5AW3B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 100 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw3B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw3B02
3UIAA 3V5BA 2W6AA 3TYYA 2ZFCA 3V4QA 3TNUA 2C9LY 5AVQB 1MFZA 1HWTC 1SLQA 5AW0B 3L36A 5AW2B 3WGVB 2Z5HA 3NTNA 5APVA 3A5TA 1HJBA 2IPPA 4C7NA 2YNYA 1CI6A 1S9KD 2Q7CA 1A02J 2WWWA 4B86A 4C7NB 4XE5B 5AVZB 2Z5IA 2W27A 5AW9B 3A3YB 1MUUA 2R5BA 2WTYA 3VYIA 1GTWA 3HE5A 1H8AA 5AVSB 4HYTB 3TNUB 1T2KC 2BASA 1NWQA 3VTPC 5APYA 3A7OA 1HBWA 5APWA 5AW8B 1GD2E 3NMDA 3T97A 1OWAA 4AQRD 2R3CA 3M91A 3HE4B 5AVTB 1GU4A 5APXA 2WT7B 3M9BA 1T2KD 1KQLA 3KQGA 1GK4A 3I5CA 3SWFA 5AVYB 1JNMA 3M9HA 2H7HA 1GZLA 2QM8A 4GT1A 2R5DA 3OAKA 3P7KA 5AW6B 2XZRA 1A02F 2XV5A 1H89A 3B8EB 1G2CB 5AVRB 1JUNA 4LC1A 5AVXB 3O8ZA 4AUWA 5AW4B 2P7JA 1IO4A 1J2JB 3VMXA 4EOTA 1FAVA 2E43A 2Q5UA 2YO2A 3MGNA 2P2UA 2XU6A 2JJLA 2R32A 3VN0A 2WT7A 5APQA 2VRSA 3VMYA 2QM7A 3HE4A 5APUA 3NFQA 5AW7B 1FOSF 3MD0A 3L35A 3M0AA 4RETB 1SP4A 3IR9A 2WPSA 1CZQA 1YYCA 1H88A 5AW1B 3V4WA 2C9NY 3L37A 3M0DA 4KHXA 2WPQA 5AW5B 4C46A 4M3LA 2ZXEB 2E42A 5AVUB 2Q3IA 4I6MC 1HUCA 4RESB 3A2AA 3HE5B 1GK6A 2WPRA 5AW3B 1S9KE 3WGUB 3LIDA 3M06A 1FOSE 5APTA 4JYCA 1CSBA 3P32A 1X8YA 3HTKA 4JYBA 4AYCA 4DZOA 5AVWB 2N9BA 3KDPB 3LIEA 5CMZA 1DH3A 1MV8A 3VMZA 3P8MC 4GKGA 1CI6B 4I2LC 1GU5A 5APSA 3TK1A 3NXSA 2KP8A 1OXZA 2YO3A 5AVVB 2P67A 1NAFA
chains in the Genus database with same CATH superfamily
4NM8H 3VH8G 2PYFA 3O9WC 1E9OB 3GSNA 3WEAA 1ZVHA 3LN5B 2Z9TA 4JCMA 5HYJB 1TCRA 1HIML 1U92A 1NVOA 4IIQA 1MNUL 1ED3B 1NCUA 1OAQH 2ENSA 3L3GA 3UBXB 3BMWA 4G5ZL 1UTDA 2CBMA 3RL0B 2I07A 1CGYA 1S4XA 4IOFD 4R2GB 2OCFD 5ADOH 3L5IA 3SY6A 4G5ZH 2XDHA 5C07B 1A6TB 4PJ9C 2Z8SA 1EQWA 1ZT7B 2ZSVA 5K93A 4MA8L 3SN6N 4NO5B 3U0TB 15C8L 1I1CA 5E4EC 1BZQK 3MOBL 1B90A 4NNXA 1YEGH 3U4EA 4PI2A 4IOIA 3TWYA 3QE5A 2ZQKA 3TBVB 1JY2O 1E4XI 3DXAE 4JY5L 1MFBH 1OY3B 1WS8A 1YEGL 4FNTA 1VZIA 4EOWH 3ATAA 3QXWA 3ZYZA 2EYSA 2TAAA 3IFNL 4Z5RB 3CMAP 4O00A 3OKKB 2KPWA 5KLVJ 4EN3A 3LIUA 4X8CA 2YQGA 3A21A 3HCVB 2RMNA 2WLLA 1PKQA 4FF9A 3F12B 3CZEA 1RF0C 3FU5A 3I3BA 1LNUA 4HWBL 4L1DA 5EU7C 1ETA1 5I6XC 2DBLH 2GCYB 1QFWM 4KNUA 2V3FA 2P43B 4L9LA 5GGSA 4YXLL 3BIKA 2DLFH 5AEAA 1T83A 3SBRA 4YHZH 1JHKL 5FKAB 4EDFA 4CVXB 5I18H 2YQ2A 3Q5SA 1KG0A 4R7LA 3RTLA 4PMFA 4X9IA 1YJDH 2X38A 3T08A 1HCFX 3BPLC 3O4LA 3V6OE 4TTDD 5CCHE 1BFTA 3TZVB 3FONB 1BBDL 2AJZB 4Y19B 3SE8H 4EI5B 2M0BA 4CJ1A 4XNZB 1UACL 4NJ9L 5ICXB 2Y69B 4P23B 3SGKA 1L9PA 2AV1B 4G8FA 1WBZB 1D7FA 5FHAH 4MCZA 3O0RH 4PCSA 1BCCG 3CPLB 4OLYH 2B88A 4RETB 1INQB 4JUSA 3OHXC 4TOYL 1S6NA 2W59A 4Z78B 1EDKA 5T1MA 3UO8B 2ZUUA 4B50A 1EAPA 3L9RB 4I5BA 3HNSL 1MFCL 2GG1A 4QUOA 1BAGA 2EXYC 4MNHA 3WTVA 3BYTA 3FU7A 3MJ9L 4ODXB 4OCRH 5GGTL 2ZCHH 1F18A 1WWAX 3SY0B 3U46A 3UAAA 1HE8A 3ARFA 4N5EC 5B8CB 5D4HA 4OU3A 4PJ0E 3WUWG 4MMZA 1ETZA 1IGFH 4WFGD 4YHPA 5DD5H 1BLNA 3ZUCA 4X6DF 3QUZB 3ZO9A 5F0MB 2W0FB 4UILH 4W93A 3VFNA 3N06B 1KYDA 3G5YB 3BAIA 4PRPE 3D2TA 1EK3A 2A45I 1HNGA 4F91B 4PJ8C 1PYWA 2V9RA 1KC8Q 3GYRA 5F7UA 1ZHNB 2IADB 4M62L 3S37X 3EH3B 3VYNA 4HS3A 3AROA 4NT6A 5D7JD 1IK7A 2P44B 4KQ4L 2F58L 4J8RB 5I66B 2F54B 1L9TA 1E8WA 4TSBL 3GHBH 4LASH 1YCSA 4LZKA 2NY3D 3B3BA 2OQJB 3HPLA 3AGVA 1TZGH 3FH5A 2IBGA 1MIML 3LV3B 4LLWA 1NC2A 2OSWA 3QYCA 2WWKT 3QDMD 3M1BA 4J7RA 2CCVA 2X28A 1XGQA 2CK3H 1OTTC 2Q6QA 1X5LA 4R7NB 1PSKH 5CP3H 5DRNA 4HKZB 3F7YA 5DFVD 3VG9C 1KLFA 3AQZA 1RCYA 5I6KA 3GTTA 1WCBB 3QO0B 1T2KC 3FQXA 3VYOA 3V9EA 2ORBH 5EEYA 2A9BA 1HTYA 3IFOB 2AABH 3MUDA 1PSKL 4UTBL 2XKNA 5K39A 4EF3A 2WQRA 4FLRA 3OZKA 3BN3B 2XKSA 4M1GH 3UROR 5GTIH 2P7TB 1MW1A 2JNZA 1JF6A 1Z5LA 1PP9D 3IGUA 1ZGLA 3V0JA 2H8PD 2I8DA 4M1CD 1Q9WB 3LW5H 1NCIA 4NQEE 4FYTA 3QUHA 3ZRFC 4JM2F 2OMTB 5D5MB 1U9KA 4RFNC 1U8LB 1AI1H 5DK0B 4L4VA 3HNTL 2MNUA 4L8DA 3WJLA 1GR7A 1EZUA 2JK5A 4XCFH 5EIQA 4PJ9A 2BK8A 4PJXA 3D3VE 4K73A 4AYGA 2ITAA 4JFZH 4FFZH 4QR7A 2PWFA 1HI6A 5B7MA 4IHBA 4BRYA 1Q94A 4ZO9A 1ACCA 1IFHL 4FFZL 4R2GC 1PG7X 3H9SB 2E74B 1FG9C 3ZDWA 3LXAA 5D2LE 1CYGA 2A5UA 3FT4A 1J10A 3L1EA 3OZ9H 2WLHA 2GT9B 5KWYC 4XWOD 2FEEI 2EDDA 3MMEA 3V9FA 3FPXA 4OAWA 2YXQB 4GSQA 1Q9OA 1HQ4B 4XP1H 2ZOLA 4GUOA 3GK8L 1UH4A 1RF0A 4N3UA 5LBGA 3IR9A 5I5IA 1UFUA 1ZRUA 2YA0A 5HYEA 3MRCB 2X1QA 3MKGA 4FYQA 3T3MF 2Y72A 5HHVL 3UYRH 4BRVA 2YD5A 3NAAL 2IPUG 4WK2B 1WFOA 4OJAA 1KY7A 3PWLA 3FXEA 4N2EA 4TVPD 4LPCA 5ID1B 5ICZB 5J57B 2WXQA 1NOFA 3K0YA 3DRQA 2V8MA 1W0YT 4IOFC 1YEHL 4RX4A 2N1KA 3MBEC 3TCXA 1T21A 2WLMA 4G6JL 1XB8A 3CN2A 1IGTA 3NCXA 5JHLL 2GTWB 1ODAA 3VP9A 2A9CA 1SQPJ 4YHLL 2VUKA 3FBKA 5DJZB 1DL7H 4PP2B 1F42A 3MX0A 3W57A 3WKNA 1PS3A 2B1OA 4ZOAA 2RHEA 1KNOB 1FL5A 5HI4D 1TO4A 3B2VH 3HFMH 4N90D 1NTZE 4KKQA 2VC2L 2VW7A 3UJTL 1A6VL 1CR9H 4ATWA 2B4CC 4D3CL 1XGYL 4J4PC 2YPLD 4JO3L 4FNPA 3C8DA 1MUJB 4GOSA 4OB5L 2Q7YB 4OCWL 1AZZC 1G7PA 5F6HI 5J6GB 4XP9H 4WUKL 5K33A 2Y24A 2ATAA 3UTSA 3WIFA 4JREC 2W80C 4NCDA 1YMMD 1A7PL 3FXIC 4LSDA 3JWNE 3P3UA 4HF5L 3LW5J 3HN5A 5AW9B 1OPGH 3B9EA 4MJ6B 2CK2A 5C0GB 4QOKA 1N68A 2Z0UA 4P05A 4PJBB 4NAJA 4XOEA 4WO0A 4A1RA 4F7PA 5C0JB 4A38A 5AENA 3NCBB 3MCYA 1NMCC 2P24A 2WZ0A 4MSWB 2HKHH 2OSYA 1MWAB 4G2AA 4ZNCA 3F6JA 4JY4A 2E74D 3MRKB 3QIUC 3UO1L 1HQRB 1WVZA 1CF8H 4Q9RL 3VXUD 4L8SB 3RPBA 3E6FB 4LVHC 1AFVL 5D1ZA 3AJ7A 2FCBA 2J4WH 5CGTA 1JGLL 2P5WA 2JEEA 1M42A 2WPGA 3LZFL 5CSGA 5T3ZH 3GNML 1AFVH 5T5FA 4FA6A 4D2NA 4XMWA 1QOKA 1KDJA 2R4SL 4MJID 2NY2D 4YSSA 3DX7B 3FB8B 1T03L 1S7UA 5DUPL 3MRCA 2YMXH 1NTKD 1T89A 3D48R 3BUDA 3DX7A 4GBXD 1RULL 2XY1A 4Y2DD 3OF6D 2E43A 1E3XA 3B5HA 4GW4B 4KHTL 2XX0A 5CJBA 3KWWB 1HEZA 2XZZA 2YMXL 4ALAL 3VYPA 4XXDA 3HI5H 4HMCA 2V33A 3X2QB 1PPJD 1KCWA 3O8XB 3S4SA 1JDDA 3DNKA 1XMWA 2WWMC 1IC1A 3AQDA 1YNKL 1WWCA 4OM1H 3X1EA 5KS9B 1BEYH 4FFYA 1KULA 1EHLH 3ARWA 3H7BA 2DYPB 4EBQH 1AR1C 1Q94B 1HJCA 4KO7A 4AYBA 3S88L 2IZ1A 4A2GA 2GA1A 1UVQB 2PYEB 3OKOA 2P24B 3HRNA 3MLYL 1OAXL 1GC1H 1FL6A 2XN9B 1F90H 3IF1B 1N7SB 1U8MA 2QL1A 4Z7NB 4LKXB 3CWBG 2FYNB 1RZIB 1THCA 4NZFA 4QY8A 1KY6A 1T6BX 2Y7OA 4OGAD 2R1XB 2FWOA 5ANHA 3B9KB 2XIBA 4QYOA 4O02B 1PNDA 2VITA 2W0KA 2GJZB 3ZOAA 4QTHB 1KELL 5DQDL 5ILTH 3QWOC 4U6VH 1SQBE 2CSPA 3F7LA 5MEPA 3JTTA 2R8SH 1WAAE 1QW9A 4ZOCA 1AO7A 1EDIA 2P67A 4NRXB 1ZEAH 3KGSA 3ZBMA 1VQ5P 1Q90D 5B7EA 1KJ2B 2QJPB 1NIFA 2BSRA 2BY1A 3V7MA 4IGBB 4QXUH 5I0ZA 2R8SL 5D8JH 1UD6A 2XVKA 1T0NA 3IDNA 3QDJB 5BNXD 1MCWW 4Z1PA 2ZWSA 5F88A 5ESQA 5IFHL 3ULVH 5H2BA 1T2XA 3BKMH 5MENA 1NC2B 3KCPA 4NQXB 3QYNA 1B2WH 4V1DE 3WTXA 3THMH 4ES8A 3RWFB 1HNYA 2ZUYA 1NCAL 5CSZA 3QH3A 1RZJH 4HAGA 5KAQG 2H88C 5J11B 3CZNA 1P84E 4XZUA 4IL6X 3II6A 2HB0A 3W2DH 2XXGA 2VLJD 3OLGA 3RK2D 2E6PA 4YQXH 1CCZA 2VXUL 3CHXA 4KKLC 5KSUB 1OW6A 2ZE0A 2L5GB 3WV0A 3ZN6A 2VSCA 4RDBA 2N0MA 2HODB 4XXWC 3KLKA 4WWPA 2HP4A 4XGZA 4FQXA 1UB6B 1GH7A 1QD0A 5JLZA 3K1DA 1GZHC 4DZ8B 2LFEA 1XVSA 4WFEE 4D0CB 2GSMB 3VXQA 3G6JE 3FQTA 1TJHH 2WT7B 2R0ZL 3R18A 5IVZA 4YDKL 4AG4H 3I6KA 1QQDB 4XP6H 1J88A 2BSCA 2ZUWA 4LVEA 4G6FD 4TVUA 5DO2C 4FC3E 4XXCA 4N2CA 3M9HA 1RIUH 1L3NA 3EOBB 3HA0A 1HI6B 1XF5B 1XTMA 5E2TL 1JMMA 1DN0B 1D2OA 4XP5L 4N6QA 3DX3A 1K05A 1N7SC 4R4MA 1CG9B 2J8UF 1ONQB 1XF5A 4HIXL 4XHJC 4X83A 1JWUA 2G4GA 3NJLA 3ZZSA 2AXTH 3MBXL 3LKQA 4KQ3H 3MLUL 4K55A 5DUBB 3CK0H 2MHAB 1J9SA 3INUH 1EVTC 2XVBA 3ZYOA 3UTSD 2QQLL 3DVFA 4L4JA 1GHFL 2I9TA 3U59A 1OK0A 4GUCA 4X6CA 4XBGB 5C08E 3WOVA 3L35A 4FABL 3GMRA 4WY4B 4J27A 4JFDA 3R7RA 1T3FA 2WN2A 5D1ZC 3TZVA 2QQLH 2EDOA 4TS6A 3VG0H 3UZVA 2WPSA 1WZAA 4OCSL 2A6IB 4ZFFA 1IB5A 4L3FA 2XA8H 3H2WA 3OKEB 4IFMA 2FH6A 3IDYB 4P49A 5I26A 5IREA 3FFCB 4ZO6A 5FO7B 2YPVH 3PL6C 4LARL 2NTFA 1OCWL 4P06A 4ZX4A 1ADQL 1AZBA 3MRLA 3N55A 2NX5E 4PGBB 5CZKA 3P32A 4KRLB 1PKQB 5ES4B 2FO8A 4QHMB 3ARGB 3D3VA 4W9EC 2WIIB 2B8OT 3G6AB 4LMQE 4QEGA 4MDJB 3HD7A 1KCUH 4NP4H 4YVUA 3CSGA 3UTPD 2IXQB 4YPGA 1CL7L 3P0VL 1I9EA 4P5MA 3QGVA 4FCAA 4HGWB 1RZKC 5F7MC 3FN3A 3HUJE 4N8PA 4LQ1A 3TYYA 1I9IH 1J0JA 3S6CA 2FBWC 1S9VA 2YRLA 2H0FA 4HPYL 5JPNB 3ZX1A 1WA0X 4LB8A 2LGNA 4JFXA 2D3NA 3O2WH 3A5TA 5LNEA 1IVLA 4N0UB 3TYGH 4YEEA 1FCCA 1YY8B 4OF0A 4GMSL 4R4BB 1FBIL 2NNXA 4DP9X 3RHWF 2X4OB 3H9HA 2QFPA 3TXAA 1QTYT 3ZKNC 1KTDB 4JLRB 4HALA 5EOCH 3AE4C 3PAYA 1FBIH 3ASWA 4BXSV 4G9DB 3NCCB 2IVFC 2WZAA 3KYQA 3FO9B 2ITEA 1IO4C 3FU7B 1CU4L 1G7MB 4XB7A 1JV2A 3H4FA 4JRYB 2CAKA 4OGXH 1YC7A 2E75D 5JIDA 2J7LA 1AGBB 4A66A 4KVPA 1A47A 1OB1B 1UASA 2GHZA 1KN4H 3CMEP 4UNIA 1MJJA 3CZFB 3KE0A 3M91A 1S3KH 32C2A 3MUUA 3DVNA 3O3EB 5DK3A 3WKML 3AREC 1BG1A 3EJTA 4QNPE 4KMTH 4NUJB 3KPRD 1T2KD 3MUJA 3T3PF 4PM1A 5GJTH 2AQ1A 4GW4A 5FGBA 1DLFH 2WKOA 4BSWA 4LSQL 4UBDD 4LKCB 1UADC 2VJXA 1FVCB 3CCQP 4LGDE 3CC4P 2AKRB 3SE4C 2HUHA 5TPWH 1P5VA 2V7NA 3IN2A 5E1HB 1AZNA 2KS1B 4CBPA 3LHAA 2P8LB 1HHHA 2YO2A 4NNPL 1H0TA 1HKFA 3MGTA 3F00A 2DQJH 4XPTH 3CAFA 5DJCA 4LSUL 1BDCA 2VGLM 1BD2E 1KYOH 4H13B 4AJWA 3NACL 4HJUA 1U8HB 4GMTL 3D4GA 1GGCL 4L8SA 4I18A 1GGYA 1IBGH 4ODVH 3FCGA 3NCEB 1FRGL 2CBQA 2GJPA 5HGDA 4NERA 3QI9D 5TQ0H 1AHWC 3QDGD 1GGTA 1GGUA 5LJYH 1X9LA 3LZOA 3N91A 1OAQL 3NCYP 1JY3O 1CLYH 2OARA 4WJ5A 1HJBC 5DJDB 4U3FG 1TTRA 1HCVA 3ROOA 3ZMEA 5KAIE 1S9KE 2EH8L 4WU5B 1VQ7P 1L9NA 3FCSB 1IFGA 2OTWA 3RVWD 4U3FD 5FYKH 1I1AB 4YX2H 1W2BO 1K8IB 2YQBA 1IFPA 1FE6A 2DYRB 5KVEH 2I60H 3MJ6A 1ZLEA 2PCPB 3JWNC 3WENA 5L7XH 4B9CA 2J88L 4WI7A 2CJUL 4ORGB 4NKIH 2DWEA 4K94H 3BW9B 5TQ2L 4P5TD 2I5YH 3ARDA 4HH9A 3BX7C 4PRPD 1A21A 1MDTA 1WZMA 3D39B 4U1MA 4RFEA 4UDTB 1ZD6A 2Q7AA 3GRWL 4KY1L 5I8CB 1ZLWK 3FSZA 1J8HB 4I88A 3DIVA 4X4MA 4PVBA 2PR4L 1MW3A 2VO8A 3DRTA 5K9QG 1EJ6A 2V3EA 1XF4A 1RIHL 3POCA 5EU6D 4K2UL 3GMLA 4RSVA 3RL0g 1U2HA 3EDDA 4NENA 1R4XA 1W72L 4MFHA 4P2QA 4TTGA 5FR3A 1HTLC 4X8GA 3PV7A 4AYEC 4S1QH 4P2QB 3K6NA 3B83A 2C3GA 3STBA 1L4AC 4FNSA 4JO4L 5DD0L 3ET9F 1OD7A 1WAAA 2ESVA 4ANUA 4WI0B 1EHNA 2BP3A 5GRJH 3Q5RA 3WAJA 3IN6A 5KLVG 1GIGL 1JZEA 1X5IA 4MLIA 2F8XC 3SOBL 4JFSA 1DBBH 1T7ZA 1GOHA 3MNDA 1FV1A 5F97E 5AAWA 4C56D 5MHSE 1NKGA 2BNUA 3S9OA 2GTZB 2OYIA 4HKBA 5F7WC 1M7XA 4GQZA 4XX5A 4HUVB 2VWEC 1ET5A 3JWDL 2LLNA 3P73B 5HVWA 5DJUB 1OCCB 4LVNB 1T0MA 1IFIA 1L0NE 1QA9B 2Q8BH 4JFHD 4D94A 4XNDA 3WMM0 3JWDH 2X41A 2NCMA 5LDUA 5F1KC 4U1HB 1JWMA 4Z0BH 1U6AH 3Q8CA 3HRZA 1NKZB 2DQ6A 2V9QA 1S7XB 2KHAA 1RE4A 2BVOB 2H2SC 3HHSB 2VDPL 4GUPB 4IMKA 4F7TB 2WQAA 3TT3H 4RGOL 3WEOA 3MV9A 4I18B 3NIFE 3H85A 4N24A 5D7EA 1YEJH 4F9PA 5IW1A 3MU3A 2R69L 3ARUA 2F53A 4CW1A 1KT2B 2RR3A 1OSZB 2XG4A 3HVNA 5KW9H 3WDHA 1FLRL 2V17L 2AQSA 3HG1A 2FBOJ 4JQIA 4MS6A 1UXSA 5KVDL 4P23C 2ARJQ 4U1JB 4XNMB 4MJ4A 4PRPB 1P5VB 4RGNE 1C5DB 1FNSL 3HNVH 1WJ3A 4JJOA 2DQIL 3PUUA 3TJPA 2K9JA 2OI9B 5GISL 1QSZA 4BKTC 2QVMA 5HDBB 5JHDE 3BC9A 3T4AA 1XGQB 2Y5QA 3B2XA 3U6RA 3KEDA 4G1EB 3ARBD 2V2XA 4TQHA 1CGSL 1U36A 4OR1A 3QW9A 4DP5X 5E24E 3LV3A 5IV2A 2IBZG 2VZUA 5FWQA 2H3NA 4I2LC 1B0GB 4OZFH 4MCYB 4L4TA 1E4HA 1OF0A 1WISA 3B6SA 4EXKA 3MNZB 3S0PA 4ZUUB 5K69A 3KW8A 1C1EH 1CGVA 4BK4A 1TU2B 3X1NA 1CQKA 2XPZA 4GQRA 5DLMH 2X4NB 5DD6B 5DJ8A 4JKMA 3BESR 1IM9B 3FQWA 2R83A 1Y47A 3U9UB 1JOCA 3FGAD 4K4KA 5CWSB 2UZPA 2ADJB 2P4AB 1MHCA 3ZT7A 4EEEA 4LIQH 2FQEA 1LK2B 4YUEH 5EZIL 1J7VR 1JI1A 1BQSA 2QQKH 4JO2H 1FFQA 4LCUB 4ZDHB 4U1GB 5DVLA 2GY7B 3SO3C 5C09A 5MEOA 1NHLA 2X1WL 2GAZA 2HT4C 4ZTOL 1AG0A 3VNZA 3OZ9L 3RVUD 3ABGA 5GQBA 4GI9A 5T1MB 2IXQA 1EDHA 1PG7W 3OPZL 4GAFB 1PZ5B 4GRWE 4DGYL 1C08A 1CUOA 5DJXA 2VXQA 1X22A 3WFCL 3RX9A 2ZOKB 4MXWL 2VTFA 5C6PB 1AQ8A 3IN0A 2EXWC 2L04A 3QG7L 1A2YA 4PHZA 2DB8A 2B9AA 3LIZH 4Q97A 4UB6E 4HOWA 4NN5B 4FQJH 2XT1B 4KTYA 4MB4A 4X6CE 5HHOE 4PJIF 2JQAA 3LKNA 5F89B 1MJUL 3GI8L 5IROD 4M1DH 4GG8B 3VGBA 2J20A 1KFGA 1GL4B 4PD4J 1WSST 4G6JH 5E03A 4OJYA 3GXFA 4KI5F 4Q8BA 4AQZA 3U2SA 4AGMA 4TVPL 1AYRA 2R2EA 1TITA 3HBPA 3OAUH 4NPDA 3TEWA 1NKRA 1KGUA 3D69B 5JORA 3BRVB 1XBRA 2DQGL 2EYSB 5ACZA 3HLKA 4K3EL 4UB0H 5B3JE 1JHTA 5D2NB 1XGYH 3RUGA 3MBWB 4R0LB 5IW6A 4RNRB 2BIPA 4Y28J 1DN0A 4DIXA 2IBZX 2F61A 3KPSD 1OQXA 5CGYC 2MCMA 5CLYA 5F44A 2Y25A 3IDGB 4ZAKA 4E9RA 4M6ML 3UTPE 4IBWA 3D9AL 3LPOA 4Z7VB 3TCLB 2BY0A 4YSOA 5APTA 5ADPH 3LNHA 5EZLB 1OPGL 3BO8B 2MKWA 4RBPH 1CPUA 4RMVA 4EUPB 4ZZFA 1QUPA 3VMZA 2EVHA 1CI6B 2OJZH 4BWUA 1N7ML 1GRWA 1RSFA 1K4DA 2WBKA 3WNPA 1NEZA 1X7QB 3QDJE 4M8QA 1UQSA 3AABA 5IEKB 2C9QA 3MACL 2ZICA 5EBLB 5CBNA 3F58H 1F97A 4ASVA 1AGEB 1OE1A 1TJIL 4JR9L 4MJJA 5DWPA 2P28B 3GGWB 5GSRB 4IS6A 3WUVA 1MCQA 1S3RA 4NQEB 2Z5HA 2RFXB 3CGTA 2B1HL 1NFAA 2YEZB 2OMXB 2QHRL 4JPWL 1CYXA 1NTKG 4LPTA 1A4JA 1O9VA 4OTXH 1TTUA 2XPGB 3BAEL 3CHRA 4Q58C 2IDTA 1RHFA 2WYHA 3HUJA 2KL6A 1P4BH 1IEAA 4PMEA 4PRHA 2ZWYA 3CH1B 5ERWB 3LZRA 4XVOA 2BSRB 4CSSA 1HHIA 2E7BA 3O6FD 3GPSA 1MELA 5T1KB 5BV7C 2AC0A 3CVIH 4QHUA 2LU5A 2KLSA 1CDUA 3ABLB 5E8DL 1NU1D 1YPZE 2CLVB 4JZNB 1JEKA 5F7EH 2EP6A 5FV2A 5FC9A 2CMRL 1W8EA 1PDKB 2FZ3B 1IEHA 2JQMA 2VM3A 3R06B 1JK9B 3L3OB 2MCPL 1KCSH 4ELKB 4LCIL 2DEXX 1V7NL 4D7PA 3BIBX 5D7KE 2KXPB 4PGCB 3ARTA 4NQQA 3QHFL 1F90L 2YD2A 5JW3L 4Y99C 4YHNB 1S7QB 3KPSB 4JQ0D 2ZUQB 2EJ1A 3IJ9A 3IVKB 5EEUA 3RA7L 4U1GC 2H43A 1T1XB 4MA7L 3MOBH 4XCYA 3TJEL 2O01N 1XGUA 2FIRT 1K6QH 5D9SB 4BFIA 4HC1H 1WDAA 3ZDZF 3MV7D 2I7SA 3FL7A 3IU4L 4CA4A 4ZZKA 3V6OC 2GSGA 1MFEL 3MLVH 5C1MB 4I77H 1KB5A 4WY7L 1E5UI 3MRNA 5EIIG 2FEDC 3LPFA 3OVUB 1H8LA 4D0CA 3HLAA 1HEZB 3IFNH 2PWHA 2A4ZA 3JSSA 2OP4L 3VVWA 4BZ1A 2OL3A 3AGWA 1MFEH 2QPEB 4HQQH 5EIVA 1BE3E 3BLPX 4DZBB 4FG0A 2ZXAA 3S37L 4F9LC 4KNQA 4TQIA 1D6EA 1N64H 2ZG3A 3EBHA 3H7LA 5A2BA 5KYYA 1I8KA 2FJHA 4XN5A 4H88H 2FYUD 1KCRL 2YA2A 4X7FC 1T6VN 1TTFA 3LSOA 1EDJA 2R9HD 4WFHD 3RZCB 1VQPP 3JVGC 4H8UA 2B5IB 4HKJA 4LSPH 2K9UA 3N41B 3N44F 3OV6A 2KYVA 3DMMA 4AYCA 1JK8A 3F7RA 3SDDC 4M93C 1EEYB 3JWNG 4P9ML 2EUZA 3UERA 3E6FA 4WV1B 4YQXL 4N6RA 3P8MC 4LT7A 4XI5D 3SE8L 3LY6A 4LEXL 1QNIA 1YEDA 3QWRA 4XXWA 5EUOA 5C0DB 3A22A 3C12A 3LB6C 3QCTL 3EWKA 2NY1C 4JL2A 3VW3H 2FATH 2P1YA 3O3BB 4YXKH 1U33A 4PJBA 1KGYE 3WEXA 4J3TA 2HT2C 5IB1B 4A7QA 1UD3A 3K4DA 2WXFA 2FJFA 3GO1H 1SFCD 1QHOA 3GZOA 4ZFQA 1SQMA 3QEHA 1U4FA 2XXCB 2ZCHL 5IG7B 1G7IA 3H1LE 4KJPC 1DANU 4AC2A 5IG7A 4QHKJ 4OZHF 3L75J 3L5XL 2ADJA 1G5AA 1FZGA 1BVKB 4N1HB 4ONFL 2B77A 5DD5L 2F1EA 3SB3A 3L5XH 1SXNA 3PNRB 1F02I 4EAEA 1WFTA 3HC2A 5LUMA 2KH2B 1PY0A 2OTUB 1AOZA 1B0RA 1IGMH 4Y4FA 4ELMA 1N26A 3ISRA 1H0DA 4G3YL 4UANA 3II2A 3O8XC 1YEDB 4OJFL 4JG1H 5I1KL 5ABZA 1BF5A 3QQ3A 1DLHB 4RGMB 4LGRB 5D71H 5IFAL 3T9WA 5FIEA 4FNLL 2Y0SA 2R3CA 4NQCA 1HDMB 1RK7A 3VD1A 2VDRL 3DBXA 3I9AA 4XXDB 4ZX6A 1X5HA 3L70J 2JVUA 3PABA 4OFVA 5AOIA 1JNMA 2NNAA 3TBTA 2P45B 3MGAA 4AUJA 4EUPG 4XN2A 4LARH 1EDYA 1NAMH 1VEPA 5H35A 5JHBA 4QPEA 3CWBE 4MA3B 4NC2B 5IQ9A 3MGNA 1SQPD 1PIGA 4HUXA 4I9WD 4ODTH 2ETWA 3VRIB 2RIKA 3TBWA 3LZLA 3HD7C 1QNZH 2ZUSA 2QSCH 2Y7MA 2LLGA 1QP1A 1MN4A 2G2RB 4ODTL 5E94A 1NIDA 2YKQA 1WAPA 3CU7A 4PS4L 3VFOA 1LEKA 5ICYB 2ADIB 1E8YA 3AEFC 1XGUB 1XX9C 1YECL 2EDWA 3MV9B 1AQDB 4FD0A 4XCYB 4GAYA 5A40E 5KN5A 3NCJH 3QXAA 1GW6A 1WT5A 5GGUB 2J21A 1KJ2H 3A6CL 3RY5A 4ZPVB 2RACA 2NMSA 1AD9A 4GKNA 2HJKA 4I13B 1P0SE 2P5EB 4ZFZB 4H2AA 3CZSA 4CVZB 4D0BB 1HHJB 2IEPA 4P5SA 2UWEA 1BE3D 1E5AA 1LWUC 1Q9WA 2KERA 2J6WA 3MJ8B 2VH5L 1LTJA 2CUIA 4U3FE 1FF5A 1V5JA 3UTSB 3WIFB 3IGAA 2AEPH 3NJVA 3K72B 3BT2H 2VH5H 1NLDL 3MXVL 4NQUA 4DESA 4ZMZA 4AXWA 4AYSA 4QAWA 1URQB 2GI7A 1E79H 1LDPH 4XTRC 4L2LA 5F9WB 4U1IA 2VL4A 4XPAH 4MWFA 3CFCL 3HZMB 4ZQKB 2C9AA 2WXJA 5EUOB 3D18B 4NN5C 4OGYH 2EVIA 1UZ8B 3PPSA 4M3KB 2CNYA 4N6RB 3OXRA 5EWIH 2FX9H 3O6QA 3TO4C 3CSPA 2CIKA 3DTUB 1KJ3L 4HIHA 3PL6D 4Q9CA 4LOUD 3C2AL 4YR6B 3T1WA 5TPWL 2XCMC 4GW1B 3VD4A 2LFGA 1ZHNA 2IADA 5JHMA 3ASOB 4PJIB 5EBMA 4HH9B 4J3UA 5IEKA 2IGFH 1HE7A 3OX8A 5IHZB 3V6ZA 2DMBA 5F9WC 1GD2E 3ULVF 2W83C 1K4DB 2MCAA 4W1TA 4JG0H 4AVIA 2WLKA 1XCTA 1L6PA 3SYAA 3UJTH 5BXFB 2F1BA 3CDCA 3Q5PA 3HMXA 2M3EA 2KPNA 1SGKA 4IIQC 1G9EA 1KXTA 1FN4A 5E99L 3ILQD 4QTIH 4P57B 2Y5TA 4JG0L 2NY6D 5D2LA 5C09E 3L3HA 4BSJA 4UM9A 2N1TA 3VB9A 2APVA 3SKMA 4JJHA 2YPVA 1IFNA 5KYWB 4WI9A 3ROOB 1X4YA 1U93A 1JL8A 4ODXA 4HJJL 5LG6A 1T1XA 4L2YA 5DC4B 1ZK5A 1D5IL 4L76A 2VZVA 3IXAA 3CFJB 4LHUA 5ESVA 5BOZG 1L4IA 4YK4B 4JN2A 1AZRA 1HX0A 1K9MQ 3QSKB 5DGQA 2I60L 3ZLQC 3EYSL 3MA7A 1XF2B 1XGZA 3ZZLA 2IDUA 3VGAB 5DYOA 2AXJA 4P46A 2OMTA 3QJVB 3QWOA 4JRXD 4ZUTB 4Z3IA 4DN3H 4XC1L 4O2CA 3D39E 3V2AR 2WQWA 1F45A 3MFFA 3VXMD 1PDKA 2XYCA 4AJ0A 4IDJL 1R5WB 3NA9L 3U83A 3PDGA 2CLVA 1JGEB 1Z0NA 4K5NA 1URQD 3U0PA 1E9QA 1VACB 1JGLH 1JCKA 4MHHG 3GHPA 4KVNL 4OUUB 3HZKB 4N25A 1VL2A 4HJGH 2DEYX 4ZRGA 4QLRA 3BISA 3MRJA 5AVUB 3WLBA 3I56P 4P2RA 1QLFB 2C1OA 4FQLH 1XGPA 4NN7C 4KT0J 2V9TA 3RKPA 3T0BA 1E5YA 1DJSA 3BPNB 5ISZB 1XXDC 4WDIA 3UACA 3P0YL 1BXUA 3F7PC 1MCIA 4IJTA 4YN3A 4RMWA 3OKKA 4HKZH 2K3HA 1CICD 3GSVB 5KSAA 1U8OA 4AKOA 3P0YH 4MNQA 3SOBH 3E38A 3HPJB 3W39A 1E27B 4AE1A 4C4BA 2DLHA 2Y0CA 2JKIS 5IK3A 3A4FA 2AFNA 1NAFA 4G7QB 1OVRA 2E4TA 4YHKH 5GRUL 4C8XA 5JIKA 4F7MB 4QHNA 4L8CB 1A7NH 5FO9B 3UBHA 4GAAA 1BEXA 4OI9A 2AXTE 1D5ZB 5I23A 3SDAA 2IF7A 5B8CC 4N2LA 1GC1L 4WW2A 4PVNA 4XVJH 5HI3D 1SJMA 1PGOA 5GRWA 3TA3D 1RLWA 2FDBP 1IFDA 5HHMD 3CFTA 3MLWL 4L05A 3DROA 4YL4A 1UZ6E 2N01B 2YUXA 4Y4KC 4XCCL 3UBGA 5I76B 4OIIL 2DIBA 4I0PD 4Y16A 1BF2A 2IGTA 4YWGH 5I30H 3FU3A 5KJ7D 3FRUB 3SY0A 4JW3A 3KH4A 4PIRF 1VKXA 4OGQC 3G3ZA 4XP4H 4FTVE 2FBJH 3R0MA 5C71A 1N73C 3RUGB 3SKNB 4GRLB 4Z7UF 2D4DA 4FXTA 3VE0A 2P8MB 4HWNA 4Z7WE 5TE6L 2FHFA 4Z77A 2JB5L 3GSWB 5CM1A 2WWMD 1OWAA 1IGJB 1NWOA 5F7AA 3VMAA 3T5WA 5IFHH 3ULVL 4P9HH 3BPLB 5KBLA 3BD3A 3TBCA 4P2QD 4Y19A 2YMKA 3Q1MA 3BVHA 1MKMA 1MPAL 2AITA 1J5DA 4JAMA 3FFCA 4HP5A 3FCTA 5SWSB 2VMDA 3B8EB 3OJVC 3APCA 4G71B 3RZCC 4Z3JA 3ROLA 3ZJAA 1SQQE 2AJVH 1CGSH 1PP9E 2P58A 5F70A 4CN1A 3VI4B 3EYVA 3N3EA 1KQFB 3WHXA 5HHPB 4JQVC 2E7LC 1K8AQ 2Z35A 1RKRA 4OQTA 3VWKD 1AYOA 4A04A 2DQMA 4WEBL 3KMDA 4KZ0A 2IPKB 1ECYA 3I6LE 3T4YA 2V7HA 1DQLL 2AK4B 2ITDB 3WTSA 2MHAA 4M43H 3GMNA 3PDOA 5DJ0B 3NQIA 1MREH 3HHSA 2N1TC 5E4EB 4EZLA 1ZW0A 3CFJA 4XP6L 2VM4A 1UB5B 5TJWK 3TBYB 4BCYA 3JV5A 2V5YA 4P3CH 1I7ZA 4NXKA 4B9PA 1BYOA 1I82A 4FTVB 5EU3A 5CEXB 4NO5A 5E70A 1YRKA 1JTHB 3M06A 1NC4A 4B9JA 1UZGA 3QRBA 3HTKA 4P3CL 3TA3B 2W60B 3IFPB 5E8PA 4M6NH 4XA4A 3I50L 4A55A 3R1GL 2YKPA 1YMHB 1LK3L 3A0BE 5AVVB 2QLYA 3UTOA 1F11B 5DZNA 2OTJP 4FABH 4MQTB 4H8WH 2X12A 3JVFC 1HEHC 3BQUA 4XN9A 5AVQB 4I3RL 2RJMA 1DTUA 1E9OA 3GSNB 4XWGL 2KBGA 4NZDA 4OCSH 1P2CB 5I2IA 1AZUA 4LSVL 4DK3A 1KJVB 5I8EB 4I3RH 1RQVA 3QH3B 4LVOB 4MRBA 1GKOA 1OHZA 2D7QA 3VDCA 3RJQB 5JOFB 1T6WA 3NSCA 5E4IA 2BOCB 3TEYA 3PNWB 2H32A 4Y5VC 4OBSA 2BCKB 4LL4A 2P52A 5D70L 1NTKE 1H8AA 2ARJA 3NIFB 4HYTB 4MNGA 4JUTA 4H0LC 2BO0A 4U1MB 5D1XC 2CNZA 3TBSA 4BUQA 4HUUB 5TF1L 1R3HB 4NCC1 4ANVA 3EXLA 3DK0A 5TK4A 2YRPA 4FQHB 3PXJA 1C8QA 5FFGA 3NFSL 3I6GA 4NJAL 4OFIA 4R90L 2XHNA 3BUIA 3KPQB 4G8IB 3DPBB 3MNWA 4H1LA 5H37G 2HTKD 4MB3A 3VCLA 1OAUH 2R0WL 4LKXA 4XBEL 4DO4A 3UAJD 1XF2A 2Q6WB 4DAGL 2XN9A 4PV8B 2YFNA 5EU6E 5DHEA 4WJ5B 3L4TA 4JFVA 3P77A 2XZRA 5BS0A 2EC8A 2EDJA 1WWWX 2VDKB 2NX5D 3QH9A 1E28A 3EYQD 3TGXA 3PLNA 1JYVA 3PE9A 4IFDK 4OBRA 1EERB 1TXKA 1EFXB 4WO4B 4WUUA 1F2QA 1O6SB 1ZANH 2F5AH 3MOQA 2FQFA 3P4OB 4FMKA 4JM4H 4Y16D 3TYFA 1BVLA 1CDBA 2R29H 1WCQA 5IJKA 1SN0A 3Q8FA 4R0LC 5EO0B 1XFPA 4A63A 2G9HB 1UWGL 3MRIB 1KEGH 5JIMA 5I5JA 2A77L 3CVBA 4UWQB 1BSHA 4H1LB 2BNRE 5FWRA 4NLAA 2FBRA 2DKUA 3LH2L 1E6OL 1TVHA 1M57B 5HDBF 3GLAA 2AW2A 3QQ4A 4JR9H 3NIDF 3LVTA 4L3CA 4OLWL 2XBZA 2ZXEB 4Y5VB 1PBYA 3QUMH 1F58H 4JPWH 5KOVC 1E67A 3NJIA 2XRAL 5CJXA 3LQZB 3II3A 3NSJA 3KXDA 3F62A 5IT2L 3WEMA 2R1WA 2HX8A 1J0IA 4JHVA 3WNNA 1TPXB 3PWJA 1P4BL 1G1OA 4Q56A 2ADFH 1S9KC 4R8WH 3L2MA 1YN7A 2J6EH 2QPFA 1DLHA 2UX7A 5T3XL 3DXAB 3VD5A 4TUKH 2KZWA 3AWFA 1ORSA 4TNWK 5GS1C 4KZCA 3V9CA 5I2IB 3BCCG 3LKOA 2WKOF 2ZIDA 3EBAA 3EO0A 3IJ7A 5E6SB 2BRRL 1IBGL 4HUKB 1M53A 1E8ZA 5BZDA 3KYMB 2GUSA 5IBTH 1URQA 3OMNB 4JB9H 4QOKB 4R4ND 4Y4KD 3H53A 5C0GA 2NPSB 1E4KC 3I6SA 2XLLA 3O6MH 1HFUA 1QASA 2GJRA 2YWZA 4I0CC 3ALPA 5LGYA 4AM0Q 1DVFD 2XOTA 4HZLA 2A45G 2ZYHA 1M71B 2OYLA 4ZI8A 3RTQD 1MRCH 2DD8H 3RA7H 1FFPA 1IGIH 2FIKA 4Y19E 1IBBA 5L7XL 1JZ4A 2EIZA 2HJKB 3BN9D 1IVTA 1AD9B 1FHGA 1FWXA 1NAKH 1P7QB 1S5IL 4LLMB 4N2OA 5GZOA 3HG1D 4FGMA 4PJEB 4NKQB 3EO9L 1NAKL 3IDMA 4PJHE 3BKCH 2XTSA 4FX5A 1UD8A 2UX6A 2F54D 4GP4B 2XDJA 3CL3D 4Q9QL 1IIKA 4TSCL 5FUOL 4YDIL 1WICA 2VRAA 4UQ3A 2VNCA 5AOJA 2DLFL 1FZJB 2H45A 2CM6A 4MYWB 4YHZL 2A6KB 4EDWL 4Z7QF 5HDQH 4QHKI 1IQDA 2NTFB 1JDCA 4KK5C 5DR5H 2W9LA 5GHWH 4S1QL 3E2HB 5FF6B 2QFRA 3JYBA 5IQ9B 1N5YH 1SQVD 2ZXWB 3ETSA 3CNKA 3WS6C 3DA0A 1CFVH 5C0CB 1H89A 4XPFL 1HVVA 3KWXA 4NKDB 4JRYE 4GUQA 1BP3B 1FFOA 4PY8I 1RK0B 4S1RH 2E0PA 5AL8A 3H3KA 4QAMB 2EC9T 1DVFA 3SKOA 1F8TL 3MCLL 1QFOA 4OKVA 2PW1B 1JCCA 3GLEA 32C2B 2VDKH 4X7EC 3N0PB 1UUNA 3ECBA 4MAYB 2VR8A 3K80A 3X11A 1C12B 3L1FA 4Z7IA 5ABAA 1XXFC 4XMPL 3EGSB 3HIZA 3QFJE 3APMA 1Y07A 3RILA 4OWFA 2Q8BL 1FZFA 5AD0A 2XI9A 2O01H 1YDPA 4XNXL 5DHVB 5SWSE 3RVWC 4U3SA 2YIUB 5DVMA 3D51A 4Y4KB 4JFQA 4F7EB 3JV4B 2FEDD 5BQ7A 5JHDA 4QRPD 1ACXA 3IJEB 3B7TA 4JHWL 1FOSE 5IVZB 1GOGA 3RWGB 1ASOA 5DMIH 1FBMA 3WNIA 3L3OA 1E30A 4ONFH 5IWLA 2FUTA 3HE6A 4BBWA 4HIJA 4HAFA 4JHWH 3DJZA 5KSVB 2DKMA 4FZ8L 2VUOA 1HZKA 2BZDA 2F8VA 4LVNC 1QLRA 1RF1C 2NTSP 4G70B 1U3HD 1A5FH 2Y6SD 3L73D 2GW5A 4PRAA 3HZYA 2K0RA 1KN2L 1AQTA 2HODA 3OHXB 2AI0H 2X88A 3CCHB 4YSAA 2B4CL 5ERWA 4H44B 4RO0A 3LNDA 3S36L 2R7EB 1E27A 1MIMH 1Z1WA 4LRNH 1EHKB 2VE6A 1BQRA 3BPNC 2Q7CA 1RZ8B 1T1WB 2CDFA 3QULB 1VQKP 3GWJA 2HVKA 3WFHA 3FRPG 4M9OA 1NGYB 1T7WA 1DR9A 2K9YA 4R4FL 1A3LL 3MV8A 2AABL 3SBWA 4UTBH 5FO7A 5C0AB 1EVUA 3QFDB 3T0ED 2SEBA 3CC2P 3AU1A 3RB7A 4FA7B 3EW3B 3Q0HA 3HZYB 1HH6B 3PP3K 4NZTH 1DQKA 1QEWA 2ALWA 2YPKB 5HPOA 1YYML 3WIIL 4UOW0 3JQOB 3D08A 1AR2A 2A06G 5CCGA 4U0RB 3OMAB 5ANMB 3Q6GL 1U4EA 2JB6A 2NW2A 2C7FA 3CV5A 3V4LA 3ETTA 4HIJB 3U7AA 4L0ZA 3MNVB 2YZ8A 1CZ8H 3NCJL 5B8CA 2VXTH 1YMMB 1RZIA 3PGCB 1SYVB 4K5MA 1TZHA 3NPSC 3I3DA 1PQZB 4QY8B 4JFZL 4HLEA 3U46B 2AANA 3S3CB 4YUEL 5L4IA 4GEIA 4NPYA 4U3SB 3OMIB 4HZ1A 3T6VA 4YJZL 4Y5YA 4LHUB 4RNRA 1JF5A 1K5NB 1QSFD 5F7LB 1QUNB 1OP9A 2AZUA 5EIIA 1CD9B 3UCQA 2VRKA 3TN0D 2YFOA 2D7OA 1INQA 4G8GB 3QZWA 3SQBA 3ML9A 4K3DH 3AEEC 4UZGA 1I9JH 1NDGB 4WEMB 5DFAA 3KPSE 3GC3A 2R32A 2HPTA 3ILEA 1EQ7A 1U30A 3ULVC 2P47B 4HEME 2C3VB 4M8UA 4PSPA 4F20A 3VXQB 5FCSH 1X44A 3ESNA 4EI5A 2CA4A 2OJEA 4W9ZA 3ECWA 3MBEB 5EV7A 2CPUA 4N4YB 3N41F 1A1MA 3OKDA 2F6AA 4LCCA 2NPLX 3C6SA 3VP8A 2F9BT 1LTBC 3QG7H 1SM3L 2M8XA 1ZCRA 4NBZB 4XT1C 1TFHA 1GS7A 5FGBC 5FKAA 5FM8A 3UABA 2XACC 4UQEA 3WS6A 3CLQA 3BD4A 1RZQA 5KLVK 2Z34A 3H56A 1Q86Q 4Z0XA 2FJUB 1MFVA 1RHZB 3EFDL 4GFTB 1L9RA 4YHLH 4LDEB 3CX5E 3O6QB 3PGFH 2G5BA 5DZPA 5DHVH 3O8XD 1U8CB 1T1WA 3HVDA 1L6XA 3JV6B 1MCOL 1OTSD 3G08B 4M48H 2HFFA 2WYIA 3L17A 4ZS6C 3AVEA 3L5WB 1ZT4A 1U8NA 3K6OA 4MMYA 2CRZA 1DBKL 1GTFA 1OT4A 2O6PA 3INOA 1AOHA 4LNRA 1DZBA 5TH2A 3TBVA 4U3FJ 1ZTXL 3U4EB 4ISVA 2WKGA 3BZDA 1MI5A 3DJSA 4JM2A 3CLFH 3RPIA 1NCGA 1GMEA 3B2UD 2Y7QA 1X3DA 4HF5H 4WKZB 3GXIA 3H3BC 4ELDA 1SVCP 4YLBA 3BHBA 5IHBA 1T2JA 4MGXA 2UUDH 4BFJA 4H0GA 1NTMJ 3GG2A 4HIQA 4UB8H 3LKSB 3HMWH 1N59B 1NZRA 2X05A 4JANA 2BP0A 3BN9C 1L6ZA 3FRPB 2Z7UA 5DWUH 1JPFB 3VXPB 4JKNA 4B9FA 1AXSA 1BZDA 4U0RC 2NNFA 4CKQA 1FL6B 5AB2A 3K71B 2GK2A 5DRWB 1AC6A 2C7UB 3HR6A 3WNLA 1NCNA 1ZJBA 4FI8A 2FY8A 2IMMA 1SEQH 3RQ3A 1VGKA 1Q0XH 4WCYL 2Y1VA 3QXAB 4PJEE 2JELL 1LP9F 2KLVA 1TJIH 4JN1L 3FQNA 4RMTA 2I25N 2VB5A 5EU4B 4BH8B 2HVJB 1PJWA 5F7DB 4G9FA 3QVAA 3GF3A 1YEFL 3TBWB 5CKAA 1SQBD 5DZAA 4L4VE 1Q81Q 2BP8A 5FYJL 2K9JB 1O0VA 5BO1L 3MP7B 2WBJA 4NI3A 1GSMA 2IPTH 3AUWB 3V5DB 1J5CA 2VKXA 1HEJC 5IQLA 1G9NH 5I1GL 5TE4H 5I24A 1FYTE 1JZ8A 1JRHH 3RY6C 2C34A 1P4LB 2IDQA 1YNKH 4DKDC 2UZXA 3MMEB 1BEYL 4HFUH 2IFFH 3UTTA 1FCGA 2FX7H 3HTLX 3ARXA 1I7RA 5EULV 1R8EA 3UC0L 5EF2A 1QL2A 2OYIC 3FJTA 3VA6A 3GXMA 4XOAA 4CGTA 2XV3A 3SDAD 4G6AD 1NTZK 2DM2A 1GXEA 2UVFA 4N2KA 1U8QB 2O26U 2WLNA 1XH2A 2HFGL 2XPYA 2MCPH 2Q3XA 4HJ1A 3X13B 4RAHA 4UB8E 4EDXB 3OJDB 3RI5K 3TEXA 3AEDC 3TGUJ 2JK5B 5C9KA 5J13C 4F7PB 1YEKL 5C0JA 1AKPA 4PAZA 5JW3H 2NZ9D 3KPNB 2IG2L 3Q13A 1KELH 5DQDH 2BS71 3BDXA 5ILTL 1BQUA 1FJ1A 3U1SH 4QKTA 2PNDA 4A7GF 1RUPL 3BZEB 3LDBB 4UTAA 4RMRA 3M1OA 4KTEH 1VF5D 3IU3A 4HIEA 2IG2H 3DKHA 3QNYB 1VGEL 2VLMD 4X8JB 3AEGC 1HH9A 2OMZB 2ALAA 3QIBB 1OM9A 1BBJB 1W15A 3L3JB 1AXIB 4EI5C 4B9GA 3H1KJ 1JXGA 1RZJC 5F1IB 2XIDA 4UZUA 5TGBA 3FUJA 1NBZB 3G5XA 4HT1H 1MCLA 2I9LB 2OP4H 4AQ8A 4FRWA 1AO7D 3H8NA 4M7LH 5DD3H 1Z9PA 4Q9BA 1B2WL 2F7PA 5GGSY 4F27A 2NNRA 1N64L 2GBVA 3U9PH 2R56L 1OTTD 2YC1B 3QG6B 4XMTA 1PD1A 1XL6A 1A02J 5CEYA 5JOFA 4KK6D 4L9LC 4P2OD 3G6DL 4JRXA 5IVOA 1I1YB 2G75A 2PRRA 1AXTH 4J8RA 1TETH 1EZVI 2YJLA 3K2KA 43C9B 1UZ6F 5CBOA 1RJLA 5AKRA 2YEQA 1KBPA 1KV7A 1DJYA 2AJ3A 1C5DA 2FD6H 4K7PX 4WEBH 3R2PA 4ZMOA 3CN1A 3T65B 1YPZB 1ZMYA 4ZKPA 4Z18A 1BAFH 3SYPA 2J59M 3F7VB 3S35L 1HK6A 4IU3A 4PLNC 4ICXA 1LILA 4X5XB 2JXMA 1E4KA 4P5RA 3FQUB 4GQPH 3ZL4L 4B9YA 2V37A 3Q9QA 3FT4B 1FVDA 4JPZB 3VI3E 1JNNH 5MP6H 3CBKB 3FB6B 4YDJA 5EU3B 1KGIA 5BVPL 5ACMA 1RH5B 1IT9H 4HIXH 4JFOA 1NTDA 2CO6B 2EUWA 1UB5A 3TBYA 4YHIB 5TISE 2GEQA 2IDCA 2VZ3A 3BRGC 4AUWA 1DE4B 5FA3B 3MYJA 4PJ7B 5BRZE 2D9CA 4L4VB 4D6TE 4HCGA 4GRLD 4FQ2H 4KDVA 4PVLA 4OZ4A 1IGML 2ENYA 5JHLA 3PXHA 4BFOA 3VCLB 1A6UL 3P8CD 4NLHA 3KPQA 4G8IA 5FYJD 3AEBC 4ZNCD 1XGRA 1G9HA 1SQVK 3BQUC 3QNFA 4HLZH 5IROC 1KFMA 2OULB 4NSKA 3ROLB 3CU1A 4JFFA 4AIOA 3IFOA 4O9BA 3L4VA 3WD5H 4E9LA 4MDIA 3EYOA 7TAAA 2AXGB 4K7PH 1FZBA 3BIKB 1CI3M 4XNQA 4GPVA 1G0YR 1HAWA 4N78E 1NAML 1ZVNA 1BZ7A 1M1XA 4K15A 3T3PB 1EHXA 4P2RE 3CFEB 1USQA 3QZPA 5A1AA 4B0MM 3WTYA 1KF9B 3BXNA 1QRNB 1A7RH 5HYSG 3VSQA 4BFBD 2APFA 2NR6C 2GEEA 4N8UA 3X1BA 4Y1AD 2N0KA 3E9UA 3IAGC 3GXPA 5DXWA 5FYLH 4JFED 3CFKB 4NQEA 2BIIA 1YN6A 1BM7A 1J8HA 4ASWA 5HGAA 2OFQA 2FSEA 2YGNA 3D39A 1P7KB 4NJAH 4OY9A 1GZHA 1SEBB 4R9HA 5E9DB 1XSOA 2G2PA 4GMSH 3WY1A 4GS7B 4JANB 1X7QA 1S7TA 3PUCA 3GMOA 5F9OH 3MLPA 2EIEA 5HBBA 1NPUA 5L2JB 3V5KA 1OAUL 4ZAKC 5AZEH 2BFGA 4GODA 1YY9D 5C0NC 1CD0A 1GMIA 2PTTB 2W95A 1KILB 3LXUX 3O6KL 1CXKA 3ZZQA 3SJVE 4X9HA 2QJKB 5DMGC 4A2DA 1CBVL 1HC1A 4JKKA 3BVNB 5IF0A 1EJOH 4UNTA 1Q72H 5CP3A 5DQJB 1I3RB 3RWEB 1BIIB 3DC0A 3BRDA 1J5OH 4ABQA 2ENJA 1KYOE 1NH4A 4JKPL 4PRBB 4QHNB 3DDFA 1E2VA 5HJBA 3RWIA 1ACYL 3NJXA 4G72B 3FO2A 4R0LA 1KN4L 1JPGB 1Q1JH 3TM6A 1PLGH 4H0LB 1MCNA 3Q6FB 3L5WA 4LLQB 2X1XR 4N3TA 3M8OH 4P04A 3AY4C 2DTMH 3ZTNL 3I02A 5HD8D 3T3PE 3O41B 3QZNA 3HFFA 4K71B 4DW2L 4OGYL 1OP5K 2Z35B 1T1YB 1S78C 2GBTA 5IMOB 4AGNA 5FYLD 5GRVL 2COQA 2FX9L 2YR3A 1CURA 1KLUB 4YSQA 2NUPB 1RP8A 2CM5A 4CL7A 1NFKA 3DGGB 1NGXA 3IJYB 1R6VA 3HZKA 2VLKD 2FH8A 4OF7A 2QPUA 1NGXB 4IL6H 4Z1MH 1MQKH 3TDKA 2EH7L 1XGRB 4ONHB 2H8PA 3ARVA 4PD4D 2DICA 1SYSB 1Z3GH 5KLIB 5HGHB 4BELD 1CJYA 4XN7A 4PVMA 1EGJH 3DX6B 2LAAA 3ZKXC 1GW3A 4FHKA 3KW7A 4P3DA 3GSWA 4Y2OA 3N42B 5HDOA 5DZ9A 4RAVB 5DO8A 1H3XA 4R7DB 1URQC 4YE0A 2WUCH 2PP6A 4Y5YB 5L2KE 4AC4A 1B4RA 1OAKL 1DD3A 4GBXA 1CDJA 3O2DA 3SDAC 4YX2L 4JDZA 4CSZA 4Z23A 1TYEB 4N0YL 3GDBA 1M2OA 5KVEL 5LN8A 1JJUA 5ISZE 3QWRD 2NYYD 1XIWA 3BJLA 3OKNB 5CAYB 1UWEH 3S9DB 2YHGA 4ENZA 1VIWA 1RPKA 4JFDE 3NZSA 4KGLA 4F5CA 1S7VA 1FN4B 2CJUH 3VFRB 4I1PA 4OH2A 1RAMA 3ZDMA 4W9LC 3EYSH 5CEZE 3GMPA 3UTTD 4N87A 5FUCC 4TKWA 3BWAB 2A6DA 3A67L 1XV8A 2R23B 2TSBA 3DWTA 1ED3A 2D7MA 3PHOA 5BMFL 2UZIL 3GZPA 4GNKB 4CJ0A 2DI7A 3FQWB 5BRZA 4XGZB 3ZQWA 2ZYSA 1P4IH 1JHLH 4K2UH 2X44D 1Z5YD 5JOEA 4W6YB 4W68A 1TU2A 4ANWA 2WO2B 2KDGA 2KC0A 4IEFA 3H9SE 3DO7A 1ES0B 1JGDB 1RQ5A 5DFTA 1NGYA 4LLYA 4EIGB 4IL6E 2OCJA 3HHMA 1X5GA 5LQBH 2Z1PA 3QULA 1IGYB 2CDFB 1T04A 4PJXE 1EEZA 1TYJA 4YDZA 4TUJA 3UJIH 2UZYA 4AGOA 3G6JA 4AYFA 3RK3D 1DJIA 2X9WA 3ARGA 3MV7A 3SIKA 4GXUM 4JFFE 1GIGH 5LQBL 1HZHH 2VMJA 5E6UB 2Q3AA 1PF3A 1T0NB 1G0DA 2KKQA 4U1IB 5EOTB 1FFTB 4P2RB 2IALB 4TYUA 3PP5A 4BH7B 1U7MA 5HYQB 1WYJA 3ARRA 3F6LA 2EYTB 4LOUC 1N73B 2FE0A 1IFMA 3U7WL 5K9QI 1OXYA 4JQVA 3N7NA 2K88A 5JMRA 3OHMB 1FDMA 4FMFA 3VU1A 4Z7UA 3V79C 3U6XA 3CX5K 1HH9B 2OMZA 4DKFL 4TV3A 1BGYG 2CJ3A 4OLVH 1KV3A 1EX0A 3E8UL 3HC4H 3IMVA 2A0LD 1FFNB 4MD0B 3GHGA 5ALCL 5BV7L 5GS0D 4N26A 3QUXB 3UDWA 2CUAA 1FORH 3KVDD 4P4KD 4P2CG 2UWEB 3K2UH 2R2HA 3UAFA 1HHJA 1KQGB 5SWZA 5JHDB 5FA4A 1X5MA 4ZFZA 4CC4C 4TLUA 4TQEH 3F05A 1KIQB 3TVMD 3HUSA 3P7KA 1DCLA 1WTLA 1NAMA 5DHVA 1FGNH 5I73B 3IWUA 2D7PA 1DQIA 4EDXA 1URLA 3VMXA 2ZJSH 4K3JL 3MRRB 4KK8C 4M5ZH 4NQDA 4X7TB 4ODUA 3H7BB 2F54E 1Z6JT 3OQRA 4MZ3A 5ESAA 4PWEA 5GS2D 1TSRA 1REIA 4D7BA 1FLRH 2E3VA 1T0MB 2A3TA 1NOAA 1QFUH 2ICES 4R4NC 1BJ1H 4XVUC 4M29A 5JPMA 1A5FL 5LGJA 3KBHE 1A4BA 4X5XA 3MDJA 3J07A 2BHYA 2XJLA 4B97A 2AI0L 3VRLE 1MEXL 1OW8A 3PJSA 3VSVA 5KTBA 2ODHA 4ZMYA 4MVBD 5F7FA 3DOHA 3M0DA 3S8FB 1T4KB 2WLZA 1MPAH 3KGRA 4PGDA 4R5XA 4U6HA 1UURA 5CCHD 4DH2A 3PABB 4QGTA 2WPRA 1ANUA 5FS5A 1NINA 5E5UB 1IQDB 4ORZC 4NAQA 1WAAF 2GITB 2ZG1A 1HAUA 3HHRB 3L7FB 3NIGB 1NUGA 1X8YA 5C0BE 2AJVL 1L0PA 4RSYA 4AW7A 3LAFA 1L4AA 3AS1A 4XRCB 3RFRA 4TNVF 5L2KB 1XH1A 3MROB 3W56A 2E59A 4ZOEA 3SBWC 4EMZA 1C16B 4PRNB 3H1KE 4WNJA 1BXVA 2DYSB 1NKNA 2A4CA 4UB6H 3GMLB 3TIEA 2Y9ZA 3G7TA 5F88B 3MV9E 2NY4D 1N0LB 3CVHL 3TN0A 2XN2A 1YJNP 4APQC 2H47C 3QQDA 4IGBA 5I8CA 3G71P 1D6VL 3UPRA 3BCCJ 3C5ZD 5HYSA 1JNHA 2FIKB 1FFPB 3M88A 4X6EB 4AT6B 2YKOA 3L1OL 4APXA 4JFDD 1B4JL 1XR9B 5ITFA 4AH2A 2VXTL 1U3HC 2DWDA 3GSQB 1PCSA 2EZ0C 3UXFA 1FIGH 4YFDB 4HD5A 3C60B 3IU3B 3KLLA 4HIEB 3MRMA 1SBSH 3GSQA 3KGUA 1K8IA 4UV7L 5HGGS 1B88A 1NTKK 3MV11 4PJEF 5F0LB 2KQNA 2EIBA 4Y5YC 4X80L 5GIRA 5HVHC 1JY3N 3JTSB 3V4PA 3I50H 1N7SA 3MTXA 3FFDA 1R46A 1OQOA 1I31A 4GO8A 1R0AL 3WU1A 1MLBB 5CILH 3OPZH 1D7MA 4X80H 1BQLH 2HA1A 4MMYB 5KJ7A 3EOAA 4LAJH 5FV1L 2CK0L 1KB5L 3L73J 4WWKB 1CT8B 5CILL 1KDIA 1ML0A 3OLEA 1I7TB 5DYFA 2QVIA 4RJTA 4FZEH 4DTGL 2VSKB 4UT9H 1QACA 3APDA 4DGIH 3ES6B 4ZMVA 1B0IA 1JPTL 2X7LA 3FH7A 3OSKA 4IDLA 4B53A 1W2EA 4UTAL 4RWYH 2CO4A 1NPNA 5E5LA 1LP9E 4PGDB 2Y6SC 3GRWA 1I8KB 1ICTA 4K5OA 4AKQA 4W9DC 3U4BH 5BVJA 1NUDA 1BMWA 2WD0A 3DUSA 3FW6A 3AG4B 4I89A 2YD0A 4TVPH 4HOMA 2NNAB 4E42A 3EFFB 1IC5L 3VFUB 1CLVA 5B3NA 1MCOH 3HKZA 3RWHA 3FT2B 5IFJB 5IHLB 1X9QA 1FH2A 3O3EA 4D0DB 2CO1A 3QJRB 3ZKQD 2R9HC 5J4MA 3NFSH 4FADA 4IOSD 2H26B 2OS7A 4X7CC 2J72A 2IH1B 1RUQH 1IC7H 2F19L 3E3QE 4NQDB 1OLZA 2NW3A 3GHGC 1FG2B 4WWKA 1LWUB 3KBFA 3GEFA 2OR9L 3D0VB 1SQBK 1MCHA 2WSFJ 2R0WH 3EJZC 3O4LD 5C0CE 3TURA 1ZIBA 3H1HD 4M3LA 4PS8A 5M95B 3NGBC 5C7ZA 2Y2TA 4HS6B 2WUBL 3V5HA 1GZQB 5F7YC 5TFSL 3P30L 3PJNA 5A16A 4LSSL 4AMXA 1DJHA 3VRJB 1KN7A 1TZHB 2NY1D 4NB7A 1JCVA 2O6DA 1N7MH 2ZP9A 1RPQA 3C60D 3MNVA 4LSTH 4MDRA 3S96A 5ITBH 3O81A 4G7RB 1XAUA 1CWVA 2DLIA 5CCKL 4DEPB 1TIUA 2JWYA 1FZEA 2GUYA 2IQAB 3GUTB 4GG6B 1WS7A 5APSA 4LSTL 3TF5A 1YJWP 1YO4A 3ABMB 3TFKC 1OSPL 2AGJH 2DQEH 4GKZB 2A77H 3B8SA 2GI0A 3WG7B 1JZDC 4NM4H 3K6SA 5IB1A 2VCOA 3V0WH 1S9VB 3WEXB 3P4MA 1NTMG 3NFNA 1WGVA 3MV8B 2QG4A 4GRWF 3M0DC 4M5TA 3NP4A 1IJ9A 3BZFB 1G0XA 1ZT4B 2JP3A 3ERXA 3OZLA 4AYFB 2YNYA 1GGIL 2I1KA 3BGMB 4YSUA 4UM9D 2OQJA 3HPLB 2ADYA 3GFUA 3VMOA 1AR1D 3P4LA 1A64A 2DJSA 4LFHD 4M61A 3VGGA 4LLYB 5JHAA 1HZLA 1CO1A 2IPTL 4HWUA 1A1NB 2SPZA 4X5WB 5GSVB 5CJQH 5EORH 3OAWA 1WZ1L 3K74B 4LVOC 1NM9A 3BPCB 1U2CA 4JM0A 1NGWA 4LPXA 1U8IA 2X0WA 3TN0C 2W6JH 3VWJD 1O9ZA 1H8NA 1JXDA 4JE4B 5IB3B 3FZUC 3UC0H 2A6DB 1IGCH 1N4XL 1VZHA 3CMGA 1JCDA 5I9QB 5I1CH 1DVUA 4OAWB 1M7DB 2DKSA 2BW5A 3IRCA 4GAGL 4U49A 4XVUD 4YGAB 1OO2A 4H7VA 1CFBA 3EGDA 2HFGH 2I7OA 1KBWA 4OGQD 1VZGA 2W90A 4DVRL 3T2NL 3QAZB 3OA7A 4A7UA 1WFMA 3WN5B 3MYZA 5EO1B 2WINB 5D9SA 1ZWIB 4BFIB 3QZWB 1IJDB 4Y4KA 1A7OH 2DLEA 1ZTMA 3LKRA 1O7SA 3C6LB 2IFMA 4DVRH 4F2MB 1GCYA 3SO3B 4WHTA 1Q1PA 1ZOXA 1IKNA 1OWWA 1WK0A 3GS4A 4R7DA 1J11A 4TM9A 1OOWA 2CD0A 4JFFD 2NY1B 5E23A 4J6IA 3D69A 5JORB 2R39A 4DUVA 4N8CH 3TGUE 1HGZA 2AXCA 1RF1A 5DZOA 1M1JA 1M4KA 1OVZA 3MXWH 1SVZA 3CC5B 3SDYL 1FOSF 2P5PA 3DX8A 3U2SB 5EF1A 3CFDB 1QI3A 5D6CB 1FH5L 2VIRA 4V11A 3SDYH 5CHNA 2YMOA 1RXLA 4YFLF 5AG8A 2WIMA 4CSTA 4PUBL 3L4UA 1QVOA 4G80A 2FK9A 5GGVL 5C0AA 4U2ZA 3FC8A 4L9LB 3VXRE 1HWHB 1PY4A 1CFTA 1DVSA 2VW6A 3O11B 5KAFE 4AEIL 2A73B 3FHQA 1AXTL 4JYCA 1KIUB 2JI3A 1FAIH 4ABWA 4NZ8A 3G6JB 3D4ZA 1ETJA 1IGJA 2WANA 4DF9A 4XPHH 1QBLL 1TKWA 2F68X 4QXGL 3TL5A 2D31A 1HHKA 5GSRA 1U58A 1N0XH 3N1FC 3ZKMC 4ENED 2WMPA 1AGEA 3EFOB 4QRRA 3R19A 4Q89A 1IAOA 4QXGH 1HWTC 1AHMA 3MLTB 1E7VA 4PRAB 4NM8L 2Q20A 2B2XH 4NAMA 2EEDA 3F7KA 1KZQA 5E1GA 1HXKA 4I0KA 3N1GC 3WN5C 2K4WA 2APBA 1MNUH 2X9ZA 4RRPA 4AV4A 4QRUA 1QSVA 5B1JC 4ZX5A 1VB9A 1LHZA 4J4PD 2R1XA 3HRZC 1SMDA 3P2BA 4KKBD 4MJIB 5ADOL 1BQHG 1JFHA 4ZO7A 5BQ7B 1NCBH 1VPOH 3CXHD 4GBXB 3KPPA 2XWDA 4PJ9D 4AIXA 4MA8H 3ZDZE 2X2YA 4NIKB 4YC2C 1BM3L 4IGBD 1ZV9A 2WZPA 1JGVH 1KILE 3QUXC 4GSUA 4PWFA 3KLAB 3L2NA 1A9BB 2NW3B 3KPRA 2E6QA 3CPLA 3FTUA 2A9ML 4NEHB 2VMEA 4JY5H 1C8PA 1OIOA 2WQYC 4E41B 5DJAA 4ZS7H 2EECA 1JI2A 4OVNF 4DNLA 5KBNC 4LRNL 5HYFA 2WXMA 2VAJA 2E4FA 3QQ9C 4TULH 5HHOD 4PJHF 3SWFA 4XNQB 4YO0B 1TQVA 3VXOA 1VADA 4J1UA 5JA9A 2ZT9C 4C58B 5DEGA 3PREA 4G59C 4PH8A 1INDL 5KG9B 3CX5J 4YXLH 4TULL 5JOPE 1TFPA 3LKNB 1QNZL 3OJAB 4HSAC 5KYXB 5FCUL 1A4KB 1SLVA 3ZYIA 3GBLA 4BDVB 1GKEA 3MUGA 3SWKA 1YJDL 1N3NB 1A2YB 2ITCA 3MFFB 4NWTH 4RGND 1KT2A 4XAWH 1G9NC 1ZLUH 2ARWA 1H5BA 2ICWI 2IIJA 5FYLL 3NFQA 4DEPC 4NWTL 1RZKL 5AOLA 4UQIM 1KB3A 1DE4A 4JY4B 4U1LB 1MZ9A 3FSAA 2BVOA 4OZHB 3VGAC 4HJSA 1A9VA 4XXCC 3ULAB 5BW7C 2E42A 5E00B 1ZRTD 1OAJA 4PTTA 5E7BA 2EDLA 2ZPKL 2Q6WA 1EXHA 5HDBE 2BEZF 2CZNA 1ACZA 2X9YA 2FXPA 1WT6A 3B71A 1M3JA 4N2BA 4YHYC 3L70G 1KBBA 5TE7H 3ECQA 1CBVH 2DL9A 1L7TH 2DDQL 2IAMD 4BXLA 2I07B 3KLDA 4OQ1A 3KWTA 2C8NA 2VKWA 3OKLB 5GS2H 5KSBF 2YD3A 3VXMB 3F7VA 2DWDB 4AENA 3RK2B 2ZKMX 4JKPH 4HJTA 4OM0L 4IRSA 3KPTA 4LMQI 3R0NA 1EZVG 2UYLB 2VUYA 4PB0H 4OJCA 1SQQD 4R83A 4KTGA 2VABB 5FFLA 4EIUA 2W6BA 3RWCB 1R3LA 3WE1A 5FLVA 4H2CA 1G1KA 2YAMA 2E7LA 1A6PA 3FFCD 1R3KA 2H6PB 5EWIL 2EXYD 3M07A 4OFQA 2WAQA 2Q8AL 4H13C 2Z8WC 1OF2A 3BMVA 4FEMA 4H40A 2CHWA 5B1AB 3PGDB 4NRYB 3TIDA 3LQAC 3EFDH 4CBZA 3GHBL 3C9NA 2C4FT 1TT6A 2DM7A 4AW4A 2XZAH 4PJ5D 3GXTA 4M8RA 3RIAF 2F2HA 1MQKL 5B39A 4EZMA 3VSTA 5IB4B 4N8VB 5E8OA 2EKJA 4LAQL 2XZAL 4R6UA 4XN8A 3CFNA 5DC0A 4ESKA 4M3HA 4F57H 3QFGA 1A7BA 4Y4HA 5TDNA 3SZKC 1MSPA 1AMYA 4DUWA 5ECGA 2AQTA 4IBTA 1YUHA 1UXSB 1N5AB 1Q9OB 1VPCA 1X4XA 4U4BA 5HVHB 3WNJA 1N7LA 3UJJH 4M1GL 4YDMA 2QQQA 3HAEB 1T3JA 4HJJH 4KFZC 5APXA 2OTWB 2O5YH 2RGSA 5HHMB 1AVOA 1DJXA 1Z32X 1LWHA 1AQHA 3QR0A 4CVZA 4D0BA 3B9VA 4RGNC 1L0LD 1P53A 4DPRA 2Z93B 4X7TA 2O5YL 5IEHB 3D85A 3BP5A 3UBXI 2XETA 1WITA 3HI1B 4M9PA 3UGUA 2XV5A 1KMGA 2LE9A 2ROXA 5DS2A 5IUSA 2BSSB 1AACA 2QJKC 2QTVA 4U1HA 3DK2A 1PCXA 1FAVA 4JZOA 1GMJA 1T0PB 4NFBA 3MREA 3PQYB 4Y1AE 1OGAD 5A7BA 2X4PB 2AK4A 5GZOC 1CS6A 4PBWD 1HL9A 3QUXA 1B9KA 1HINH 2P8PB 5BOPA 3FQUA 1JB0J 1KEML 4JQIL 3DPBA 3MNWB 1MW2A 2OW6A 4ZT1A 4JS7A 1XZ0A 3MRBB 3HG5A 4AQEB 4DQOL 1X9UA 1ZAGA 2HRGA 2BNUB 5CCGE 2BCCJ 1N8ZA 4K35A 3CFQA 4Z7UB 1YYCA 3L74G 3P11H 1F4WH 1GGBL 3KZIH 1K9TA 3AS0A 4Y1TA 2Y0DA 3QO0A 2ADGB 5SWSD 1HUCA 5DQ9B 5BO1H 3H1KD 2MQ0A 3LIDA 4OZIA 3RNQA 4K9EL 2HLOA 3MPCA 1EZVX 2ZYIA 4YAQA 5AVWB 4Z7OF 3PNWA 2VW4A 3KDPB 2DIEA 3C09C 4LLVB 5EU4A 4BH8A 5C0BD 3PGDA 3G6EP 1MRDL 5GRUH 3SE6A 2K7PA 3EJZD 2NY7H 4HVBA 2YO3A 1OGSA 3L70E 4Y88A 1SOSA 1I8MA 4D6TD 5KANG 1FHNA 5JIQA 3QI9B 3C6EA 1UWYA 3K71A 3CCEP 1JRHI 1F3JA 3O2VL 4H1LH 2CGRH 3BQUB 4OLVL 1JMBA 3P4NA 1PIXA 4FFWC 4J6RL 5DJYA 4L3EA 3AC0A 1GAFH 3F83A 4WGKA 5DK2B 4AL8H 1EO7A 3L3KB 2D9QB 4D9LH 3ELQA 1FORL 3LKSA 3P3SA 1TU3F 2D4FA 3BWAA 2JJSA 4G7SB 1NLBL 5D4JA 1DDTA 5LWYH 1T20B 4MMXC 1WFNA 4MBOA 4MMZB 4W80A 4BK5A 1XMEB 2JMRA 4WUKH 5FPIA 2FJFB 1RUPH 3GZQA 1BV8A 1L0LG 4L75A 4HIIB 1QBAA 3MA9L 4Z3TA 2ESVE 3MCKB 4U0QB 2FBJL 4DP8X 4UTBA 3JXAA 4PCTA 2YD4A 3L75E 3SWYA 3NEXA 4WI8A 1ZSDB 4IJ3C 3TH4T 1H6FA 3S5LB 3OGCB 1U8NB 2ZXGA 3QCUH 3PQYD 1TKWB 4PBVC 1FSKC 3DHJA 3V6OA 5IBLD 3IDIA 1TLMA 1OHQA 1M1SA 1IAII 1ZDSA 4UBDC 1R34A 4PG9A 4XPBL 1CIUA 4Z6AT 2WWKO 3E7KA 5K9KB 3DMMB 3UO1H 4G43A 1NBYA 3HJEA 3GUFA 5AB1A 3HE6D 2EDHA 1OT2A 2GIYA 2GK0A 5KVGH 4WV1C 1QLFA 3ILPA 2LW3A 1GYVA 4YSDA 2NY3C 2Q1KA 1OZHA 3OAKA 4EIJA 1XSJA 5KYXA 5D6DA 4YH6A 2CBTA 4BA0A 3QJHA 3QQ9D 1CDCA 3DIFB 3C8VA 4JAMB 4FNQA 5E5RB 4N3YB 3D2UB 1TENA 2YUVA 3GMRB 5IJDC 2WKLA 4WSJA 1DHKA 1RULH 5HGBA 4I1LA 1XQ4A 2DMHA 3NIGE 5HVGB 5C0BB 3UG4A 2DM3A 4DUXA 1AVAA 5T1DL 4U05A 4PYGA 3EYFA 4WJG3 4P46B 4KO6A 4KTDH 4WIQA 3QUKB 4FOMA 1SP4A 3FMGL 1VQLP 1R17A 3IDXH 2R4RL 4BUHA 1J05B 3EJQA 1A6ZA 4DHLA 5L9DH 3HZVB 1G7MA 2Q9IA 4HUWA 2AQNA 1PLBA 4OCYH 1IT9L 1WUNT 2V2WB 4QXTB 2AXFB 3FMGH 3QIBC 5HHME 3S88H 1ZLSH 4LCVA 3U25A 5D7IE 5KYWA 4YZFF 1XTLA 4Y16B 5CEZL 2PWGA 1KIRA 1MFDH 3VFVA 2QE7H 5C07A 2BSTB 3FCBA 5IJKC 3ZKXB 2AEMA 5CJ0A 3U82B 4RRPM 4XPGH 4HEPA 4NOFA 3RPIB 3WLWD 3VXRA 4BEIA 3HBZA 5LGHL 5GS1B 2CK0H 4K7PY 1HOEA 2ZVNB 3IE4A 4GW1A 5D1XD 1RZFL 2CKBB 3ZHDA 2BVUA 2WXNA 1N9PA 1CIDA 3WD5L 2R1YB 3HKFA 3B3IB 1AIFB 9CGTA 5EU5B 1NIAA 3HE7B 2LHAA 3OC8A 4LLDA 8FABB 1KCKA 3ARBB 5HJDA 4XMKL 3VXSD 3HE7A 3SE3A 5EU5A 4RLDA 3NN8A 2YEZA 5IM7A 1J9CT 2IWKA 4Z7VE 1AGFA 1TJGL 2OMWB 1U8PB 4PGBA 3Q5OA 4LOVA 1NCAH 4JZJA 1E5BA 3GDCA 3ZE2B 1LTSC 1U3JA 1EDQA 2P5WE 3SQOH 2EXWD 3POHA 2XG5A 4ZO8A 5GS1A 4MDIB 3ZIYA 3FTWA 2BNRD 4FLSA 4FQ1L 5EN3A 4X9YA 4AVJA 2ZJSE 2HXAA 1XGTA 5C0EB 2ESVD 3FSWA 3QA3B 3AEAC 4JFDB 3T71A 4KGJA 3L72D 2YSSB 1Z2KA 1JTTA 3BP7A 4N9GA 3SKJL 5J12C 1H6TA 1AY1L 2EQDA 4M6OL 1KQLA 1FQ9C 2VL5A 2EXTA 4FLOA 1JUFA 1GZQA 3L7EA 5EH1A 4BXVA 5CD5D 1UKQA 1V8HA 2WC7A 3DSNA 3H9ZA 3MYJB 4KK9D 2QBWA 3IF4A 5TFSH 1XEDA 3SGDI 4YDKH 3D0AA 2BC4B 5JPNC 2DQHL 1J05A 1XIWC 4N86A 3NEEA 1G2CB 5AVRB 2XWRA 2ZX6A 4OCXL 2VDNH 4NPYB 4R5TA 5CCKH 5C9JA 4XP5H 2KZKA 4MN4C 3LRHA 3QDMA 4JHAL 1TZOA 4MAYA 5INCA 2G2RA 3TSIA 1DQJA 5D2NC 2D03L 2J73A 2VDNL 3EJUA 5KAQF 1F6AB 3NVQA 4N0FA 3SKOB 4NO0A 5I1IL 5LCVH 2DTML 1KTBA 3VFUA 3VQLA 4PIBA 5D4IA 4DZ8A 4OSUL 2A1WH 1AAJA 4UOZA 3I9IA 2CA3A 5IB3A 2XRAH 3OX8B 3CX2A 3GKWH 5F89A 1CDIA 5T5NF 5C70A 1N6QL 3R4DA 5IT2H 1PVHA 3RVXD 3N5AA 4PRHD 4KXCA 2X4RA 4MS8D 5IKCB 2XA8L 3ARBC 1D3CA 1PZAA 1Z5HA 3BP4A 1PX4A 2J6EL 4Z7QB 1A1NA 5GSVA 3HE7D 4I48A 5CZVL 5EOQH 1FC2D 1UWXH 2HVKB 5D1ZB 2YPVL 4M61B 5DUMH 3KZIE 1G6RH 1KBKA 1DVFC 4N78D 1KYAA 3VQ1C 1Z3GL 1ZA3A 3QZMA 3V52L 1MZZA 4XAKD 1WEJH 5D1XA 1OGTA 2GJ6A 1SXZA 2J1ZA 5IBTL 1BCCE 3MRPA 3V4PH 5DRXB 3V5BA 1NL0H 4DP4X 2Y5EA 4LPVA 5A2KH 1I85A 3TV3L 3NQKA 3UBFA 1KXQA 4E5XB 3QRFM 5JIHA 1NL0L 5B38B 4JJ5B 4EQ3A 2N4IA 4NNYA 2O4EA 3AADB 6TAAA 3FO1B 2VDNB 4DK6A 2OPCA 3IGAB 3BI9X 3NH7L 3C08L 1MRCL 4EYYQ 5GS3A 5CD5C 3O2WL 4F8NA 1N2DC 2R69A 1BA9A 4JFPB 3T0AA 4ZAKD 3TO2B 4L5FH 5CLXA 5JXED 2CKBH 4JRLA 3IJEA 4UQ2B 2BINA 4A7TA 3V0EA 4UIKH 4NFCA 1U3HB 1A6WL 3JV4A 2VLKA 1OPOA 2KNCB 3P9MB 3QQDB 3KVPA 2Q76A 4HS6A 3EO9H 2EDKA 2ZF9A 2F08A 3K46A 5PAZA 2M3BA 4J2XA 1NCWH 3O3AB 3OJDA 3NIDB 4P46C 1UVQA 3OKOB 4XX1G 1P4IL 1AQDA 5CU5A 3OKMA 5I1JH 3S5ZA 2GTWA 3DVIA 5BCAA 5HDQL 3WIAA 3X11B 3FDWA 5CU9A 2ZYGA 3FTXA 2PW1A 4LPWA 1N5YL 3L7FA 1SJXA 4HISA 3RWHB 2KSJA 1FYHB 2XFXA 4PUBH 3KR3H 4S11A 1GZLA 4U6HB 2Y9RT 4FYSA 4X5PA 4CSPA 4S1RL 2J5WA 3NCMA 4UNUA 4IKLA 3VFSB 2P48B 4QRRD 4JQXA 4DZBA 1N8ZB 4LSQH 1ZS2A 3TBTB 4QD2E 3VXRD 4E36A 1F41A 1NICA 3AE3C 3QQ4B 1HQ4A 4MQ7A 3V0HA 2AXHA 1FIEA 4I2XA 3T04D 2XTJB 4XAKE 3U7WH 2VR3A 1CFNB 5K9OA 2B87B 2HLFC 2XWBA 2X4PA 1FNGB 3D07A 5KZCD 1W72A 2DQJL 1XB3A 3LD8B 4LSUH 4N2DA 1TCMA 3VWKA 4XNXH 2R59A 4R97B 5I28A 4ZFOB 4QRQA 3VD3A 3S7GA 4C83A 3NZHH 4MSWA 3WFZA 4ODVL 2DY2A 3IVKA 4FP8H 1W6WA 4UV4L 4H8HA 3Q05A 2PO6A 1FGNL 2EABA 2LVCA 1NDMA 2PXYA 1QAWA 2VLLB 3HS8A 3QUZC 1FE8H 1QLEH 3VDBA 1E4WL 3HAEA 1OEZW 4JFPA 1BW8A 3B9DA 3QZWG 2OYIB 2MSPA 4HOXA 1PX8A 2XIIA 1KCVL 4IMLA 3L1GA 2UY6B 1BM3H 1MI5B 4ZMLA 5I5RA 1H3GA 2EYTA 2NXYB 3S36H 3SPJA 1SUHA 1QI5A 1TTBA 1IILE 2FAUA 3AMLA 3R4RA 3UPRB 3EHBD 2ARJB 2HG5D 3I85A 5TQ2H 3EO0B 2EVGA 3I2CL 4FTDA 3RIFK 4PP2A 1EHAA 4HH8A 4EI6A 3TLRA 2JDIH 2Z31D 4I3SH 1PPIA 8CGTA 4NRYA 2A83A 4NN7B 1EZVY 3BKYL 1RQUA 1JK8B 1W72H 4L8BA 5C6TH 1QRNE 2D2CB 1KJVA 3QJXA 4KFMA 5I8EA 5KBMA 5AZ2H 5KVFH 4YXHL 4Z0XB 3STLB 2ZUTA 1GVIA 2YD6A 4PG2A 3QIUB 1R3LB 1MY5A 2R27A 3S3BB 3X14A 1T4KA 2X2UA 1M05B 1O7DE 1LLAA 3VXRB 1NMCB 2B14A 1I9RL 1NTZG 3ZK0A 1BF8A 2R23A 5I6XB 3JUYA 3V0FA 3IDJB 4C55A 5J1SC 2GC4C 2F53D 3O3DA 3D1MC 3WY4A 1KWKA 3AG1B 4EUPA 3TU6A 1O7VA 4ETQA 5LGJB 3VD0A 1GJWA 3L1OH 3SE9L 1JVLA 2F5BL 3X17A 3HTKB 2QHLA 1X9VA 2O61B 3RWJB 1MFCH 3VXNB 1OKEA 1T66D 3H9SA 5HHXL 5FB8B 4PEEA 4PTTB 4TNFA 5IJVA 3O0LA 2V5RA 2Z92A 2QRXA 3CPUA 3LEYH 4XBMA 4LIQE 3VTTA 4PJ9B