5AW3B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 100 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw3B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw3B02
3NTNA 2KP8A 3B8EB 3V5BA 1FAVA 3HE5B 5AW2B 3P32A 2R32A 5AVVB 2WT7B 3O8ZA 5AW3B 1SLQA 5CMZA 3NFQA 2YNYA 4XE5B 5AVYB 3VYIA 3VMZA 3A7OA 4C7NA 1MV8A 1YYCA 5AVZB 2WTYA 2Z5HA 2R5BA 3OAKA 5AVSB 3VN0A 5AW5B 1CI6B 3HE4A 1JUNA 2XZRA 3T97A 2ZXEB 4I2LC 5AW8B 2R3CA 2P7JA 2Q5UA 4KHXA 5APXA 3P7KA 4JYBA 2H7HA 3HTKA 2BASA 3HE5A 5APVA 3SWFA 5APTA 2WT7A 2P2UA 2WPRA 3TK1A 3TNUB 1A02F 2IPPA 2YO2A 5AVRB 3I5CA 1CSBA 5APQA 5AVTB 1X8YA 4GKGA 4GT1A 5AW9B 3VTPC 4HYTB 5APYA 3M06A 3NMDA 3UIAA 3TYYA 1GTWA 2ZFCA 4AYCA 3P8MC 2N9BA 4JYCA 2P67A 4B86A 3M9HA 5APSA 2E43A 2W6AA 3L36A 3L35A 1FOSE 4C46A 5AW6B 1MUUA 2VRSA 1JNMA 1KQLA 1NWQA 1FOSF 5AW0B 5AW1B 4M3LA 1S9KD 1H89A 1G2CB 4AQRD 3A3YB 2XV5A 1HWTC 4AUWA 1T2KC 1MFZA 3IR9A 4I6MC 3LIEA 1CI6A 1GK6A 1J2JB 4RETB 2C9LY 4RESB 5AVQB 1SP4A 1GD2E 3KDPB 2QM7A 1GU5A 2Z5IA 2Q7CA 1A02J 3VMXA 3M0AA 2Q3IA 2QM8A 3KQGA 5APUA 1NAFA 4C7NB 4DZOA 1GU4A 1S9KE 3L37A 3LIDA 1HUCA 2WPQA 1GK4A 3M91A 2C9NY 3MGNA 4LC1A 5AVUB 5AW7B 2R5DA 1H88A 3M0DA 3A5TA 1GZLA 3M9BA 1HBWA 2XU6A 3HE4B 1OWAA 2WWWA 2E42A 1H8AA 3TNUA 1IO4A 4EOTA 3A2AA 5AW4B 3MD0A 2WPSA 3NXSA 1DH3A 2JJLA 5AVWB 2W27A 2YO3A 3WGVB 1OXZA 3WGUB 3V4QA 1HJBA 5AVXB 5APWA 3V4WA 1T2KD 1CZQA 3VMYA
chains in the Genus database with same CATH superfamily
4MSWA 1JGVH 2OQJB 4D8PA 3HKFA 5ENWB 1OARH 3VU2A 5E08L 3ULVE 4YDJA 1H3UA 5E8NB 4XE5B 1XGYL 5DS8B 5I8OL 3VWJD 4HXBH 2NNXA 3DUHA 3K46A 1P5VA 1BHGA 4JY5H 3V2AR 4AJ0A 1DEDA 2AVFA 4M3HA 3UYRH 4Y2OB 3T0EC 5D2LB 4GQ9H 3H0TB 3D18B 3FYEB 1ORSA 3L7FB 4N78D 1ZMYA 1INQA 4IYKA 3H1JJ 4EBQL 3B2XA 2HT2C 4PJ7B 3WKYA 4ZTOL 5HJDA 4GXUN 2LXCB 1J1EB 2F19H 2F54D 3H9SA 3V6FB 1U58B 1Z9SA 2BLFA 3ZDZF 4L0PB 1E8WA 1M7IB 2CIKA 1ODUA 3GS0A 1MJUL 1QSEA 4O02L 1EDJA 1LTIC 2AV7B 4NHCL 4PR5B 2FGWL 4P49A 4OM1H 1PIFA 2JE8A 4HAKA 1UM4L 3SGKA 1UTDA 4WK2B 2DQDH 1KPUA 4PJXA 1DQIA 4D8OA 4YLCA 5DMIL 3QIUD 2Y23A 1HHJB 4AE1A 3PWLA 1F18A 2BNUB 1UWEH 3CSYA 4ZMAT 2XDHA 5DZJA 3ALPA 2CKBB 5CBEA 1NH6A 1GOFA 1RIVL 1UIIA 1SEQH 3HPLB 5KAQF 5DD1H 1DLHA 2XWCA 3ISYA 4Y1AA 5FUOL 5EDXA 3LW5J 2P80A 2IAAC 3GK8L 4M6ML 4WWNA 4WSGA 2X4NB 3VXNA 1B2WL 3AB0B 4JG1H 4QYOB 2CPBA 1UZ6F 4I1LA 3BAIA 3L16A 5L4MA 1X5KA 1MCFA 5DEGA 2C3HA 3SDYL 2EICA 4P23D 5SWSB 4GY4A 3P0YH 2KHAA 3TBWA 2VUOA 2Y07L 2BVQA 3BZDA 4PJCB 2N0KA 1ZVYA 2JCCF 3P9LB 5JW4R 3GDBA 1DVYA 4X4MA 4J3OF 2XRAL 4DQOL 5K5GB 4PJ5D 4YHLL 1VCAA 1NIFA 5I16A 3PAYA 1L0LJ 1YPZF 1MHEA 1ZSDB 4TRPL 4YDVA 4ODUB 5I26A 1EZSA 3A0BH 5TE4H 3WENA 4Y5YC 1I1CA 4KV5E 1HL8A 3A21A 4LASL 2CNYA 3I2CH 3OB8A 5GRZA 5C08D 1N73B 2X1PA 1K4DB 1YRKA 5ISZD 2WXQA 2LV4A 2NYKA 3OTTA 4BK4A 4HKBA 5B5EH 5FOBB 5F89B 1JWUA 2FZ3B 5KLVD 4EUPA 5GS1B 4XP4L 4A7VA 1S5LX 3RTQA 2VLJE 3RX7A 1XF2B 4MQ7B 4OQTL 2BJML 5FKAA 4FQCH 2ZKHL 4JUTA 2ATPA 2FQDA 3ML9A 3QUXC 3U2SA 4LHJB 3DO7A 5IFAL 3VAEA 3WU2H 3U0TA 4K7FA 5AD0A 2VM9A 1N3NA 1TFPA 3MBXH 2OYLA 4XCCL 4NAJA 3T08A 1YNKL 2RQ8A 4N8UA 2ZYHA 4C83A 1D5XB 1KYOE 4G8IA 4LP4A 4PLJD 4ZO6A 1F2QA 5F0JB 4JNXA 4FOMA 4Z7NB 2AKRB 5C0AE 2LAAA 4YK4C 4CVWA 2L3BA 2P7JA 3G08B 1NIAA 3IDGB 3HHSA 2YGQA 3KPMB 2E76B 5BVPL 2Y24A 2OTUB 4F93B 5IKCA 3IMBA 4PG9A 3O4LB 4E42A 1HJBC 4OFQA 1OQXA 4KY2A 2O72A 3QQXA 4JN2A 2WC7A 4YE0A 3W82A 4N0YH 4F27A 4Z95L 5FX3A 3RIAK 2O6FA 3UZVA 3KWWA 4HCRA 2X87A 2VERA 4JCMA 5DS2A 4EMZA 4XI5D 5AOLA 4PRIA 3DBSA 1BLIA 4F15C 3ZQ9A 1E6OH 2J4WL 3TYYA 4N87A 4KTGA 4H44C 1FGNL 3AU1B 1IO4C 4OGXH 1G4MA 1OCZB 1JTPA 3ASWA 3H2PA 3UZEA 4Z78A 1TLMA 3NSCA 3MV8E 3B3BA 4XNYH 4PD4D 3JZYA 2GUOA 5BU5A 5EOCL 3A0OA 4JQXC 1NC4B 3FHEA 1UUSA 3L5WB 5C09D 2PO6D 4WFED 3DOIA 4HG4J 4LSTL 4UBDD 1FPTH 2X4QA 4K55A 1ANUA 3PL6A 4B5ZA 4GG8A 2EE6A 3C8KB 3MRCA 3UGXA 1OZTG 2HLFD 1NGXA 3R4RA 5DMYA 4U1IB 1CZ8L 4C58B 4NRZA 1OD9A 1RY7B 1KXTB 2IOIA 4R3SA 4DKFL 2RGSA 5MEND 3MJ7B 1RUKL 4B9GA 3AEEC 3SPGA 1L9PA 2WCPA 4L3AA 2A6JB 5GZOA 1T89A 3ETTA 3GMPA 3T04D 3FU3A 3BJLA 3KJ4C 1L7IL 3DMMC 2DLTA 4HUMB 1KGCD 3WNOA 1TCRB 2Z6FA 4XMPL 3RY6A 1XGTA 3C09C 5EBWA 4DP6X 5EBMA 1SF5A 1JPST 4O2FB 5KLVJ 4KTDH 1NTDA 4NJ9L 4OAWA 3STZA 3TYFB 1CIDA 4CDGC 1U8MA 1MEXH 1QPXA 1L5GB 3DX8A 2EIBA 4M7ZB 3KPSD 3UG5A 5GISH 3WGUB 3GT6A 1U8JA 2ZZUT 5F7WC 5DJ6B 2CRZA 3VA6A 4G7YL 2IIJA 3ROOA 3F12B 4PQXA 5HYFA 3F6JA 5E99L 3CUPA 3QI9D 1BZOA 2D8KA 3A0HE 1JERA 1WHPA 3ULUL 2E27L 5L2JB 2ICEC 2HKHH 1KEGL 4FXKB 5KUMA 3L74E 3V2PA 3GPEA 3K71B 1R5IB 1UFGA 2H2SC 1OLLA 1F11B 2FATH 2GK0B 4YBHA 1BBJB 4OI9A 5CCGA 1KCVL 3OWEA 4RZCA 2X0UA 5DGQA 4U4BA 3HBPA 4MCZB 4QRPA 1JG9A 4ZQKB 2FO1A 5CILH 3MXVL 2Y5TA 5DMGC 4OZIE 3IMWA 3RY5A 1GXEA 5KJ4A 5CZVL 1AXTL 4LHQB 4NAMA 5DHVA 5EIVA 4F8QA 5ACZA 3RVVD 3S88H 3HZ3A 2R0ZH 4HIIB 3LNDA 4K5LA 4Z7VA 4XB8A 2JK5A 2OMUB 1CGVA 1CTMA 1PZDA 3ZMEA 3VRJB 1OIPA 4AIOA 2A1WH 5BZDA 3EYFA 4H20H 3GBML 2QADB 3UAJA 4NWUL 1G1OA 3AQDA 2ZOWA 1AO7E 1GHFH 1IC5H 3H1JG 2YSSA 3EJQA 4RGNB 1TTBA 3QIBB 1E9PB 2V2WB 4C4KO 5DT1L 1TJIL 4WHTB 2V2XB 3EH5B 3L3IA 3SY0A 1TIUA 4KJQD 4QRSB 3SJVD 3FOMB 2Q8AH 2AK1H 1G6RL 1JN6A 4KI5F 3D51A 2A6DA 2F1EA 4OTXH 3G6DL 1HI6A 2WBJA 5JNYA 1T1YB 1XSKA 5TPWH 5I73C 1URQD 3KVDD 1IM9D 2R9HD 4JKNA 4PTTA 4ZX6A 1MUUA 3TX4A 3KS0J 2DF3A 3L3KB 4X5XB 1JFQL 4DKEH 1GZQA 1TQCC 2VDML 1PCSA 4AMKL 5DVMA 5DVLA 1EZVI 1CVSC 4W68A 1IBYA 2X6MA 4GBXD 4EZLA 3D69B 3UBXG 2HUEA 5E2TL 4LCWD 5GZNC 4OZFA 3IXTA 4IQHA 1ZOYC 2V9QA 3SKUD 3VWKB 1BM7A 3F7YA 4PG2C 2NXZB 4DZBA 1E65A 1N0LB 2VIRB 2WVSA 1O9WA 1TZOA 4QOKA 4IL6H 5DLML 3VFWB 2Q3IA 2QQKH 4EVNB 4EEEA 1AR1C 2PW1B 1NAFA 1KBKA 2A6IA 2PCFB 3ILPA 5D1ZI 1JMBA 4G6KH 2HFGH 3AG1B 3OJDB 1FH5H 4APXB 5I1LB 3VFOA 1A1OB 3MRBA 4PRDA 1KB9E 5AW7B 3GUTA 3KBHE 3AG4B 1IAIH 1WGVA 2P8LB 1J8KA 2FD6H 2VC2L 4LCUA 4Y5XA 1IGTA 4PJ9D 1OKEA 2LU4A 4HC1H 4N68A 1EXIA 3FSVA 4ZMQA 2WUBL 2DYSB 4ZUVA 1PGPA 1ACXA 2NRGA 1FL5B 4MNQB 1CR9L 3PGCB 1M42A 4G5ZL 3V4QA 3ZY7A 4H0HB 2DYPD 2CLZA 5JPNC 2R1WA 1L0LG 1IM3B 1EZLA 3TO2A 1UB5A 3OHMB 4NQDE 1A6WH 1ZV2A 1UT1A 4PRBB 1SJXA 1OALA 2C9SA 5EUOB 5EV7A 4JAMA 3SDDA 4XPAH 3ZL2A 7PCYA 1DBKL 4UT6A 6TAAA 3BZFA 1RZKC 2WYHA 1PMYA 3IDNA 2NW3A 4G1MB 3BVUA 2OR9L 3K0YA 3FOLA 1ETA1 4Z7WE 4D7PA 3BRVB 3NJXA 4K3GA 4BUHA 1RURL 1XO8A 4Q9BA 5I66A 3HFFA 2VN3A 5TDOA 1HQRB 1HXMB 1L3NA 1YDPB 4EXKA 2WNXA 2X38A 2O1JA 1N8ZB 2BDNL 4YSPA 3K8LA 1ZVHA 4PV8A 5KTEL 2BZ7A 1U8IB 5G4NA 1CLZH 4NO2B 5BCAA 4WJ5A 1VGEL 4ALAL 3F89A 3KBFA 2EDDA 1JNLL 1S7XB 2BXZA 2NY0B 1TU2B 2J1WA 4KRPB 4MN4C 3I6GA 5D7JB 4ZXBD 5L4IA 1OB0A 1TETH 1GL2D 1J8HD 5HDOA 3RKPA 3ZDXB 4I5BA 4Z7OE 3LZQA 4XP9H 1R24B 3NEOA 3NH7L 1NCTA 1O6TA 3RB5A 2MOGA 3ZW3A 2AJZA 4R7VA 4Y4FC 1LT9B 3OKMA 4PD4H 3M46A 2ZOLA 5GRUL 5D55A 2QDVA 3CXHI 2Y6SD 3L9RA 1JF6A 4M8QA 1EGJH 3UTSD 3Q48A 3IU3B 4KH9A 5DQ9B 4HT1L 2OAAA 2MKVA 5JO5B 3KS0H 3DSNB 1E42A 3II6A 3G7TA 3CPWO 3GHEL 4MMZA 4N1EA 4QRAA 5T5FH 2IFFL 3NIGB 1Q1JL 4QXWA 1CFNA 1G1IA 1R19A 3JWOC 4G9DA 1L9RA 2XN0A 4XPGL 1BOGA 2JI3A 5SX4H 4IHBA 4EPSA 5JHAA 1W8OA 4MD5A 2R1YB 3UFIA 5GSRB 5CD5D 1BVNT 4K9EC 1VESA 3SGJA 3SGKC 2X4UA 1J7VR 3BE1H 1CI6A 3NJVA 3JTSA 4RETB 1MFAL 2HVJB 1HEHC 3VI4B 3QS3A 3P77B 4ANKA 3GXDA 5FYKH 3DO4A 1OFCX 4W6XB 5KANG 3KLHD 2JJUA 1HEJC 3GSNL 1PX4A 4FAAB 2WQAA 4X5WB 1LQSR 1AVAA 4B9KC 2WPQA 2VLLA 1RZGA 4U1KA 2D0FA 1HXYA 3DIDA 4I7ZC 1TQBB 1EHNA 2H26A 5DHEA 1AGBB 4OVVA 4KT0J 3VQ2C 4BKLA 3GIZL 2QZ5A 2NY2D 4P8QA 1BW8A 1RE3A 3DX3A 1EEYB 3U7YH 1KPVB 2DM7A 1LTJB 4NNXA 2R2HB 5I1AB 2AABL 3V7AG 3BJ91 4NKOA 4NQVB 1YNLH 3TBSB 2CIIA 1T8ZA 2OYIB 3GS4A 3ETSA 1RMFH 1A7BA 2Q6WA 4XN9A 3S36L 3ARYA 4NO3B 3TS8A 3SKNB 3LHAA 1NWPA 3BWAB 1FLRH 2F53D 4PW3A 1AGEA 4PJDA 5KLVG 1E2VA 2F0CA 2Y0DA 1PCXA 3QIWC 1IFMA 4HWZA 4K8RD 4W70A 4GPVA 4GW5A 5E1HB 5CAYB 4H0IA 4ICWA 2F5AH 3WN5B 3KPNB 1DVTA 1QRNE 2Y69B 2PP9A 1CXHA 4QHLB 5JHDE 3L5IA 1JGIA 1VACA 4N6RB 4C55A 1P84K 2DQCH 3WIHL 4ES8A 3OD3A 2JKRM 4H4NA 3JVGA 3VG0H 1QHOA 2AJXL 2V6HA 2WNWA 3AWGA 3ZTNL 4FYTA 2UZYB 4P2QA 5H94A 3L1OH 2W59A 3RWDB 1KUMA 3FTGA 3O0LA 4N5UA 4CN1A 1NCBH 5EFIB 5IWLA 1DEEA 1QKZH 4X5RA 3CX5K 1MJ8H 4MAYA 4OSUL 2ESVB 2GJZB 1RZKL 4NZUL 3RTQC 3NPSB 3UPAA 1Q72L 4ADGA 4ZNEE 1KYAA 5HHQB 4JG0H 1NCJA 4S1SH 3K3QA 3V4VH 1N7SA 3DSFL 1S7SA 3T2NL 2HRPH 2X4OA 4KVPA 3R7QA 1RF1B 2OX5A 2V3FA 3AE3C 1MF2H 2PPDA 4XAKD 3V6IA 4EUPG 1HT6A 1KCRL 1QSFB 1UASA 1FDOA 4QLRA 1OSEA 1PJWA 3NA9H 1YVLA 4MXWL 2WUCH 4WKXA 5E8PB 4ABWA 1IX2A 2JKTM 5I18H 3P4LA 4TSAH 2E43A 5A3ID 3TBCA 2R8SL 3DOSB 2VJXA 4X6CF 1M57D 2PO6C 5TE7L 2NY4D 1SQPK 2IV9A 1GW4A 4WY4D 3OMAB 3QORA 4UBDC 2IADA 2WO3B 5EOTA 3ULUF 3PDGA 2AXFA 1JHLH 3MLZL 3HZYA 2WXJA 4KMTL 2XDJA 2CLRA 2XKUA 2JDIH 3G6EP 3FQUB 3V0IA 1MRFH 2EXTA 4IRJB 4PMEA 1GR7A 4K23L 5FA4A 1G9EA 5CU5A 3MC0A 4TNFA 4DCQA 3VI3F 1U8LB 3LKPA 2XX1A 4XNUH 1N2DC 1DL7L 2X89D 1CGSH 3CMOL 4QIRA 4YVUA 3SDAA 3US1A 3MJ6A 1HJ0A 2HJFA 1S6NA 2DBJA 2H3NA 4YSDA 4J27A 1CI5A 5AENA 3IJEA 5KBDA 1N7ML 2PWFA 1KIPA 3IRZA 4JDEA 5FGCB 1QEWB 2DQTH 2QSQA 2QVKA 2UUDK 1DSFH 2V7QJ 2W88A 1FCCA 5IVNA 4ABVA 3JWOL 4XMLH 1NBVL 3NDYE 3V0WL 2C3GA 2WOBA 4A68A 5ICXA 3QDME 4K9EL 4AQEA 1NFDE 5TJHA 1IGMH 3D33A 3PL6C 3GZKA 3EJTA 3CXFA 2IBZD 3ZE1F 1NDMA 4U1SB 2YUZA 3G5XA 2CJ3A 3WE1A 3DVIA 3WD5L 5A1AA 5DUPH 2VDOB 1CICB 1KGXA 1YA5A 1HZHL 5GS0L 1Z5HA 1TKWB 4MQSB 1MIMH 3ZDWA 1AHWB 1YEGL 1ID2A 2ZXQA 3K5RA 4XO4A 3O4OB 2AXWA 3GTNA 3A0BE 1X5MA 1X7QB 2FWLB 2O6CA 2V8MA 3TO4D 1SDAB 1A14H 3RVVC 4PWKA 3C75A 1QTSA 5F7MC 2FSEA 1HTYA 3KLKA 4FGMA 5BXFB 5B5EE 2PWHA 4WW2A 3D6ZA 3HE6D 3RIKA 4GDOA 4Z7QE 1AD9A 1RK1A 2C9RA 5ICUA 4F5CE 3QYMA 3O2DA 3FQ1A 1RF0A 1AP2A 3O3EA 2X05A 4PS4H 4ES9A 5I1IL 2D2CD 1A3ZA 1SJMA 5I8KL 4U1MB 4DN3L 1QLEL 3FN3A 3F7PC 4OCRH 1OF0A 4YGVB 3BPNB 3B7TA 3V55A 3NRFA 4OFKA 3UIZA 1AMXA 4Y89A 2Y5EA 4XPFH 3NMDA 1LTAC 4DP4X 4Y4KA 2ICCA 1HDMB 1XEUA 2VDRL 3W0WB 4BXLA 1XGQB 5BJTB 3VD4A 4I9XA 2OXHB 5CCGC 2FR4A 4ETYA 5APSA 2UXGA 4Y99C 3GJEA 2JKJA 2DRUA 4CN4A 2A2QT 5ADPH 4L76A 5AW6B 1GYVA 2QKIA 1JRHH 5IG7B 2EUVA 3ETBF 1NWQA 4IDJL 4OJCA 4XN7A 1LO5B 5AW1B 1FVCA 3S37L 3STLA 3W9DB 4GBXC 3MX0A 2C1OA 3RK2B 4HJJL 1KCBA 4NP4L 5FDWA 2WTPA 2DQGH 5B1JA 4DF9A 4JPWH 3DNKA 5E9DA 3V6OA 2EDQA 2PFXA 4ONHB 1AH1A 4X4XA 5DEJA 4R4ND 2CM6A 3HR6A 1ESOA 2R69A 1UXWB 4MNHA 1KF9B 3ZYJA 1MXGA 3WUWA 1XH2A 5TDNA 3V0JA 4NKDB 4UM8B 2BNQD 3ARGD 3LEYH 3R4YA 2B14A 2E47A 4KKNA 5ID0A 5JA9A 1KBBA 4XO5A 4JB9L 4N28A 2V7QH 4UV7H 4Z7AA 1A3RH 3IWVA 3N5AA 1UOKA 2DJSA 1IQDB 3TYGH 1WMKA 1P6FA 1U8HB 1ZANL 2WBJC 1FNSH 1A6ZB 1P2CA 1YYMH 2FYUD 4RAHA 3FGAD 2Q76B 4H1LA 4W9GC 1UJTA 3ASOB 2VLRA 4UNIA 3LXBA 2ZUSA 5A6MA 4UYPA 5JPMB 2I25N 2CLVA 3A6CH 2CJUH 1F4YL 2DB8A 1KIRA 1CQKA 3Q6GL 4ZMYA 1SJEB 1YNTB 1PPIA 1IGYB 1GJIA 4HCRL 4GSDL 3EDDA 2ZSWA 4YTPC 3GSUB 1WBZB 3MCYA 5HI3D 3RX8A 1S3KH 1E4WL 1B9ZA 1J1XH 2Y22A 3GMRB 1V7NH 3BFOA 2E9BA 2AQNA 2X9WA 5JZ7D 1FVEB 2YPLA 5HHOD 3VCLB 1YEDB 4OGYL 1GGCH 3IMSA 1ACCA 3MRMB 1BQLL 5HDRA 3G9VA 3K6IA 3D4GA 4E2OA 3QNXB 4JO4H 3IJ8A 1IZNB 1QNZH 3KPPB 3SYOA 2ZOTA 3U1CA 1FNAA 4L1LA 2J8UE 1G7MA 1GL2C 4LPXA 3RVUC 1NBYB 1QP1A 1ZJBA 4HA1A 4NRXA 4P2YA 1XGRA 1XTLA 1RLWA 2Z3FA 4Z0XA 1NTKK 4PJ6A 5ILTH 4YSOA 3VH8B 4Y9CA 3QAZC 4N78E 1T4WA 3DX7B 3SDDC 1OTUC 2D0HA 3FUJA 3SE4C 2EKSA 2R2EB 3LKOB 3SBPA 4Z1PA 3WS6A 4X7DC 1BQHA 1T7WA 4GP8B 4L4TB 2NXYB 3WYRA 5JXEA 1HOCB 4N24A 5ALCL 2L8AA 3UTOA 2QJPC 2E75C 2FIKA 5IJKA 3OB0H 4FQJH 5AQ0A 3U9PL 3TURA 3ABZA 3RVTD 1NU1D 1BLNB 3CPUA 3MRJA 4HJGA 3D3VB 2NSXA 3KH4A 4LSUL 4XH2A 4FE9A 3HHRB 4I77H 5AW0B 2IYOA 1SBBA 3JV4A 1EAJA 4L8DB 1USQA 2JWAA 1NTME 4WEUD 3UTQB 4P5KA 2Z7ZA 4FLSA 5EUKB 4UOQA 1KCSH 4CSZA 1M1JB 5IHBA 3F7LA 3CVIL 5JOPE 2F7QA 4UIMA 1KIQA 1DQTA 1UWGL 5CU9A 5J3HD 1JD7A 3KLHC 1VFOA 2IFMA 5H2FH 2YEQA 3FB6B 3N2JA 2DIEA 3F01A 3FTVA 4PP1D 2IVFC 1UA7A 4Q0XL 2UXVA 3RIAF 2HKAA 3EBAA 5MI0C 2CSPA 5DWUL 1WAAE 1UENA 3DRTA 4MJ6B 4M9OA 3C9NA 4WWKA 5J1AB 5HI4C 4GQQA 2RHEA 5DD6A 2B2XL 4HLEA 1AIFB 4P2OB 5TGBB 1KCUL 2K1MA 5J5EA 2BY3A 1A7OH 4PGBA 4ZFZB 3GSOA 2NZ9D 4PJ5E 1KD1Q 3Q2NA 3NP4A 1T1WB 1YY8A 1DQDH 3ZX1A 4WQOA 1JVKA 3QDJD 4H0LC 1I1YA 5M7QA 4S0SD 4OB5H 3OJVC 4K8RC 4HIXL 2EIZB 3TZVD 2FHCA 2AVGA 1W2BO 1CFVL 5D5MF 4IL6E 1AVOA 3HI1A 3LYRA 3GHGC 4YR6B 3VQLA 5I1EH 5C08E 4J2XA 3AADB 4X80L 4L0YA 2CCVA 1OCWH 3I9PA 4RFNC 4GRLA 2OSLB 3C5SB 5FA3A 2Y5QA 3TEWA 1MHCB 5E6IA 3LSOB 2LQRA 2OYHA 3BO8A 3RIFK 1T7VA 3CCHA 5KYWA 1JV5B 2RALA 2X4PB 2WXLA 5GHWL 1QR1B 1JJUA 4Y0GA 4JYBA 4D2NA 1TDQA 1HCFX 4MHHI 1XCWA 4EIJA 2E46A 3IETA 2PWEA 4YSTA 9CGTA 1DJSA 2KLUA 5KVFL 2WT7A 1I1AC 3SGDH 3DECA 1UXMA 5IROD 4B3VA 2QRXA 4L74A 1HHKA 4R90L 4AZ8B 4X6FA 1XF4A 5IJVA 5AKSA 5D7LD 3OAUL 4UILH 1YEFH 1MVFA 1WA0X 4BFOA 3L71J 4B0MM 3H6PA 1OXYA 1QFPA 3DXAA 3TBVA 3RUGB 3X11A 3VGEA 4DVRL 4YDZA 4B9YA 1NU1J 5A3IC 1B6DA 1UJ3B 5FGCE 3KHOA 2DTMH 4PJXF 5LQBL 1GS8A 3MLUL 3H32A 4W7YA 4WY4C 5KN5A 2AQ1A 2WCGA 5HDQH 2BOCA 3JVGC 2VDNL 3CFCH 2ITDB 3G6JE 3N43F 3Q5TA 4JHWL 2HJLB 3VA2C 4BZ2H 4IMLA 3TP4A 4X5PA 2CDGA 3NRPA 3MRIB 4ZUTA 2CGYA 3T09A 4MD4A 2CXKA 2PYFA 3CDCA 1PW3A 5IWLC 3Q2VA 3WHE0 2OJZL 2G2PA 3V0DA 4UT6L 2ICWB 1I53A 2A06G 1NTZE 1XV8A 1MZZA 2C9LY 25C8H 3QQ4A 4BFIA 1FYTD 4B27A 4L29A 1CURA 4PD4E 2X3CA 1U3YA 4LLUB 3FCBA 3WTWA 1KELL 3IPFA 1XT5A 5M1BA 4V1DB 1DEEG 1HYSD 3KXFE 1U30A 4RJTA 2Z7UA 3CHXA 1SFCD 3S4SA 4JN1H 2JI2A 1JPGA 2OR8A 5IBUG 2VZ3A 4HJ0C 1Q9OB 4U3SA 1Y0LB 4RGOH 4MNGA 1MCWW 4M4RA 1HJCA 3MLRL 5K9JH 1VFBA 2NY3B 2IH3B 1KV4A 2QGDA 1C08B 2YLKA 4ORGB 4DGUA 3ARDA 1C12B 3SSGA 4UU9B 5MENE 5D7HA 3S0PA 5DK0B 1N4XH 4JO3H 1SFDA 1NUDA 1EAPA 4Y4HB 3WY4A 1D6VH 3H1IE 2JCCB 2JJSC 1R3IH 1KGCE 2IEPA 4HQQL 1G9HA 1N64H 2VXSL 3MGAA 5FYKE 4C7NA 4JDTL 1LE9B 3DUUB 1RZ7L 1AD0B 1AZBA 3EGSB 4PRPB 3S3DB 2XVLA 4PUBH 4Y2DD 3SDAC 3DRQB 4OZGB 2VR8A 1XEDA 3D39A 3KPSE 5KVGH 2IBZG 1G7QB 4WDIA 2A38A 3DIFB 2W0FB 2XKNA 3VDAA 3WFDH 1TO5A 4YHML 3LD8B 3IDXL 1URIA 4FYRA 5E08H 3DHJA 3SCMD 5KSUA 1U3HA 1XB6A 1MI5B 2GBVA 4H8PA 1XGYH 3HE6C 2O01H 3QDGB 3QEQB 4KY1L 5HHVL 3N55A 1PFIA 4Z76B 4Z3IA 1PX3A 2Y0CA 2IDUA 3QUKA 2WYTA 3GMAA 4YNYA 2CHNA 1RULL 3O6LL 3FTXA 3KYMA 2E6PA 2XCMC 4UT9H 1KILB 3TN0D 3PIQA 3ULUD 4ZTOH 4EBQH 1MCHA 1OAZL 4G1EA 2KZJA 5APQA 1KYFA 1WQVT 1AXIB 4LHUB 4W9CC 1MCPH 4O02H 3ZYOA 1MJUH 1RUPH 5FV2A 5FCSH 2H32A 3S96A 3X1FA 4WWPA 5F9WC 3VXPA 2AMUA 3Q06A 2FGWH 3OXSA 3K6NA 1JCVA 1T6VN 3BP4B 4HWUA 5AOMA 1ZE3H 5ESAA 1IT9L 3M9HA 1I9EA 2ZE0A 1IKNA 2RA1A 4XC3L 5KSBA 3RFZB 4P3CL 4GODA 1FZOB 3PWPB 4P57B 4GLRH 2OSWA 3FONA 3OKEA 2DN7A 2BX5A 5DD0H 5DMIH 4ZAKB 3EJSA 4YUEL 1LMIA 5EZJA 1S7TB 1RQVA 2E0PA 2W07A 4AW7A 1BJ1J 1TZAA 1QABA 4L3CB 3FT4B 4XBMA 2FVNA 1OP3K 2V9TA 1RIVH 1A6PA 1FZAA 3I3DA 3NK3A 5F3HA 3NACL 3QWOC 3WLBA 3LEVH 3ALXA 4RFEA 1BVLA 3EH4B 5FUOH 3GMNB 4M6MH 3GK8H 3OAYH 4OZHE 1KFMA 5DSCA 4XT1C 4IS6A 4M1CC 1NOLA 4G9FA 7CGTA 2YKLL 4PI0A 3S5LB 4UINL 2GJ6A 2ZXDA 2BY2A 3BPOB 1E7VA 3CDZB 2YRBA 1M05B 3M1BA 3VOPA 4MBRA 3AREB 3HS0A 5DO2D 4Y4KC 5SWQB 1EHXA 1NOFA 3T3MF 2FYZA 3SDYH 2CBPA 3KPRA 2IAMB 2Z4QB 5T1KD 3HNVL 2Y07H 3BP5A 1H0DB 4LSDA 4R4BB 3GSRB 4XO8A 5F96H 1HBWA 3T1FB 1QVGO 1E67A 2P5EB 3BUTA 4NQEA 4PJFA 5I76A 3MV9D 2QE7H 3CHSA 3Q6FA 4Y16B 2XRAH 5DJAB 1JWMB 5F0LB 3HR5A 1T03L 5HYEA 2HVBA 4YHLH 3FFDA 4LPUA 4Y28J 3ZZSA 4G70B 4ZX5A 4TRPH 1MRCH 1P5UA 5B1JC 3V6OC 1U8KA 4DN4L 3U1AA 1VEPA 4UM9D 3RYMA 3RDTA 2L5GB 2WINB 4LMQE 3WIFB 3P40A 1YYCA 4YOKA 5EULV 1EVUA 4J8QA 4X6EB 1CLYL 4P9HC 4UZGA 4ZFFB 2NNCA 2NX5D 4PGCB 3CFDB 3F7VA 4XP4H 4OFYD 1UWXK 5D1QB 1HQ4A 2WLLB 4RGMB 2WB7A 4MVBD 2BJMH 4BSWB 3BZ5A 3FFCE 1KTJA 3PHLA 2ZKHH 3L5XL 4YHOL 4ACTA 1G94A 1OVZA 2AHIA 1RERA 5IFAH 4NAQA 4HKZH 2ARWA 4JBSA 3RWFA 4KOBA 2IWGA 5DHYA 2XTJC 5CLXA 1BJMA 4JM2A 2X41A 2J8HA 1KXVC 3VXUA 1KLFA 5APVA 3NGBB 1SHSA 4XCCH 5FC9A 3KYKL 4D9RE 1OE3A 3NIFE 1PEZA 1QRKA 4RO0A 5KSAD 5A43C 3A47A 3HD7B 3HI6L 2YO2A 3T4AC 1ZLDA 5LAXA 1WZ1L 4XVJL 3MUUA 3GNML 4G42A 3IPBA 1G7JB 2YEZB 5BVPH 5IJBC 4NN6B 1UCTA 3LY6A 3VFNA 3KDMB 4J3WA 4Z7VF 1MG3C 1SEBA 1NMCB 5K39A 4D0CA 3B5TA 4DGYL 2CXGA 3R1GL 3BRTB 3N40F 1UD6A 4Z95H 2BP5M 1BGXL 2X4SB 4PLNC 2VR9A 1CD8A 4KMLB 1BJ1H 2I5YH 4DEPC 4Z3TA 2PCYA 1JVOA 3PQYA 3L71G 4MJIA 3APCA 1IFJA 3F64A 5AB9A 1D5BA 2FJUB 3FH7A 4DP0X 1QLFA 4JHBA 3L3OC 1HWTC 3S2CA 1QUNA 3M7FB 1FGNH 2DM2A 3UTSE 2DAVA 2QVAA 1AI1H 2ZP0T 3PXLA 1QA9B 3PP5A 1OIOA 1FNHA 4P46B 4YIQA 5CJ4A 5EOCH 3MRNB 3C60B 4A2FA 4IGBB 2VZUA 3GXUB 3RWHB 1TQUA 3HC3L 3EOAA 1NGPH 1H9DA 1R3LB 5EN3A 2ZCHL 4IKJA 2W83C 4RRPA 2K4WA 2QVTA 3OWRA 4H13D 4F1ZA 1AS7A 2ZUWA 5IJKC 4ERSL 3BGFC 2F5BH 3IU4L 4XNQA 5J4MA 4IBUA 4L4JA 1CZ8H 2PP7A 3MUZ1 4GQPH 2O5YH 1RUKH 3BW9B 5EA0L 3WXVL 3BQUA 1H15A 1KJ2A 1LHZA 4PJGB 1AACA 1XF5B 5B3NA 4MZ2A 2IJ0C 1L7IH 2FT8A 3BDYL 3LPOA 3PHQA 2OMYB 1JGDB 2ZCLL 4PGDA 1U8QA 2XG4B 4XP6L 3TVMC 3K6DA 4XMPH 2LTQC 1WH0A 1IC7L 3VXOA 3HB3D 3MA9L 2VDQL 4NJ9H 1CB4A 4LKCB 1WT6A 1FJ1B 2X10A 1U8NA 5H8DA 4EI6A 3QVAA 4CW1B 2YMYA 4NZRL 5I74B 4JO1L 4G7YH 5D6CA 3GHPA 4QTFA 3Q43A 1GYUA 5KVEH 1U2HA 2I26N 4DVBA 3ZDZE 4ELMA 4WWKC 4ANWA 5FYJL 2NY6B 3ULUH 2C5DC 3E6FB 1Y6MR 4ADIA 4Z3GA 3L5JA 4UV4H 2TRHA 2JB6B 2QMKA 3ZTJH 1AGFB 3COOA 2JQAA 2PAJA 1CVRA 3MJ9L 3MRDB 2BPBA 1MFBL 4FQXB 1YMMD 2A77L 3CX2A 1AYOA 1BVZA 4FNLL 4ZYKA 1C5DA 1ZT1A 2YC1A 4IRSD 2IPPA 2R69L 5A2FA 4KITB 1NJ9A 1S5IH 3HN5A 3MXVH 4N0UA 3CGTA 5BQDA 1M1XA 1LTXA 1NAMA 4QHMB 2IQ9L 3L45A 1AXTH 2AEOA 5EO9A 2CGRL 3M06A 1MCBA 4WENB 5IEKA 1AZCA 4K0OA 1MWAH 2PABA 1IFPA 1ZVSA 3D25A 4F91B 4GRLC 1U0QA 4HH8A 4N8CL 4GRMA 4B9CA 4ETQB 1DR9A 3GBMH 4BCXA 2NZ2A 2FY8A 3AMKA 2FUTA 4C7RA 2R1XA 1BP3B 1UZ6E 3UDWC 3MUGA 3LVTA 1A6VH 4XPTH 5KAFH 1G0XA 4FHJA 5DT1H 4OLYL 5ICZB 2WPGA 4GXFA 2WVVB 3CZLA 3O8XB 1UA6H 1UZGA 4JO8A 5C8JB 3FO1A 5IR1A 1CU4L 3G6DH 5DI8A 1QYGL 1VDFA 2NZIA 4F1SA 4HV8A 4PY7A 3PS6A 2P3YA 3ARFB 3E2HB 4FQHB 4L3EB 3HG3A 3N1FC 4NP9A 1YPZE 3OF6A 5T1JA 4TVUA 2I24N 3B6SB 4FQ2H 4JQ0D 4HJIA 1P7KA 2VDMH 4X99A 5EF3A 1NGQH 2XA8H 3RGVD 1UOVA 3BRFA 3VU1A 3K1DA 1D9KA 1EA9C 5E2TH 1I3RB 4LVEA 5CZKA 2B5IC 5DJYA 1DLFL 5H35B 2GVYA 4PWHA 4I4WB 3DROA 3CN2A 3RWJA 4PWIA 1DX7A 3AWEA 3GTVA 4NOFA 1PKQE 5GTIH 1NCIA 5GGVY 1FV1B 1Q86Q 2O61A 1JMXA 5CD3B 1IFGA 1RXLA 4AUYA 5D71H 3RL0B 2XU9A 4UOW1 1GKEA 5EO0A 3IGKA 2VC2H 2EADA 3WN6A 8CGTA 3U0WL 1FFNB 1UFUA 2XXMB 4KKAD 1UZ8B 1KFAL 3K4DA 4ZS7L 3U6RB 2ZYAA 3GEWB 1G1JA 1CR9H 1QATA 1VFAA 4G5ZH 5IMMA 2GIYA 5L2KD 3I3EA 1ZWIB 3L4YA 3D85D 3KZ8A 2CDEA 2V2TA 5ICYB 4WUUA 5IHZA 4N0RA 2KB7P 4KNSA 3SB3A 1U6AL 2X4TB 3GIVA 1DBKH 4HIHA 4PJDF 5HHMD 1J1DB 4HS6A 3C12A 1T20B 2ZYRA 4YDLC 5C07B 5C71A 2YXRB 3S35X 2DDQH 2E8YA 3WAKA 1PD6A 5ES4B 2P8PB 3L3DA 2BFVH 4JZOA 3TN0C 1TVHA 3PJSB 2HB0A 1YC7A 3LZFL 1CS6A 3DUSB 3GJFH 4Z77A 3WUUA 4GQRA 2BDNH 4KC3B 5KTEH 3D09A 3LIUA 3PUCA 2XYBA 5IVXA 1JB0J 2Q6QA 4B96A 2JLPA 1QQDA 2RFXA 2IWEA 4MYPA 2J5LC 2WTRB 5TDPB 2VDKL 4ALAH 1JNLH 2DQ6A 2WSCH 3JTTB 3KPLB 4YO0A 1I85C 4OH2A 2UYLB 5BRQA 4BCZA 4LAQL 1FHNA 2YUWA 4P4KB 2EACA 2XV6B 3MLVL 2YFOA 3V5HB 4EI5C 4IEFA 1WS8A 5IB3B 1FZGA 3EADA 2YN5A 4N0FA 4X7FC 5E5LA 5I9QB 2ZUYA 5KYXB 4GRWF 2EYTA 5FKPA 1KB5A 5FO8B 1OVVA 4GJTB 1FHGA 5I8EA 1XZ0B 3KL3A 4N3TA 3IDIA 1GAFL 4MS6A 4Y19A 4ENZA 3VD3A 3BPCB 2MOQA 2J6EA 5BS0D 3EO1A 3MRLB 4HT1H 1DBAL 1RUML 1T5WB 5KYYB 5FO2A 3D2UB 2FO8A 3OKNA 2E9WA 3CC4P 1HESA 4QDGA 3MTUE 4OQ1A 2KH2B 5ESQB 1Q1JH 4YXDC 1QWNA 4XPGH 1GGUA 4G8GE 5KVMC 1CCZA 5D1XA 2F1BA 1Y18A 1O9ZA 5FO7A 5T1MA 3RQ3A 5J9PA 2QQLL 1O6SB 1P1ZB 3HE4B 1CG9A 3BWUC 3QFJD 4BEIA 1ZD6A 2DWYA 1MFAH 2X5PA 1BSHA 3LKNA 4AIZA 3GB7B 4JFOB 1X9QA 1ZGLA 4PBVC 4NNYB 5AW4B 3RI5K 4P05A 3TA4D 2NR6D 1P4IL 1BCCE 1FZCC 2QIWA 4Y5YB 4AL8C 3DVNB 5DVNA 2D3LA 1PAZA 4XVTH 1BX2A 4HEPG 4MZIA 3VI3B 5BNXD 2QJYC 1GW6A 3GSQA 4P48A 1F90L 2NUTA 5CMZA 1W5CE 2B87B 3GIZH 4BK5A 2C26A 1M3IA 2FYUE 1I9RL 1QACA 1TTGA 3EFFB 3DGGA 4KQ3L 5A2KH 4I0PD 4PJBB 1FFRA 2AABH 4P5TC 2CBTA 4FQLH 3VTTA 3T2QA 2ZKWA 1TZGL 2XZRA 2BNRE 5ITFA 3NFNB 3PHOA 3RBXA 4RFOL 4H8WL 5BZWB 2YMKA 1U93B 3F65A 2ZJSL 1Q9WA 3OPZH 4FNRA 4JFFD 1FNLA 4JR9L 4K07A 5J1TC 2WKOA 3FUEA 4KXZH 2DLEA 4KO7A 2X1XR 3BH8B 2BMKB 4MA8H 5TFSL 3JXAA 1MLBA 1NM9A 3BP7A 4K7PL 2QMJA 2ZVOB 1RJYB 2PYEB 3EFOA 3TIDA 2D7TL 4XXCC 2OQJA 3SPIA 1YN6B 1U3ZA 2HPTA 1G6RB 2JELH 5HHOE 6CGTA 4YK4B 1NUGA 2YIHA 5E8NA 3WKQA 5HHNB 4JJ5B 5IJDC 2J58A 4KRNA 1EZVY 4H5SB 3BAXA 4R83A 5CEYB 3QQ9C 3WIHH 2GHZA 3ZK0A 2G0KA 3QQNA 2AJXH 3ESMA 5D96C 3ZTNH 4Y2OA 5LG6A 2BSSB 4WW2F 5D2LA 5A40E 5JHLA 3MA7B 2WP3T 3D18A 3H0TA 3K80A 5KVGE 3U4BH 3L7FA 3UERA 4HUXB 3MACL 3N0AA 4WI6A 2AJSL 1XZWA 4PJ7A 3U0PB 2ZUQC 3G3LA 2YUXA 4J28A 3SDCD 1QTYT 2J2ZB 3AJ7A 4NZUH 2N1TC 4ZS6C 3VXMD 1U58A 1Q72H 2WZPA 2QZQA 3GBNL 4W7ZA 5CCKL 1UKTA 1M7IA 4F15B 1WA1X 4C46A 3AEGC 1ET8A 3DSFH 3BGMB 1JY2P 1E5ZA 2AV7A 3HC4L 3KVQA 3T2NH 5HD8C 2J1XA 4X83A 1GY1A 2WLIB 4WEMB 4DGWC 4QR7A 1P7BA 2YK1L 3CZKA 4JM2C 3RIFF 3A3YB 3B3IB 1MY7A 4BQ9A 4IBVA 2Y7LA 3FQRA 3QHZL 1BM3L 1S7WA 2YGPA 3ILQC 4MXWH 4WI7A 3SQOL 1HHJA 4AYID 1FN4B 2BNUA 3NEXA 2FT7A 2R8SH 2CKBA 2VXTL 2YMOA 3D5OF 4WI8A 5TE7H 2CMRH 3ITKA 3HPLA 4PY8J 1HHIA 3ZRCC 4KMTH 2YD2A 4ZPTB 4H13C 2XXFA 2JJVA 3D7PA 4QRUB 4OVNF 1PTZA 2X4NA 5EF2A 1S7UB 2DBLL 1E8YA 5AKVA 1QHQA 3I74A 4K23H 4QYOA 2KQMA 2EXWD 3UYPB 3WJJA 1RJLA 1DL7H 1YEKH 4X4YB 3DETC 3KJ4B 1XCTA 5SWSA 3DMMB 4QRRB 3A67L 1XGZA 5IB5B 1NJIQ 4PJCA 3PGFL 1KB9I 2NNAB 2Y2TA 4JE4B 2ADIB 3B8EB 1KENL 1N7MH 3P9LA 5E1GA 3HN3A 3TJHD 1N6QL 4WEEA 3EJYC 5HVHB 4R8WL 3IFNL 3MDJA 3VMAA 5M95B 1EZVD 3ECQA 1UD5A 4HDIB 1CE6B 4I87A 4X98B 1NBVH 2QVIA 4AQZA 2EVFA 2JKNA 2WZ5A 3V0WH 5ANMB 1RL1A 4OM0L 1ZSDA 3UTTB 3ZMNA 1UT2A 4ODUA 3VYOA 2VTFA 4HLZH 1HHGB 1EERB 1LK2B 3B7YA 5FYLL 3GO1L 4G43B 1XGUB 5E2WH 3ZHDA 1X7TA 3RK3D 2ICEB 1N73A 2QR0B 1K4DA 3QPQC 2ZX6A 5CMAB 3L75J 5D1ZD 4J6IA 4IMKA 4FC3E 2L91A 4LXFA 2FZ3A 5FOBA 1EXHA 4UZUA 3WD5H 5GS1A 3C2AL 2Y7SA 3UAJD 5EU7C 5GS0H 2OMBA 1GW3A 4U3CA 1SMAA 4Y1TA 3RA7H 1YEGH 1XF2A 4MQ7A 3KLQA 3UG3A 2WSDA 4RRPG 1RPKA 2GTZB 4OIAA 3F3HA 3SBRA 1RPQA 4L4VB 1RZ8B 3TH3T 2AEIT 3T65B 1D5MB 5F2FA 3VFVB 1JHKH 1HH6A 4ZMNA 2ARJQ 1JCDA 4PCSA 2I9TA 2YEVB 2DJ4A 3FPYA 1LE5B 3CV5A 1IFHL 3O9WC 3V4LA 2ZX7A 3TWYA 1MLCB 1OF2B 3SSUA 1V8HA 3CH8A 5AZ2H 2XBDA 1ZLLA 1M9WA 2VO5A 3EJUA 3G08A 3HMXA 5AOIA 5GGVH 5I8KH 5GJSL 3VSVA 4DN3H 3IDGA 3KPMA 4CADA 1FFOB 4S0TD 4KXBA 3H9HA 5D7LE 1T4KB 3O4LA 2KLVA 1AKJD 1EAOA 3VD9A 3GSNB 4FA6A 4MVBC 1TZHB 3JC22 2VDRH 3UBXB 3K5SA 3QJXA 3T97B 5K93A 5I73B 3JT0A 5C0BD 4S1RL 2CWRA 2GBAA 2POHA 3O6FA 3UAEA 5MERA 3UO8B 1VB9A 2OZ4A 1Z0NA 3IE4A 2VLKD 3SEPA 4EDXB 2WVTA 5MEPB 3NCYP 3L70J 5JIHA 5DURD 2O5ZL 3W67A 3Q1SL 4IDJH 1H8NA 2WLYA 4JF7A 1XB8A 3TJPA 1Q0EA 3AU1A 1T3FB 3LZRA 3U9UA 4NP4H 3QCVL 1GCYA 4XB3A 1U91B 1WBYB 1WD8A 2DM4A 4N2AA 4UAOC 3CXHD 4F8LA 1NC4A 1D5ZA 2WVRA 4GP5B 2ITFA 3E0GA 3N3EA 3GS7A 4QGTA 4RMBA 1AR1B 3T0EE 1FYTE 4A7PA 2KBGA 2HR3A 2XUWA 4UQIM 2G3XA 1TJGL 4ZG1A 3C8KA 5DHMC 4OJEH 3DI3B 4U1GC 3NCFB 1VF5C 3QUZA 1L9NA 2YXWA 3N1PC 5C0RH 4BUQA 1ZIBA 1KJ3H 4WWIA 3VD2A 1XF3B 2ADFL 4U1IA 3UPCA 2MKLC 2EO9A 1ZANH 4APQD 2Z92B 3O8ZA 2ROXA 5F6HI 1QUPA 3MJ7A 1WFJA 2OCJA 3VMZA 4MD0B 2A6JA 2PNDA 3HG1E 3D0VA 4FTVD 5JPNB 3AROA 1NLDH 4N2KA 3T6QC 1E28B 4LPYA 4QWWD 4XFJA 1TCRA 3IAPA 4HSQA 1F4YH 4JEGB 2N9YB 3IAQA 2KS0A 3VWJB 5LDUA 4O2FA 1M4KA 2BOBB 1WBXB 3TYFA 4GSDH 2W8ZA 1L5GA 3BCCJ 1SY6A 2WM0A 3ESOA 2PN5A 5DUBB 2B1HH 4AQ8A 5A7BA 2FX7L 5DJ6A 4JQIH 3C1LA 5KBPA 5LXGL 1ZLUK 3TGUE 3DX9B 2F54B 5HHPB 3F12A 2AJVL 1T2QL 4OGYH 4MB3A 1FG2B 3FF7A 2SEBB 4NO0D 1BQLH 3HBQA 2XY1A 4HLZG 2DOCA 5L2JA 2EDNA 2HPOA 4ZJ9A 4FXKA 3K71A 3EDEA 2WGXA 1R5IA 1XSJA 2P24B 3UADA 4XWGL 4QXTB 1F11A 2GK0A 1YQ4C 3L4CA 5E94A 1BBJA 3H42L 1DP0A 3TEUA 4RMSA 1TXKA 4ZNCA 1LLAA 3WS3B 4CC4A 4L5FL 4MSWB 4D8PB 5J06A 1MFEL 3K6OA 1LO0L 3NJJA 4JHZA 4LBAA 4MCZA 5GQBA 5E00B 2ERJB 1ZDSA 5TQ2H 1MH5A 4RBPK 4X6CE 5GRXG 4P2RD 2IG2L 4Y4FB 2FSDA 1E9QB 5J89A 3ULUE 4HIIA 1N12A 4QYAA 3HN8A 2ATAA 2AK4D 1LMKA 5MP6H 3VRJA 3M8OL 1TQTA 3JWDC 3N1GC 2FWSA 1ORSB 1LGHB 1INQB 2CBQA 5IW6A 4MQXD 3VI3E 3CLWA 3H9SB 2BSDA 1IZKA 1LP1B 1OMIA 2GIXA 3QIBA 4P99A 4BQCA 2NYYC 2V2WA 1PNDA 4WHTA 1QSEB 1JK9B 3UAAA 1A6AB 4LSUH 1EQ7A 4JW3A 4QRSA 3FOMA 1NUFA 3V5KB 3ORJA 1RP8A 3QRFM 3UJJH 1SJVA 3CXHJ 4CMHC 1MW0A 4PJXB 1T1YA 3VXSE 1ET5A 3W1ZA 3WY1A 4R2GD 3CVIH 4YXKL 4A2DA 1IAOA 2A4CA 3PWLB 4XP1H 1TT6A 2D7PA 1UWGH 3L3KA 5I71C 1VCBC 4B9FA 2NR6C 5KAFE 2RCSL 1VQMP 5EZLB 2P52A 2WOYA 3QCUL 3A23A 4Q0XH 2JJLA 5J11C 4Y1AB 5HDWA 1OK0A 3D69A 1NDGB 4I7ZB 5FHBL 1RCYA 2KLSA 1IKFL 1EV2E 3RL1B 3ZE1E 3B5NC 5ISZB 1KQFB 1KG0B 3VWKA 3VXNB 4Z8FH 3TFKD 2JWDA 1NAML 2DQIL 3MQIA 1N0LA 2OLDA 1KN2L 2VIRA 4F2ME 4YEEA 3KHUA 3QO0B 4EVNA 4TXVB 3VE0B 5CIPA 1S5HA 3CH1B 4K2UL 2B2XH 2PCFA 2F8VA 5AAMC 5I1LA 1NBCA 3ARBD 3OJDA 1J5CA 1SQ2N 3GM8A 3ZKNC 1A1OA 5A16B 3SKOB 2MQ0A 3EJJX 4AXWA 1A8JH 2P8LA 1VZGA 5F8RC 5D1XC 4R9HA 4M93C 2XWDA 4EYYQ 2Z31D 4F9PA 3WV0A 4P2QD 1TMQA 5HYJE 4ZMOA 2JO1A 3QIWB 3MR9B 3FAWA 3P69A 2WWMD 4JPVL 1FL5A 4KFMA 4MNQA 3UEQA 4DPAX 4PVNA 3PGCA 2ZONA 3UJIH 1CFVH 2XN9D 4U3FD 5HGAB 5GTIE 1IVTA 1ASPA 1IM3A 1MHEB 1E90A 4LQ1A 1A9EA 5KBKA 1DQLL 1QD0A 3KYOA 4PRBA 4G6FB 5EUOA 5DCCA 2NX5E 1Q90A 1R17A 3L13A 1L0NE 1M7LA 3H7BB 4G1MA 3KPTA 2J88H 2W8CA 2X2UA 4QHKI 3L75G 3OLEA 3W9EB 3ZN6A 1CSBA 3CX5H 1WZAA 5GHWH 4TL4A 4EUPB 4XN5A 1M7XA 4QY8A 4LCIL 5GIRB 2DIAA 1HQRA 1B0RA 1HXMA 1YDPA 4OT1L 4A2HA 4F8PA 1S9WB 3RTQB 4POYA 1N8ZA 2XN1A 3DHUA 1X9RA 1WPCA 4XNBA 5LLIC 1U8IA 1J86A 1IKOP 1K8AQ 3U2SB 4NO2A 3DO7B 2MRYA 5H4YA 3S3PA 3RNQA 4PRHD 3V4PB 4E9XA 1NTKD 1S7XA 5ACMA 1F13A 1HCZA 4JANB 1TU2A 5D7JA 3IMTA 2W9DH 1ND0B 3THMH 2WXPA 4E41A 4YPGA 4GKOA 4HWBH 4G8IB 1YYLL 4DVRH 3L1EA 3CBRA 4ODSL 4I1NB 4UUJA 1KGUA 5C09B 3C87A 5KSBF 5L9DL 1N10A 1JYNA 2PO6B 5C0GB 3BWUF 2HX7A 3MLUH 3UGUA 1RH8A 1HGVA 5J7CC 4LK4A 4QXVA 2HODA 3O6ML 4K71C 1LWRA 2APWA 2VDNH 3R4DA 2QKSA 5KS9A 2ADJB 3ZPDA 3F05A 4JHWH 3Q3DA 4OLVL 3WHXB 1MNUL 1AV1A 1SRDA 3CMGA 3NSDA 3TASA 3IU3A 3E80A 1H6UA 3HE7D 1RE4A 5JO5A 4S0HA 2OBGA 2FEEI 3DSNA 2B1AL 3KWWB 3S5YA 5I1KL 4UT6H 1K6QH 1B88A 1NCAL 1XR8B 1SQVJ 3MZTA 1HWHB 5BUAA 3L70G 3A2AA 4XO9A 3FSAA 3KLSA 2KOGA 2R1YA 5GSRA 4Q4EA 5SX5K 1C8PA 5EN2B 1KELH 2KLTA 3GC3A 5AVXB 5EU4B 1M71B 4Q58C 5L88L 4Z5RB 1T2KD 3JV5A 3F04A 2XQYG 2HSIA 1ASOA 4TN9A 2DKUA 1DEBA 3B1UA 4KHTL 4YQXL 3P77A 5A6IA 2QBWA 4OGQD 4KK5D 5C0CD 3EAKA 1VHPA 2YXVA 4FI6A 4ELDA 4F37F 4X5WA 3MLRH 3KL0A 3HVDA 2Y3AA 3QI9B 4S1QL 3T3MB 3HG0A 1OVRA 3PL6B 3OLDA 4ESKA 1MHHB 1CFTB 2IH1A 5D7KD 4TLUA 4P5MB 5AW5B 1AGBA 4R84A 4NQUA 5F21B 4L05A 4L9DA 4W9ZA 5D1ZC 2X1QA 5B3SB 1JNJA 2ISDA 1XR9A 3EDKA 4NRZB 4HQQH 4PB0L 1KB5L 1EEYA 3BD3A 1CT8A 3WJJC 4PJIB 1Q7YQ 2R2HA 5I1AA 2VR3A 1JZJA 4JDTH 1SLVA 4AQ1B 4YSQA 1F4WL 3B37A 3TBSA 2F58H 2OYIA 4XCYA 2DLHA 4LL4A 1PLAA 3D07A 4DP9X 2PP8A 1AQHA 1CFMA 3WNIA 3SKNA 3GMOB 3UJTH 1F1GA 1X79B 2MH4A 3BWAA 1SF3A 2VL5B 4YHMH 1I3GL 3D08A 5JMOC 3W11C 4NGHL 1U8MB 2G9HB 1FL6A 1YUKB 3DX8B 4JRYD 3RX5A 4F7CB 5AVRB 3BCCG 3S6CA 3WN5A 3KPNA 5HHVH 1M2OA 1T1ZB 3CZNA 3FCGA 3MFGB 1FRGH 4JM2F 2Q7AA 1P4BH 3ROOB 3LJ3A 1IU1A 4MZRA 4UTBA 4N6RA 2HFFA 1RULH 2YKQA 5D8JL 1SLXA 3WTTA 4D6TE 3GMQB 2V7HB 3PNWB 3S48A 3P4OB 4WJG3 4U33A 5F7LB 3SJVB 4MS8C 4B95C 3RWDA 3V4VB 4IMKC 5HGDB 1OSZB 3W56A 1JNMA 2B15A 4HJEA 4WNSA 4ZX4A 4XBPA 3AQZA 1A65A 1S9KD 2W0KA 4LOUC 4RZCB 4N90D 2GJZA 4Y99B 4YN3A 1RJZB 1YTZT 2KPNA 4FJZA 1YY9C 4NZFA 2E4TA 4QRPB 3KPQB 5HHQA 3AEBC 5LGJA 5FFOA 4FG4A 1IT9H 4UQCA 2GBUA 1DZBA 3S34H 4P3CH 5DHVB 1BMGA 2ENJA 4GBXB 2V4HA 2BS9A 1QSFA 4LCWB 5BZDB 1EFXA 2MTPA 4G8EB 1N6VA 4FABL 4DOHE 3MV7D 5E8PA 1RIUL 1B0IA 2VLRD 3DOSA 4IKNA 4FG0A 2ZP8A 2X2IA 2ZAGA 2DM3A 4GAGH 2YKLH 3QJOA 4ZMTA 1I8MB 1G84A 3LX9A 3JSSA 1DANT 3FQUA 3IGAB 4DUWA 5I0VA 1Q94B 4APQC 2RH0A 3NZUA 3OZ9H 1KLUB 2DQFA 4H8VA 1U8LA 4GP4B 3OV6A 4PTTB 4FG6D 2DMKA 1QBBA 3CFTA 3F5WB 3O6FC 5D5ME 1CC3A 5ABZA 2BW5A 4GW1A 2DYPB 2WBWB 5JHLL 2J56A 2BCCD 4QWWC 3UACA 3EJRA 1GTFA 5I23A 3DX4A 4J3TA 2XIIA 3T8MA 2ZX8A 1QEWA 4HK0B 4BFJA 3IXTB 1NL0L 3AT9A 3RDJA 3VGDA 1I3VA 3GM0A 4BK8A 4DN4H 3P73B 2F8OA 4GRWH 4ZW6A 3HNSL 2ZICA 4QOKB 4F80A 1UWYA 2LLLA 3ILPB 2XWZA 1NICA 5ESVB 3I9GL 4YPJA 3CDFA 2BEZF 4PRDB 1VSCA 2GKIA 3VXQA 3L81A 3QUZC 4TUOA 4XMXA 3SE9L 1K2DB 4LCUB 5IMOB 1IGTB 2CKBL 5D2NB 4FFYA 5H37A 4CSSA 3BT0A 4OCYH 3OMIB 3L5XH 1CICA 4XBGB 4OVUA 1GL2B 1J8HB 2N59A 1TKWA 1DBJL 5KG9B 2GB2A 1AHWA 4X9IA 2PWDA 5HHME 2CLZB 3X17A 1L9SA 3QZMA 4PHXA 3TO2B 4PJXE 2R4SL 1NFAA 3I6LD 3RGHA 4XCEB 3KYKH 3QAZB 4IBZA 2WQRA 3LRGA 3Q8BA 1DJIA 2GEQA 4MLSA 2NW3B 4IOFD 4K94H 3HI6H 4O4YL 3WEMA 5BXFA 4NJAL 1WZ1H 4M7ZC 4WRLA 4XVJH 4AQ8C 5D72L 3BYTA 4LSPL 2EVHA 2QJPB 3A22A 1SQBK 4DGYH 4KU1A 5CS7A 4QAMB 4U1MA 4W9DC 5CP3A 3R1GH 4O9HL 5AYUH 1FA4A 3ATAA 3PRZA 2IPUG 4FXKC 2H2PC 4H7VA 1VEMA 5CSBA 1B90A 2ZX9A 1J9SA 3EGXB 3C5JB 5DR5H 3MJGX 4NN7C 4DAGL 1HDMA 3I6GB 3W0WA 1EJFA 5BJTA 1RZJL 1OTTC 2CA4A 1KTBA 1FJPA 2VSMB 4KKCD 3F7RA 1TVBA 4L73A 2B3IA 3CVHB 5IESH 3M91A 3IRCA 2WZ6A 4JREC 4X4ME 1Z7JA 5T5NF 4K7PY 5IG7A 5BS0E 1P7QD 3UEZA 3WSQH 3U7WH 4HU2A 4NQCD 1LO5A 5SWZB 2FEDC 2ZOLB 4ZK8A 3AAZB 3W9DA 4XMKL 1PZQA 1LO2L 1ZLWH 5MI0B 2XWJA 2W27A 3HC3H 3IEAA 4GSXA 4ONHA 2YZ8A 2FWOB 4GXVL 1BQKA 4X5QA 1KN7A 3HTKB 1G4RA 1KZYA 1XIWC 5D6DA 2FB4L 5DJ8B 2NNFA 3V9FA 1UXWA 5F7DB 1FAVA 4RGNC 1FAIL 4CSPA 3QIBC 4ERSH 1NEUA 1U57A 2IV8A 1SQVG 4JRXD 4NKDA 3EIFA 4G9DB 4RSYA 5E6ID 5SX4I 1BOGB 2EDTA 4TSCL 2F53B 2Z31C 5EA0H 2BSED 4S2SB 4YMPA 1IQDA 3HMXL 4DERA 4MX7B 1CI6B 1U8HA 4JFED 3LKQA 5G4OA 1A6ZA 3BDYH 3JTSB 3VDCA 5IB1B 3LRMA 4KZDL 4XP6H 1HNGA 2Q76A 1A21A 3GHGB 2AJ3B 1KTMA 1XDTT 1IC7H 2IAND 3VGAB 5CCHA 3MA9H 1PP9G 5JPMA 4RFNB 4FP8L 2AI0H 4YZWA 3GEFA 2AJUH 3KM1A 1SJEA 1YNTA 4GQZA 1IGYA 5CR1A 3BKYH 3ZKSD 4ZPVB 2Z93A 3TA3D 1AQTA 5JR1L 4JO1H 4BV1A 3EYVA 3HZMB 4ONGL 1DVQA 1BOYA 3TEYA 3SFDC 3F5HA 4MMYA 1F6FB 1YEEH 5FYJH 1X8YA 3VCLA 1YEDA 2BM3A 1TITA 2CIIB 1I1AB 2Y1VA 2Z4TA 2ZXAA 4EDWH 4HD5A 3FB8B 1CDHA 4XWOD 3MRMA 3DPBB 2Y0EA 4ELKB 3MJ9H 3SYAA 4WCYL 1GIGL 3KPPA 4NRYB 1MFBH 2J43A 4F9PC 4AVJA 2R69H 4ZUWA 4N2EA 4PRIE 3CSPA 4ORZC 5IVXF 1PD1A 3U4KA 3CDYA 2JTYA 1NBYA 2IQ9H 5DEZA 3B4NA 4LLQB 2CGRH 2PXYC 3QG7H 4J4PD 1M57B 4NYLA 2NY4B 4WY4B 3VH8A 3DX7A 2Z34A 3FYIB 3LKOA 4W9EC 1RIHL 4H1LH 2E5EA 5TH2B 2IFGA 2IDFA 3BD5A 3H3KA 4ZMLA 4L4TA 3FTGB 4XCNB 1HOCA 4XVSL 2HT3D 3OG6B 1DEEB 4OLUH 1QASA 3FCSB 3DYMA 3KR3H 4JVUA 1XL4A 3WI9A 5ITBL 4N2HA 5DDHB 1BLNA 2EECA 5AVUB 2ZNXA 1SY6L 3D3VA 5IBUB 3NFSL 4PLKC 3GXPA 1GZLA 2HFTA 2LOEA 4EOWH 2OX5B 5E51A 5HBBA 4H2CA 2QPFA 4DT0A 3BAYA 4QJ5B 3UTQA 5HYSG 3L3HB 1M1JA 4O2CB 3ZIMA 2GITA 1A7PL 4UTAA 5MEQB 1NGMB 2QJDA 1MSPA 1NCGA 1CLVA 3D39D 3GI8L 1DLFH 3A4EA 3GMMB 1NTZK 3ZTEA 3WDJA 4F8TA 3HZYB 3FRUB 4J7RA 1LO3H 2B0SL 1MIEL 3J07A 3WEBA 1BFTA 4C4KT 2LVCA 4YHIB 5LCVA 5T1DL 3BUIA 4NPYB 2C4FT 4YSSA 3WMQA 5FA4B 1RE4C 1BE3J 3ROLB 1V55B 4CAGA 2F8IA 4UQ3A 4PS7A 4WEBL 1AIFA 1CXKA 4P2OA 1KTRL 3D9AH 5FF6B 3SDAB 4LMQI 3LZNA 3U0WH 2OL3B 2QQQA 1VEOA 4ZFZA 1KFAH 3T8XB 1INDL 1T1WA 3H55A 1CYXA 1VA9A 3E8UH 1KCKA 2W1NA 1O0VA 1KLGB 4YX2L 3PCYA 1EJOL 3CK0L 3P4NA 3V6BR 3HE6B 2ITCB 1DFBL 4HJGH 4GAJH 3A4FA 4JKWA 2WKOF 2DEWX 4NKIL 4YR6A 3EXLA 4H8HA 4YC2C 1U6AH 2ZXGA 1PY4A 4FQ1L 4Z7VE 4JKPH 3AE6C 2R83A 3K2UL 2FNBA 1F5WA 2D2CB 1E8ZA 2OSLA 3C5SA 3HPJB 3C5XA 5T3ZL 5FYLD 2OCCB 1FIGL 3LSOA 2RB8A 1IGIL 1Q9KA 2EDLA 4A37A 2B4CC 1NDMB 3W39B 2G3ZA 3W5NA 1R34A 2X4PA 5HJGA 2FAUA 2WXIA 3AZUA 3RTLA 5LBSA 4E5XG 3UROR 4RZKA 4LEXL 1LP9E 1EXJA 1G7PB 5FK9A 1AGDA 2OKMA 1P84E 3V8OA 5D2LF 4YBQC 1JZIA 4G9FD 1SQQK 1FVDA 4AZ8A 2IWFA 5DA4A 1BZ8A 3BVNA 3MLVH 2MCPL 1MREL 4QF1B 1QVFO 1LVEA 4NI6A 2WQ8A 2FSEB 1OP3H 4FFVC 1J5IA 3CX5E 3CI9A 5DC4B 3RUGA 1THAA 3D06A 4TSBL 2Y72A 4LLHA 3IJHB 1AP2B 2M0BA 3AT0A 3QWOB 3UX9B 4W1TA 3M17B 4XCFL 1EANA 5KVFE 1GAFH 3NJMA 4AVIA 2FECL 4L1SA 2A6KB 4ISVA 4AJVA 5DJCB 1Z3GH 3GXFA 1DBAH 1RUMH 2BNQB 2FHBA 2W5PA 2ITDA 3U82B 2ZPKL 1UH2A 2EH8H 1JZ7A 3MRIA 2EZ0D 3SPHA 2VLKE 4Y4KB 1QI3A 3EBGA 2NSQA 4Z8FL 2W9EL 1OP9A 2IO5A 4FCHA 4PREB 5BRZD 5F3BA 1YAZA 1SQPE 3RDTD 2ICWA 4N0CD 4W6YB 3NPSC 5FECB 3ALWA 4XN8A 1YTZI 1R46A 3S5ZA 3FDWA 1ULVA 5C0DB 1YJDH 4XHJC 2QQLH 1JRHI 4XC1L 1NLBL 4P0DA 2AITA 2NY1C 1LDSA 4XMVA 4WI2A 1FVCB 1NCDL 3HC0B 4IOSD 3STLB 2F68X 3V52L 3ECWA 4V1DA 2MKWA 3X3FH 1HX0A 3EHBD 1P4IH 2VN4A 4QRBA 3Q05A 4PJCF 2X44D 4JFDD 2YKOA 4P3WA 1S3RA 4PI2A 3T0XA 1Q9OA 1Y0LA 1I9IL 4LESA 4UNUA 3Q5RA 1X5IA 4YWGL 4C56B 4LSSH 3VXUD 2X6BA 5CHNB 1C08A 5CFHA 4KHXA 2WSKA 3D87B 4ODXB 1C12A 1UWXH 3KYQA 4ORGA 4UU9A 5TDNB 4UAHA 1AHMA 3SOTA 1C1EL 4Y4HA 4O9BA 3G5VA 1SVZA 3KWXA 2W6JH 5LHDA 3IDJA 3QZLA 1TZGH 1P2CB 4H8WH 2ZJSH 4LU5L 1LE9A 1G1KA 3DUUA 3LS4L 1AD0A 4PRPA 4PS3A 5F7FA 2XTJB 5TK4A 1IEHA 4X2UA 3VFGH 3DRQA 4OZGA 2N7SA 1G9ML 4NC0B 1G7QA 4K7PH 1V27A 3DIFA 2W0FA 3PAUA 3Q3GA 2WZ7A 1INEL 3VM5A 2LABA 4TQ8A 3G5YA 2HH0H 4IOFC 2B16A 3T4AB 5JDJA 1MI5A 5LWYL 2QPDB 3N06B 3QDGA 3QEQA 3OMNB 4Z76A 1F1DA 2V5RA 4R26L 3ULVD 2BVOB 2VRSA 4M5YH 2F2HA 4YXWH 2I7SA 4ODHH 4JVPA 2ZNWA 5B7EA 1BAWA 1P0SE 4Z7NF 1KILA 4BHUA 2Z8SA 5T1LD 2AJSH 5B4MD 1X4XA 4WKZB 3S98A 3CBKB 4DEPB 5E95B 3EDJA 4MQTB 4LHUA 3GBNH 2APTA 4ZUSB 4P4RA 5CCKH 2QSIA 1G7MB 2WMPB 4GB9A 1RZQA 3HC4H 4U3XA 1Y07A 3IF1A 1DBML 3L3OB 4L8BA 3RZCC 4NRXB 4GAFB 1JXDA 2QM8A 2B4CL 2YK1H 3IBOA 4MHHG 3RFZA 2E6QA 1C5BL 2LFGA 1FZOA 3CC1A 1JDCA 3MP7B 3PWPA 4P57A 5BUGA 3OJAB 3QHZH 5EO1B 1BM3H 4ZAKA 3QCTL 1I82A 3EO9L 5H37G 1NHLA 3SQOH 3H25A 1S7TA 4YHKL 1K04A 3OC8A 1W2KT 1WZKA 2VXTH 3FT4A 1ZOXA 1D7FA 4N2CA 1L4AD 4MA3B 1QNIA 5DFWH 3NXSA 3WIIL 4J1UB 3L95B 3GMNA 2YFNA 2HG5D 1D5IL 2QL1A 3BGFB 1R3JB 4KX8A 4U7SA 3S5LA 2YKKA 1R6VA 3I3BA 3QB7C 2DBLH 3CDZA 1M05A 3APFA 3VYIA 2XWXA 3AREA 1ZCRA 3GPSA 3QDJB 4UTBL 2IAMA 2VL4A 1E43A 2Z4QA 4HIJB 3A67H 4JL2A 5FB8B 4F8OA 2Q5BA 2XKSA 3TVMB 2LTQB 2KERA 3VQ1C 3PGFH 3T1FA 1KIQB 2HWZL 2P5EA 1YEHH 4X7EC 4PJDE 1N6QH 4Y16A 3QXWA 4R8WH 2BSRA 5TQ0L 3Q1MA 5DJAA 3IFNH 1JWMA 3OXRB 1CQYA 2GUVA 4IKLA 4OV5B 1MCRA 2H32H 1JK8B 4NPKA 4OM0H 1FBIL 1FDMA 1ZS2A 4NIYE 2BIPA 2APBA 4Q14A 1RUQL 2A45I 4PJ8D 1GS6X 5FYLH 4DPRA 3RRQA 3AM8C 1T83C 2IXQB 4M5ZL 4WWKB 1PLGL 2WINA 3O11B 5D6DC 1BE3G 2GSMB 3WO4C 4P2QE 5AL8A 5AB1A 2DWXA 1PY0A 2F74B 3N91A 2AEPL 4ZFFA 4X42A 4PGBB 1NEPA 4JFTA 4EDFA 1FC2C 3C2AH 3H1KJ 3CFDA 4PGCA 4PGZA 4U3FE 5D1QA 1IJDB 1F3DJ 3G3ZA 3N9GL 1I1YB 5EPMA 4BSWA 4PP2B 4B41A 4V2BA 4ZMXA 4JYCA 2HP4A 4NDMB 1YEIH 4LF3B 4YFLF 4Q9RL 2ZUTA 3KM2A 4GRWE 4Y5VC 5CGMA 2OTLP 3HI1B 2G9KA 1I1FA 2IDQA 2VLJD 2XV2A 3G04A 5CCHC 4TTDD 3PP3K 3U1SH 4N26A 2YMTA 1A7NH 2A9NL 4GRLB 2R39A 5F1KC 1MCLA 3MRQA 4ABUA 3QNYA 3FH5A 4LDLB 1S7RB 2VZTA 4FLHA 1B4LA 2FX8L 4LOFA 1ZTXH 2HXAA 1A7RH 2H0EA 3FU8A 3AC0A 5GJSH 1RUAH 5LG1A 1G7JA 2YEZA 4RX4A 1PZUB 3JCUH 5DLLA 3KDMA 1I4FB 1NTKE 1VADB 3IETB 3ZXAC 1D9KD 2H41A 4GKSB 3H1HD 4RLDA 3TV3H 4UANA 4OLZL 3PPSA 4X6FB 3OJMB 2X4SA 2X9XA 5GRJH 2F7PA 2PCPB 3DXAB 1WIOA 3IJSB 3X11B 3BI9X 1SFCB 2O5ZH 3FB5A 4NIKB 3V0AC 3UYOD 5HDLA 3UL4A 2C3WA 4WK0B 1I9JH 3CN0A 1FORL 5JOFB 4S10A 2B5IB 3QCVH 1QA9A 2VDOL 1ADQA 3FT3A 5K9QI 4P46A 1MRDL 3R0NA 1JXFA 3C60A 2OARA 3NIDF 3H53A 1OGTB 4IGBA 5KZCD 1W15A 2E8ZA 3CQQA 3RWHA 3WTVA 1FZBA 4ZUTB 4K73A 4KUCD 1J1PL 1KCLA 1VQNP 4BSJA 1TENA 3MV8D 2DMBA 1AQDB 1UC6A 4MD4B 1XQ4A 3GXIA 3TTYA 3HNTL 3N85L 2YAFA 3BKML 1F3RB 1XX9C 2ADFH 1X5HA 2AAAA 1FZFA 1T66D 3LQAH 2P7TA 4X7SL 4ZUUA 1BPLB 4WVZA 2EAEA 3UGEA 5CCJA 4PJGA 1XF5A 4WHDA 1IJ9A 3FUDA 1WYJA 4HX1A 2OMYA 1JGDA 2JKIS 5JW4M 1QFHA 2I07A 2XG4A 3O3UN 5D7KE 2O6DA 2BZCA 1IGFL 4U3SB 4MNGB 2IC2A 4LKCA 1VFBB 2NUPB 2HYMA 2DZEA 1FJ1A 1MDAA 3FMGL 3KJ6H 3JWNH 2ZWNA 5E70A 4BFBD 4OZIA 1P1VA 3D48R 4CW1A 1F3DH 1PSKL 2FX7H 1JTHB 2VN5A 3TN0B 2EE2A 2FEJA 5LXGH 1OTSC 3ULVH 2VDPB 2UY6A 3VQMA 3II2A 3P8MC 5EUOF 2DKMA 4EAEA 2IZ1A 4FFZH 3TOPA 3BXNA 4F20A 2PR4H 5HI5D 2WLKA 4M6OL 4CNIB 3E6FA 3CG8A 2J5LB 5HGBB 4EIGB 5C9JA 1NOAA 3RWIB 4EZMA 3UZQB 2JB6A 5DRNA 4JO2H 1G43A 2FBWC 1AE6H 4JRYE 4BM7A 3H42H 3CJJA 2UY7A 5E8OB 4FQXA 4EI5B 2VZOA 1MFEH 4OBRA 5E1IA 3L74D 1KYOJ 1LO0H 1MWAB 5L0QC 4OF6A 3CVCA 4JKKA 5KSUB 3IMRA 5F71A 5DJZB 2Z8WC 5DQJB 5FYJE 1YZZA 3LNEA 3D71A 1QFUL 4WAFA 4IFFA 3D70A 3QUKB 2R7EB 5BQ7B 3WKMH 2QM7A 2ZCZA 1JGLL 4FKHA 1HHHB 1BMZA 1MCJA 3M8OH 5E9DE 3V6OE 4ETQA 2K7QA 4RISL 5EPMB 1S9KE 3FUFA 4OIFA 2AQRA 2XHNA 2GCYB 1PG7H 5BV7C 1E4KA 1AJ7L 1G5GA 3S1KA 2KIKA 1H3GA 1FZJA 2EZ0C 2K45A 1XHHA 3RBSA 5ICZA 2WVVA 5KS9F 2EDXA 4JZNB 4KJPC 4OD3L 4EQ2A 5EU6A 1R75A 5C8JA 2YAOA 3NABH 1DJZA 2VAAA 1W0VB 1YLBB 3MV9B 5KSBB 3BWZA 4NT6B 1FZKB 1D3CA 2XFXA 1HZLA 2VLRE 1B4JL 4FQHA 4L3EA 5EZJB 3T77A 4NUJB 4GUPB 1D2OA 1QSVA 2G5BB 3AWFA 3AXLB 3B6SA 1FZCB 4H26B 3B1TA 3GQFA 3ZT5A 1P9MA 3MBED 4NZDA 1EDQA 1H3VA 4X5LA 3FU5A 5E4AA 4RVBA 2PPFA 3MMEB 2D73A 4NN5C 2ZCKH 5FHBH 3TPUB 1SQXK 1I3RA 2DEYX 4OBSA 5DSCB 4BCYA 4LDOB 5AAWC 2G5UA 2GJ6B 2DQIH 1NAMH 4I4WA 3U4EA 1KN2H 2E74D 3L2LA 2ID5A 2YPLE 3M1BB 4P5TB 2FFDC 2W9LA 1FV1A 1LWUB 1UD8A 3FHQA 3QO1B 4Z7WA 5CD3A 3LQAC 1IAKA 5LNEA 2UWEE 5FR3A 3UC2A 2J57A 3BP5B 5KJ7D 4KNUA 3SWYA 3QPKA 2BIMA 2PPCA 1T04B 5I76B 1NCWL 1FFNA 1CL7I 4QXUL 5DS1A 3SOBL 1UZ8A 4YVNA 5B1CA 5GGRB 1W80A 4DT2A 4JPVH 2OK0L 4WV1A 1F56A 2LVEA 2IBZX 3FFDB 3FUMA 4I89A 2OMZB 1ZWIA 5GSVB 3NN8B 4FQPA 2WZPD 2VAJA 3QS2A 4IOIA 4AK2A 1DQLH 4GIOA 3S3JA 2Y06L 4KRLB 1JF1B 3GJFB 5D96B 3D2TA 4A63A 2JV6A 3CHRA 5LUMA 4BUGA 1EO8H 2NY3C 3P2DA 1AY1L 3GMLB 3L74J 2I60L 1HE8A 3M9QA 4NQDD 4U7JA 2P8PA 2V5TA 3BN9D 3MTRA 3F7VB 3PJSA 2FNWA 2ZUQB 3H1KG 3DUSA 1NIEA 5B4MC 4UTAL 1VQPP 4Y4HC 2IYPA 1HQ4B 2N1TB 1F4AA 1G7HB 5E56A 1W0YT 3MNWB 1JMZA 3TH4T 2OZNA 1VFMA 1D7BA 2KZBA 4GI9A 2H1XA 3Q8CA 2WTRA 5TDPA 2H3KA 4XBEH 2UWJE 3FJTA 3JTTA 4U1NB 3KPLA 4ANXA 3WELA 5CM1A 2X70B 4M1GL 3LMJL 5LCVL 1JBJA 1KLFB 3MZWB 4P4KA 2IF7A 3UBGA 2R29A 2WJ7A 3LD8C 3LNGA 2BVPA 1EHLL 5IB3A 3BUYB 4N85A 4HSCX 4X0KB 4H2AA 5L9DH 5BU8B 2VXVL 2BSCA 2XU6A 5FO8A 1ZW0A 2GJJA 3L5HA 2WTOA 4ZMPA 4J2QA 3O6MH 3VFNB 1E30A 4H13B 1SEBB 1U95B 4KX9A 2ZUUA 1PD0A 1CLOL 3BPCA 1AFVL 1MNUH 3NJNA 3MRLA 2WXFA 2CR0A 3WFEL 1T5WA 1ZIAA 2GI7A 2R0KL 5KYYA 3D2UA 2B1AH 1DUYB 3L4UA 4YHZL 5I1KH 1DDHB 4Z1MH 3KW8A 3KAAA 4MJIB 1NCAH 5ESQA 3LHPL 4KK8D 4ZZKA 5FPIA 1T5KA 3PXJA 3MJ8B 1D5BB 3MLWL 1GSMA 1QLFB 2IGLA 1K4CB 3LRHA 4MDJB 5FWQA 1V5JA 1BPVA 1W6LA 4NZTL 2C0WA 1O6SA 5H4ZA 5L88H 1JZHA 1P1ZA 3NPZB 3HE4A 4ZKPA 1U4FA 3B7RL 5G4MA 3GB7A 4KHTH 4JFOA 4YQXH 4P06A 2DI8A 3ELQA 1EDLA 3P3SA 2J59M 1OO2A 4PJHB 4Y5YA 5I6PA 4S1QH 4U0RC 3FC8A 3DVNA 1E4JA 1QG3A 3O6QB 4CU7A 2BASA 2WMMA 4EZKA 3O3DB 1BFSA 1KB9J 3A6BL 2YN3A 1GVIA 4U3HA 1N8OE 3FO2B 5GRWA 5E7BA 4BFFA 5JHDA 2B87A 4D9QE 2CHWA 5IOPB 4CBPA 3EFFA 4PB0H 1RY3A 4XPHL 1G7LB 1YMMB 4G3YH 4PJBA 4BFKA 2M8RA 1KJ2B 3P2TA 2VN6A 4A39A 3W5MA 1JVLA 1V3MA 2BS8A 3NFNA 2OS7A 4R6UA 1U93A 2EEAA 3JYBA 4WK4B 4XNMB 5I0XA 4M62L 1GMJA 3OKOB 1M9SA 4NHUB 1IFDA 2BMKA 4NGHH 2PP6A 4TTDC 3M07A 3WJLA 4LQFL 2PYEA 1RJYA 1BXVA 4R7LA 2ITEA 2ZT9C 3O9WB 4KKRA 1OP5H 2WBKA 1J5DA 3SO5A 1N26A 1ECZA 3QT2A 3C6LD 3I9IA 1IEAA 1H5BC 4JJ5A 1QBML 2R0LL 3CLEH 2QPUA 5D8JH 3NOIA 2ZJSE 3M1CA 1CGXA 4KTEH 1QRND 5IBTL 1AKPA 1WZMA 2K3HA 3KPEA 3T4YB 2BSSA 3FU6A 1R5SA 4NQTA 4WGKA 2ZSVB 4S1DD 4W4OC 2K9YA 4ZYKB 4RA3A 3L4ZA 2KNCB 2WYIA 2J2ZA 2YC1B 3GWJA 3OG4B 4WI3A 1R9FA 3EYUL 3MPCA 3RNKA 1AS6A 3BGMA 4KHXL 3ZO9A 2WLIA 1IO4A 2WZ0A 5JDSB 3B3IA 1ZVSB 4J6RH 3CFIC 3VW3H 1D7MA 4NERA 3MOAH 3Q2YA 4FABH 1X6NA 4ODVH 2CUMA 1FN4A 4UAOB 3TU6A 4IIQC 4MNGE 1KORA 1NH4A 1ZRTE 2ED9A 4O5LL 4NM8H 5D7IB 2R32A 1YQ2A 1V7ML 4L8SC 3U30C 2W95A 1PIXA 3FUNA 5E2VL 1RVFL 3NCYS 2VKWA 3ZE2E 1J11A 4U1GB 3J8F7 4QRUA 3T6XA 1A02N 1PLBA 4JVWA 5F97E 2XZCH 5CJOH 3CZEA 5IR1B 5HP5A 5HGHB 1X5FA 2JQMA 3Q7JA 1EXUB 4HV8B 3UYPA 3D4ZA 1E3FA 3FQNA 3AEFC 1H8SA 4G83A 4AEEA 5DFVD 1BD2B 2CHZA 3DMMA 3D39E 5JHLH 2ZYIA 5IB5A 4W4NA 2BVEA 1K9MQ 2NNAA 4X99B 4AJYV 2QSTA 2ADIA 5LJYH 4I2XB 3MHZA 1GYWA 3RVWC 3PJSK 1EEUA 1K8IA 1NL0H 1OGPA 5DJYB 2HFEA 5CZXD 1OSPL 1ZLUH 1CE6A 4ZNCD 4X98A 1W2EA 5F6HJ 2F08A 3BASA 3RWJB 3DROB 5ANMA 3AUVA 3HNSH 4FNTA 3UTTA 1L0QA 4GT1A 3EJZD 3N42B 4HP5A 1HHGA 4HXAL 2O61B 3I9GH 1YNTF 2A0LD 1KGIA 1XGUA 2QLYA 3NZHL 4FNSA 5C97A 5GGUA 2QR0A 5CMAA 3SE9H 5IHUL 1E5AA 3D50A 1E4HA 1PQZA 1USDA 2YUVA 4XPBL 3VGFA 1GZPA 2I85A 1DBJH 1U42A 3OQRA 5DMKA 5E23A 4RBPH 5IMMB 3DO3A 3E7KA 1N67A 4HZLB 3U1PA 2CDEB 1NSNL 5E7FA 3T65A 2R4SH 5FYLE 1D5MA 4HUVA 1WFTA 4XP5H 3VFVA 2B3RA 4NBZB 3GIVB 4YDIL 4CUCA 2FJHB 2UZIL 3KYNB 4HS6B 4O58H 3W37A 3HRNA 1LE5A 3O45B 3L74G 3GSVB 5BOPA 1MLCA 1OF2A 4IBLT 4JZOB 4LSPH 5D72H 3WU1A 3BLBA 1OLZA 3RPBA 3SN6N 2O26U 1FGVH 1KOAA 2K9UA 4G9FE 4M1DL 4BRJA 4O9HH 1IMHC 1FFOA 2NQCA 2R5DA 2GHWB 1A22B 1FZMB 2O6EA 4N3YB 4XX5A 1T3UA 3AS0A 1MCNA