1LTJB 2XY1A 1RZFH 4P59H 1WTGT 4V1DB 3LS4H 2XZRA 1CD1B 4GOEA 3A6BH 3EO1A 4KROD 4F92B 4MAUH 5JHBA 3AEAC 1MH5B 3B2UC 4PSPA 4OB5L 2D3LA 1GGYA 1N59B 2N59A 5E8NB 1J1DC 3VD7A 4DZ8B 3CCJP 1NDMB 4LVHC 4HK0B 3TWYA 3FO0L 4YHMH 4PJIE 4UINH 1L7IH 5IHWA 1XF2B 2VDNB 3BZEA 3L3KB 2YKKA 3CCUP 3VSTA 5FLUA 3G6AB 4ZNCD 1UEYA 4NT6A 1CE6A 4JFDD 1RHZB 2IC2A 5GJTL 3CCMP 3RY4A 2YC1A 3EXJA 5GRYA 5TDNB 2CRZA 5DQDH 1XBDA 3D4CA 3WHE1 1N12A 4ZRGA 3MFGB 5T33L 3ZT7A 2FFDA 2K8MA 3LXBA 2ESVE 3KWXA 2CR0A 1ODUA 4MDRA 1GSKA 2XRAL 1PY9A 5CZVH 1NGMB 3QORA 5BZDA 4CN6A 4DGIL 2AXFA 4Y4KD 3NIDF 4U1LB 2JI3A 1U6AL 3QEQA 3HTKA 1VFUA 3VXMA 2JXMA 4WVRA 5KVDE 2BHUA 1NEPA 2VDNL 2OXHB 2YRPA 2X4NB 3FHQA 4PBWD 4APQC 5HJ3B 5ISZA 1RE4A 1EERB 2A6KB 2Y6SD 4R9HA 5CXPA 4DCQA 3DUSB 1SF3A 3HMXL 1W72H 1FZFA 1U8KB 1VZIA 5HDBB 3UZEC 1SQXE 1P5UB 2FBWC 4R26H 4A6YH 2G75A 3D33A 5H2BB 2XACC 2NNAB 4PJ8D 7CGTA 1NAMH 3MXWL 2WLLA 3CFUA 1FSKB 2I9LA 3V5DB 2VKWA 4AG4L 1V05A 1ILUA 3LN4B 3NRQA 2JLLA 5DD0H 1GYVA 1X9QA 1AGFA 4JRWA 3RK2D 1H0TB 5I30H 2VJXA 5I8EA 4TLTA 3CDZB 3U46A 2IFMA 2YMXH 1BOYA 5HYIA 2YMKA 2QJKB 1EJOH 4XXDA 1AD0B 3UP1A 2C9NY 4K3EL 1QWHA 1SQPD 1G2CA 5AALA 2OZNA 1ES0A 2NY4C 1IAOA 3BX7C 3E8UL 4R2GB 4E9SA 1MFEH 5F7NC 1DDHA 4PJDA 4Y9EA 2NW3A 2NZ9C 5HHOE 2DQ6A 4IS6B 1QSFA 1EIBA 5CBNA 2WUCH 4PLOB 2OXGA 1E4KC 3WEAA 3ULAB 5JOFA 1CD9B 2LE9A 3BPNC 3HC4H 1T03L 4JPKL 4YDJA 3KHQA 3RBSA 1VGKB 5I0ZA 4Z3GA 2FHCA 5AW8B 3KBEA 4Y8AA 1ZLWK 5F7AA 1MCEA 4PFEA 1CW5A 3CFIC 4NN5C 3U0TA 3WU1A 2BVTA 2K4AA 2W9DH 5ICZA 2K88A 3EGSA 3N42F 3AQYA 4GG6F 1DD3A 2FD6H 3MLRL 3OZ9L 4FI6A 4TLUA 1G1JA 2CRIA 1RCYA 3S1KA 2GC7C 3OQRA 4K5PA 4OBRA 4MZRA 2UY7B 1MFAH 2HLOA 4QRPB 4Z95H 4YNYA 3R8BB 4OJCA 3RGVC 4JRXD 3TK1A 3LZFL 1P5VB 3POHA 3RTQC 3L4WA 4OF6A 1Y18A 2WXRA 4CBPA 1PFIA 4MX7B 1VERA 1CFTA 3L74J 3MR9A 4OKVB 3HRPA 1TTBA 3QDGE 4LOFA 4L3CA 4B9KC 4CL7A 1JZ6A 4FFZA 1WEJH 3KYNB 5D5MA 3SO5A 1FC2D 5C2UB 5SV3A 1ZTXH 4JL2A 1DBMH 1NSNL 4FTVA 3SJVE 1FO0A 4X8JA 4FQJH 1VFBB 1CLZH 1S7WA 4JZOA 4LVHB 3ZE1F 3CZFA 5TE4H 3U0PB 3MHZA 1D5XB 3HHSB 1QFWH 2ZP0T 3L9EA 5EOQL 4F8NA 1FZKB 3GSNH 1JYNA 2N9YB 1XR9A 1UATA 5FYJE 2MWCA 1P7QB 4J2QA 2Q0ZX 2XKSA 1JSYA 2N1TC 4FNLH 4PN6A 4BUGA 3FT2A 3T3ME 1Y47A 1BJ8A 4LCCB 3WGVB 3FT0A 1EDYA 3RK3D 1G7HA 1KBWA 3NZHH 3F5WB 4M5ZH 3UO8B 4DN3H 2W80C 4KNTA 4EUPA 3G5VA 4RFEB 2WWKO 1T89A 1TCRB 3L1EA 3P3RA 1IM3D 35C8L 4Q9QL 3T2LA 4UF7C 4YSQA 1OP5K 2E7LA 4JK0D 2BSCA 1YYLL 4IDLA 3C60C 4MGXA 2J8UB 2IBGA 3FQTA 4JO1H 5I6PA 3RL2B 4KRPB 1EHKB 4J3XA 2FYNC 4PG2C 4G9FD 3DO7B 4HXBH 3VRLE 4APQB 4PD4E 1U3ZA 4QTHA 4YX2L 4HHWA 1WE5A 1ASOA 4X6FB 4XBGB 3QIUB 5BXFA 1B0GB 1TMQA 5BO0D 1SYSB 2FJHA 1NC4B 3QRBA 3VSVA 3BZ4A 3BRDA 4ILDA 4O2EA 3DHMA 4R8WL 5E00B 4NUPA 3WFHA 4J6IA 4X8XA 1QUNB 2H7WA 5EU7E 4ODUB 5GRJH 3PAVA 4MB3A 3OG4B 4IDJL 4OD3L 5D1XE 2YPLD 5SX5K 5IFJA 1P7BA 4ZUSB 2XQYK 2ESVA 4J3TA 1FGVH 3O8ZA 1M7DB 3FOLA 5I1KH 1F4WL 2VM9A 1QBML 4ZW3A 4NNYB 3ESVF 1OTUD 2FB4L 2VLJD 2CGRH 1A65A 3IDIA 2AAVA 2O01H 1NJIQ 1IAMA 3EOTL 4XPAH 3NCFB 3CZKA 4FC3E 2R2BB 1NH4A 2K7QA 3KD4A 4BHUA 4IJ3C 5IEKA 2NY4B 1HYRC 5FAAA 4OM0H 4DKAA 2ZXXA 2GT9B 5JOEA 4DT0A 2QZQA 1U3JA 3L3IB 2BEZF 1UA7A 5E2WL 4JFOA 3QCUL 4DTGL 1WIUA 1BQHA 2BY0A 1FBMA 1FV1B 3CSYB 1JHLL 4Z7UF 1BM7A 4PVBA 4QRTB 4OTXH 4E5XB 1CBVL 3BPNB 1G4MA 1FL6A 2B4CC 4YWGL 1X7QB 1F41A 3X1FA 3MA7A 4AYEC 3GRGA 3IKCB 3O0RH 2GAZA 5FB8B 3VMAA 1XZWA 1B0WA 5KYNA 1BHGA 2BY1A 1CGXA 3FB6A 4FQXB 4MSWB 5C0ND 1U95B 2XN1A 1NIDA 5DQ9A 1XIWD 3QYNA 4KJWD 1NGYB 1LYQA 4KO7A 4P4RA 2CBQA 4ONFH 5E2UL 1VF5C 5BO1H 3ARED 3PIQB 3SDXF 1XH2A 2LU7A 4J3VA 4N2BA 3CQPA 1UWFA 3RGVB 1FZMA 2KSJA 2KBGA 1KYUA 4TUOA 4XPGL 4WHYH 4IBVA 3S88H 2W94A 4IFFA 2OW7A 4ODVL 5BUPA 3B2PA 2X9XA 3OWRA 3F12B 3I3DA 2YPKA 1BE3E 3NGBC 1O7DC 2AK4E 3AS0A 4ZUUA 1OAKL 3O9WC 3Q6GL 2AXGA 2YQ3A 1PAZA 2JWDA 5DJ2A 1GZPB 4ODWB 1ADQH 1J0IA 1NICA 2XX1A 3CMGA 1YBKA 4QHLB 2C1OB 5GIRA 1LP9B 1JIBA 5EBLB 1KILC 2X70B 2CM6A 3QFJA 1UKSA 2DYPB 1SJVA 3L95B 4GSDH 1BX2A 4OD2B 4Z78A 4NP9A 1S5LE 2CD0A 2EADA 2I25N 4XAKD 3V4WA 2BXZA 4IKIA 4LOUC 2O5NA 2XNAA 4JM2F 1YEGH 4PD4K 1FHNA 3GI8H 1FNLA 5DQJA 1X4YA 3K46A 4NQXA 5JNYA 1I4FA 2N1TB 2Q6QA 2IBBA 1RFDH 4PJAF 4AIEA 4AZ8A 2BOLA 4ODBD 2CKNA 1JGVH 3JZ7A 1QMUA 4L4VA 4HK3J 4Z7VB 4HJGH 1TFPA 1JZJA 4OCRL 2VSCA 1NLDL 3OAZH 1C5CL 4UTBA 2GUYA 3CC5B 2A74C 1RIVH 3ZLQC 4PJFF 3SN6N 3AG4B 3MLTB 1OL0A 3C60B 4TNVF 3WHXB 3RIKA 1OM3L 3ARFC 2X09A 2FYNB 2VDMB 2CKBA 4JB9H 1MFBL 1Y6MR 3BVWA 5K1JA 1OB0A 1IKFH 4L18A 4O9HL 3U2SB 1T66C 1XCQA 3KGUA 1KB9K 3B2DC 1TG8A 4AC2A 4QRQA 3D51A 1A6UL 3FSVA 3WGUB 1FRGL 5EF0A 2OV0A 4P9HL 4G6AC 1HZHL 5HI5D 4JFFE 4ZI8A 4N4YB 2I7OA 3ZTJH 5E1QA 4MZIA 4NIYE 5EU5A 5TE7L 1RP9A 3BGFC 3HAEB 1L9SA 4Y8DC 2VDML 1L0NG 4PWJA 1K4CA 1S9VB 5EO1B 3TYFB 2XQ0A 3ZQXA 3K2IA 1L9MA 1Z0MA 1FIGH 1MEXL 1LQBC 1HINL 2H2SC 3QUXD 4GRWE 4OZGB 3W1ZA 5KAQF 2DIAA 1G1KA 1NUNB 3DXAD 2WVRA 5AUMB 3RIAK 4LEXH 3CLEL 4H8QA 1I8AA 2ZCHH 4NFBA 5D7KE 4ZYKB 2BNRE 4P23C 4PWKA 4LAJH 1GC1C 2FSEB 3JV4B 3OMAB 4R83A 3DI2B 2NXYC 4XVOA 5AL0A 5DR5H 3NJFA 4D9LH 25C8H 2HMIC 5DJAA 4XNQA 2WLJA 1F8TL 2WQRA 4LIQL 4HX1B 3TCLB 5EEYA 1AZUA 1PIFA 5D72L 4HCRH 1AC6A 2DQHL 2OK0H 1D5BB 3UAJD 5ADPL 2GJ6E 3GO1L 4EIGB 5IF0B 1JTHA 5KSBB 3VQLA 1OPGH 5IIEB 3LQZB 4KK9D 4ZO7A 5HGDA 2PCPB 1E3XA 3UACA 2WSEH 1RUKH 3CZGA 3ENEA 4JFEE 4R5XA 4B9ZA 1BSNA 5MI0C 5G4NA 5HYJB 5EUKA 4KBPA 4WI8A 3IGAA 3V6BR 4C47A 3L48A 2D2CB 4DT2A 2ENQA 1I3GH 3MRRA 3QXDA 4F7MA 2V2XB 3QAZB 4LLHA 2VZSA 3PE9A 3Q44A 5CNHA 3ISRA 3BW9A 1HTLC 1IM9D 5ITFA 5F7UA 4HHAA 1BLNB 2HWZH 1T1WA 3FCGA 2Q86B 4HOZA 5C0JB 4BKTC 3AM8A 1FH2A 2VMEA 3O9WB 2VLMD 4NCC1 3IGUA 5E6YA 3MNZA 1BMGA 3IF1B 3PHAA 5BRZE 3D09A 1KILB 2IQAB 4AITA 4NRXA 5ICXA 3V5KA 4UNVA 4ALAL 4YHLH 5HYSB 4ZSOE 4ZT1A 1LLAA 4QXGH 4LCWD 2IBZG 3UH8A 5IHZB 3D6GA 1KJ2H 5T1KA 2GTQA 1M53A 4YXHL 2KLVA 1VEMA 3US1A 2CLVB 3RNQB 4HJ0D 3UROR 3LS4L 2CLRA 2JK5B 3A6BL 1KPUA 1RLWA 3EGDA 3WNKA 1IT9H 4EN3D 4PRIA 2JFCA 4R0LA 3V55A 5KS9E 3ILQD 3FH8A 3L3OB 4ONGH 1OP4A 2BDNL 2G8YA 3SGEH 2AK4A 4PD4J 2OYIA 1NCAL 3AAZB 2KT6A 2JJVA 1GU4A 3QIWD 4PJXF 4MA3A 2M1KA 1AKJA 4CJ1A 1XSIA 1I85C 3ARFB 4B60A 4FKEA 3SYOA 4ELKA 1PZCA 1A4KB 1D7FA 2X4TB 2P8PA 1ORSB 1FVCB 3BVTA 3FUJA 2NY1D 3HG1D 4GG8A 3SWKA 1W72B 3L3DB 4U1GC 1ZANL 4Z7QB 1JF1A 1OSZA 5DQDL 2EIBA 2IPUG 2R29A 4A6YB 3RDTC 3BH8B 2CXKA 4JHUA 2WPQA 3L8QA 4OCXH 4H8HA 5C09A 1NAMB 1QLFA 1KCWA 2OMVB 4MXVF 1GS8A 2Y72A 1SMOA 4MMZA 2D0HA 2HA1A 3QPQC 1ZJBA 1AQMA 1KB9J 3TBVA 3HI6L 4NSKA 3OJAB 1E6OL 3ESOA 5H2FE 1ZVHA 4Z7NB 5L8RJ 1X8YA 3CFMA 4FG6D 3S35L 4PJ7B 5DGRA 2EIDA 3QNYA 1QFHA 2FR4B 1WF5A 1ANUA 2X4PB 4ZW6A 3VD2A 3GHPA 3K72B 2XG5A 5BZWB 2DI7A 1J12A 4R26L 2QFPA 3HE6B 5G55A 1XX9C 1YAZA 3I6GA 2W8ZA 2WNGA 3QH3A 4MNQD 4N0YH 1S2EA 3FN0H 4RBPH 3T4YB 5DHXB 4P23B 1O7VA 1AR1C 3X11A 4GLRH 4M3LA 3FU7A 3LSOA 4BFBD 3UZQA 4RNRA 2Q8BL 3K0WA 4YDIH 5DD0L 5DRNB 3GNMH 2NXYB 4M3KB 5E6ID 2OSWA 5BS0B 4F7TA 5I30L 1FYTD 2J8HA 4MWFA 1HHJA 2PKDA 2H88C 3FFOA 3ARPA 3DVIA 2WQSA 3GMLA 3L4ZA 3JTTA 4G70B 3CNKA 4OU3A 1EJFA 3LW5H 3MXVH 1BXAA 1RK1A 1DBBH 5I8CA 3AQXA 2EDOA 3VXUA 3W2DH 1SQBG 1C7TA 1EJOL 4EZMA 4DGUA 3KPNB 4JRYB 2YEZB 2VLKB 3TCTA 4G9DA 1KYOH 2NY7H 5I26A 3I6LE 4KI5D 4U3FD 4G8IB 5JMOC 1CVSC 4PW3A 2BSSA 4FXKA 1MFEL 2FX9H 1V7MH 1CBVH 5MI0B 1BE3J 2Y5TA 3S3DB 4ZMDA 1A7NH 2L7JA 1WBXB 1QFWI 2NZ2A 4MAYD 4UQ3B 1EZLA 3BAYA 1EDIA 1F58L 3LKOA 3KM1A 4OLZH 2AAAA 1BVNT 4NUMA 6CGTA 1NFDA 4P2YA 3P8MC 3S36X 2MQ3A 1YUHB 3T4AB 4JKMA 2IAMA 4G8FA 4BFJA 3IM1A 3JWDL 5F44A 4AGPA 4ZX4A 5D7LE 3PWNB 4HPOH 2QSQA 2WW8A 2W9DL 1GW3A 1TQBB 1Q9OB 2HYMA 3MZTA 3TN0C 1A64A 2X3BA 3PXLA 3DDFA 5KBNC 1QW8A 4M93B 2OYHA 3FU8A 4F9PC 3IDMA 3GSNB 1QFPA 4PGZA 4S11A 1M1XA 3SY0B 4JFEA 2Q8AH 1UH3A 1U57A 3L73G 4YPCA 2IEPA 4M7LH 3UBXA 1RAMA 3MFFA 2G9KA 4HIHB 3D70A 4KRLB 1OP5H 4GUCA 5DVLA 1N4XH 4AGNA 3CCRP 4KPHH 1WEJL 5APYA 4HIJB 2XKNA 4OQTH 3U7YH 5HPOA 1ZTXL 3NBNA 2PYED 3LH8A 2P8LA 2X4UA 1J8HE 2R1YA 3KPRE 2YO2A 3BP4B 4P46C 1H3XA 5TE4L 3AITA 1JG9A 1MSPA 5CEZD 4HMDA 3A0OA 4J3OD 1QFWL 2RN0A 5G4OA 2ZJSH 1BZDA 2HX9A 4L4TD 4PV9A 4FA6A 1BEXA 3DVNA 4IRJA 1M56D 3HBQA 1OAYH 2NTFA 3BHBA 4OT1H 4X6EA 3OKOB 4JDVA 4FNLL 2XG4A 4U1GB 5DJXA 1KCRH 1PMYA 4J5VA 1MCKA 4M5ZL 3QZLA 3MJWA 1SLQA 3RZWA 4KKLC 4ZQTA 5SX5H 1WAAE 1UJ3A 5C8JB 2O72A