5AW3B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 100 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw3B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw3B02
2XV5A 2R32A 3L35A 3NTNA 1GTWA 1H8AA 1S9KE 1CZQA 1GZLA 2R3CA 3A5TA 3V4QA 3IR9A 3WGVB 3NFQA 3P8MC 2W6AA 2QM8A 3MGNA 1T2KC 4I2LC 5AVXB 5APYA 5AW1B 5AW7B 1KQLA 3NMDA 3I5CA 3M0AA 5AVRB 3UIAA 2P67A 5AW2B 4C7NA 4RETB 2XZRA 1CSBA 3KQGA 5AW5B 5AVUB 1GU4A 4M3LA 1HWTC 1H89A 2E42A 2ZXEB 2WTYA 4XE5B 1IO4A 2KP8A 3L36A 2IPPA 2VRSA 2Q7CA 5APQA 5AW9B 1T2KD 3HE4A 3M91A 3V5BA 3OAKA 1NAFA 1SLQA 1YYCA 4AUWA 3TNUB 4GKGA 1FOSE 1DH3A 3KDPB 4DZOA 5APXA 1SP4A 4AYCA 4EOTA 5AVZB 4KHXA 5AVSB 2WWWA 1J2JB 3HE4B 3P7KA 2Z5HA 3HE5A 3M06A 3T97A 2C9LY 1CI6A 3P32A 1JUNA 5APUA 1GK6A 2WPSA 5AVTB 2WT7A 1G2CB 4B86A 2Q5UA 2P7JA 4LC1A 2JJLA 1A02J 1HBWA 5APTA 4RESB 4GT1A 5APSA 3VYIA 1A02F 1H88A 2P2UA 5AVVB 2N9BA 3SWFA 2Z5IA 3VMXA 4HYTB 2WPRA 4C7NB 1GU5A 1OXZA 1HUCA 1GK4A 1S9KD 2R5BA 2R5DA 3B8EB 2QM7A 3O8ZA 5APVA 5AW0B 1GD2E 3LIEA 2YO2A 1MV8A 3LIDA 2BASA 2YNYA 3WGUB 5AVYB 3A3YB 2XU6A 3L37A 3M9BA 5APWA 2E43A 3MD0A 3A7OA 5AW3B 1FOSF 5AW4B 1HJBA 1NWQA 5AVQB 1MFZA 2Q3IA 3VMZA 3M0DA 3NXSA 3TK1A 1X8YA 1OWAA 3HE5B 4AQRD 3HTKA 1CI6B 2YO3A 2ZFCA 5AW6B 2WT7B 4I6MC 5AW8B 2C9NY 3VTPC 4JYCA 1JNMA 3VMYA 3A2AA 2H7HA 5AVWB 4JYBA 5CMZA 1FAVA 3V4WA 3TYYA 3M9HA 3TNUA 1MUUA 4C46A 2W27A 3VN0A 2WPQA
chains in the Genus database with same CATH superfamily
3P9MB 3OWEA 1JY2P 2AK4E 1HSBA 1NWOA 4PD4J 1G9MC 3FCSB 4QHMA 2WKOF 1UVQA 2FL5B 1RIVL 3LN5A 4ODHH 5E1AB 1NTZJ 3Q9PA 5D2NE 3OKNA 5B1JA 4A7VA 3MV9B 4U1IA 2AK1L 4XC3H 2I85A 1RY7B 4KNTA 4ZTEA 1FI8C 3L3OC 4XNYL 4LAJH 4N78E 3CBKB 4QTIH 2B59B 1P84I 5D1ZB 4ZBJA 5IMKB 3P0VH 2R0LH 5LG6A 3K6SB 2YBRA 3LRLA 1A66A 1NL0H 1PW3A 1Q9OB 5MP6H 1D3CA 1UT9A 4DKAA 3O3EB 5H37A 4AXWA 1A6AA 4D6TE 1H3GA 1F1GA 4KI5E 3QFJA 5IVXB 3MKGA 2R1XA 2ZCHL 2H47C 1IIIA 2FEEI 4G8GE 4GAAA 4NJ9L 3UAJD 3K91A 5DMKB 3SJVA 2P24B 1I3VA 2QHRH 2PCFA 4U33A 1S5LX 2DQHL 1NAKH 1T1ZA 1RH5B 2AQRA 3QO1B 2VAJA 1BLNA 3WNKA 4WI5A 3AADB 1B90A 2YOCA 3MLXH 5ICYA 3PP5A 3FO1A 5EDXA 1P5UC 5C6PB 1UIIA 1CR9H 3BDYL 4DTGL 4N0UB 3LSOA 5FGSA 2YA1A 5C0CA 5D1XD 1XGTA 1BE3G 1AE6H 3D87B 4WO4D 5IG7A 2JI3A 3N41F 1RPQA 1G7JA 4U3SA 5K59E 4E9TA 3G08A 1F90H 1DSFH 4PRNB 4AEFA 3LYRA 2E75D 5CBOA 3MUUA 4PBVC 4GXVH 3VXMA 5MEPA 2EO9A 4MWFA 1U2HA 5IIEB 1GGIL 3SE3C 5T1JA 4QJ3B 3GUTB 2DV6A 2X4OA 1PKQB 5DJYB 3L4TA 5E6ZA 2G9HA 2XG4A 3EZ8A 5C0DB 1AGEA 1UA6L 2Z7YA 4I8DA 5KUMA 3HAEH 3GMOB 4UT7H 1SZNA 1Q72H 3FQNA 4NPYB 2EYRA 3BUYB 4OF0A 1KXQE 2YHGA 4K5LA 1EWHA 5ADOH 1BSNA 1LEIA 1T3JA 4KZDL 3I6GB 1VADB 2GUYA 4NPKA 3K7UA 4RCAA 4IKIA 5LBGA 4IKLA 3U30B 1A8ZA 2D2CD 1NLBL 3LZRA 1LT9A 2WMMA 4HIJB 4AYGA 4HOXA 2JWYA 2JH2A 5IV2A 1MW2A 4P2OA 3L3JA 3GKWH 3NACH 3TNNB 3L71J 1NTKK 1LEGA 4XNMA 43CAA 4F93B 4D6TJ 5KYUB 3VXQA 4L3ED 3WU1A 4WJKB 1QLEH 2A74A 4OQTA 3DURA 1BSIA 3C8KB 1GGCH 5CJXC 1KXVC 5C6TL 5SX4H 4AMKH 5ITFA 4NUJA 2WWMC 4WI3A 3RPIA 1H6EA 3M17A 3U9UA 4A2GA 2PP8A 4XGZA 5IZ7A 1EAPB 3E1RA 5C0BA 2FUQA 3MLTB 4U1MA 1T2KC 1T7VA 2NNAA 1A0QH 4JM4L 5FOJA 5IQNA 1SQXG 2G3NA 4JHUA 1A6WL 1L2PA 2XZCL 1IGYA 3O6QA 1MVYA 1FCCA 4LSVH 5I18H 4K94H 2WYHA 1L7TL 2CSPA 2DZEA 4MMYB 5MERB 2VABA 3D0AA 1I8KB 3MDJA 1NINA 2BHZA 3QEGH 4P9MH 1MCWM 2HKHL 5IQ7H 3HFML 4MDIA 3HHMA 2LTQC 4JKPL 4PBXA 4ALAH 5HYSB 3Q05A 4S1QL 3IMSA 1PY9A 2FHFA 3L4ZA 4OUOA 4PD4H 15C8H 2X6BA 4Y5VC 3VTMA 2FYNB 3US1A 1THAA 2OKMA 3V4PB 2X41A 1UKTA 2QQQA 3NTCH 1JPGB 1FDMA 3OKDB 1RVFH 1ZHKB 2H0PA 2ED8A 5FO7B 2KS0A 2Q8AH 3SKNA 3MRKB 2A6JA 3MJ8A 1FORH 4MVBC 1LO0L 2R83A 5EIIA 5FDWB 3MV7D 1DQQB 1QI4A 3L3OB 2Z5IA 1QO3B 4K9EC 4RX4A 3VXNB 3PLNA 3KHOA 5E2WL 2H6PA 2PW1A 3G6AA 5D7IF 3CLQA 1U3NA 2NUPB 3VXUA 1IFNA 2IANE 3Q0HA 4ZYKA 1J1OH 3EGSA 4PVLA 5JW4N 2Z91A 5HI3C 3VO0A 5K9JH 4PRDB 5JIPA 4OF6A 3MROB 4AUUA 3ARQA 1U57A 1S9XB 4FFYA 4ZO8A 4JFDD 3P4OA 5FV1L 3WMQA 2VNCA 3MI6A 4HUVA 4GUPA 5EF1A 2BVPA 1G7PA 1G0YR 2QMKA 2ZOOA 4FZEL 2NSXA 1U92A 3QYNA 5FECA 3HE7A 1INQB 3ECWA 4Y1SA 2Q7NA 3KPRE 4BZ2A 5A6LA 2V17L 3K71A 1UH2A 4TLKA 2KLUA 1FNAA 2JXMA 2OMNA 3E6FA 4QYOB 4D0BA 5E6IA 2CHDA 1ZWIA 1SQXK 2J21A 3PL6C 4FFZL 3ILEA 2DQMA 2W9EH 3LZNA 4N24A 4OT1L 4QOKB 3Q5OA 5J9PB 2VR3A 4OD1H 5A2IH 3FRPA 4UMSA 1CFVH 2D7MA 4H0HB 4HU8A 1RK0A 4N26A 4PJHE 4IRJD 5ABZA 3WL9A 1A9EB 4IIQA 5CN1A 3UBXB 3ULVE 3EFFA 1A7PH 3QISA 2FUTA 3F7QA 2HLOA 4X8JA 1S9YA 3QCUH 4GI6A 1JZ6A 1MCJA 4G83A 4FJYA 3GD1C 3MZGB 4M29A 1UOLA 4GP5B 5EORL 1N8ZB 4S11A 4QXUL 3WXVL 1CDJA 3BUIA 5DVNA 5EEVA 3ALWA 1U41A 3QHFL 4DUWA 1KCKA 2XA8H 4MNGE 4ZI8A 3ZHFA 4DVRH 4GW4B 3W0WE 4JREC 2ZTBA 3WY2A 2FX7L 5I1KH 3ATAA 3BEWA 2YOAA 3C60C 5E24E 2WB1A 4M1CC 5HDBF 3MACH 3HNVL 3P77A 1CFTA 2EDBA 4J3OG 4ZUVA 5IMLA 5MENE 4XP9H 4NAMA 5F1KC 4U3FG 2QGCA 1PZAA 1IZNB 1S7WA 2OMWA 2VDPH 2YXMA 3MUGB 4YEFA 3ARFB 3VWKA 3UGXA 3X12A 1RMFL 2BY0A 3B9KA 4XZUB 2I9TB 3H7BB 3L70G 3QDGA 2JCCA 5BVJA 2P44B 1CE6B 4ZNCA 2XY1A 1SVZA 1XR8A 2E7BA 5F7EH 2WUCH 4K5MA 2Z4QB 3GQFA 3A0HE 1XGPB 2ZXDA 4Z3FA 5BRZE 3DDGA 2XKNA 1XTMA 4AE1A 2EVGA 1MFCH 1IL1A 1RZJL 2Q8BH 1J5CA 5CUSL 5AOLA 3ZUNC 1BD2D 2CQVA 5DYOB 3K1DA 2DQGH 1F4WH 2NPSD 5LN8A 2LTQB 4WWKD 4IRZA 1VQLP 4IOIB 2EIKB 2HMID 4BEIA 5IFJA 4DSYA 3EH1A 2YQBA 4Z0XA 1DQDL 5C0AD 3VWJA 5D93C 5GGUB 1IVLA 2UXFA 4R4BA 2XZQH 1VQ4P 3I75A 4J3OC 4JS7A 4AIZA 1LO2H 5HYIA 1KILC 2B0SL 5KKZC 5LGHH 3T65B 1IBFA 2J8UA 5FB8B 3IXAB 3RX7A 1B6DA 1INDH 3VNZA 4NHUA 4KTDH 2ZWZA 4QOKE 3CXHK 2P10A 4G80B 3NZSA 1W8OA 3L3DB 5J1TC 3S88L 2PUQT 3DXAE 4IMKC 5KVEH 2NR6D 1DX7A 1QLRB 1YNTB 3NCMA 5DYFA 3VAEA 3C5ZD 4HIEB 5CF3A 2V5SA 2FYYB 2Y3AA 1CQKA 1N5YL 1SJHA 1HEJC 4LNRB 2HX7A 4NM4H 4LCWB 2IH9A 2NY5C 4UT9L 3AREA 1P2CA 2AJYL 3TFBA 1FDLH 4Y2DD 1P7QD 1TYJA 3BJ91 3LQZA 3ZDYE 1OSYA 1U8PB 4TNGA 5SWQA 1XF3A 5HY9A 4OCSL 4YR6B 1GY1A 3D4YA 1FA4A 4DOJA 1BVKA 2EH8H 2IAMC 2VL5A 1NDMA 1D5IL 4Y1AD 4GI9A 2PNDA 2AEFA 1PZSA 1PSKL 2C4XA 2FX8H 2PO6A 2MTAA 3OLIA 2DTML 1HXMB 2R0WL 3O6KL 3E80A 2WQSA 1JMMA 2IPPA 1YEWA 5AL8A 2ZXAA 3SGEI 1GVIA 1SXZA 1WZAA 4PU2A 5C1MB 3OZKA 3V10A 3M91A 2HFFB 3F58H 4S1DC 4EVNA 1I1AB 5EFWB 2RJMA 4OJEH 4XVSL 2Q7AA 5FYLH 3LZFL 2XG5A 5AYQA 5KBNC 5AVZB 3SGJC 2Q6QA 2Y7MA 3T09A 5LQBL 3KZ8A 5CHNA 4OH2A 1WUNT 1T0MB 2YFNA 1HHJA 3V2AR 3VQLA 3G6EP 2D7NA 3AEBC 1L9RA 4JFEA 3GO1L 2ADJA 3KG5A 4LGRB 2XQYK 3MNVB 2IF7A 2NW2A 4FQPA 1V5JA 1V05A 3A0BE 1FV1B 4AJ0A 3MJ7A 2BSTA 1P4LA 2X2UA 4LLDB 4O00A 5F8QC 2VLJB 3NA9H 1M90Q 2ED7A 1GD2E 3L3IB 3O8ZA 3O0RH 5D8JH 2CBMA 4GO9A 3FTWA 5GJSH 5DQJA 2YR3A 3G5VB 1TU2B 3SHSA 4NWUH 3RPKA 4HJ0C 2GC7C 4JREB 4G42A 1QYGL 4L8BB 1D9KA 1HN1A 3ZL2A 4YGAB 1S7TA 3C60B 2B4CC 4OLYH 5D5ME 4KKAD 4XNUL 4QRUB 2OPCA 2BIOA 2X4RA 4KKCD 3P3YA 4ZUTB 3IJSB 1X8YA 1Q9KB 4D9RE 1EERB 2NY6D 4G1MB 3HTKA 4KPHH 4PLNC 1T83C 4N5EC 4HIHA 2M83A 4KI5D 1KG0A 3L74G 1WEJL 1FNLA 4PCKA 1M7UA 3A4DA 4NQDA 4G8GD 4LSRL 4OZHE 3SGKA 1ZA6A 3WFBL 2JR8A 3CIQA 4ILDA 2CLVB 5BQDA 1QGKB 1HNFA 1QUNB 4M61B 5DRWB 1V54B 5C0EB 1FG2B 1P7HL 5D96C 1OPGL 3VGBA 3FSZA 3NFPA 2W60B 4NYLA 4P2QD 4Y4KD 1BE3J 3VFOB 2PCXA 1Z9OA 4U05A 1N3NA 2WB7A 4E9SA 1MVUA 1NGQH 3DYPA 2KZWA 4PV9B 5GSRB 3GG2A 3V6ZB 1NGWB 1O9WA 4HLZG 1QI3A 1MWAB 5F1SA 1F11B 1SVBA 2F1AA 4JPWL 4BQBA 3O3BB 1FZOB 1GZHC 2J4WH 4UQ9A 3OAWA 5GRWA 5A2AA 1PZ5A 1HOCA 4NRYB 1N7SC 1TVHA 4E68A 5C70A 5DFWH 2QGDA 4QGTA 5DZJA 1MPAH 1J1PH 1U42A 1F02I 3C9NB 5A40E 1FN4A 2OXHB 3DOHA 5DJXB 5IB3B 1W91A 4UINH 1G7HA 3IJ9A 5D93B 3PHSA 1I4FB 2FLBT 1XH2A 5LCVA 1UM5L 3PGDB 4RGMC 3WTVA 4IGBA 3V4PH 5AW9B 1KILB 1WSST 3PFUA 4WHCA 5KKZB 2VXUL 3SDXB 3KLLA 3LKNB 3MRLB 4XWGH 2KXPB 4R0LA 2YPLA 4MAUH 4ZMXA 3ARBA 5EC1B 1SQVD 4HK3N 3SKOA 4YHNB 2OXGB 4EOWH 1UZ8A 3L1EA 5KYYA 1VRSA 5C0RL 2IO5A 4N86A 3FO0L 5I1EL 5DWUL 2Q1KA 1GMEA 2QQNH 3SYAA 4FOMA 3UZEC 4GW5A 2A38A 3T6VA 5L0QC 3R0NA 3VI4F 1U8HA 5KVDE 1U7JA 1H19A 1DD4A 1A02F 1NC4A 4UM9D 4LRNH 3VXRA 3B6SA 3TU6A 3VFSA 3HZYA 3T0AA 3UEZA 1YMMA 4BFGA 2HT4C 3RTQA 3N1QC 2JK5A 2UZPA 2XDJA 4J1UA 4MX7B 2IAMB 5ENWA 3WUWG 3BUPA 2BOBA 1SQXJ 3AXHA 1GW6A 1E2ZA 2XBTA 4LHUD 5EN2B 3WU2H 4OCMC 4WI6A 3O4LE 4JFWA 3TT3L 5HHQA 1J1XL 2YNYA 4ZOBA 2EE9A 4HEPA 1F4XH 4Z6AT 1S7RA 3TN0C 2Z92A 5D7LA 4AMXA 4FFWD 1QR1B 3QZOA 3VA6A 4LSPL 4OFIA 1AZRA 5J0BA 5F72S 2O01J 3EH4B 2FLMA 3PV6A 3QH3B 2JJWA 4OV5B 3OLDA 4FTVE 2Y6SD 3O3AA 2D3LA 3EJJX 1IGFH 3H6PA 3EO9L 3VTPC 1BQUA 1IJ9A 4M62H 4WWNA 2H45A 4Z7QB 4QRSA 4NZUL 1TG8A 1E8ZA 2YD8A 4G9DA 4CMHB 1NM4A 3QHZH 3M9QA 5IR1A 4NO5A 2BS8A 3BJLA 4X9FA 3M9HA 1M1SA 5DVLA 5B1BB 1D5ZA 3HN5A 1MQ8A 1BCCG 3KXFE 4ZMQA 4N0YH 3MLWH 5DJCB 1HGVA 4FS0A 4KHTL 2MOGA 4KFMA 4RJTA 4GOSA 2FHCA 4H8WL 1RF0C 5E9AA 1SY6A 1CDYA 2EILB 1Q1JL 1OSZA 4JRYB 4O5LL 1E8XA 4YHPA 5FYKH 2E76C 1TENA 3DIVA 2ADYA 1DN0B 3WO4C 1FJKA 4K8RC 1T0OA 3TP4A 2E8ZA 4G8EB 4JVWA 5IBLC 2FEEL 3FB8A 1QRNA 2CNYA 3TF5A 1AIFB 4FQIL 4G6KH 4L1BA 1NFDA 4XP6L 1TQCC 2GIXA 4M6OL 4PWIA 4YDIL 2CJUH 2PYEE 4MZ2A 2IOMA 3E2HB 4LDLB 1S46A 3L8QA 3DETD 2OMXB 2R2EA 4K3EL 1BG9A 4U3FE 5I66B 1W80A 1CYXA 2VXVH 3D0VB 5CBAA 1EDQA 1ZDQA 3B2MA 5CBNA 1NDTA 4OD2A 5IF0B 3T6XA 2EH7L 3FT4B 1MSPA 4LLQB 4XTRD 4YEEA 1YN6A 2GT9B 3UL4A 5D96B 5KBLA 4RGND 4KROD 5I30H 3KPOA 3WE6B 4PJGE 1JPTH 4CVUA 5I9QC 3MLYH 2F8VA 4K55A 3WNOA 1UADC 1V3KA 4AE0A 4LC1A 3GLDA 4HWBA 5DRZA 1OTSD 1NEZG 2ZYIA 5LGYA 5LAPA 3G6JE 1IFMA 4HHAA 1JFHA 4XCNB 2OMVB 3PIQA 2HTKC 2IGLA 4LVNC 5AD0B 1N7SB 4M4RB 4KXCA 3UJIH 3R0MA 5ELIA 4P23A 3EDDA 4XPFH 1Y7VA 1CFSA 4POYA 3FQ4A 4YHIA 2R5DA 3ULVD 4H8PA 1DQJA 3AEFC 1J12A 2E9BA 2FBOJ 3NZ8B 5T3ZL 2EDJA 4AIOA 5KWYC 1EJFA 1JTHA 2AXGA 4B7LA 1CLZL 4TNWK 4OU3A 2VB5A 1KCLA 1R3HB 3UYRL 1TMQA 1OHZA 3MBEB 3V5DB 1CF8L 2QZQA 3PXHA 1OGPA 3QQ3B 2F9BT 4LLWB 4PGBA 4BK5C 1ZSDB 1AR1D 5JIMA 1I1FB 1JE6A 1RZQA 3DV4B 5KJRH 3UCQA 5LUMA 2NQCA 1F3JA 1CTNA 3T0EC 4E36A 3W0WD 4J3UA 5HHOD 2HT2C 4K9EH 5L0QB 1KIQB 4AYBA 1A1MB 1OB0A 4PGEB 4JFXA 5F1IB 3TEUA 3WS6C 4EN3D 5ABAA 5FEBA 5MEND 3CMEP 3BT0A 3T3MF 4GG6A 2HH0H 1AS6A 4RISH 4BSVB 2WIIB 3IJHB 3QUHA 2BC4B 4MMZC 4ZZFA 2QPUA 3L70J 1KENL 1JUFB 2KSJA 3HS0C 5I1IL 4IBVA 1TQSA 3LJ3A 5AWNL 3NTNA 2UY7B 3GK8H 4ODUA 5C2UB 2XSKA 4YHZH 1QSFE 1TF4A 5C7XH 3QDHA 1Y1UA 2BWDA 4NN6B 2O01H 2R29L 4Y16C 1XIWD 3TN0B 1CDBA 2OZ4L 5AW1B 1NEUA 1OAZL 1S5IL 2NTFB 2YD2A 2JIXD 1F5WA 2DKSA 4LPVA 4XNXL 5BRZD 3EO0B 5I6OA 3HOGA 3UIAA 1DBBL 1RUQL 4PRPE 4C83A 4UNIA 1JN6B 1GOFA 1T3FA 1JHLL 3G9VA 4GAFB 2D03L 2JWAA 3ENEA 1Z9SA 2H26A 2WXGA 3T3PF 3PPEA 3SCMA 1YEGL 3RDTC 1KCRL 2N59A 1ZANL 3HBZA 4UYPA 2O5YL 1PG7W 4K5NA 3EZJB 5E08H 2WW8A 4QTHB 4M7KL 3QIBD 5IJKC 2P42B 3BUTA 1F1DA 2QKSA 3VI3B 2XICA 4OFYA 3TNUB 1D7BA 1KB5L 1YY9C 2E7HA 1KTRL 1WIPA 2C1PA 5FFOA 3O11A 4L5FH 4WK0B 4GNKB 4QRTA 4Q0XL 1A1OA 5A6IA 2KLVA 4TQEH 4BFEA 2B5IB 3BN9D 4JLRA 1BAFH 5EUOE 1JUNA 4PJDE 1SFCC 4BWTA 3NCXA 4KH9A 4WCYH 3WUWB 4YTPC 3WO4B 1KGWA 5KVGH 1LMIA 5J89A 1H3VA 3NCBB 4YXKH 5C71A 3DXAD 4DJMA 3BKYL 3RVVC 3MXWL 5GRXG 1TUPA 1DBAH 5D72H 3IAQA 2A9BA 2AF2A 5SWZE 2CLZB 3RUGF 1I8LC 2AGJH 3B5NC 1KD1Q 1H9DA 2YK1H 3FUJA 3II1A 1C9SA 2W6JH 2HVKA 2Q1EA 5APWA 4WJ5B 3H3BC 2GUSA 3CZFB 2BSRB 4LAQH 1JK9B 1K9MQ 5KAFE 4URTB 1NICA 4QMEA 2K9FB 3V6OC 3U1AA 4OZGE 1CK0L 5TF0A 1CDGA 2AEPH 4C56E 4ELMF 3DBXA 5GZOA 2H7WA 5GRZA 5C0FB 5I8OH 4U6YA 1D7CA 1U7MA 2GK0B 4U6HA 2YO3A 4PJBF 4S0SD 3LKOA 3V5HA 1TSHA 3D3VA 1HVVA 3H2WA 2JKXA 2FQDA 3VFTA 2GW5A 4LCYB 1EHNA 5C07E 2Y36H 2WWMD 5ISZB 5AOMA 1RZIA 3UH8A 5EU3B 1E27B 4WUUA 4YSAA 3BZ4B 4R9HA 4ANXA 5JZ7C 3QXDB 4LVNB 3EQ2A 3CXHH 3H4HA 5DSCA 2XJKA 1KN4L 1MWAH 4XP5H 1AD0B 1NH6A 2R4RL 3FK3A 3OHXA 5I6PA 3ASNB 1BHGA 3ZZSA 1RJZA 1PZ2A 3L2MA 4ZNEA 2EXYC 3BAWA 4YE4H 2IPTH 2L3BA 3P1VA 4LL1A 1RHHA 2A06E 2ENSA 4MAYB 4PVBA 4UDUB 4ADGA 1TITA 3MCG1 2XIDA 1NIDA 3RFZB 4M43L 3M0AA 1JNHA 1DQIA 1IAIM 2P5EB 3OB8A 4KJPC 4JZOB 4WNQA 25C8H 1ZLEA 2PXYB 3NIGE 1UKQA 1BXXA 4UQ3B 1JNLL 5GTIH 3JVGA 3GSNA 5F3HB 4NQQA 2FWOB 3J07A 4G6FB 2NXYD 4AQ1A 1MCKA 3HD7A 3NFSH 1M57D 1MY5A 4PR5B 3L74J 1OM3L 2R9HC 1P7BA 5C09E 1MIML 3TYFB 3B43A 4LPUA 3RNKB 5D9SB 3UTSA 1AGCA 5KTBA 1IARB 32C2A 2NY5H 3OF6A 4AKQA 4OTXH 1OF0A 4P5MB 2EZ0C 4GMSL 1UQSA 4XCCH 1FDIA 2VZTA 4HV8B 3CWBJ 2BSDA 3ARGD 4XC1L 3O8XC 1TTRA 1JWMA 3CFDB 2VWEC 2F53A 4O02L 2QMJA 3CVBA 1JXJA 3AW5A 1RD6A 3MFFA 4D7PA 2RH0A 1LDPL 1E5YA 3LNDA 1E4WH 4KJQC 4UILH 2BCCJ 2NNRA 3ZTCC 3N04A 3FUKA 5IEHA 4BKLA 3MJ9L 1OXZA 1L9MA 3FFCA 4H1LH 5CGTA 4F9LA 4G11A 5CNHA 2NY3D 1MFEL 3BP6A 3WIHL 3L48A 3V0GA 4Y4HD 1M1JC 1R5VA 4G7YL 4JDEB 4IBUA 2X4SA 4IMLA 5INDB 5FYKU 1YUHA 3RDTB 1I8MB 2E43A 1FL3A 4MTMA 3C2SA 5IKCA 4Z7UB 3UO8B 4MZIA 3A6BH 4OGZA 3GMNA 3KPQA 2JJTA 5HJ3B 2ZCKH 2WP3T 3UC0L 1KYUA 1Z0MA 1J0YA 1I7TA 2PTUA 3V7MA 3D30A 4CC4C 5KSVA 4ONOA 4AZUA 4DETA 4FZ8H 2H6OA 1BF8A 4A67A 3N4XA 4LMQE 1U3JA 2KH2B 3JVFC 3KD4A 2J1WA 1SFCB 1SVFA 3HBQA 3PWNA 2YD7A 3QEQD 3DTUB 5DJ6A 3OAUL 3P2DA 3DHMA 3OKMB 3RJOA 3DVGA 2HN7B 1QWUA 4N90D 4HFWB 1NTDA 4M93C 1O5DT 1SQPG 3K5RA 1O9VA 1T0NA 4H5SB 2QTEA 3RIAK 2VIRB 2W65B 3EOTL 2VT0A 4NAJA 3VRIA 3B5NB 2NTSP 4PP2B 2HFEB 3VFRA 2H8PB 3UYOD 4LCVA 1E4XI 3MGNA 1GAFL 2Y2TA 4U6XA 1BVOA 1JV2A 5DUBA 2PPCA 5T1KB 1SQ2N 3RWJB 1LE9B 5DO2D 5F9DC 2CGRL 4DFHA 3SDAD 2EDKA 4OKDA 3S37L 5BMFL 3F7PC 3T0EE 1OLZA 3O4LD 3APDA 1NQBA 3A67H 4F27A 5DD6A 3OPZL 1MHPL 2OJ1A 3CVCA 1NPUA 4FCAA 4N85A 4OV6F 3JSSA 4WTWA 3RIKA 1UACL 3QO0A 4G8IB 5D7JC 1VPOH 3LH2H 1ZTXE 2CMRL 3WTSA 1VZHA 1FZAA 3Q44A 4UQBA 2LU7A 2K9JB 2ADFH 2HTLC 1VACB 4BE6A 4EOTA 4FTVD 5IBTH 5E8NA 2XTJC 3HC2A 4NOBA 4KO7A 2BRQA 2GTWB 4YHYC 4GYBA 1JDAA 3U7AA 5I24A 1BCCJ 1AYRA 2FJGA 4XBEH 3TA3B 3UTTD 1IJDB 3UGEA 5PAZA 1WT5C 2W0PA 4RSYA 1G1IA 2UVFA 5ILTH 4HAGA 4DP4X 4OZIB 3KXFD 3QJXA 4G7VH 4PLJC 1S7QB 1R6VA 1DDHA 3WYRA 3HJ0A 5B1AB 4FLRA 4GO8A 5TE4H 1G7QA 3NJVA 1E30A 5C3LD 1D5BA 2ZKWA 5T1LA 3QWRD 3LXBA 1NIAA 4Z7UE 4ZFOL 5CCHA 5LKNA 1TXKA 2BNRB 3OZ9H 4U6VH 3A6CL 1X4YA 2AK4A 3M9BA 4P5TC 3R1GH 1LTAC 3MD0A 3L3HA 4ANWA 1CS6A 3DV6B 3QDMA 5GS1C 2GUOA 3CCHA 5GGRB 4X4XB 1F4YH 3QUKB 5D2NA 4KY1L 4GS7C 4XP4H 2QIWA 1FLTX 3MRDA 3O9WA 1A6ZB 2O01N 1PD6A 3U0WH 2F58H 5DWPA 2E7LC 3LS5H 4U3FD 1AO7E 4GW1A 4QJ4B 4LL4A 1S9VA 4PIBA 1N19A 4B9YA 3LNHA 5FUCC 4FTDA 5HGAA 1AD9B 2V3FA 2WINA 3PAUA 3C5SA 3H8NA 4H25A 4HLZH 3TVMA 3MQIA 1ZLSH 1MHHB 3O8XB 3UO1L 1AG0A 5JXAL 3I9GL 3S35H 3CTTA 2YKQA 1KYOE 1SUJA 3KZIH 3TM6A 4E2OA 1A7QL 2F5BH 2F18A 3H1KJ 4JG1L 4WDIA 4W7YA 1ITBB 4NZTL 2IADA 2P8MB 4NKIH 2BWIA 2VO8A 3ZRCC 4XPGH 1XV8A 1KY6A 1M1JB 2V33A 1A47A 3V6OE 2GSMB 3DRQB 4OM0L 5IUSA 4NNPH 3P3RA 5AVXB 4X6EB 3BP4B 3QWOA 3MOAL 4N0FB 1HILA 4MRBA 4YO0A 5DRXA 1T1XA 4XN2A 2OX5A 3BCFA 3NN8A 4YPGA 3ASWA 2IDFA 2B9AA 2VLRE 5BNXD 4PJAB 4PJXF 2QDVA 4F7TA 4G1EB 1QMUA 1ZK9A 2E7MA 1WF5A 2Y69B 2X28A 2YD6A 1UWYA 3QBTB 5L88L 3D8MA 2ADGB 4PS8A 3PREA 1WZ1L 4L29B 2P52A 3MR9A 1XGRB 1T4KB 3O2DH 3SDCA 4EPSA 5CD3B 1J5OL 3BIBX 3FC8A 3TLRA 2ZCZA 4A2MA 4AYFB 1Q0YL 3P3UA 2OBGA 2IGTA 1FH2A 2YFOA 3HZ3A 4M93B 3DUSB 4OI9A 5JOFB 3MP7B 2RFXA 5C39A 2DIEA 4MYPA 4BM7A 1UYWL 3ARSA 2P7JA 3AXLB 3QULB 4C57C 4WNSA 1WAAE 1A65A 1L0NK 1PZDA 2DD8H 4E5XG 3WFEH 1KB9J 5C0IB 1E3FA 4BWNA 1UOWA 1KC5H 5KTEH 3T6WA 4H20H 4MQSB 2DM3A 1K8IA 5IB1A 1LP9B 5BW7C 3N0AA 4RMWA 3MRHA 3N50A 3P9MA 2AJSH 1QSFD 2J6EH 3B2XA 3TIEA 3FCSA 9PCYA 2OK0L 3D69B 3KCWA 4YDKH 2X2YA 5IGXH 2FL5A 2HWZH 1N6UA 4KI5F 5E1AA 4BZYA 4PRHB 4ANUA 1G6RL 1C12B 4KXAA 3F5WB 5B38B 3MV9A 2D3NA 1IC7H 1KXTA 2DQJH 5TQ0H 4PRPD 1QHQA 4Q4IA 5D1ZA 5IMKA 1E3ZA 2B59A 2M2DA 3JV5A 3WTYA 3FF7A 3FRUB 1JF1B 4PJCE 2XTJB 3FH8A 1JZFA 3KAAA 43C9B 4NDMB 3WHE1 3FTUA 1UTDA 3HIZA 4DGIH 1MIEH 2EE0A 3PHAA 1X5JA 5AOJA 4B50A 3ESNA 3GF8A 6PCYA 3MRPB 4XXCA 3O3EA 2YJLA 1HQ4B 3MLPA 2W0KA 3MV8B 1FGVH 5I17B 3GSXB 3V4WA 1UA7A 2RMZA 2BSCA 4KOBA 2EDRA 1K05A 2VR8A 4RWYL 4ZTOH 5K59F 3CHXA 4JO4L 3LEVH 4HZLB 2P24A 5J6HB 3N43B 4NQCB 1J11A 3GJEB 3QO1A 2XV5A 5FGCB 1AGBB 4KVPA 5I23A 1AXSA 2ZKHH 5DCCA 2ODHA 2BFVL 3GTNA 3JQOB 4FG6D 3JZYA 4JQXC 4N0UA 4P5TB 2QPEB 5ABDE 4R7DB 5F89B 2YMKA 5B66E 2EICA 3TWCH 4GS7B 4PRNA 5SWZD 1OE1A 3I6LE 4TVPH 5DJZB 1S5LH 5GS0D 4GH7B 1PX8A 3HI5L 4PB9L 2NYYC 4OUUB 4HOWA 1J18A 1EXJA 3SE9L 1MY7A 2PPAA 3GUTA 2BW4A 1DZBA 4KTEL 3U2SA 3LS4H 1BPLB 1PKQA 5GZND 1ZGLP 2IANA 5DJYA 3AT8A 3VW3H 1QG3A 1S72P 4C56D 3NZHL 4ODWB 1EO8L 4F33A 4JHWH 1TQBC 1UJ3C 3GMOA 1FFOA 1JVLA 1A3RL 1TTUA 4NPYA 3OMNB 2A83B 1BFSA 1PCXA 4DIXA 4TTDD 3VXSB 2YQGA 4YXDC 3I6GA 1VADA 3GSRB 3LH8A 2APFA 4NQTA 1U8IB 3HI6H 2D9CA 3ORJA 1QQDB 1Q90D 1UUSA 3FONA 4HIJA 5C07D 2A9AA 4QXGL 4AQ8A 2QEXP 3KPRA 1PYWB 3MLRH 3TNNA 3GB7B 1OPOA 2WXNA 1FH5H 2YSSB 1N4XL 5KYUA 4YXLH 2QJYC 2WXIA 4A04A 2VXQH 1WP6A 3VD0A 1WWWX 3L5JA 4RH4A 1OTTD 1OAKL 3C8KA 4DK6A 2DIBA 1PY0A 4H26B 2VDNL 2HVJB 3T2NH 3WJJA 4OIIH 5EF2A 4PRHE 3HZVB 3ZT7A 4H13C 1EAPA 2XN0A 1OARH 3W57A 1OVVA 2GY5A 2FIKA 2A06D 2KDYA 3MLTA 1DBKH 1FVEB 5T1DL 4V1DB 3MIWA 4CUCA 2DYPB 3E7KA 3GUFA 2Q76B 1U33A 3RGUA 3MLZL 4R4FL 3MO1B 4MJ6B 3TZVC 1XH1A 3IM1A 4FGMA 1QSVA 1FAKT 2X1PA 5HD8C 1Y0LB 3ZRSA 3V79C 4MMYA 2B2XH 5MERA 2DI8A 1BFVL 1JF6A 1I8KA 2RKLA 2WXHA 2ZXGA 4FNRA 4ECNA 5AW8B 4X6CE 1KB9H 4HWEL 4P99A 5FUZL 4WU5B 4X5XB 4JFFB 1LE5B 1JNMA 4UQ2B 1JV5B 2ZXXA 1MFVA 5AVWB 2B3IA 3F2LA 4HKXB 5C09D 5HYSA 4A7TA 1NU1K 3SOBL 2FYUK 5FC9A 5HVHC 5A2LH 5KG9B 2D0HA 2E76D 3VN0A 4PCYA 1JPGA 2L7EA 3X3FL 4N8PA 3OKDA 4Z23A 1ZHKA 5DVKA 5SWSE 4G72B 4PB0L 2R32A 5FCUL 2DLHA 4WENB 1IFIA 3WLBB 4DP9X 5ID0B 4NO0D 2IG2L 4IOFD 4XMPL 5GGSY 3MRKA 4AKOA 5L8KB 3BUQA 4OAWB 4W6WB 1X5LA 1VF5C 2VERA 4PRIB 1U8NB 4YAQB 3D39E 4R2GC 5EH1A 4NKMB 4JPKL 7TAAA 4PVMA 3L3OA 1P5VB 1QO3A 4FQJH 3RWFB 3VXNA 2OYHC 1H8NA 2WANA 2XZRA 4M7ZB 2EDFA 4LPTA 1SM3H 5EO1A 1FC1A 2NUPA 4X50A 3FYEB 1HYSD 4C4KO 4OGQD 5LXGL 4CSPA 2A9ML 4QGYA 2APSA 3U9PL 2K78A 2AAAA 4Z3JA 1KMGA 1MRDH 2E4TA 2OTPA 4LEXL 4PRDA 1QTYT 3K72B 4AGPA 3MROA 4FQLH 4XVTL 4HFUH 4PGJA 5HHMB 5E5MB 3LD8C 1NTMG 4A2DA 1TKWB 2K37A 4ZW3A 3QCTH 1UM6L 4F2ME 4F3FB 2K6YA 2R59A 3V7AE 5AL0A 4PJHF 1INQA 4E5XB 1PEWA 1XD1A 4UMGA 4AOFA 2HYMA 1JPFB 4XMTA 3ULVF 1C5CH 1NBQA 2ZOKB 4QYOA 1P5UA 1G1YA 1SQPJ 4NPJA 4UT6H 2HFGH 1KCBA 2OCCB 2BDNH 1KTDB 3DC0A 5TJWK 2BVQB 1JXDA 4UANA 1WWBX 4ZG1A 2JI2A 3RWDB 2R4SL 3N40P 1MFDH 1UOKA 3HC4H 4OGXL 1PLAA 4PY8J 1SFHA 4QOKA 1SXCA 3IDXH 2VISB 5J9PA 3S2CA 3DUUB 3NGBC 1ET7A 1A9EA 4YHML 1IBHA 3IGKA 2VZ1A 1A4KB 3QORD 3SE3A 2Z7ZA 5GGQL 2OYIC 5KANG 4YPJA 1N0LA 4ETQB 5J56B 2EVIA 4IBTA 4UTBA 4NP4L 2W94A 3ZYIA 1XH3B 4WEEA 1TQBB 3T0ED 3VH8G 4DPCX 3CVHB 4AG4L 1BQLL 2CJTA 2HT2D 4A7GF 1IBDA 1EEYB 5EBLB 1N8ZA 2HG5B 1JAEA 1WCQA 5HHVH 4CSSA 4PSRA 4MQ7B 3JV6A 5LAXA 4CDHA 5L7XL 3KXDA 2XKMA 1RZKL 2X6CA 4F7CB 1MQKL 3K6OA 3P69A 3AAZB 1DVYA 3EIFA 4J6IA 2ENJA 5FYLE 4JRLA 1XSKA 4P46B 3DX8B 1OW6A 4OIBA 4X6DB 4GB9A 1KBBA 4L3CA 4FA6A 2XWCA 5IOPB 3IETB 1WG3A 1IU1A 3EJTA 3RZCC 3X1NA 1LDSA 5BPPA 5FDYA 3BRDA 1KXVA 1SDDB 4MXWH 3I9IA 3LV3B 3EGXA 5DJ2B 4Y16D 2I5YH 1KJ3H 3V4VB 3B5TA 4F2FA 1S9KE 1NCUA 3MFGB 4GBXC 2MCMA 2ORBL 3RAJL 5T33L 2DJSA 3D9AH 5DFVD 3CC4P 2MKLC 3MUGA 4EI0A 3ARFA 1FRGL 4XZUA 2I9TA 2FEDD 1JHKH 3DMMC 2X89A 3H7BA 3F83A 2CZNA 3JWOC 4NZFA 4W6XB 4ZW8A 1L5GB 1CE6A 1NTMK 2E9JA 2WTPA 3NT0A 4R5VA 2YD3A 2UWEB 3VQMA 4JM2D 4BWWA 5CGYC 2JTYA 3K0WA 1JI1A 4ABVA 3TZVB 1OWRM 2HUEA 1HHIB 2Z4QA 4ZODA 4FC3E 2DQTL 2BPBA 3DARA 1JIBA 5AUMA 2VQTA 5BZXA 1L6ZA 3EHBD 2XQBL 1W16A 1HIMH 1MH5B 5D7SL 3ZXAC 2ZD0A 2VKXA 1WTLA 5DD5L 1ZPLA 1YYCA 4E9XA 5F96L 4AYSA 3CZUB 4IOIA 1ZCRA 3IU4H 3MNDA 3D6GA 1SP4A 4WSKA 4Y5VA 5HVHB 1SLVA 1AO7D 1RCYA 1GYWA 4APXB 3N1PC 3CXDL 2O72A 3UPRA 2ZUQB 2DKMA 2M8XA 5E1QA 2VXTH 5GGUA 1KGCE 2FY8A 3JTTB 5A7EA 4HKZB 5EBGA 1GJIA 4JHZA 1YYML 5EF0A 2EXWD 2M26A 5CBEB 2APWA 1E50A 3IAOA 5EOQH 1A9BB 1KYOD 3T65A 4LP4A 1XF2B 3P2BA 2V8MA 5BVPL 5FB8A 3IXAA 4R2GB 1ID2A 3ZDYF 2I24N 2CK0H 2JVUA 4L1SA 2GPZA 3VD1A 3VMXA 3H9SB 2CXGA 3L9BA 4PGZA 1W5CE 1AJ7H 4C7NB 2GSGB 1L4AC 1O9ZA 4G80A 3L3DA 3UYPB 4KDTC 4AVHA 5IY5B 3ULVL 1EV2E 3L75E 1QLRA 1YNTA 4G9FB 4P2RB 4HISA 4HIEA 1Q82Q 2O5XL 2FYYA 4LVEA 5BV7B 5I1DB 4LNRA 2H3KA 3CFEB 1E4HA 3CVIL 4EI6B 3H54A 3WKNA 5DD0H 4FXGC 3VG9C 5DMGD 2VW4A 4FNLH 2HPOA 3O6LL 1PCSA 3EOBA 3LD8B 4YR6A 4ADIA 5DI8B 4IL6X 4X5PA 1CI3M 5CZXD 2DL9A 1HHKB 3P4LA 2IYOA 1RZ8B 3ATDA 3BVWA 4N8CL 3ATFA 4NQEB 3VD3A 3QJQB 4V2CB 1KPUB 5DEJA 4LPYA 2HXAA 3DKHA 5DR5H 3IE4A 4AUYA 3MNZB 1E4XL 5I1JH 1A6TB 3FTGB 3HI1B 2HFFA 3PL6A 1TOXA 1I1AA 2OTWB 1N64L 2DEYX 1IQWH 4CKQA 3B7SA 1NUNB 3QUGA 4BKSC 1X5AA 5ERWB 2CA4A 2VMJA 4XVUC 1H15A 1QP1A 2OW7A 4O2EA 2MRYA 4K9JA 5KLVG 4MA8H 3VGEA 1MFBH 4JZJC 1T0MA 4WGKA 2H0JA 2ZOTA 5F1OB 1QBAA 1ZT1B 3NGBB 3P11L 4Z7OB 4IBZA 2YZ1A 2OYIB 3ARRA 3MNVA 5D7KE 2JB5L 4MN4C 5D5MF 2Y6TE 1DHKA 4L8DB 4AYID 4DQOH 5L6YH 1AFVL 1FV1A 2P67A 1KYFA 4Q2ZB 3JCUE 1J9RA 2OR9L 2V0AA 3B2VH 4YDMA 1ZGLB 2XY2A 2KLSA 1SJXA 4LLDA 4X7SL 2K6WA 2H2PC 2VLJA 1XL6A 3L3IA 4G5ZL 4UUJB 5DHEA 1F6LL 1MF2L 5CEZE 3UJTH 4APQD 3G5VA 4OZHF 1TU2A 2MTPA 3TFKC 1VQKP 3K6NA 4L8BA 1QI5A 3QJHB 3QI9C 1FJ1B 2EZ0D 3C60A 5L4FA 3TESA 4PUBH 5DZVA 2DI7A 3KGTA 4QRUA 3SOTA 4G43A 1VFUA 3IPBA 4ZUTA 3DSFH 3IJSA 5DJ8B 3AROA 4AMKL 3BCCJ 1Q9KA 1IVTA 2ZOLA 3NJHA 1PL3A 2OYOA 4G1MA 3TJEL 3VFVA 1VGEH 2IALB 5KSBB 4FL4C 4GBXB 1OGTB 2NX5B 1KGIA 4XMWA 1KGXA 3LIZH 1IFJA 2EQDA 4QRRB 5AKSA 2MFNA 4XBPB 1YY8B 3DMMB 3V9EA 4AEHL 3NOIA 4HETA 2D31A 2XXGA 2CLVA 1QUNA 2VKWA 3D85B 4LMQI 4M61A 4FQCH 4B9CA 2E5TA 5DRWA 5C0EA 2Q86B 1FG2A 2WC7A 5HVFB 4EBQL 1UKSA 1VAHA 1BMWA 4HJEA 3BKJL 4LCCB 2W60A 4HT1H 1N70A 3VFPB 3VFOA 5FFLA 1NDGA 3X1EA 3X11B 4PV9A 3V6ZA 3FAXA 3L7FB 2FYUJ 3WMSA 1NGWA 2FJFB 1ZIBA 3VH8B 4EDXB 3CZEA 4KHXH 1KV7A 1GTFA 3VFMB 3CDFA 1F11A 1GY2A 4U7JA 2FRGP 2GCYB 3CX5J 1FZOA 3QPQD 4Q58C 1ACXA 4OF8A 3I6LD 4NRYA 1AVYA 1Q94A 2F54D 5EOCJ 1RZ7L 3C9NA 1XO8A 5KLVK 5EBMA 3R4RA 4F1ZA 4AQRD 2BP8B 2X4PB 1FZJB 5DJXA 5IB3A 3W5MA 3Q3DA 3HG4A 1I4FA 1OWWA 1S3JA 1XMEB 3PGDA 2PYEA 4NC1C 2WJ5A 1KILA 1YEHH 3GW6A 3SDXA 2P1JA 3GRGA 4N6RB 3ZKND 3LKNA 1QBMH 1R3JA 4F37F 5EU6B 3MRLA 3P9WB 4FYRA 2R0KH 3HRZB 2Y07L 4AMWA 3U7WH 5EC1A 2CDGA 3UIZA 4N8VG 4EE2A 1WFNA 4YHNA 4JO1L 1L4AB 4X9YA 2OXGA 4KK6D 2DL2A 2I07B 4ZS7L 4IMKA 3PP3K 3LB6C 2VOTA 1UWGH 3H2QA 1GGTA 5JLZB 2DLFH 4NC0B 4PJGA 4KKBC 4K3DL 2FDBP 3RE0A 4JE0A 4KK9C 3VG9B 1WITA 2QPDB 4IBSA 5E8PB 3EH3B 4LFHG 3MX0B 3WSQH 4L8SC 4MX7A 2IAMA 1KZUB 3OB0K 4NM8L 3PLYA 4FQ2H 4FXKC 3L54A 3NQKA 4P5KB 5D7JD 4R8WH 3S6CA 3V6FB 2VH5H 4FI7A 3BKCH 2JKLA 5IOKA 3CCMP 2UY6B 3SKJL 1CT8B 1OIOA 3C09C 5F70A 4D0DA 1SBSH 4K71C 3PHQB 4C55A 5HGGS 3K3QA 3RNQB 3MRIB 3E8UL 2ZSVB 3IKCB 4HD9A 4JM0A 4W9GC 5DT1H 4UTAH 5LGKA 4MA7L 4BZ1L 3B3BA 1QR1A 2GJ6D 1KEGL 4YSTA 1RP9A 4HSQA 1S7XB 2VRKA 3TOPA 4AEIL 5KSBE 3QH3A 4KDVA 1U3HD 4OV5A 3UTOA 1GK6A 5EZLB 1BM3H 1G5GA 1WBXB 4K7PY 4UM8A 2LXCB 5FM4A 2O4EA 3OKKB 2FJSA 3TCLA 2BVTA 2CKNA 4N2EA 1TZGH 1Z3GL 5SWSD 1W72L 1BMGA 1G9HA 2GG1A 1CBVH 1AQMA 1KYOI 3GBML 1GW0A 4P4KB 2OQQA 4JRYA 4P49A 1RURH 3MLSH 3MZTA 4Q9QH 3CD6P 3D39D 2IFFL 2H1LM 3N1FC 4XPAH 1DN0A 1JXKA 5F7WC 2HKFH 3AT9A 1NUDA 2R27A 5H8DA 1Y47A 4OLXL 3EJZD 4WEBL 3VFNB 4YFDB 4ORZC 2H4EA 2HPCB 1AIFA 2R1WB 3GMMB 4KH2A 3NCCB 2OMBA 3EBAA 1V7NH 3NA4A 4RSVA 2MMXA 1KYAA 5BS0E 3TO4C 1E5AA 3QUML 1QPKA 5JOPE 4PJGF 3L73G 4BDVB 1DVFD 2OMXA 1NTMJ 4LSQL 4UB0H 4BCXA 1T83A 3RX5A 1KF9B 2A6DB 1D7MA 5I66A 4LPCA 4FL4B 1IX2A 2BS71 5AKVA 1B3JA 2KQNA 2H1PH 3D0VA 5LNGA 1KCWA 3G6JF 1GR7A 4GSRA 4KDWA 3WNIA 1R5WB 2KLTA 1JGVH 1U8QA 4KQ4H 3V4VH 5IF0A 1VENA 5I73B 4LLQA 4F20A 3CC7P 2BS9A 1T6VN 4MD0B 1KSRA 4HQQL 3C2AH 3PJNA 5T3XH 2V2TB 3GLZA 3OAZK 4M7LH 2RQ8A 3U7YL 2F1BA 3C75A 3LKPB 3TBTA 1L0LD 1XBDA 2OTJP 1UXSA 4I9XA 4PJIB 3DLQR 4JQIL 3DVFA 5KVGE 1P9MC 1QA9B 3T8XA 1FZGA 5EOCH 3QGVA 3G6DL 1XXFC 1GZHA 4XCNA 2OMVA 4AK2A 2CKBB 1S7VB 1MJ8H 5AD0A 2A45I 1N7SA 4M4RA 4OFPA 2W1NA 1NCBH 1I8IB 1ZMEC 1M7LA 4WNJA 1T21B 1FCGA 2C3WA 3QR1A 4DGWC 5K9OB 3BZFB 2RGSA 1IGMH 4U31A 5BVZA 3NZ8A 1KBKA 3ARYA 3RJQB 4ABUA 2RBLA 6FABH 5H35B 2IGFH 4NAQA 1R3HA 1RPKA 4QUOA 4NPDA 3HCVB 4HKZH 3V5DA 4KK5D 2J55A 3EFDH 2YPKB 3KWWB 3BFWA 3QQ3A 2FFDC 4LLWA 3VFUA 3MREA 4TSAH 1ZSDA 3X1FA 1JPSH 2LLNA 4ZX5A 1AZBA 2WVVA 1B2YA 1I1FA 3DV4A 3VB8A 4P05A 4UYQA 4M56A 4BXVA 5KYXB 3UZEA 3CQQA 2AXTH 4TM9A 1KIQA 5FYLD 1YEFH 1YAIA 2NNXA 1A1MA 1ASOA 1ZE3H 3JWNE 4I3RH 3BESR 6TAAA 2VXSL 3CXHE 3NSJA 3WFHB 1AQKL 4BSVA 3CSGA 2YGNA 5BV7H 2WIIA 3IJHA 3WAKA 2BC4A 2F61A 5D2LB 1DLFH 3QH9A 1Z3RA 2DBLH 1GC1H 1S9KD 2I69A 3CC5A 1ZT7B 1YYLH 2AXJA 4KXZH 4PTTB 4X7CC 1K04A 2UY7A 4OIFA 4LGPB 1E40A 3CX2A 3F00A 3RKPA 3F7YB 1N6VA 1I3GH 1JFQH 5D4IA 4L37B 2BIPA 4K71B 1FYHB 4O58L 4OCLC 2CCWA 3TN0A 4IHOB 1MREL 3DI3B 2NTFA 1FPTL 3EO0A 2WV3A 4OWFA 4XAKE 5HDLA 4DKEL 1UD4A 3B9EA 3EBHA 4Y19B 5C92A 2P26A 4I2XE 1U8LA 1E65A 1JN6A 1WCBB 4IYKA 5EZPA 4H2CA 3RGVC 2CU9A 5EUOF 4DWHA 4PJDF 1INEL 1B0WA 1X4XA 5DQDL 1MJJB 1SF5A 4N8VB 4G6ML 3K8KA 3UEQA 4QTHA 4BJLA 3IMVA 3LW5H 4POZC 2BJMH 3TNUA 2VGLM 3MA9H 5IHZB 4IRSB 4GG8B 4WK4B 5FYJE 4OJFH 3KPMA 2OZNA 4WY4C 3PGFL 3PP4H 1KGCD 4KUZH 1SDYA 3RB5A 2O61B 1I1YB 3HG3A 1FBMA 3O2DA 1RF0A 2C3VB 4TVUA 4D3CH 3U4BH 2OJZL 1MLCB 1G84A 2P5PA 3IFOB 2YD4A 4XHQA 3GIZH 3WUWA 1JTPA 2ERJB 4OZGF 4UBDD 4JPIB 2MPAL 3ZIYA 3R19A 2XQ0A 2CIIB 3REWB 4D7BA 1QVFO 3L75D 1FAIL 1LO5B 3DX0A 4GSUA 4PW3A 1GMJA 3TWYA 4TLFA 2AQ3A 2VLKB 3TO4B 2NT1A 2CLZA 4HIXH 4HS3B 1B88A 3GXUB 4W9ZA 4UV7L 1JK8B 1L6XA 5AZUA 3T0BA 2EC8A 4WJ5A 1R4XA 1CDUA 1LILA 3CZFA 4WWIA 2J6EA 4GSQA 1U93A 2BVOB 2XXFA 2XA3A 3ZZ1A 1E6OL 4MCZB 4Y28J 2PETA 4ZX6A 2Y7OA 2BIHA 5CWSB 4XOEA 4WIQA 5BUGA 4WBAA 1AOHA 2DMKA 2GK0A 3M06A 3IPFA 4H0IA 3JWOH 5E79H 5MEQB 1CICC 1Q7YQ 1X5KA 3SYOA 1NCWL 5A2JH 4M48L 2JJLA 4I85A 1GW3A 1RZJC 5JQ6L 4GT1A 4LCYA 5KLVJ 3V0HA 4NKOB 4W4OC 5ISZA 2KMWA 3S37X 5HYJB 3CMOH 3BRVB 4HYTB 3HJEA 5EU3A 1E27A 2HLFC 3BZ4A 2P1YA 5L4IA 1E9OB 4GAJL 3QXDA 4NFDA 2ZF9A 3EF7A 1BOGB 3K8MA 3NIGF 3HG1E 4PJ7E 4D8PB 2R5BA 1AD0A 5K33A 3DX7A 4KITB 1T0PB 2JJVA 2OP4H 4OSUH 2NUTA 3JWDL 5LJYH 2Z31D 5EPMB 1F0LA 5D7KD 2N1TE 1NCJA 4N9GB 3MV11 1CD1B 1B2WH 2W38A 3OWRA 1WK0A 5CCGD 3SQBB 4FDWA 3ALXA 4WHDA 1CE1L 4CBPA 1ZKAA 1HZHH 3FZUD 1IC5H 1RL1A 3K0YA 4Y4FC 1R5IB 4F5CE 4BK5A 4XOCA 2MCPL 3VCLB 5CEZD 4OW6A 2UZIL 5DEZA 2WBJC 2R69H 3QJVB 1Z6JT 2NY0C 3HNTL 3BIKB 4ZOAA 5F3HA 3U4KA 2FWOA 1AGFA 2W95A 3LQAL 3TJHC 1OT1A 4RFOL 3WS6A 1A6UL 2DJMA 5C86A 2QRXA 4LIQE 1AZVA 1LTGC 3TYFA 2FD6H 2C9QA 3V8OA 3D48R 4MMZA 5D9SA 1XWVA 1BAWA 3F6IA 3MODH 5KW9L 2NY2C 1JCVA 1NGPL 2D7TL 3HS0A 4P5MA 5TTRA 1CLOH 1AYOA 2L04A 3BH4A 3KBPA 5EZIH 1NTKD 1ODAA 3PUUA 4FI8A 1MG3C 1RULL 4L1TA 3CLFL 4MS8D 4KXBA 3WHXB 3CFDA 1FL5B 3GNMH 2K4WA 1YJDH 4MCYA 1KQLA 4OCWH 5GS0L 4QHMB 4QF1B 3EYUH 3CXFA 3TH3T 4JRXB 5H4YA 1DL7L 5K1VA 4ZTPL 2RCSH 1RZGB 4DAGH 3D4ZA 3KLHD 4F1SA 1ZT4B 3QUZC 4IW4C 3NCJL 2P7TB 4UIMA 3RGVB 4JDEA 3SD2A 3TEWA 3GBNH 4LVHC 4PRAB 4OGYL 2RACA 1SGKA 1I8MA 3RDTA 5KN5A 2VJ0A 2GUVA 2F7OA 3QS3A 4Z7UA 4EKJA 2L7UA 3LEXB 5ESAB 3BHBB 1IBYA 5DJTB 2XBDA 4LQ1A 5IJKA 3O6FC 5L2KE 3IGAA 3PWPE 4CU6A 4ERSH 1F2QA 4XI5C 2LFGA 1HXYB 1A6AB 3H1JG 3QFJB 4RMUA 1FYTE 5HHNB 8FABB 3ZTNL 1EJOL 4GOFA 2JLLA 2PCFB 3FN9A 3L1OL 5HYJE 1SFCA 3PAZA 4L2LA 4DGUA 5E9DD 3T77B 5IROC 4AC2A 4F80A 4OCXH 5GQBA 3VACA 4Q56A 2WLLA 4KXDA 3CDCA 3OKOB 2NZ9D 3N44F 1WMKA 2I7SA 3OKMA 5ICXB 1MRCL 1ACYH 4P2AA 4R4ND 1H6FA 5IHUH 4LDOB 4HFWA 3LSOB 1Z5HA 3EYSL 2QM7A 3MTUE 4H5SA 1FO0L 1J0ZA 5FAAA 5K69A 1AXTL 2VIRA 4GFXA 4Z5RB 4L18A 3L73E 1I8LA 1YCSA 2BMKB 3B5NA 1G7JB 4PP2A 2HFEA 5E1HB 2H8PA 4BGDA 4BSWB 3L37A 4X0KA 3IFLL 3C5JB 3TYGL 2XVKA 4L4VE 2WYZA 1TEFA 2D4DA 1WBYB 5B5EE 2DEXX 3VXMB 2G5UA 5T1KA 1XH0A 3GM0A 3RWJA 2CIKB 3SQRA 4HGMA 4I0CC 3V6OA 2C9SA 4I0KA 4F8TA 5T5FL 2J5WA 2X2JA 2X4OB 1YQVL 2BP0A 3ZDZE 4HPHA 5EZOL 4PBWD 5FK9B 2UX6A 4YLBA 2VLRA 1QX8A 4IKNA 3RL0C 5GIRB 1EZVD 1F6AB 4HOMA 1SJEA 1CICB 5IP4A 3RIFF 3C6LC 4V33A 3ZU8A 3P30H 4G8IA 4FMFA 1E43A 1T20B 3VMPA 4M1GH 1GIGL 3NDZE 3O3DB 4NUMA 1M05B 3ASOB 3RFRA 4TQ8A 4Y9GA 1NSNL 2K9JA 3CJJA 1LT9B 1VACA 1VESA 2JQZA 3Q8EA 1DBMH 4JM2F 3TURA 3C9IA 5D7IB 5IV2B 1BQHG 3L3JB 3HR5A 4XNMB 2GTWA 3UG5A 3PP3H 5CGYD 3EFFK 5B8CB 4LCWD 4QAMB 1BQ5A 1K6QH 1E9QB 4OLUL 4FFVC 3EUDA 2G60L 4K15A 3U9UB 4W81A 4OZIA 4OZ4A 4MXQD 4OLEA 4B9FA 4O2CB 5C0BB 4DW2H 1WAAA 1S7QA 4DQAA 4U1MB 1RIUL 5KAIE 4KKLD 3SPJA 4Y4FB 1QAWA 5AB9A 3H1IJ 4WWOA 3OB0H 3LEYL 1RIVH 5JTWA 1X9VA 3FFOA 4XMVA 2BNRA 2YPVL 4A7QA 4QO1B 4H0LD 1E2VA 1D7FA 1IGYB 2MJZA 2AK1H 3NPSC 4Z8FL 1MAKA 5E00B 1UATA 4DVBB 1RZFL 2BXYA 2WKLA 3F7VB 3IFNL 3QUKA 4X4XA 4DN3L 2FK9A 2D4FA 4UOZA 5JOPD 1A6ZA 1PLGL 1JYNA 5DEFB 2ZP9A 3GXDA 5B1CA 2WCPA 2NY2B 3RHWK 2BEQD 3K4ZA 5A3IC 5I6NA 1BFOB 4Y9FA 2A1WL 1GCYA 1AD9A 1LO4L 3K2UL 4PJCA 3GMQB 4JR9H 3RJDA 3EO1B 2ZCHH 3CPUA 4PJ9C 1YQ4C 1MHHA 3O8XA 4NJ9H 3K4DA 2ETWA 5FA4B 3RVXD 4ONFH 1KNOB 3DUHA 2VZSA 1CGSH 1VCAA 2JNZA 4W1TA 2EXSA 3FUHA 4EZLA 2P8MA 2ZJSE 3KLDA 1VQMP 3C12A 4X9GA 1AHWC 1J8HB 1NOHA 1VFAB 2Z4TA 3FPXA 3QUZB 1M1JA 4ZDHB 2VSMB 1F8TH 1Q4NX 4HBQA 3BDYH 3FWNA 2H41A 4I1LA 4DTGH 4HF5L 4N8UA 3DO4A 2CWRA 3DRQA 3HW7A 1HCZA 1LM8V 5KAQF 4X6EA 3BP4A 4GT0A 4N0FA 3ULUH 1XCQB 3O6FB 4KVCL 4AYEC 3EGSB 3NAAH 4IFDK 4IOSD 4PJ5B 5IHBA 1ZTXL 1RZPA 1GGIH 4ZJ9A 3K74B 5C08E 3QSKB 3DDFA 1DANT 4XX1G 1XGUB 4H8WC 4HUVB 4M9OA 4GUPB 2ZAEB 1G7PB 2ADGA 3SBWC 4TF4A 1KXHA 1UA6H 4L29A 3BQUB 4RZKA 1NPJA 5FHAH 5C2BL 1XGRA 2V5TA 3HE7B 5FECB 4UB6H 4NGHH 2K3RA 4KQ0A 5CD3A 5GJTH 3D6YA 2VDML 3QB7C 2P3YA 4AYFA 3Q9QA 2PTVA 4JPVL 4KZDH 1ZWIB 4TVSa 3DUSA 5JOFA 1NLBH 4L4TE 3OAZH 1GHFL 1XGYL 2IPUG 4GODA 4F8PA 3UAEA 3H85A 3MU3A 3HPLA 3S1KA 3QULA 1C5DB 4I2LC 3CXHD 3AXLA 3S0PA 3S5LG 2XN9E 3QZNA 1P84K 3X14A 1N6QL 1D5MB 2Q20A 4HMDA 5C0IA 2E74D 1JY3O 2Z8RA 3WELA 5C6TH 4RDBA 2P5WE 5INCB 4PJCF 2BFGA 2J20A 5HDRA 3SDYL 3D06A 3FT2B 1ZN5A 3CCVP 1QFPA 3QI9D 3FUEA 2C26A 2R0LL 3D69A 3P0VL 5E8OB 3ZZQA 1ZEAH 5MP6L 4PRHA 3KEHA 3IAGC 2J59M 1C12A 3C6LB 4JM4H 1RUML 2Z9TA 1BXUA 3F5WA 4ADJA 1OW0C 4DPRA 5B38A 4WWPA 4XAKD 3KDPB 1FNFA 3AQDA 1A6WH 3HS8A 4Q8BA 1GPOL 3NEOA 3FRUA 2X6VA 1JF1A 3ZDWA 3IKKA 2OSYA 2X6UA 3QC5X 4QHKJ 1QFHA 1TCRB 4NDMA 4U0QB 2OSWA 43C9A 1IRAY 3QT2A 2Q9OA 4MJIE 1TJXA 3AACA 4HKJA 2HKHH 1QSEE 1SN2A 2HX8A 1M56B 1CBJA 3HFMH 3MRPA 4J28A 4JKPH 1OAYH 1HQ4A 3QUXC 2WO3B 3GSXA 4CILA 1WT5A 1KOAA 4FABL 5FYJD 1R47A 4ZUWB 3BYTA 4HZLA 4TNVF 3ZDMA 3DHPA 4WB4A 4OKVA 5J6HA 1R0AH 4BIKA 4NQCA 3GJEA 1DJHA 2CCLA 1URQB 3KJ6L 4XRCB 2ATPB 4LLYA 4Y99C 1BZDA 4NJAH 5EWIL 4ZMYA 2IQ9H 5BVJB 2KZBA 2DQDH 2ENPA 1UB6B 1MFAL 2G0LA 2J72A 2ZX6A 4YFLI 1GOHA 5HDBE 3ZGIA 1Z5LB 5IHLB 1IUZA 4X7TB 4MKTA 2W80C 4Y5YC 3NPSB 4P5TA 2XKNB 5GS1A 4R7DA 3MBXL 1SFDA 3AEAC 3KPSE 4XVJH 1SMOA 1IL1B 3ZYJA 4M6AA 3UG3A 5KVMC 3V0JA 4ZMVA 4HHGA 2E7LA 5DJZA 4QRBA 1Q72L 3E1IA 2EDXA 4OUUA 2KBGA 4HJGH 2WZ6A 4K5PA 4G8AC 4K7FA 5DUJA 3WCYA 4AJWA 2WLNA 1JZ3A 1BQHB 1EFXB 4DPAX 5JHLL 3ZTEA 5CZKA 1NCTA 2X1XR 1O7DC 2RALA 5C97A 3MA7B 3OKYA 2AEMA 3AG3B 4R7LA 3NACL 4X7DC 4XMXA 3VMAA 4D9LL 1OGSA 2A83A 4ZS6C 4F8QA 5GGTL 2CALA 4BSJA 3QJRB 3VXSA 1HSAA 3N6YA 3U9WA 2V17H 3GSRA 1CZQA 5DZAA 3WLWC 1BGYE 1AHWB 2A3TA 1QHPA 4FERA 1QQDA 4KKZA 1ADWA 1S2EA 1ZLUK 4N5UA 1PYWA 3GB7A 4OF5A 3VYOA 2XU9A 3OGOE 4B9PA 1MFTA 2XOTA 2EYTB 1SJHB 1A0QL 2APBA 3LIZA 5E99L 1I3RB 4H26A 1SXBA 3W2DL 2HVJA 4XZ4A 1N18A 2FGWL 5KANI 4X6CF 3HZVA 2EE2A 2N1TD 4K94L 1JVOA 4MNQB 1CL7I 2X42A 1N7MH 3TIDA 1DJZA 3ZSTA 1FVEA 4BUQA 5H37H 3CCSP 1NDMB 4V1DA 1P0SE 2DYPA 4HEME 2Q2LA 2Q76A 1ILSA 2IDQA 4PJEE 2FQEA 3HB3D 4LLHA 2VM3A 1UXLA 3MO1A 4MJ6A 3S3CB 3SZKC 2ED6A 3CI9A 4D8OA 4KHXA 1PL5A 2DIJA 2PR4L 3IDYB 4QXUH 3HEIB 3K81A 1EDHA 1EUUA 2Z6FA 4EVNB 3NTCL 4BFNA 3GPEA 4QKTA 3PNWB 5CJOH 4X5XA 4JFFA 3ZHDA 1IBGL 5KSUB 4UQ2A 3WIIH 3G04B 2FX7H 1JV5A 1TDQA 3Q6FB 2QTVA 1SVCP 1IE5A 1OT4A 1JGLL 1NMAH 1WE5A 2DN7A 1CG9B 2Z93A 2A2QT 2YMXL 3ZX1A 3GRWA 3HNVH 1QBLL 4PV8B 2V9UA 1HQRB 3FUIA 2Y5QA 3GBEA 5K93A 2B1OA 4ODTH 4RKUJ 5JPNC 2ZQKA 2WK2A 5PCYA 1ERNA 2V5YA 5BW7A 1QX1A 4JFEB 2NYZA 1YMHB 4H44C 2YA2A 5KZCB 1Q8MA 4M6NH 1AKJA 1GMIA 3WLBA 4AVIA 5JO5B 5ID0A 4IL6E 5H2FH 3QXUA 3GSWB 3TH2T 5L2JB 1SLXA 4J4PC 2QELA 4HU2A 4YAQA 3OL2A 3WY1A 3OKEB 2Y7NA 1TTBA 4XNZC 1EDYA 4NKMA 4F8NA 4WTZG 2Q3ZA 2BHYA 2VYRE 3MBED 3RWFA 1P5VA 4LCIL 1AA0A 3QA3B 4J5VA 2COVD 3PXJA 3MCLL 1H9VA 4JAMB 1RZJH 1MNUL 4G42B 1D9KB 5CUSH 2XCMC 1S7TB 3AGVA 3FN3A 3SYCA 3VI4B 1SJMA 5E8EA 1N59B 4UV4L 4DOHB 3W9DB 3H1JJ 3CWBD 2OYKA 3IN6A 1F58H 2Q3XA 4UQCA 3UIYA 3K72A 4X9IA 5CLZA 3PWPD 2ZG3A 3GT6A 4RMRA 3SDDD 1MVFA 3VUAA 3NSYA 1DQDH 5GRVL 2C0XA 1YPZE 5E5MA 4OQ1A 1PX3A 3A47A 1TKWA 3F5HA 1M3JA 3L5XL 3ZRFC 3AE1C 4OQTH 1FYTD 3PCYA 1RF1C 1DUYB 4F3FA 3R4DA 3GHGC 4Y99B 3PGCA 4F92B 4UTAA 3BH9B 4E5XA 1R75A 2QV4A 2DIAA 2FQGA 4Z18A 3IDNB 1NCHA 2ZT9B 2B0SH 4RO0A 3BI9X 4OD1L 4D2NA 2ZOKA 2VR7A 1VCBC 2ZYRA 2VSCA 4JQXA 4PEEA 1A7RL 4NYLB 5LNDA 2BVQA 2XYBA 5IVXF 1IFDA 2LLLA 4KX9A 3FU6A 5JYLA 4L0PB 3RWDA 3S88H 1M7XA 3ARTA 3BSZL 2YRLA 4KVNH 3T0WA 1U95B 1Z0NA 3L73D 3CXHI 1N5YH 5DHDA 3KM1A 2UV3A 4L4VD 4UT9H 4TL5A 1A4KA 1TVHB 3AEGC 2AANA 3IDIB 1YDPB 3QVAA 1RPUA 4FLOA 1UXWB 3NSFA 4GT7A 2OLDA 5D1XC 4ETQA 2OARA 4WO4C 1G7HB 1CFNB 1EHKB 4OCSH 1WH0A 1A7NL 3MRGA 1XH3A 4JDZB 1A4BA 3QXVA 1UJ3A 5GGVL 4B3EA 3NBNA 3ARVA 3CVHA 2E75C 1NGYA 1EEYA 1MJ7L 3CSBA 3MACL 5EBLA 3U46B 2EC9T 2HG5A 2R0WH 3HKFA 3FO9B 3T71A 3CK0L 3J27A 1Y6NR 2IDCA 3B3IA 2Z0UA 3UBFA 1ZK5A 3LMJL 4F7CA 3UJJL 1D6VH 2VDPL 3AAZA 1UZ8B 3RK3C 4QRFA 4U7SA 4P46A 4QRQA 4X6DA 4XVSH 1YEEH 5IOPA 3LZFH 1NBCA 3IETA 1TEYA 2VZUA 5DZPA 3IAPA 1R8EA 3LXCA 5F7EL 5LQBH 3KJ4C 3D0LB 1KB5B 3LV3A 2F2HA 2F7PA 5ACMA 1OGAB 5DJ2A 3VXRB 1T66C 3VFSB 3S34L 5I0XA 4XWOD 4J3SA 3RTQB 1T5XB 3GO1H 5HVGB 2JK5B 2ZXQA 3DA0A 2Q8BL 5ENWB 1L5GA 1NAMA 4ZXBD 4HPOH 4FQXD 2UWEA 2DQGL 5EEUA 4FFYH 5DLML 2NZ2A 1AJYA 3EBIA 3TZVA 2EIDA 1HHIA 2I8DA 3QDJB 3IBOA 1BBDL 3VI4E 1XTCC 1P84J 4TMPA 1TCMA 3VD2A 1JYVA 2YAMA 3ALPA 2LU3A 4BZ2H 2DQUL 1MH5A 2XZQL 2NRDA 3L4WA 1QYGH 2BZDA 3Q5PA 2OS7A 3DOSB 5EFIB 5EEXA 2CLRB 1TETL 3BMWA 3ZW3A 3AWFA 2L5GB 5I75B 4JY6B 3PS6A 5KLIC 3W1ZA 4APXA 3MRCB 1GZPB 6CGTA 5JPNB 4QRSB 1HKLL 4G9DB 3BIAX 4HGKC 1FF5A 2NYKA 4X6BB 4YHLL 4H44B 3BGFC 3JTTA 5IR1B 3VP8A 2FLRT 4NO5B 2B1HH 4XP1L 4OVVA 1D5ZB 5CBEA 4PRBB 4LSRH 5HVWA 1VQNP 1A9BA 2WVTA 3WFBH 2GC4C 1L0NE 2ISDA 3U0TB 2N0KA 4XNZB 4MAYD 4HBCH 1OVRA 2B39A 4NPFX 1OSZB 4C7NA 2GSGA 5TQ2L 1FDLL 2BIIA 3UYPA 2P5ED 4GLRI 2GITB 1H89A 3TBBA 1FL6B 5TF1H 4G9FA 4P2RA 1AC0A 2OL3L 2PXYD 2EH8L 3Q8CA 1UWEH 1E4JA 1QRNB 5I1DA 2VN3A 1JEKA 3CFEA 2FX8L 1E90A 4EI6A 2N3JA 4JPWH 1ADQL 3F7RA 1SHWA 2WZPD 3T3MB 3KDMB 3WY3A 2I60L 3WBDA 1AG6A 3POCA 4GRLD 4KQ3H 2D7OA 2BH0A 1MKMA 5DI8A 3H1KD 3S8FB 3BQVA 1U8JB 2K70A 2DMHA 2VN4A 2XFXB 1HHKA 1RU9L 2Z5HA 1DVSA 2VZOA 1RZ8A 5C08D 5FYLL 2V9RA 1H6TA 4YVNA 3RTLA 4WEUD 2WXRA 3QG7L 4NQEA 3M07A 4N68A 2MCAA 4XA4A 3BDXA 2VXUH 1A02J 3GXTA 1A6TA 1M4KA 5I1HL 3CV5A 3HI1A 2UZYB 1A3LH 4P3CH 4H0GA 4ZSOE 3D09A 2OTWA 1QFUH 2W88A 5D1QE 4XMLL 2AMGA 4HSCX 1HUCA 5ERWA 4N2MA 5C0RH 1SEQH 3B71A 4L4TD 3PDOB 4GRWB 1Q0XL 4EI5C 3WV0A 3JTBA 3JYBA 3T3PB 4EEEA 2HFTA 4EIJA 3PIQB 1ZT1A 3BWSA 1MJUL 5KSAD 3NA9L 3O0RL 3FULA 2KKQA 5HXMA 3MHZA 2X6MA 2OYIA 4GINA 1CFSB 4FKEA 4UQDA 5D1XB 2P5WD 4NWUL 4WO4B 1WZMA 3D2UD 5I1AB 2QADD 2QQKL 4MNHB 4M7LT 4Q2ZA 4O02B 5J06A 1ZGLA 2E75B 3FQTB 2ILLA 1HH9A 4QNPE 1ZV5A 2WT7B 1H3PH 4IRJC 1J1XH 2ICES 2V4LA 1U8CB 4X98B 4NUGL 3RBGA 3ZDXE 4KPHL 5TISH 4JMNA 5DGRA 3RWCA 5HDWA 2ZYHA 1WBZB 2Y1VA 1TZHB 3QJHA 5E7FA 3DVNB 1FJ1A 1L9SA 4LSPH 1UD2A 4A66A 2HJFA 4PN6A 1K5NB 4OZFG 4N6QA 4Q6YA 3AM8C 4YWGH 3RZCA 1OO2A 5DJ8A 5LBVA 5DUPL 2FSEB 3FTYA 4MJID 3MRBB 1QSED 5FWQA 3RUGB 1OX3A 3C1LA 2XN2A 3EO9H 4FRWA 2IALA 4FMVA 2ATKB 3RKDC 5KSBA 2D2CB 4GBXA 3NJFA 4UB8H 2XACC 2ZKYA 4QRRA 2R8SL 4XBPA 1YY8A 2QSTA 3DMMA 4M3KB 5F7BA 5CLWA 3L95B 3W81A 4ELMB 2JV6A 3D85A 4L3EB 1P84H 3F6JA 3PTZA 1JG9A 1JPST 2Q86A 4KHTH 2XPGB 1KFMA 3QPKA 2AW2A 3PQYE 2E42A 3VFPA 3TH4T 1G43A 1Q1JH 2PYFB 4K3HA 4XE5B 4O5LH 4PJBB 3TL5A 2XRAH 1MPAL 3NSXA 4HUKB 4C59B 1V27A 3L7FA 2GTZB 4UINL 3VH8A 2G3MA 4EDXA 1DP0A 3Q8FA 4J3WA 3VFMA 3KPSD 3CU1A 4C83B 3VP9A 5K5GB 1T3FB 4R5TA 3IMRA 2Z8SA 3NYKA 5JOEA 1I9RH 4M6OH 3DGDA 2H26B 5AOKA 1JY3N 2LR2A 4YFLF 3SCMB 4J2XA 4OLWL 1RI8A 1JZIA 5KLIB 2XJLA 4HUWB 4MAUL 1DZ0A 1GA2A 1JZDC 1G9NL 1CTMA 1FZJA 2X4PA 4K3EH 4F15B 2EDMA 4YNYB 5TDNA 2EDWA 5JMOC 3BGFB 1O7SA 5BS0A 2DWYA 2C1PB 4A37A 3TA3D 2CUAA 3DHJA 4FHJA 1TSRA 2NPSC 2QQNL 4NZRL 4WWKC 2P2UA 4QRTB 4N6RA 3VRLE 2EH7H 1NU1E 5EU6A 3E0GA 5GHWH 3B1TA 4B53A 2HMIC 2R69A 3HC3L 1NAML 2LU5A 1AMXA 1NIFA 4LRNL 1L4AA 1ZLWK 4KDTA 5JA9A 1CDIA 1BGYD 1CW5A 3VYPA 3CZLA 4JG0L 5FV2A 1NOFA 3LRKA 4M00A 3D52A 1U4FA 3ZSSA 5EULV 4A38A 1YVLA 5F8RC 3FDWA 2E5EA 1WWCA 1ZLLA 2HKAA 1C16A 1DTUA 1QLFA 3QNXA 1PJWA 4JUTA 4KUCD 3QFGA 5CEZL 3MV7B 4DGYH 2R1YB 5CSBA 4Z3EA 4GOEA 2ZAHA 1VQOP 2NR6C 1KJVA 3LH9A 3Q7JA 1SRDA 1YG9A 1IQDA 4P5KA 2HP4A 3C5ZC 3SQOH 4FADA 3V6FA 5T3ZH 1B4RA 4JPSA 2UY6A 1CT8A 1PNDA 3RK3E 4MRCA 4JYBA 1IGFL 2IC2A 3B5HA 3PHQA 4U6YB 5I82A 4ATWA 1Z9MA 3RNQA 4EQ3A 3PHOA 1EC5A 3NSCA 3IKCA 1CF8H 3HTLX 4Y2DC 5A43C 4MA3B 2IFNA 4JFDB 3WGUB 1S7XA 3D7PA 4HZAA 1F45A 2JJUA 4YIQB 5AG9A 4EF3A 1GTWA 1EDLA 3M88A 2V9TA 1U3ZA 1JJUA 4JZJA 2PPFA 1JERA 4WUUB 3ML8A 5EZLA 1WBXA 1BVLB 5DSCB 4FLHA 3WIAA 3II3A 1MW3A 2VSDA 3G5YA 1F4HA 3OHXB 1NOAA 1ZLUH 2IBBA 3OKKA 3W82A 3IDMA 4OH8B 3U59A 4N3YB 2KOGA 1URLA 4H40A 1KENH 5AW5B 1WHPA 3RBZA 2Q6WB 4AT6B 5I1IH 3NEEA 3QRGL 5CR8A 1M6OA 1A6VL 5CLXA 1ITCA 1DE4A 4ZW6A 2CJUL 2D9QB 4J3TA 1NCOA 4IRJB 2BINA 3OMAB 2TSAA 5LCVH 5BOZG 4OJAA 4DESA 1Z66A 2R29H 1ZY9A 2OV0A 3BP5B 3DJZA 4PS4H 3U82B 2OZ4H 3AE6C 4FHKA 3EJUA 5FHBH 5LVEA 2VXVL 4AIXA 3GHEL 4F7MB 2HPCA 1DBBH 2R1WA 4OM1L 4EMZA 4Q9RL 3DECA 2YLKA 3SPIA 3KPEA 1WDAA 2VUOA 3GSNB 2WQYC 4PJ9D 2NPLX 4JO2H 1FZKB 5I74C 2ESVE 2D03H 3VDBA 4J3BA 2X44D 4BDVA 4QCIB 3GMLA 1IZJA 4L3FA 1KCRH 1ZANH 4HWZB 2A6DA 2O5YH 4E42B 4MXVE 4QHKI 4ZO9A 3D6ZA 4M7KH 5JPMC 1JPTL 1KLFB 3SGDI 3RLSA 3UTSB 3HHSB 1AFOA 1QNIA 1KB5H 1ACZA 4W9CC 1R5WA 3SPGA 2YXVA 5TE6L 4KKAC 2DWXA 3FU9A 4KKCC 4P9HL 4YHKL 2XV2A 4IJTA 4MD0A 4Q0XH 2NY6C 2XBZA 1S78D 1S4XA 3HNSL 3MRJA 3LKPA 5F6HI 3UJIL 2YO2A 4X0NA 5BZDA 1WQVT 5H94A 4KI5C 4PJIA 2EEAA 1SQVG 4B60A 4BKLB 1QA9A 1CUOA 2IVFC 4AQAB 1DEEG 3S36X 2A9NL 2WZAA 3BP6B 1MI5E 2QR0A 3BKYH 1R19A 3NVQA 3NXSA 2ITCB 2CKBA 1S7VA 3IRCA 3MXWH 8CGTA 5LO7A 1S6NA 2J3SA 1YUHB 5A2FA 2PRRA 4NQUA 5IKCB 4FNTA 4Y4KC 1I8IA 2OYMA 1I7UB 1T21A 4WAFA 4OFVA 3SY0B 2WZ0A 3KPQB 3BZFA 5K9OA 3GMAA 4RZCB 3KYOB 2FNBA 3EAKA 2O6DA 1BD2B 4CGTA 2P48B 5H35A 2P80A 3MV8D 5LG1A 2VQ1B 5KSVB 1CK0H 2GM4A 4LHUG 5FKAB 1MW0A 3KPPA 2P9RA 3GSOB 1DLHB 2DLGA 3KWWA 1A64A 1CGUA 1RUPL 1CI5A 5C0AB 5E79E 2WGXA 1IM9D 1DUZB 4RISL 3FXDA 1KT2A 5DJ0B 1SY6H 2XI9A 4Z7WE 4XE0A 3BWUC 5DJ6B 3IR9A 1CL7L 5KYXA 4WK2B 2WSCJ 2QHLA 4YHZL 2E59A 5DQ9A 2JQAA 1PFOA 4G6JL 1CFQB 3D18A 3WFHA 4I0PD 3LCYA 1KN4H 1OD9A 3L4UA 5D2LA 2R4RH 4O51B 4PWKA 4CADB 2Y2WA 1ZT7A 2A77L 3O0LA 4L8SA 4U6XB 1JV2B 4PTTA 5HHXH 3C5ZB 2GVYA 2WVSA 3JBG7 1Y18B 3I6SA 5GISH 4NLAA 4RVBA 3HG1A 1XFPA 4BV1A 3EF4A 1TMCB 2TAAA 4M1DH 4XN7A 4L37A 2YEZB 4AITA 4Y89A 4IHOA 4Y2DB 5APXA 3RK2B 2LU4A 5E08L 5E4OA 2LGNA 4Y19A 3LKQB 4AKPA 1KB3A 1WCBA 4LCUA 2C9LY 2KHAA 4HCRA 4JGUA 1X7SA 2IMMA 4Z3TA 2WNGA 1UM4H 2R0ZL 1MJJA 1ZJBA 4N8VA 4XN9A 2ITDB 4GRWH 4HWBH 3O4OB 2C9XA 4LLAA 4GKOA 1OM3H 4FFWC 4ZMPA 1MIMH 5KUKA 2MNJB 5DVMA 5KVGL 2PTTB 4C47A 2YD5A 3GINA 2O61A 4PJXB 1TNMA 2QFPA 4GMSH 2D7QA 2Y6SC 2WJ7A 4M4PA 4NO3B 2C3VA 4Q9BA 2V3EA 1PPJE 1CDHA 2IBGA 2PWDA 4XC1H 3IU3A 1L0ND 1MLCA 3Q2YA 3QZMA 1G4MA 4X8GA 3IFOA 2AGJL 3VG0H 4O02H 1KZQA 2K0RA 2PP9A 1LDPH 1G7QB 1ZXGA 3B2PA 4K23L 1RZKC 4JPIA 4DUXA 2FWUA 3REWA 2CIIA 2KI6A 3IJ7A 4LAQL 2K88A 1LO5A 1KZYA 3QJUB 3N85L 4NZDA 1D6EB 1MFEH 2AK4B 4HXAH 1RLBA 2AEPL 2VLKA 4G7YH 4HAKA 4Y8DC 5F0JB 3TO4A 1S4IA 5IQMA 4W9EC 1SLWA 2CE6A 5IVOA 2IH3B 1ZS8B 5D2NB 2A4CA 1JK8A 3O9WB 3DRTB 3IGLA 3HE6D 3MOQA 2IH8A 5JPMB 1NJIQ 2FXPA 3P0YH 3WE1A 4A68A 5E2UL 3BFOA 3UC0H 2RA1A 35C8L 4MCZA 5HGAB 3FT3B 4GAGL 4PJ7F 2Y36L 5T8IA 5CWSA 4NB7A 2BVYA 3W11D 2PWHA 3G5XB 1LTIC 1TVBA 4P2YA 3DETC 1MXGA 4QKXB 1V55B 2NY6B 4I77L 2E6QA 4LLUB 2E9GA 1MWAL 2BSEA 3FB6B 2WKOA 1WA0X 5JHMA 3Q06A 2IADB 4G8GB 4PRID 1NHLA 4YS4A 5D1QD 4CVZB 4NKOA 4ZUSA 3OAUH 2QPSA 2IPTL 2V2XB 5HYJA 1AS7A 4XTRC 4XO8A 3ETBF 3AG2B 5I5IA 4LOEA 4JZNB 1E9OA 3ARDD 1ZIAA 3ILPB 4RGNC 1BOGA 4KROC 4D8PA 2CGYA 3B4SA 3BE1L 3EOTH 4Y4KB 1N67A 1CIUA 2GJJA 5EPMA 3SGEH 5DZ9A 2OX5B 1ZAGA 4PJ8D 5MHSE 4IK6A 4N9GA 1TFHA 1LWUB 1CD1A 1UD8A 1OTSC 3SQBA 1QRKA 2CGRH 2DH2A 5JHDE 2ZSWB 4Y1AE 5KVFE 5EA0L 4F7TB 9CGTA 4JFQA 3AXIA 2JKNA 5BMFH 4Y9BA 1ETJA 2WWWA 1BZOA 1R5IA 1JZ7A 3RI5K 3VXPB 3FW6A 3VCLA 2MHAB