5AW6B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw6B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw6B02
5CMZA 1GD2E 2KP8A 2WTYA 2R32A 1CI6A 1FAVA 3SWFA 3KQGA 5AVZB 4I6MC 2C9NY 3TK1A 3TNUA 3NTNA 3VTPC 1OWAA 1A02J 3TNUB 1SLQA 1GK4A 3UIAA 2Q5UA 2ZFCA 4HYTB 2E43A 1HUCA 5APYA 3WGUB 1GZLA 5AVVB 1GK6A 5APWA 2QM8A 3IR9A 2Q7CA 1DH3A 3M9BA 4RESB 1JNMA 3LIEA 2QM7A 2P2UA 2N9BA 1H8AA 3HE4B 4KHXA 4AUWA 1YYCA 5APXA 1JUNA 3M9HA 4I2LC 2BASA 3VMXA 3A2AA 1FOSF 3WGVB 5APTA 3NMDA 3O8ZA 5APSA 3P32A 4C46A 2XV5A 4EOTA 2XZRA 3A7OA 2ZXEB 4GKGA 1NWQA 3T97A 2YO2A 3HE5B 3M91A 5AVQB 1GU4A 4XE5B 5AW0B 3HE5A 3I5CA 4M3LA 1H88A 1OXZA 2C9LY 2R3CA 3HTKA 2YNYA 4B86A 5AVYB 1T2KC 5AVXB 4GT1A 5AW6B 2XU6A 2WPRA 3KDPB 3TYYA 1HWTC 1MFZA 3NXSA 3B8EB 5AW2B 5AW7B 3P8MC 3M0AA 4C7NB 1KQLA 5AW4B 5APVA 4RETB 2IPPA 1GTWA 2R5DA 3VYIA 3M0DA 2R5BA 5APUA 1T2KD 2Q3IA 2Z5HA 3VN0A 2E42A 2WPQA 1CSBA 1H89A 3V4WA 3V4QA 1HBWA 5AW9B 3A5TA 5AW5B 2VRSA 3HE4A 5AW8B 2Z5IA 3P7KA 3V5BA 4AYCA 1CI6B 5AW3B 4DZOA 1MV8A 2P7JA 4AQRD 2YO3A 2W6AA 5AVWB 3L37A 1S9KD 4JYBA 5AVSB 3VMZA 4LC1A 1X8YA 2WPSA 2H7HA 3A3YB 3LIDA 1SP4A 2W27A 2WWWA 1S9KE 3MGNA 1HJBA 1IO4A 3L36A 5AVRB 2P67A 3OAKA 1MUUA 1A02F 3MD0A 5APQA 5AW1B 3M06A 2WT7B 3VMYA 1J2JB 1GU5A 5AVUB 1NAFA 3NFQA 2WT7A 1FOSE 1G2CB 1CZQA 3L35A 4JYCA 5AVTB 4C7NA 2JJLA
chains in the Genus database with same CATH superfamily
3GXPA 5ANME 4NQDD 4U6TA 2N1TA 3NCEB 4PS3A 1XGQB 3LNIA 3RGVD 4HIJA 1MJUH 5E6ID 2WCPA 4PJXB 1AQKL 2W9EL 4QTFA 4DGYL 3T0XA 1QTPA 1B0RA 2KERA 3DMMC 1NDGA 4HG4K 2KDYA 2OR9L 4JPVH 1AD0A 5HVWA 4H1LG 1QEWA 4GW4A 1KB9E 3UBXI 2YJQA 4HX1A 4QYOB 1YEFL 3MGAA 4Y7OC 1MNNA 1WC7A 2A73B 2AZUA 3SB3A 5KYXB 2Y7OA 3K1DA 4YX2H 2WWKT 4F8OA 1RIUH 2DB8A 3SOBH 2FY8A 1LQSR 4HALA 4UB0L 5DEJA 5T3XH 3WNLA 2WQUA 2A06D 1QTYT 3JV5A 4HZ1A 5E24E 2NY3D 2ZXGA 3WTSA 3OSVA 2DQDH 2OX5B 2EYRA 3L7EA 2NQDA 2I24N 4ZOBA 1V3MA 3BD5A 3MODH 1GKEA 3G04B 5DMKA 4N0CD 4GQ9H 4MNHA 3F05A 3KNBB 3V4UH 4XP9H 5E6IC 3KYAA 4ODVL 2C9UA 4Y4KD 2R56L 3GGWB 5ERWB 3JWNE 1NCWL 4NKIH 4P2RB 5IK3B 1JWSA 5B5EH 3VFSB 4QRPD 1ZVSA 3GI9L 4LIQL 3QDGA 1ZCRA 1S7WB 2X9YA 2WLKA 4MGXA 3NIFE 3QCTH 5HHQA 1UZ6E 1RURL 4OLEA 1QL1A 4A63A 4Z23A 3E6HA 2X44D 2AP2A 2ICWB 3O6MH 4Z7QB 1PG7H 4OAWA 2K9JA 2EXTA 4QUOA 5SWZA 3R1GL 5D7JC 3P11H 4U1KA 3T8VA 4U6YB 3VYIA 1JFQL 1X7TA 3EKCA 3V2AR 3MRBA 5T5FH 2FX8H 2JXMA 4KHTL 4JB9H 2ZZUT 3BAWA 5I75B 2C9VA 3K5SA 5CSZA 4TSAH 4MD5B 2F6AA 2MKWA 3EQ2A 3L2MA 5A3IC 1BMGA 1L4IA 2NY7L 3TYGH 2QVTA 2AK1H 4PRPB 3ZUCA 1GIGH 2FJGB 3D50A 4BWNA 5EO9B 3HS0B 1T1WA 3APMA 1G7PB 2BDNL 4XH2A 1NA8A 3BN9C 5IG7A 2SEBA 1II4E 4BZ1H 4R7NB 3QNXB 5H37H 4AGOA 4HPYL 2UZPA 3OKKA 1VRSA 2ZKHH 3ZDMA 3MRGB 4OLUH 4KJPC 3NK4A 1LO0H 1GA2A 2WK2A 2Y2TA 3Q6FA 1LVEA 5JOEA 1CBVH 3A4DA 2J5WA 1T22A 2F5BH 3U6RA 5KG9B 3MV01 4N8VG 3T2PA 1CICC 4TQIA 3AE7C 4NKDA 4QF1A 1GW0A 1P4LB 2DPKA 3MV8B 4G1EB 3IJ8A 1JV2A 4Y99C 1P7BA 4KMLB 2Q6WB 1HCFX 1SM3H 4LCWA 4RMTA 1RE3A 2JWDA 2WCSA 4HPOL 3BUPA 1SMDA 1LMKA 3OB0K 3FWLA 1SQQE 1A64A 3GMRA 1J1XL 3GSNL 3MNVA 3RTQA 1K85A 2CHZA 1KLGA 1G7LB 2FATL 3DOSB 4RMUA 3PAVA 5I17B 1A6TA 4F2ME 4P46C 1NC2B 2Z8RA 4G7SB 3L3DB 2CO2A 2YXVA 2BY0A 4JVUA 1E42A 1TTCA 1E4HA 3GSUA 5KWYC 5BZZA 3QCTL 2Y6SC 4PRIB 2VXVH 2GK0B 3BEVA 2DZEA 3QPQD 5HDBE 4EN3D 2AXFB 4ZUUA 3U4EA 5EEWA 4XMPL 2SPZA 3LY6A 4TLKA 4FA8A 5CGYD 4POZD 5J1AA 3SQOL 4AUJA 2V2XB 3UOAB 4EUPA 1S9VB 2FYUJ 2P5WA 3ZDZB 1T1YA 2NLJA 3AU0A 2OMUB 3CFQA 1JGUL 3BJLA 5TPWH 1KFAL 3I9AA 1HSAB 2XG5B 3Q1SH 3GSQB 3QZLA 4DJGA 2YQ3A 2DICA 4JRYE 4P2YA 5C08E 4BQ8A 4JFHE 5I71C 3BH8B 4N28A 4G43B 3ROLA 1RSFA 1PP9G 2IBZD 2E46A 5J7CC 3DX4A 4HC1A 4R2GC 5EOCH 4OLVH 4B7LA 3SKNA 3FT4B 3H1HJ 2F74B 5C0IA 4JPKH 3NABL 3FXDA 3TBVB 3E3QE 3CZGA 2PYEA 1NCBH 5KN5B 3NQKA 2FGWL 1WWWX 2Y5QA 3GXUB 4E2OA 4ZTPL 3LH8A 4KVNL 4MXWL 1I7ZB 5CR1A 3OC5A 4HPOH 1QR4A 4Y5VB 3KPOA 1NTZD 3B71A 1BEXA 2YIHA 3GKZA 3PDDA 4NUJB 5DVOA 4FQ2L 3VGHA 4XPGL 1FDOA 4UYQA 3IKCA 4PG9A 4NO3B 4FE9A 1HU8A 4X5RA 3O0RL 4XCEB 2X70B 5DMIH 3WHE0 3MLXL 3T4AC 4K4KA 3AMLA 3VU2A 5DO2D 1URQD 3PABA 4IGBA 1INEL 2ZX8A 4F7TA 3VFGH 3DV6B 1DVFD 5AAWA 1U8IB 1OO2A 2FK9A 2EVHA 2NY3B 4B60A 5IHUL 1T6VN 4PRID 1K4CA 1U8JB 2Z3FA 3FCUB 4PJBE 1EEZA 4HKZB 4Y4HB 1LTJB 4AX3A 4E41B 4AMKL 1E9PB 1GW6A 4YC2B 1M6UA 1VZHA 3BPCB 2V7QJ 4TSBL 1Q38A 1WFJA 4GINA 1E3XA 4ICXA 3ZHNA 1PGJA 1UKTA 1HILA 1T66D 4DN4L 1KIUB 2EH8L 5JYLA 3IAOA 4BFJA 4UOQA 1KTDA 4E0RB 1KZUB 4YSUA 1F58L 2CO7B 4G6AD 4RVBA 2O6CA 4M4PA 1OHZA 2XIDA 4BDVB 5KANI 5DD3H 3BAJA 4RRPG 2JF1A 3E1ZA 1FFOA 1O9WA 2APVA 1TQWA 3EOTH 4EIZC 2F19H 4Q2ZB 4LLHA 4WEBH 1EHLL 1X22A 1T7YA 2IAMB 2WVVB 3IDYB 4K07A 2Z0BA 4QJ5B 1H15A 2KXPB 3UFIA 4F1ZA 4WWKA 3OVUB 5DJ2B 4R7LA 2WUBL 5T33L 2IADA 4I8DA 5I1HL 3UBXG 2F15A 3BUTA 4N6RB 2HXAA 4X6DE 1M7IB 3DNKA 3U1CA 1QPXA 2BOCA 3ZKMD 1BZ9A 3HC0B 2NNAB 3V4UL 5IR1A 3RY6A 1RZ8B 4NS0A 4UQ3B 4HEPA 3UH8A 3MO1B 4OKVB 1L0XA 4ELMB 3K5BA 1IE5A 2E74D 3KYOA 2P5ED 1EZVG 1NKZB 1TZIA 5B1KA 1GY2A 1Y47A 3T3PE 3P0GB 1OWRM 3DJRA 4OLXL 1CFNA 3G9AB 1JPGB 2DJUA 2YPLD 3CZEA 3JT2A 1G9NH 2YPLB 2BSCA 4XRCB 3O2VL 1UXLA 3EUUA 1PD6A 1K8DB 3AREB 4XP1H 4JR9H 1B2YA 2N01B 4TULL 2D3JA 1PQZA 2WQSA 3C6LC 4YFEA 5CCGD 1N4XH 4UQCA 3FTSA 4AVKA 2X2JA 2PLTA 1NBZB 4QXTB 5FUZH 5DVPA 5GGQH 3H1HE 3CFKB 1FYTD 4WUKH 2V4HA 4GG6F 1CGVA 3EDDA 4BZYA 1WC7B 2YD4A 1Y6MR 1FNEA 3M0DC 1QI5A 2P46B 4GAFB 3SPJA 3TJEL 1SOSA 3FU7B 4XP4H 4XPHH 3BQVA 3QNZB 1NU1G 4MQ7B 5B39B 1KDJA 3SDXF 3HBGA 1CTOA 1VFOA 2RAMA 1IAKA 4JZNB 3SHSA 2IALA 4NT6A 1M7LA 3L45A 3CLFH 4GEIA 3TF4A 1CGTA 1ZWIB 3VGAB 4BGDA 3CC4P 2A4EA 4HUUB 3SOTA 4R4ND 3HMXH 4Y2NA 4AIZB 2M5AB 4WQOA 1A8JH 1A4CA 2NY4D 2A45G 1LE5A 4Y2OA 4ELMF 3T08A 4FADA 4N8CL 4XNUH 4FA7B 5DR5L 3K3QA 1KC5H 4GQZA 3MNMA 5IVOA 2BIMA 2I9TB 3EH5B 3QCUL 3CGTA 3PWJA 1RPUA 5A7EA 5FV2A 4GRWE 2JCCF 3S9OA 1RZJC 4WTXA 3TTYA 1BREA 3PNWB 5LBVA 5E08H 4JQIA 4XB3A 1QYGH 3AWGA 5E2TH 1WFIA 3GKWL 4LDLB 3ARSA 2OCCB 4MAYA 1S78D 4MNQA 1M1SA 2WWOA 4HJSA 4IQHA 2EIEA 1L5GB 3BLKA 3NCJH 4ZXBB 5JW4N 3KQGA 1XO8A 4Z7QF 4K0OA 4NERA 2X4OA 4OLWH 4AYSA 1KYOJ 5HHPA 3QIBC 4U3FE 1AO7E 4O5LL 2DWXA 3OXRA 1JZHA 1F42A 3BPOB 2A4ZA 2H2PD 3VXRD 1MHCB 1HJ0A 2WKOA 3CVBA 4FD0A 4BE5A 1MY5A 2FRGP 2YAPA 3DI2B 1JK9A 5J5EA 1DL7L 1U3NA 3QNXA 3H2WA 4BK4A 2A5UA 1PY4A 3K2UH 5F21B 4MDRA 4HUNB 4J6IA 2E86A 5EU7E 5KVDE 4YPJA 1B0GB 1QYGL 4N24A 3TZVA 1DBKL 5E6IA 1MI5A 5EZIH 3IJYB 1DQVA 5FDWB 2RIKA 2ADJB 4FQJH 1IGCL 4KZEH 1MI5E 3QULB 3BIBX 4PM1A 1P4LA 4NZJA 1OGTB 2YHGA 1ZR2A 4S1RH 4HG4J 5I28A 4TUKL 3C6EA 3F84A 5LXGL 3L1EA 4M61B 2H3KA 2R7EB 2DF3A 1A9VA 5KZCB 4G6FB 2KZKA 1TZGH 2AEFA 5DC9B 5E1HB 3BCCG 3QRFM 2GPZA 4XNMB 5FUOH 5IOPA 4YEFA 1A6VL 1LP9E 2GT9B 4I48B 5D2LB 1KCUL 3WU2E 3SGDI 4JPWH 3V4PH 3P4NB 4M7LH 3QWQB 1DO5A 1E2WA 2GFBA 3EBGA 4L1BA 4QLRA 4PP2B 2VMEA 5C9JB 5FFLA 1L9TA 4LFHG 2NT1A 2PPAA 3QQDB 3CZSA 3IFLL 5F7YC 3U0TB 1ESOA 1DQDH 1CU4L 2IV8A 2Y1YA 1XEUA 1TT6A 5KJ4A 3D4YA 3SJVE 4Y0GA 1JY3N 1QNZL 2EVIA 1JNNL 1WZ1L 4QTHA 1PDKA 3N3EA 3RA7L 5I1JH 1JGVL 1RERA 1MY7A 1BVNP 1FBIL 1T1YB 2ED7A 4J3OF 4J27A 5LNEA 2KLUA 2HLOA 4OD1H 3KZ8A 3MGNA 4K94H 1YN7B 3NGBB 4WHTB 3SDXA 4TT3H 1VJSA 2JDIH 1BWWA 3EBIA 4NRXB 4XPAL 4U7KA 3R2PA 4XC1H 5D7EA 1X79B 5GJSH 2H3NB 3HR5A 1T0PB 2VZ1A 5EUKB 1UC6A 4OJFH 1ORSB 3S9DB 1A5FL 3W5NA 3ILEA 3DDFA 4X4XB 4JRXE 1TZ8A 5C0IB 3ZDXE 1BLNA 3NZSA 3REWA 4KXZI 4R26L 4DIXA 4W4OA 3VWJA 3QWOC 1NCOA 1MFDH 3OAZK 3VFVA 4YXHH 3LH9A 4FG6D 1S7UA 1E5YA 4MB1A 3T2LA 2Y2WA 3EYFB 4P46D 4ETQA 4JPIB 4LSPH 3C5ZB 2EC8A 4PWIA 4ZMWA 4XA4A 4M1GH 5E8DL 3LMJL 3F6LA 2D7OA 1D5IH 2R69A 4NJ9H 5F71A 2X7LB 3P0YL 2WVRA 3F3HA 1JTHB 1A47A 2QLYA 2IDFA 5KVGL 4FQCH 3PP3K 4P23C 3ZTEA 2IAMC 3AE5C 3FU6A 4GB9A 4LDOB 3VXQA 3K7UA 1EAQA 3GZOA 2KLSA 3OKNA 3QEQB 3ULUL 2O6DA 4W9LC 5DQDH 4LQ1A 3WBDA 1WCQA 2R2HB 1XV8A 2F5AH 4JFXB 3CZLA 2BP8A 4Y9BA 3ARWA 3MXWH 1LTJA 1PTZA 5JHDB 3MRJA 2O4EA 1X9VA 4WFED 3IMTA 4MJJA 4J28A 4XP4L 5D1ZD 5E95B 5GSRA 3QRGH 5JORA 2ZPKL 1H6UA 3B7YA 3QEQD 4FZ8H 2X6UA 4HH9B 5HI5D 4LCYA 5HY9A 1AI1L 4WFEE 1IAII 1DYZA 4LSUL 1KIUA 4N20A 4OZIE 2ITDB 5D93B 1JNJA 2WM0A 4RNRA 5IBTH 5L2KA 2ZNXA 2YPVL 3T04D 2FQDA 5C0BE 1FO0B 1HT6A 3IJEA 2RMZA 4WEUD 5C07B 3VTAA 3EYQC 4CADB 3EOYG 4AQ1C 3D52A 1FFOB 1RJZB 3NSFA 3VXRA 4NO2B 2H41A 4ZO9A 2PWFA 1I31A 4I0PD 3EYUH 4Z18A 2EDTA 3FCGA 5I1IL 1PNCA 4DGVL 4OGQB 5F70A 3P40A 3RBGA 3QUZB 3KD4A 1DVUA 1HL4A 2X0VA 1KJ2L 5DTFB 1KB5A 3D39E 4Y19B 3UBGA 1FE8L 3LNDA 2XWJA 4IHOB 3QC6X 2ZCHL 4NM4L 4H0GA 3UYPB 4AJYV 5IVZA 4K3HA 4FF9A 3H4FA 4P3DB 2Y0SA 3MV8E 3KWUA 2GY5A 1E67A 3GHEL 4JREB 5FKPB 4QRPA 5IB2B 3D25A 1ZJAA 1OAXL 5KAFE 1V7NL 3BWUF 1OK8A 4PI2A 3ZHLA 1R34A 4ELMA 3K2KA 5EEVA 2NZIA 3EJZD 4Y5XB 3FRUA 3ZYZA 5I76A 4ELME 4Y2DA 4NQQA 4X5QA 4KRLB 1CFNB 2W88A 4UI2A 3E38A 3C08H 3N85L 4IBWA 5F7DA 4YHNB 3FOMA 3PDOA 3DXAD 1Z9NA 3JWDH 4PJXE 3V2QA 4AM0Q 5GZNC 4LRIC 3RL0D 3B8YA 1IAMA 5LCVA 3VCLB 2X6VA 2J6EA 2WWMC 2FUTA 4JHVA 3VXSD 1EGJL 4HS3B 1ORQA 1FNFA 5AVUB 2JELH 4F20A 1EZUA 3AB0B 5MERA 1EAPA 3N40F 3KWTA 4PJAE 1KIRB 1OALA 1FG2A 1OP4A 4DN3H 4OWFA 1EHAA 2HFFA 4UZUA 2JJSC 3VG9B 1FUNA 5J9PB 3QDJB 2J2ZB 1RHFA 1UM5L 3PFUA 4RFNB 5K9JL 3HOGA 4U7JA 3ASNB 4PGCB 1UM4H 3NJNA 2FR4B 1YECH 4DH2A 4JBZA 1KMIZ 5DMGD 3N1PC 3EH2A 4PJ7F 3TNMB 2Z1PA 4I7ZB 1PX3A 2O5XH 5HD8C 2NY0C 4Z7UA 4IW4C 3RK2D 5SWSD 3PPSA 1MWAB 1T20A 3PWPA 4PCTA 2HT3C 2FO8A 5HXMA 1QLRB 2W07B 2LR2A 1VQ8P 4O2EA 5KSAC 3X13A 1WRFA 2O1KA 2DWSA 3GB7A 4PP1C 4HUUA 5E5UB 2CJ3A 3N5AA 4L0ZA 2DQFA 4NN7B 3QFGA 3VU1A 2JJWA 3ETBJ 1SRDA 5H4YA 1HHJA 1F3DJ 5J12C 1OAUL 1P4BL 1LTSC 1CFVH 4WV1C 2GJ6B 1R3HA 3RGVA 2A83A 2Z64C 3D2UA 4ZJ9A 1AFOA 2KZ1B 4HF5H 4ES9A 4U1SA 5DUPL 5K1VA 3PWJB 4U0RB 2ZT9D 1LO5A 3FTVA 5FPIA 5IUCA 1DQQB 2NQ3A 3EYVA 1A7RH 1PP9E 1F3JB 3V4LA 2NUPB 4LOUD 4UOJA 2XZCH 5E4OA 5J56B 4WK2B 3S96A 3V6OE 4CKVX 3ARTA 2OYMA 3QIBA 1OIOA 3LIUA 2ZNWA 5CSBA 1DLFL 1PFIA 1PLBA 4CMMB 4JAMA 3PUUA 3S37X 2H6PA 3P54A 4TVPE 2AK1L 2CALA 4K5OA 3HR6A 5D1XD 1G7IA 3ARGA 1MRCL 2HRHA 2BFVH 4NUPA 4OKDA 4NCC1 1D6EA 2UXVA 1JTOA 2ZE0A 3ZKXC 4JFDD 4PRHB 5CHXA 3MROB 4NYLB 2CSPA 3QVAA 2DAVA 4KKRA 4MFHA 3U6XA 4FQXC 3C60B 3U7WL 1HGZA 3OSKA 3BLBA 4MB4A 3RUGF 5FW7A 2ZUQC 1QHPA 2EDRA 2MEJB 2GJ6E 1ETZA 1RHHB 3LQAH 1KJVB 4L4TD 3W0WB 3O3DA 4JO2H 4WO4A 4CDHA 4YE0A 3V79C 1SOQA 3EJRA 3GMOA 2QJYC 4LLAA 4PGJA 2F7RA 4Z78B 3NRQA 4K9EH 5I6PA 4KO6A 1WV7T 4YHYC 1ID2A 1XGZA 4ZRGA 2ROYA 1KGCE 3DGCR 5EV7A 2Q8AL 2IDQA 4L3EA 3R7RA 4H8QA 4HAGA 2CUIA 4ZFGH 2Z31D 1TPXB 1TTAA 4LNRA 4LRNL 1M1JB 5EC2B 1MRCH 3TBWA 4QO1B 3CWGA 4BIKA 3CCEP 1EZSA 2ZWKA 5D1ZC 3RK2B 1MCJA 3TO4A 4DGIL 5EN2B 4I1LA 2NX5A 2BEQD 3R0NA 4W4OC 1GAFL 5KW9H 4RAVB 1MCEA 4M7JH 4HKXA 2EEXA 5JYMA 2WXIA 2XFXA 5G4MA 2E9GA 4HB1A 1HIMH 5I1GL 4PVNA 3N42F 1LE9B 2GJPA 1NCIA 3QJSB 1PW3A 2W0KA 3OAYK 1N68A 1U8CB 3OKEB 1DVTA 3VQ1C 3RLSA 3UO1H 5LG1A 3DXAA 1HNYA 2YXWA 3P4MB 5E2VL 3GYRA 1KTKE 4LF3B 2I27N 3Q9PA 3ZZSA 3KZIH 2DTML 4ZSOB 2OSLB 4U7MA 5AZ2H 5C0AA 1J88A 2TAAA 1S72P 4KHXA 3RL0B 5D1QC 4FP8H 5I1EH 3B2XA 2QIWA 3WXVH 2W83C 2J4WH 3QG7L 2X4SB 3VNYA 4I2LC 3C60C 5DJXB 1VFUA 3MUGA 4UT9A 3SE3A 2WSKA 1CD9B 3UDWA 3L75D 3LKNB 2NY6B 4UU9B 3MGOA 3VRLE 4NDMA 3IBOA 3W68A 4JG9A 2Q2LA 5D9SB 5ISZE 2CLZA 1JM0A 3FO1B 2O5YH 1H5BA 2WWNA 4F37K 4K71B 3RVUC 4UZGA 5KUMA 3V6IA 4FMFA 4IYKA 4B50A 1NDMB 3BP5A 4B9ZA 3R8QA 1N2DC 4LLYB 5IQ7L 4U6HA 2EVGA 1DP0A 2D2OA 1UZ6F 3H7BB 3NZ8B 1A7BA 2F7OA 1UKSA 5EC1A 1S78C 2EABA 3OKDB 4QR7A 4C56D 1I8MA 2W9DH 1X5AA 4TSAL 1UD3A 3QZWA 3NUKA 4WCYL 1SMOA 2B77A 4KRNA 3ULSA 1FZAA 3QDGE 5C97A 3GXIA 2DQ6A 2W8CA 4XOAA 4AQOA 2GBUA 1G7HB 1TQCB 3ZYJA 2XN1A 4DN3L 5J89A 1R0AH 2R59A 1MJJB 4WW1A 4AITA 1R5WB 5LXVA 3L70D 2HJFA 4XOEA 4LOEA 1LTAC 1K2DA 1U41A 3UTTB 4YSEA 5F3HB 1XR9B 4UT9H 3SEPA 3RK3E 1EV2E 3O45A 3D08A 2WXNA 4NZ8A 5CBOA 4P4RB 3UGEA 1L4AC 2FAUA 2DJMA 1U8KA 2VZSA 2FBJL 1GS6X 4N1HB 1KG0B 2CGYA 2E7DA 1L0QA 2Z7WA 2WXRA 3ECQA 1T7XA 4OD3H 5CN2A 3MNWA 1O6SA 4HXAH 1MRDL 4BQCA 2B39A 5JR1H 2ITDA 1Z3RA 5AKVA 3WTVA 3W81A 2WXFA 1GGIH 3FH5A 5IFHH 3H3KA 1ACYH 1K5NA 4XX5A 1BJ1J 2P47B 3NJVA 2GABA 4PI0A 5IB4A 4AUYA 1WD8A 3PE9A 1BFTA 3X14B 1DEEB 4I1RA 3VXRB 2ZCHH 3B2MA 4TTDC 1JSYA 1MUJB 1R3KB 1UD2A 4UDUA 5HHXH 2BSTB 4GI8A 1YYML 1KJ2H 1V27A 2ENJA 5D6DA 1U8QA 2KZWA 43C9A 1CU4H 3ERXA 3SBWA 2WJ5A 4NBYB 3WLBA 1YJDC 4J39A 3WJJC 2H8PB 3L13A 5DQJB 5J8OA 2Z7UA 2ADFH 4UILL 3IXAB 3VD0A 4AG4L 1N6QH 5FKAA 2CGZA 3L74J 1URLA 1ZHKB 4BFIA 2XQBL 3RL0g 4PJ9A 4YDZA 4BWTA 3VTPC 5GGUA 4TNVF 3VOPA 1PL3A 1ZRUA 2P48B 4PJ9C 5FA3A 1A6VH 4Q74A 1W72A 1BAWA 4QHKI 3RVTD 1E4WL 1N0LA 4I3RH 1UJTA 3QJFA 3FOLA 5TJHA 4OIAA 3RY4A 5DURB 3TT3L 1JYXA 4ZFFA 3LIZL 1OLZA 2O30A 2ODIA 1R8EA 1A65A 3FF7A 3VWJD 1BFSA 4WFHE 2Y24A 3EFFA 3S5LA 3H56A 2QKIA 4QY8B 4DP8X 3OMNB 4F33A 1KYOD 2YIUC 4MS6A 1NC2D 4MWFB 2H2PC 2J5LB 1S7WA 4BYHA 1AHWA 3DPDA 3GHBH 2HPOA 2CK0H 2FYYA 3LKQB 1N2RB 4FG0A 4A7PA 5E08L 3KGUA 2Y0CA 3ZMRA 2RGSA 1U3HA 4HS3A 5SWZB 1FL3B 1FLRH 3UZVB 5AVQB 5L8JB 3QXDA 3GJFK 3RK3D 2UZYB 4JM2A 4TPRH 3F6JA 4BFGA 3O9WC 1BMWA 3FMGH 4HIEA 2HFFB 3WEXB 3S1KA 4U7SA 4QRAA 5CSZB 3OF6A 3L72J 3CCVP 2J1WA 4CU8A 4PPTA 1G6RA 4BXLA 1QAWA 1TF4A 4IRSD 4NENA 4EF3A 3PIQB 2DEYX 1UZ8B 1MFBH 1DJHA 5H2BA 2FJGA 5DO8A 2DQIL 4JFPA 4B9KC 2A7BA 3HS0A 4GIAA 1USDA 1AG0A 4RETB 3GMQA 3NN8B 4DPCX 2VDNB 4NPKA 2QJKB 1L6PA 2XICA 3QDMB 1GOFA 5DC2A 4YQXH 4TQ8A 4L76A 3TJPA 5KTEL 3MRGA 2NRGA 1IT9L 1H3UA 4RWYH 1NCNA 5B39G 2NY5L 3L5HA 3HE6C 3Q6FB 1RUKL 3INUH 3NH7L 5EBWA 1KY7A 4RX4A 4YN3A 1HH9B 1CTMA 3G5YB 3SE4A 2BCCE 4HXAL 4IKIA 2FFDB 1GYCA 3ESNA 4MHHI 4X6EA 3UMNA 1USQA 2KS1B 3MJ9A 5I1AA 4IJTA 4DSYA 1T7VA 3SD5A 3QUYA 1OM9A 4HKJB 3GC3A 1M1JC 4C8XA 2B9BA 4WY4B 5DDHA 3AY4C 2CLRB 2Z1KA 3GTNA 4X98B 3QWOA 4A7TA 1M2OA 3P3SA 3IVKB 4Q58C 1MCRA 3DJ9A 2MPAL 1TETL 4A67A 1JMMA 1MIEH 4X5PA 1YYLH 4EDXB 1K6QL 5TK2A 4AQAB 1NMCC 3MV7D 1YJDL 4F7KA 2E4TA 5FUCC 2Z91A 4XCCL 3L3DA 1GZHA 5TGBA 1R0AL 1C1EL 2WLYA 3L4VA 4K5NA 1ZSDA 4QHUB 2MCAA 2N59A 1CWVA 1ZTMA 2WNKA 1S1CX 3PL6A 5D7JA 1S5HB 4FXGC 2H47C 4CW1B 4DPRA 3P3RA 5T1KB 3FQRA 4HXBL 1EEYB 3UAFA 1VQ7P 2JB5L 3RK2C 1TOXA 3T1FB 4IRZH 4FHKA 2APSA 4F9LA 4F7EB 1S9YA 2XN2A 2R8SH 1GGTA 4G9DA 4J3OD 1SY6L 2ZUTA 4UT6H 4R5XA 3NPSB 5CBEB 4YGAB 4FEMA 4Z7OE 3RX9A 4BUGA 4Z7OF 2IGFH 2Z8WC 35C8L 3GMOB 5AWNH 5DS2A 2PTVA 4JPQA 1ZV2A 1NBYA 1O7VA 2V5MA 4PJHB 4KI5C 3O11B 3NDYE 2M2DA 3A4EA 5JPNB 3Q2WA 1CGSL 3H85A 1IC5H 4KDWA 1YCSA 4ODSL 3P32A 1IK9A 3SKNB 1NIEA 4HOMA 1BYOA 4URKA 3A7OA 3FPYA 1NWQA 2BSSB 1WIPA 5DSCB 1X4XA 4YSQA 4EEEA 1V5JA 5E6YA 3UAAA 1IC4H 2ZXWB 4YNYB 5KN5A 2BHYA 5ES4B 4NAQA 1ZPUA 3TFKD 1ES0A 3TNNB 1DQIA 1TITA 2N0MA 4O5LH 3DPBB 8PAZA 4DEPB 5ID1A 1I82A 4Z9KB 1J8KA 3QIWB 1IQDB 5I1KH 3EFDL 2N9YB 1PZ2A 3IDJB 1N0XH 1MFZA 2M0BA 4XNDA 2ADGA 4PG9B 2VWEC 4QD2E 5JW5A 3OTTA 5TQ2L 2Y3AA 1WD9A 3KPLB 1AQ5A 3JWNH 3QORD 4DFIA 3QP3A 1HHKA 1U8IA 4LASL 2XPGA 2N7BA 4IRZA 4XNYH 3SODB 3WMM0 1S9XB 5F89A 4TV3A 3RWJB 1M6OB 2P5WD 5H4ZA 2A38A 2CLVA 2W6JH 1F90L 3FB8B 2UZXA 2XVBA 1ZMEC 1AD9A 5DC0A 3X1BA 3CN1A 1D5XA 1UEYA 1MH5B 4PJHF 5BXFA 4QRRD 4FXTA 4DNLA 1TFHA 3LKNA 4X5LA 1MHEA 3R18A 5T1LD 4PJCE 2OI9C 5T1LB 3IN0A 1KGIA 2QBWA 4OJEH 2YAEA 2DWYA 4WRLA 3QUXD 2DQEH 4ELDA 4O4YH 4F37F 5JZ7C 3MJ9L 3ZE1E 2XTJE 1CICB 1BCCE 1LEKB 4YHPA 3D48R 4Q2ZA 3NZ8A 3BN9D 4LEBA 1N7MH 4M3HA 2WVVA 2R0ZH 2BFVL 3F7YA 1OSPH 1KIQA 3CLQA 5DYOA 3X11A 1WFMA 1AKJD 2AQ1A 3MRDB 3NRFA 4W7YA 1RF1C 5KLIB 1BZ7B 5JHDD 2YMYA 4LHUA 4ZS7H 4KVCL 4K5PA 3HC0A 5HPOA 3S5YA 4V1DD 4G9FD 4NRZA 4MASA 4B9IA 1E9OB 4ZFZB 1DLFH 3TCTA 1SQMA 1AXTH 2H0EA 1SQBE 1SXNA 5ESAB 3CFEA 4YGVB 1E0OB 4NPFX 2YD2A 1BQKA 1BFVL 2F54A 4PRIA 3S3PA 5IHHA 1JPTH 3AS3A 3VB9A 5D2LF 3L95A 3QUXC 3P0VL 1U2CA 4BZ2H 4XCNB 4L8DA 5HDLA 4YHZL 2VR8A 1NOHA 2NZ9D 3PG2A 3STLB 3TOPA 1XMWA 1Y07A 5AENA 4OIIH 2B15A 3GDCA 3T0BA 1DANU 3QYMA 3DETC 1OSPL 4N3TA 2DYPA 3WN5A 1DLHA 3BGFC 3TS8A 3U30B 2D03H 1PGPA 3HE7B 1NMBH 1I7UA 2ARJQ 2DBLL 3K6FA 1B88A 1FORH 2FJSA 3I84A 1HSAA 2FLRT 3GM8A 4XZUA 5CIPA 2H1PL 3KCPA 2DM7A 2Q86A 1YZZA 4ODTL 2W81C 4AEFA 1XGYH 2TRHA 1MRFL 1OOAA 1CIDA 1B2WH 2AAVA 2APBA 3QAQA 4RBPK 4GOEA 3UAJC 1XSKA 3FU7A 4MAUL 2D3LA 2UUDK 1AO7A 3TA4D 4YHIA 4MQ7A 2QJKC 3D39A 5TDPA 4R8WH 4MJ4A 4URTB 3UTSB 5IIEA 1TCRB 1RCYA 2X88A 1A2YB 4PGBA 2F74A 5MENE 3VXPA 2DEWX 2F8OA 1RZJH 2QL1A 3E7JA 3CG8A 4HIIA 1GTWA 1CFQA 1WPCA 3K8MA 5E9DD 4OSUH 5DRNB 3TVMA 2VJXA 5F7KC 4H5SA 4B41A 5I2IB 3DX2A 3GLEA 2PW2A 3KCWA 4QXGH 2V9UA 1K9TA 3B5GA 3MODL 4NO3A 1KBVA 4X7DC 3HMWL 4YDNA 2X70A 4QI3A 4AKOA 2JKVA 1YNTA 1XL6A 4S1DC 3ABMB 3W9EB 4LC1A 1RQ5A 2BWDA 4DEWA 4Z3TA 2AXWA 5GJSL 3LRLA 4UQ9A 5BRPA 1HL5A 1KCWA 1FVDB 5INCA 2CNZA 3KWXA 1UWEH 4U1MB 4L4VE 2IPTL 4YC2C 1NEUA 2VLKE 5K93A 4LESA 1XF3A 3CXDH 1A25A 4V2BA 3NFPA 4PVLA 3BPCA 4MKMA 1LTJC 3FUHA 3HUSC 4EMZA 4K3DL 2LVEA 2FYNB 4NM8H 3CFIC 1YQ3C 1DN0A 1IC5L 4E5XA 4FQXD 1OTSC 3QUHA 3QJOA 4NQSA 1Z56A 4P2QD 1MHPL 2FYZA 3IFOB 2FYUK 1ZXQA 3I2CH 1JTTA 1AE6L 2XX1A 3IDYC 3EF4A 4O2FB 1TJXA 4M8VA 5F0LB 4S1SL 2IPKA 5D96C 1L3WA 3D4ZA 1YUHA 3OJMB 4NSKB 4JM2D 2YD7A 1B4LA 1YEDA 2PWGA 4JGJA 3TBSB 3F89A 3LN4A 5IB5B 1QPKA 4YFLI 4OFYA 3QH9A 1URQB 4WKZB 3Q0HA 1SLVA 4OT1H 4YSSA 1CG9A 3K2MC 4EJ1C 3FX0A 2LOEA 3NIFB 5CD3B 1K4DB 4KKNA 3QEUA 2PP6A 3INOA 1FVCA 4GSQA 1QZ1A 3D5OF 2OMNA 2R29L 1BM3H 2XXCB 3L3OC 5C0DB 3CSFA 2KOGA 3HE4B 3D05A 1CICD 4OZHE 5HHOA 3MO1A 4OKVA 3HG1D 1N7ML 2APXA 3LQZA 5KLVK 2RJMA 4R5VA 4RDBA 2CK2A 5GRUL 3RKDD 5JIQA 1BGXH 4U1HB 2A6DA 2W5PA 3KYNA 5HYSG 4AQAA 4NQCE 2Y5TA 4POUB 3VRJB 5H35A 1S5IL 4PGEB 4L1HA 5AB1A 3K6IA 3M8OH 4H8UA 3FTGB 4KO9A 2E59A 4PWHA 2K9UA 3PL6B 2OV0A 1TDQA 2KK7A 2HA1A 3P0YH 3WHXA 1UD5A 3SJVB 5J3HC 3RAJH 3HD7C 1JGLL 2IZ0A 3WUUA 1EANA 1NIBA 5I23A 5I5MA 4QXTA 1ZLLA 4CGUB 3IGUA 2DKMA 3CFKA 4XB8A 2B3IA 4GUQA 1JERA 3K0WA 4JG1H 4K3JL 3AFLA 4NLAA 4HIQA 1M71B 4FNQA 3I50L 5T3XE 3S5ZA 1FRGH 4UTAH 1CFMA 4JKNA 3IMBA 1KNOB 4ODSH 1YNLL 4Z3IA 5CJXA 25C8L 1P4IL 2D7TH 1E6JL 4L3CB 3EXLA 1SQBG 3BIAX 3O11A 3K5RA 3CZFB 1XR8A 1M42A 4R6UA 1VZGA 1KB9D 4LEXH 4ORGA 4V2CB 2DQMA 2BERA 1ZK5A 2A74B 1QO3B 3DROB 3HAEA 2ZG1A 3QDGD 4HPYH 3X3GH 4A68A 2EIJB 5B7EA 4HCRA 2FLBT 5A16B 2D0FA 4AIZA 2WOBA 3MI6A 5TH2B 1PIGA 6CGTA 4Z1PA 3VFVB 2HN7B 5ESQB 1L0LG 3CMGA 1YNTF 3SKJH 4UANA 4KK6D 3LXCA 4JZJA 1PLAA 1PF3A 2JI2A 2V17H 4ZPTB 3S37L 3SQBB 1MREL 1OE2A 4BXVA 1AQHA 2E6JA 8FABB 5G2NA 1RF1B 4ZS6D 1T5XB 2PO6B 4Y16B 2G9HA 3AG4B 3KPRB 3OXSB 4G1MB 2IANA 1TEFA 4FQLL 1G9HA 2XZAL 2X89D 1CLCA 1W80A 2BC4A 4RH4A 4WGVB 4GI9A 2CMRL 3I02A 1AJ7L 4UM9A 1BG9A 1E50A 4ODUB 1D6VH 5IJKA 2W9LA 4AXWA 5E2UH 4XE0A 3QUKB 4L4TB 2QLVB 5F9AC 4N2OA 4CJ0A 3SWFA 3CN3A 5JHDE 3UJTL 5HYJB 2NZ1A 5FUOL 5CEXA 1J0KA 4XBGB 1E5ZA 1RZFH 4HC1L 4JN2B 5IW3A 2DM4A 2CLVB 3FB8A 3HNTH 4OZGE 1AD9B 5HDRA 1OB1A 1I3RB 2BIHA 2GCYB 3ARDD 4MS8C 1WWAX 4XT1C 4RGND 5K1JA 4GT0A 2R27A 4L8SC 3EYOB 3S35H 2HPCB 4TXVB 2Q7CA 4WW2B 2Z8VC 1BCCD 1DE4B 1JD9A 4C83A 4NC0B 2AJUH 1HXKA 5DJZA 3RIKA 5SWSB 2GUOA 1MCLA 1VACB 3M46A 4U6XB 3TZVB 1INQA 2AV1B 2HTLC 2NY5H 4PV8A 2JWAA 1LEKA 4ZD3L 4NO2A 3RPBA 1Q81Q 1OM3L 2XV5A 4FQXB 1BDCA 4IFMA 1MSPA 2XZRA 3ET9F 4LQFH 2KMWA 1LNUB 3WFHB 4AEHH 2Y72A 2AQPA 3QQ9D 3QUZA 1IAOB 4IEFA 5K39B 1J12A 3HZYA 4M3LA 2JIXB 3MRMA 3GM0A 4JEGB 4ANKA 1VFAA 3WJLA 4CSSA 1MKFA 1SJEA 3NFNA 2XKMA 1G1YA 3L1GA 5DA4A 3C9IA 4GT1A 1C16A 1DBBL 2D2CC 1CCZA 1TYEB 2C5DC 1Z5YD 2B2XH 1DCEA 5L4MA 5E23A 4A2LA 1UWGL 3NA9H 5CJOL 2JJTC 3K74B 3P8MC 1FYTE 5CEYB 1VKXB 3P4NA 3N40P 4JFEB 1AA0A 1X5MA 2O6PA 1JGLH 4WI0B 1WJ3A 3ULVF 3LNFA 3SKOA 4X6DF 1WYJA 3S6CA 3AROA 5E2TL 2ESVA 1VQMP 1YMMA 4X6CE 2ORBL 3RJOA 3Q5OA 3WXWH 4ZD3H 4DKEH 2CK0L 3HC3L 4L8DB 3SDDA 4OFKA 3BVWA 1HHHB 1DVFB 2N1TB 1SXCA 1XEDA 1E5CA 2ZXBA 2QR0A 1D7CA 3NIDE 3RWEB 4GMTH 5IW1A 2W95A 5GRYA 1MFAH 1TZHB 2NYKA 1OE1A 2WQ8A 4JG0H 1X5ZA 3IDIA 4JRLA 5EDSA 3CZJA 1URZA 1VENA 5J0BA 4U4BA 4NB7A 5DC4B 5EZOH 5HGBA 4LARL 2FEJA 4UNUA 4ZMVA 4HU2A 4AM0B 1C08A 1PIFA 1PLGL 2J6EH 1RY7B 3V6BR 3HFFA 1BHGA 5JDSA 3JBG7 1LT9A 4NI3A 2YRBA 2MQCA 1XZ0A 4OZIF 1XBDA 1XH1A 1WTLA 4ISVA 4KDVA 4FL4C 4UT7L 3MP7B 4UILH 1TCRA 1TMQA 1BD2D 1M7XA 4U05A 4NOFA 2GKIA 2XN9D 3MBED 2OL3B 4P23A 1JK8A 1JHLL 4HUWB 3REWB 4LGRB 2OQQA 2WB7A 1JI2A 1NUDA 4N0FA 1LHZA 1D7MA 3X13B 3MR9B 5HYQB 3ZZQA 4DKFH 3OMAB 3LW5J 2PMZA 3WFDH 1NLDL 3EYFA 3KGRA 1HJBC 2V2TA 3F12A 5GGVL 1KJ2A 4GUPB 3V6ZB 1KPVB 3CPUA 5L88L 3GGWA 1XBRA 3C1LA 3HNSH 2TSBA 1R3HB 4H8PA 3VFSA 3QDGB 1KEGL 3D2UB 3OAUH 4YDMA 4JPKL 1JZ3A 1UJ3A 1OP9A 3MV7A 3UIAA 2AK4B 3TPUB 3E6HB 4EQ3A 1BZEA 1D2OA 3DKHA 2BNUB 2V2WB 1J7VR 2YKOA 5DZJA 3DETD 5E4IA 3S96B 3EJCA 2NXZD 3Q1SL 5B21A 5KSVB 5PCYA 4MN4C 2VR5A 5JORB 4Z3HA 2WKOF 2OQJA 3VXTA 1J0JA 3EDFA 3FFOA 1W2KT 4MZRA 1GC1L 4QHLA 2DIAA 4Y4FA 4Z7UE 1YUKB 1EO8L 3DVNA 4AW4A 2P5EE 3VD2A 1VQKP 3WO4C 1AZRA 3IWUA 3T2OA 4J8RA 3FU3A 1KBKA 1X5FA 1EO5A 1NTZE 1U7MA 1NBVL 2H6OA 1FH5H 3BISA 4JQ0D 1VGEH 2AJYH 1IM3A 4S11A 5DZOA 4Z0BL 2VW6A 3DYPA 3ZRFC 1F3DH 4AK1A 1LQBC 1SBSH 1XCXA 4HWBA 3U9WA 3C60A 4GY4A 3KXFA 4PTTB 2VDRH 2ZCKH 5IB5A 3OHXC 3JWNC 2D9QB 2D2CD 2O5YL 2EIZB 4HGWA 3QG6A 3REVB 4Y19A 5IJBC 2R5BA 1Z2KA 4L3FA 1T6WA 3EBHA 4ZZKA 3BE1L 5T1DL 4TF4A 5KYYB 4YR6B 3ESUF 5AW9B 1A3ZA 4L29A 3B9KB 3HE4A 4FCAA 4JRWA 2DJSA 2EDJA 4JM0A 2V9RA 3FRUB 3LQZB 1CK0L 2CIIA 5BOZG 3O3AB 5D2NA 2QPEB 1MDAA 1G7LA 3NJLA 1M1JA 4GW5A 3KYNB 4Y4KA 2MSPA 2AXCA 2ZXDA 5I17A 4YDIH 1F97A 2QQKL 4YHNA 2J8UA 5IHWA 3TO4B 1S9KE 4ZMZA 2M83A 1IO4A 1FDIA 5A43C 3HPLB 2DQUL 3GSUB 1OCCB 5FHAH 3P0VH 2YAOA 2QHLA 2XOTA 1A02F 4RFOH 2HRPL 4RZCA 4IIZA 4WFHD 5IESL 2QQKH 4KXDA 3MLZL 4HJGA 3WHE1 3VACA 8CGTA 1SFCD 1GY1A 5J1AB 2BCCD 1B9KA 2EEFA 4M02A 3ATDA 2F7QA 1ML0A 3BP6A 3C8DA 3I50H 2QADC 4EUPB 5C0EA 4W6YB 4R7XA 1MG3C 1CDGA 1I9RH 1Q0YL 1ZANL 2XWXA 3T4YA 4ZSOA 1BBDL 3FB5A 4PGCA 3VD1A 3RZWA 3P1VA 2L04A 4N9GA 2PWEA 2Q87A 4CA4A 3VX1A 3LEXA 4FQIL 3I6LD 5IM7A 5A2BA 5TQ0L 1KV3A 2HFEA 3HC4H 4RFNC 3TFKC 1VQLP 3OHXB 4Q4EA 2ZJSE 1X5XA 2JNZA 3K4ZA 4NDMB 2EXWD 4JO4L 1UASA 3TZVC 1ZA6B 4NQDA 1FZJA 5DK0B 1T89C 3GB7B 3BRFA 1H5BB 5E03A 5CHNA 4U31A 1F1GA 4R7DB 1DQJA 2P10A 1R5SA 1BIHA 1T0OA 3X1NA 4E68A 1YY9C 3LXBA 3PWVB 4JRYD 5FO8A 2X6MA 5D7LD 2GJ6A 4MZIA 4U6HB 5A40E 4LB8A 2FXMA 4NKQB 1GCYA 4ZNEE 4S1QL 3STBA 2CXGA 4O51B 2R0KH 2FWSA 1XD0A 5C09E 1MCWW 2BOLA 5HGAB 4Z7IA 2W0FA 2E5TA 2AJVL 4MD4A 1BDDA 3UC0L 4XMPH 4FAAB 1C8QA 3T71A 2XKNB 3I02B 4UM9B 1REIA 3BWAB 1CE6B 1NM9A 2K37A 4AUUA 5H37A 4M7LT 1MCPH 4LL9A 3C87A 3AECC 1U9KA 4M7KL 4EXKA 3S4SB 1U8JA 3VXUB 3C5JA 5FGCB 3WEMA 2WXPA 1WWCA 1IFDA 3GBNH 4WV1A 4LOUC 1QSFE 3PWNA 1MFEL 4MZ2A 5CS7A 5EBLB 2NY4B 5K5YA 5KBNC 4DQOL 2ZUSA 2FZ3A 4WJ5B 3VN0A 3U83A 9CGTA 2NCEA 1MOEA 5FM5M 3H2QA 3BMWA 1XB3A 3H9HB 3HB3B 4ZUTA 3V0WL 4E0RA 1LO2L 1JIBA 5JOFB 5F8QC 2VJ0A 3K6DA 1QSED 4DOHE 4TQEH 5C7XH 3SBWC 1NGYA 3EDKA 3ECUA 2B0SL 2XZQH 3SBRA 4M7ZC 1MW0A 3A3YB 1LNUA 3D0VB 4XB7A 2MPVA 3V4VB 5JLZA 3GUTA 1G0DA 4KNUA 1QMUA 2H8PA 3UL4A 1M3JA 1VFAB 1QTSA 4KKPA 4UMGA 5J13B 5KBKA 4UOZA 4L3EB 4G7VH 4LLWA 5IMOA 3RVVD 4OZFA 5CO1A 3W57A 1R33A 3VG0L 1XH0A 1YEKL 2UY7B 1NEPA 1QUPA 1JGVH 2NNAA 3ZMNA 4MYPA 2XQYG 1NGZB 1QVGO 2X3AA 4CC4A 1YQ4C 1I8IA 2GC7C 2P8MA 3BKCH 5TFSL 4E9TA 1TUPA 3H42L 1UOWA 1RI8A 4NQEE 4PJGE 5HGGS 4DKEL 3S5LB 2IQ9H 4F80A 3FRPB 3I6LE 3GIZH 5EF0A 5AL0A 4ADJA 3F7RA 1EDKA 1EZLA 2YK1H 3QYNA 3LKQA 2I9LB 3HI6H 1ADQL 2WTRA 5LCVH 3RU8H 3H1JD 2ED9A 4LF3A 4KKZA 5EEYA 2HG5A 1QFUH 3TDKA 1NAMB 1NCDH 4PWEA 5C0AB 3ZTDC 5LLIC 1N5YH 2EH7H 1OAXH 4PYHA 4ESKA 1GTNA 1QR1B 4KJWD 2ZAHA 3FQTA 3MUGB 2D73A 3PXLA 5EOQL 5APTA 1AXSA 5EU7C 1ZGLM 4OH2A 3B5ND 5GGTH 4EOTA 4LLVA 3II3A 4G8EA 1ID5I 3JTBA 4K5MA 2W60A 3MYZA 4E36A 1NLBH 4MDJB 3ZKND 1PJ9A 3VXMB 4LPUA 1VQ6P 3SOBL 5CEZH 1S3KH 3RP1A 2ZXQA 3KPSA 1KY6A 2XTJD 4KQ3H 1QSVA 1D7FA 3MJ7A 1OT4A 3HC4L 1OP3H 4QKTA 4DCQB 3EJZC 4M4RB 5L7XL 1A1MB 4I5BA 3F7VA 3CCQP 2Y6SD 4PTUA 3HCVB 2EE3A 3RX8A 4N8UA 1MI5D 2BOBA 3D3VB 2VO5A 4OZFG 4R96B 5DK2B 4GT7A 3AY4A 2KS1A 1UOVA 3FQ1A 3JVFC 4GKZA 3UJJH 4BELD 1SQVK 4LSVH 5INDB 2X0WA 5F7WC 1VB9A 1AGDB 1NZRA 1SFCC 3FPXA 1YEEH 3O6FC 1HK6A 2R4RL 1YNKH 3KPRE 1K2DB 1JZ6A 1W6LA 3CSYB 4O02B 2VLKB 1MFNA 3MVSA 4PY8J 5FC9A 3QEGL 4HJJL 2ATKA 3V5DB 3GEWB 4G7YH 2AEQH 1SEQH 2CIKA 4LKXB 1D9KA 4UIKL 4JPWL 2H9GB 4M62H 3V4PL 1U8KB 4XMUA 2GTZA 2Z91B 3LB6C 5FECA 2J8HA 4HV8B 4QHUA 3E8UH 3H8NA 4F5CA 4UB6H 3I55P 1NOFA 2XV3A 4U4IA 3V4VL 2QTVA 3QUXB 3ARGD 3CBKB 4JFQA 3VJ6B 4NGHH 1FGNH 3GSVA 2ZYIA 1BM7A 5IB4B 4F7EA 5C0BB 3G5XA 1S9YB 3QWNA 5DF0A 3DRTA 4G9DB 4OCLC 4GUCA 2YSSA 1LDPL 2ORBH 2EJ1A 5SWSE 1J1PL 3SPVA 4N78D 5CBEA 5JXEC 1P5UA 1ZVHA 2MFNA 1IFPA 3KL3A 4ZUSA 3QULA 2P8LA 4L8SA 5FKAB 1Z5LA 1JVOA 5MENB 2GJRA 5C2UB 4PJ9B 1JHKH 1OQOA 1QLFB 1ROWA 2AEOA 4L29B 3BUIA 4N2CA 4Y5XC 4TQHA 1NFIA 4DFHA 3PJSA 4N90D 3D7PA 2GITB 1DZ0A 3ARUA 2OARA 1U2HA 3DVGA 1CGWA 4NC1E 1MFDL 4UOW0 4BUHA 4EI5A 1SHMA 1E27A 4GSUA 3H0TA 1FC1A 4ZUVA 4MTMA 3Q44A 3M9BA 2GFBB 2IH1A 3P73B 3QCVH 4JQIH 1AQTA 4GEJA 4R4NC 1DBAL 5B7MA 5C9JA 3MUDA 1URIA 2Q3EA 2GUSA 3QQDA 1IK7A 2X1XR 3V5HB 1F4AA 4M1DH 4J23A 1N12A 4KY2A 1G0YR 4KRPD 1VFMA 4X80H 3WKNA 4DUXA 3FN0L 3N7NA 2VL5A 5DJ6B 2QSCH 4PD4I 1O7DE 2ZX5A 4PJBA 2Y4SA 5FCUL 2UZYA 4JM2B 3TEUA 1RJYB 1BMZA 3WEXA 4LVOB 1UZGA 1PDKB 1ITCA 2YAMA 1HHKB 3FO0L 3IF1A 5C0EB 3TIDA 2AJ3B 1VSCA 4YXKH 4H8HA 1G4MA 2Z4QA 3MV8D 5FHBH 4L1SA 4WI5A 1HWTC 3DGDA 2UZXB 1CBJA 4PRIE 3OKMA 4HHGA 3MRHA 3AG3B 4DHLA 3G6DH 1A6AB 2WGNB 3MZGB 4X5XA 1QUNA 3WIHA 3VI3F 3HC2A 3SYCA 4Y5VC 4WSJA 4GKSB 1JMZA 1HEZA 2R2EA 4CVZA 1OARL 5HYSA 2LLGA 1EJOL 4G8GA 5MEOA 1IKOP 4FC3E 4JFYB 4M5YH 3G6DL 2VDLH 3QYCA 4IL6X 2CDFB 4KK5D 1BV8A 3E9TA 3ULUE 3UAJA 4YLBA 4YHPB 5D96B 1UQSB 2QVMA 2VISA 3O4LE 4P5TB 2PYFB 4E41D 4YDLC 1JAEA 3BJ91 5AB9A 4JHWL 3C60D 3MV9E 2VT0A 1BCIA 4X4KA 1TFPA 5D5ME 3QUMA 1PZ5B 2NPLX 3IPFA 4WY4A 4G7VL 4MD4B 5DDHB 5BRZB 4OCXH 3A0HH 5TISE 3L73G 4AC4A 3L75G 2X87A 3M1OA 3QXTA 3O3EA 5E6SB 3VXQB 3NIFF 4H7VA 1LP9A 2POHA 3INUL 1JGIA 4DOJA 2K3TA 3NH7H 1OPGL 4LZKA 5AW1B 4XNXH 3WY3A 5KJ7E 2ZSVA 1E9OA 3UBFA 1U6AL 3B56A 3NCYS 3MYJA 3VMYA 4NQTA 3TEZA 1P69B 2BP8B 1AGEA 1DBAH 3MRJB 5JO5B 4UOW1 5EIVA 1ZGLP 1UB5B 3B3IB 4RGNE 25C8H 4AI7A 5D7JB 4LT7A 1LDPH 3FQRB 3FT2A 1N59B 4KK5C 4M3JA 4OI7A 3DMMA 1RU9H 2ZOLA 2KPNA 4H26B 3QI9B 5IBUG 2FSEA 1TIUA 4AQ1A 3G9VA 1IMHC 2FL5B 2X38A 4ZUTB 3TK1A 2WB1A 3QDAA 3MJ6A 4P9MH 3L72G 4YXWH 1ZW0A 2WXMA 2XJKA 4FFYA 5D6CA 3SDXE 3ZHKA 3ZDWA 1NGYB 1G0XA 1UB6B 1IL1B 2IBZY 2VMFA 2DQGH 3GHPA 2BRRH 4JF7A 3LW5H 4HX1B 4H1LH 2BW5A 2FCBA 3EYSL 3O6FA 4LHUG 5L2KD 2LLNA 4LQFL 4FI8A 5T1MA 4N2IA 5JPNC 3V9FA 2HVKA 2QSIA 2HKAA 1MEXL 4PJCF 1ZLWK 4YHMH 3KW7A 2WQYC 2YMOA 2EE2A 5TDPB 2QEJA 3N1GC 4WI4A 5IIEB 5JPNA 2HMIC 3K72B 4ONFL 3P4OB 4HKZH 3D25B 2BSSA 2DH2A 5DSCA 1H9DA 2WXGA 1NAMH 3T97A 4FFVD 4LSQH 5T1JA 2HR3A 1EZVY 3A67L 5I76B 3QORA 4JO5A 2R23B 4J7RA 4MNHB 5FUZL 4F7MA 2XRAH 1ZVNA 3M45A 3LB6D 5FOBB 1EEUA 4GQPH 5ERWA 1G9MH 1PNDA 1QLEB 3RL2B 1VPOL 4KNQA 1ZVSB 4XAKE 3B5NA 3B8EB 3HUSB 1N9PA 5E9DE 1D2PA 1AQDA 1FU1A 4IU2B 3KZIE 5GJTH 2PO6C 4Y16C 5DFTA 4RQQA 1EDIA 4X6BB 5F7AA 4L0YA 1ZXKA 4U1KB 1YN6A 3J07A 1E28B 1DBJH 1ZE3C 3MTRA 4MMYB 4XVTH 3ZPDA 1JYVA 1BBDH 4ETYA 1ZLVK 1P7KB 4J1UB 1IC0A 3CFUA 1ASQA 1I1FB 1N73A 2V3EA 1NKRA 3TF5A 2RB8A 3BUYB 4PRPA 3DYMA 3NABH 4HIPA 1J9CT 1VFBA 1F00I 5B22A 2WUBH 4Z7UB 1U8OB 4RWHA 2A45I 4HZAA 4AYID 4P48A 2P5EB 1BZQK 5AVRB 1Y0LB 2E74B 3ARFC 5TE6H 5GGVY 4PS8A 2NSMA 3ML9A 5C71A 3TM6A 2FJHA 1X5LA 2OYIB 4L5FE 5ETUA 2CO4A 5AOZA 2ARJB 2WKGA 1FL5B 1YUHB 4NSKA 3ES6A 3TBSA 1M9WA 4KJWC 4PJIF 1C12B 4GH7B 5DMGC 1IGTA 1AJYA 1GC1C 1TVHB 5KG9A 2MQ0A 5K33A 3QEUB 5DXWA 3POHA 5SX5K 4Z77A 2KSEA 1AANA 3AE1C 4CSZA 3BH9B 4P3CL 4KHTH 1IUZA 2VXSL 4ZFZA 4JFEE 3IRCA 3MNVB 4JN1H 5TTRA 4YPGB 5HYIA 2O61A 4G6FD 3NTNA 1RULL 3FN9A 1Q0XH 3NSDA 4Q9RH 1RZJL 5G4NA 3ARYA 4LKXA 3GS4A 4E9SA 4PHZA 4R4MA 2EKSB 4L8BB 2OAAA 5JW4Q 2A99A 4Y1TA 2NRDA 4OZGA 1A7QH 4PGEA 2W38A 5FGCE 1DH3A 4JX0A 3RDTA 3RVWC 4IRSB 2OYPA 1PD1A 4FFWD 4IFFA 1O6VA 2KBGA 1N7LA 2CDGA 3CC5B 4M93B 4FQ2H 2DWDB 4PJXA 4X4ZA 4XVUD 2AXFA 4B9JA 5IROA 3LEYL 1OT2A 1SDYA 2DYPB 3CHPA 1P84I 4WY7H 5B1JA 3V0WH 3WN5B 2BFGA 1CDHA 3AUWB 3QZBA 5K9KA 5F1OB 3L74E 4UAOC 4EYYQ 5AOMA 1BAFH 3IFNL 4NNPH 1NICA 1S4XA 2OJEA 1QRKA 4XN9A 3ZE0F 4B0MM 3DX7B 3D0LA 2HKFH 1AO7B 2CCVA 2WD0A 3GO1L 5I16B 3W0WA 3HE6A 2EYSB 1T2KC 5KVGE 2KZIA 2WBKA 5FA4A 2G75A 3WAJA 4FNSA 5D7SH 1GGBL 4U3SA 5GPRA 4ORGB 5DZ9A 2CH8A 2F1EA 2CKBB 2DQJH 5IB3A 4JO8A 2I60L 3CVHA 3QR2A 4U1LB 4ZQKA 3TBVA 1XDTT 1UH3A 2YD5A 4JM4L 1WVZA 4M6NL 3B4NA 1NKOA 2JB5H 5BZDA 3HN3A 1NLDH 4P2RA 3MGTB 4A7GF 2J6WA 5FO2A 4XP5H 2I26N 5IHBA 2EECA 2Q2EB 1YNTB 1OF2A 4L05A 3TT1L 3S7GA 3IU4L 2ICEC 4RAVA 3QJTB 2BCMA 2GBVA 2J3SA 5E00B 3R1GH 1ZAGA 3ALPA 1DJWA 3CLWA 3C12A 3SE8H 3US0A 1HKLH 2IANB 4K7PL 3X2QB 1IM9A 3BP4A 2QJPC 3I9GH 2H0JA 2VE6B 4C4KT 1FVDA 1D9KC 4B9FA 2W1NA 2IPUK 5DQDL 3BRTB 2R3SA 5BRQA 1DJSA 5LUMA 1FH5L 1H8SA 3TC9A 4FXKB 2Y7MA 5AAMC 4Y89A 2OTKE 5AKSA 3HMWH 2P4AB 1OAQH 1R4XA 3CX5H 2UX6A 5EU3B 3SQOH 1JNLL 3K6OA 2J8OA 3L6FA 4KJQD 3HBZA 2V8MA 4AY0A 3G7TA 3ZBMA 1DN0B 4QRRE 4E5XB 1I8LC 1KACB 3AABA 3VXME 3WJLC 3EYQD 4C7NA 4DP4X 1XCQA 2WQVA 3MCKB 4OFYD 1O7SA 3L74D 2HPCA 4TNWK 2DYSB 1HEZB 2NY2B 3LX9A 4C83B 3QEHB 2JV6A 2CO7A 5MEPA 1B3JA 1KWKA 1CI6A 5FYLE 3RVTC 5BVPL 1AQ8A 4HLZH 4P06A 4PJFA 3Q05A 4HJGH 2GUOB 4AT6A 1G87A 5J4MA 4R8WL 5DJ8B 2A45H 2EDLA 1PIXA 3WJJA 5I1KL 1CD1A 3CXHH 1OK0A 43CAB 1IJDB 1WGOA 4JKKA 2OMYA 4FQXA 5FYKL 2HVJA 2MTAA 5B4MD 1H15B 3O4LB 4Q6IB 1TQBC 2Q6WA 1Q9KA 3QFDB 2C3VA 3VGDA 1F02I 3V95A 5B3JF 4D7BA 4YSOA 4LSTL 3Q2VA 1Q7YQ 2JWYA 3RY6C 3H1LE 4Y19D 2JP3A 2PR4H 3MRNB 1YMHA 2ESVD 1AR1B 5BO1H 2E6PA 4WW1B 4YL4A 3AEEC 3CDYA 4H13C 4W81A 3SSUA 2DLIA 4GQRA 4HWBL 3LHPH 1FZEA 1IBZA 3EGDB 2DN7A 5EU5B 3WEBA 4AV0A 4FX5A 4YDKL 1AGEB 1GU4A 1GH7A 4JCLA 4LBAA 4PJEE 3RWCA 3O45B 1Y6KR 2LGNA 2JVUA 2V3DA 4NXKA 2NY2C 1AR1D 2ESVB 2DOCA 4MCYA 5I1IH 4XO3A 3WG7B 4JDEB 2CZNA 4QHNA 4RO0A 3QFJE 3O3BA 2BCKA 3V8CA 3SJVA 1CT8B 2PETA 3AT9A 3E7KA 1JO5A 1U92B 3QI9A 3C9NB 2AGJL 1BOYA 2FT8A 3DXAE 2FSEB 1UT2A 3DI3B 2O01H 1PQZB 2FYUG 1F13A 1TZHA 1RF0A 1TO5A 2AKRA 1MF2L 2V2XA 4WI3A 4DAGL 4ODVH 2ILLA 5EULV 1CO1A 3P02A 4PJ7E 2FT6A 4K8RH 1IGIL 2EO7A 3FCTB 1SQBK 1FWXA 1R3KA 3GSQA 4KFZC 4UDUB 2Z35A 2BSTA 4HXBH 3EDJA 1ADWA 4LMQE 2AQ2A 5TE7H 1DJIA 1BLIA 4KXCA 3QZOA 2VRSA 3A0OA 4L3CA 4H44C 4AVIA 2VH5L 3KHQA 5KYNA 5HHNB 2GJZA 4MA1C 3U2SB 5GTHH 5HGDB 4AJ0A 4MA7L 1ZHKA 5I1CH 4UIMB 4DESA 1RF0C 4RISH 1WICA 1YHPA 2IC2A 3WKYA 1GL2D 4YBLB 3T97B 1GYAA 3O2WH 4HJIA 3RWGB 1W72B 5JXAL 3S36L 1I7ZA 3GJFB 2R23A 3BAXA 1M56D 4MCZA 1EFXD 4Z7WB 4Y5VA 2VZOA 2WUCL 3FGAD 2CR3A 2EDHA 3FFDA 1BF5A 2V2TB 2JCCB 1Q86Q 2DQDL 3TVMC 1AYRA 4FFYH 4OGAD 4IRJB 2V5YA 1MAJA 1PD0A 1UA6L 4YPCA 3B43A 4BE6A 1IGCH 4MWFA 1TTUA 4AWJC 3QK0A 2WLJA 4DKFL 3I3DA 4ZW3A 2AK4A 4JYCA 3NSCA 3FC8A 1P4IH 2D7TL 1M1XA 2AMUA 3CN2A 2KP8A 1IBHA 1QBML 4J3TA 3KGSA 5C3LD 5L8LB 2EDNA 1E28A 1FFPA 5IKCB 5CILL 4HA1A 4JN2A 4N2EA 4P2OB 3U0PB 3MC0A 3QUZD 4GOFA 1W0YT 4HEPG 3MA7B 3VXTB 3V4PB 1IBGL 1WP6A 2DL9A 4KZDL 4DP2X 3OJVC 1F6FB 2EIMB 5E1GA 1UZ8A 1CTNA 1KB5H 2XYCA 3NIDF 4YBLC 5HYEA 3WN5C 3DHUA 1KCBA 2B1HH 4BHUA 1DE4A 3VRIB 1OVZA 1VCAA 1XF2B 3UTQB 4JCWA 3TIEA 1MJ7L 3A24A 3F7KA 4JFHD 5IQLA 3ZTNL 3DX9A 1UIIA 3VFNA 3MACL 5BJTB 1LD9B 1OE3A 4OCWL 4XWGL 3ZKMC 1H6FA 1KCKA 1PEWA 1T89A 1B0GA 4A66A 2LU4A 4WWKB 1BE3G 3GZPA 3IJYA 3QCUH 5FDWA 4JNXA 4U6VH 1EHNA 1TVHA 1T3FB 4K9JA 4LLDA 4OGAC 5D7LB 3HI5L 4FCHA 1P5UC 1QOKA 1MQ8A 1Z3GH 1NTKG 2ZT9C 4JJOA 2H88C 4UINH 3LRHA 4N8CH 4XNUL 4Z77B 2HRLA 4LBEB 4P9ML 3WKQA 3BH9A 4KZDH 3WFZA 1KBGH 5CZXC 5IR1B 4U0RC 3OG6B 2VLRB 1TNMA 3PHLA 1BP3B 1EQ7A 1DCLA 3C6LD 2GT9A 6TAAA 5GTHE 1G6RH 2AEWA 1SEQL 3MV9D 4OZGB 1SQQG 5DEFA 2O1JA 3B83A 2Y5EA 4AG4H 4UV7H 2A9MH 4XPFH 1GAFH 4NP9A 4WWOA 5KW9L 5TK4A 4IU3B 4A2MA 1KORA 4M1DL 1I7TB 2VAAB 3KPPB 3PL6D 1UWGH 3NA9L 1SFHA 4AYCA 4FN0A 4N8VB 2MTPA 1OY3B 4OF5A 5CJOH 3TBYB 4EI6A 3LVEA 3BZ4A 2P80D 4GIOA 3SO5A 4PMFA 1DVFC 1S9KD 1RUQH 3B9DA 3L75E 3CIQA 3CZNA 1OAZL 2I5YL 1JVLA 2YXFA 2WWWA 3IFPB 4HS6A 2D9CA 3T4YB 2A0LC 4V11A 4R7VA 5JDSB 3H1LG 1AACA 4RISL 3BVXA 2MH4A 2OJEB 5C08A 4GXUM 2L4OA 3T0EB 4P07A 4NBZB 1NTMJ 4K7FA 2G75B 1K05A 3FO2B 2YLKA 4WEBL 1ZTXL 3M7OA 4YEEA 4UV7L 2IGTA 4XPFL 2XDHA 4TKWA 1JOIA 1L0NJ 2E4FA 5DK0A 2YD9A 4H13D 5AZEH 1MPAH 4ZQKB 4K15A 2HRGA 2WZPA 4R7DA 4I18B 5A7BA 1E8ZA 1HSBB 1RZGB 2B5IB 4ABWA 3L3KB 1MREH 1USZA 3F00A 4OF0A 3AAZB 1NINA 3P3YA 5H37G 2W9DL 1N86A 2ISDA 4QRUA 2BIIA 3O9WD 4EBQH 3B2DC 1M7UA 1IEAB 3NSXA 1KYOH 4TYUA 4NPEA 2R29A 1PPJG 4LLQA 4MBOA 1P4UA 2LT9A 3ZT7A 5AAPA 1SQBD 2UXFA 2VE6A 3BN3B 1F45A 1R75A 5JHMA 3DV4A 1FJPA 1ZOXA 4XMKH 1H8AA 1TSRA 1YJ9P 4AV5A 4X9GA 2GHZA 3F65A 1AGBB 4E9WA 1FOSF 3MFFA 3MLXH 2VR6A 3MRLA 1RIHL 3RWJA 5IV2B 5ITBL 1JY3P 3O6KL 3OXRB 3VSUA 1MG2C 4QNPF 2CPBA 3T0VA 4D8PB 1SVZA 4PV1C 1NGWB 3SGDH 4BWWA 1MH5A 5L4IA 1FE6A 1J18A 1KD1Q 1G1JA 4ODBD 4WJ5A 4WNQA 5IOKA 4JZOB 4AYBA 1MHEB 4JLRA 3EO1B 4M5TA 3MOBL 4AQEB 4M3KB 5BUAA 2Z93A 4AYEC 5BS0A 2DS4A 2NY6C 3C5ZC 4KK8D 3MBXH 5MEPB 3IRZA 4OLWL 2EZ0D 3KR3H 2XVGA 3ZE0E 3NXSA 1AZUA 3KXFB 4PTTA 5E6IB 4ZSOE 1HEJC 3VP9A 1CD1B 1SJMA 1ODUA 3AS2A 3IMSA 1RL1A 1UACL 2HODA 1NLBL 4RIRA 5IQNA 2HLAB 2P3YA 2H6UA 4HUCA 3Q5PA 1ZA3B 4YR6A 2XN9E 2QELA 4DJMA 2FD6L 3L75J 1SYSA 1JWUA 5FYKU 4TUJB 2E7LC 1A6ZA 2V7NA 4LGDE 1Z5HA 2NW3B 3T4AA 4XXWA 2WSFH 4LLWB 5IMOB 4NQDE 5FKPA 1X5JA 4XNMA 5IOPB 1WISA 4MNGE 3U25A 1K8AQ 4I48A 4ZMNA 3B9KC 4A6YB 2F8XC 2R0WH 2XTJC 1KJ3H 5JXAH 5JIPA 3MTXA 1UYWH 3MLUL 4KHXH 3UYRH 2WIMA 2TRYA 3ME0B 5CCJA 3GMLA 1JPST 3VAEA 1UTDA 4H1LA 5ABAA 2PCFA 2ZKXA 1S7RB 3FSAA 3HG3A 4EN3B 1UYWL 2PAJA 5C0GA 4Z95L 1KGXA 4KVPA 4Z6AT 3C9NA 1NAFA 3ZQ9A 5TE7L 3DLQR 3MNZB 4FQIH 3BXNB 4ZO6A 5FO7B 2HG5B 4HCRH 3KWWB 4Z7OB 3LRSB 3MJ8A 4XP5L 2EDFA 4KNTA 3SY0A 1N70A 1QFPA 4I0PC 3VDCA 4PS7A 3RK3B 4NQVA 4L0PB 3KCPB 4OT1L 3AW5A 4YLQT 4LK4A 1ET8A 3F01A 3WFBH 3LEXB 1N4XL 4Y1AE 1QFWI 2MNUA 4GP4B 2BS71 1QR1A 4JJ5A 4QJ3B 3SDYL 3HR5B 5EUKA 3MA9H 1SF3A 2XT1B 4NZUH 4YDJB 5T3ZL 4OGYH 4CBPA 4M8QA 4R3SB 3VXNB 5IP4A 1XWVA 2ZF8A 3LQMA 4P2OC 4BFRA 1FZJB 4DT2A 5GZOA 1KCVL 1GPOH 1MCOH 3WE6B 1SQQJ 2CA3A 4LKCA 3WUWG 2WHVA 4Y9CA 1MHHA 4FLQA 1FAIL 5EG6C 4Z7AA 2HX8A 3RWGA 1JWMA 2QSTA 5BUPA 2QFPA 2N9BA 5IBTL 2H26B 5FO8B 3CCLP 3GJFA 3T0AA 4ETQB 1EDQA 2CJSA 2ADIA 4P46A 1D5MA 5F1IB 3VMXA 2HT2C 3F7VB 1E4XI 3T6ZA 2AZAA 4PTUB 4Y9GA 3EJSA 3GSNA 3H1HD 2B89A 4J5VA 4LMQI 2XKNA 4W68A 3FTWA 4G9FA 3W9EA 1BQ5A 1CE6A 2CD0A 2GTQA 4DP1X 4OGXL 5BU8B 3CSYA 2Z34A 4G6KH 2BNRB 4J6RL 3UACA 1JPSH 1UH4A 1G9EA 1PKQE 2F1BA 1E3ZA 1RV6X 4M7JL 3V0EA 1ZLSL 3P69A 3V5DA 1A14L 4BZ2A 5CJ5A 1E65A 2P45B 5EBLA 2EIDA 2OA9A 2H8PD 2ZAIA 3ILQD 3NFPB 5ANMB 2IX7C 5IQ9B 1WIOA 3U36A 5DVLA 4HV8A 1TJIL 1VGEL 2AJYL 2AW2A 1IARB 2ITCA 3Q2LA 4KTYA 5IMLB 2QQLL 4AV4A 5HPMA 2R0LL 1EXHA 3QUXA 4UM8A 3TYFB 2EDEA 5E1AA 4HD9A 1E3FA 1XIWD 4I7ZC 3P7KA 2E9WA 2GIYA 3H3BC 3RRQA 4AMKH 1IFJA 5C0BA 3QR0A 4HDIB 2IPKB 5DJCA 3CPWO 2JELL 3TP4A 4ZFOL 1IFIA 5FWQA 3QJQB 2BVOB 4F8TA 1YYLL 3V4VA 2WSCH 3LN4B 3CU1A 3TTSA 3NVQA 4ADGA 3L2NA 1WBZB 1KJVA 1CG9B 2PXYA 5JOPE 1RIVH 2ZOOA 4ODHH 4DZ8B 3KJ4C 1A3LH 4HLEA 2VSKB 5MENA 4XNQA 3WIFB 4F9PC 1BPLB 3FHQA 5C0DA 2KB7P 3UPRB 2A6JB 1IX2A 2Y06H 3G3ZA 3AEBC 1NGXA 3M1BB 1TJHL 2K78A 3S34L 2OR9H 4J3SA 4LNRB 3DVGB 2NPSB 3L71J 1EZVI 1LP9F 2ZKWA 3D2UD 2AEPH 1XAUA 2Y5TB 3WNOA 5KVEE 4XVTL 2IH1B 2OM5A 2X5PA 3TZVD 1RE4A 4KKAC 4CU6A 2OL3L 3D4GA 1CFSA 1QQDA 1LILA 2FWUA 5J11C 3NZHL 1T5KA 2I9LA 3P30L 2NR6C 3CFBA 4YK4C 1AY1L 4N8VA 2HT4C 4PLJD 5FYLL 2Z6FA 1JXKA 3AY2A 1BCCJ 4JKPH 4PJBB 1UD4A 1SMAA 3MLYH 1X3DA 1JN6A 4FA6A 5JPMA 5J9PA 2Z31A 4PJAA 4HIXL 1FDMA 5L88H 1UUNA 4N2KA 2KI6A 4WWPA 5EDXA 2JH2A 2X1OA 4TUKH 1SY6A 5BOJA 4P99A 4J3OH 3KL5A 4WI8A 1H3GA 4Q7DA 2PTTA 3O8ZA 3L73D 1L0LK 4P9HH 3AWEA 1QUNB 3CZFA 1IGJB 4PJCA 1QLRA 5LDUA 3D12B 1I7RA 4W9DC 5DT1H 1F2XK 2A1WL 2HT2D 3BKJH 2GI7A 1M90Q 4H25A 3NOIA 3BKYH 3D2TA 2GHWB 2Y7QA 1FZOB 1SBSL 3B5NC 4TUOA 2WPRA 3GK8L 1XHHA 2ODHA 3OQ3B 5M1BA 1NDMA 1J86A 3BP5B 3CBJB 3UJIH 4QMEA 4R96A 2EQDA 6FABL 2FUQA 3SQBA 4BKLA 5IGXL 5T3XD 1KULA 1UKQA 4TOYH 5D1ZB 1IC4L 1NM4A 3VWKB 4BINA 1N64L 3EHBC 1U93B 5D4QA 4O02A 2BC4B 4OGQC 3QORC 2XBZA 3RYMA 1I3VA 1T3JA 3ELQA 1NBQA 1ZEAL 4NO5A 3AZUA 5DS1A 4DERA 3QUKA 4P8QA 2CRIA 4UB0H 5CCHA 4V1DB 1S7SA 1KCSH 3LZFL 4PJDE 3MRLB 4EOWH 1HDMB 3FS9A 4OH8B 1XIWC 3W82A 3G08A 4I89A 4H44B 3Q5TA 2F08A 1KN2H 3OV6A 3RL0C 5D1QB 3BFQG 4YHOH 1MW3A 2LAGB 2EAEA 4N1EA 3DTXA 4UQAA 3V52H 1E7VA 4Z1MH 5BS0B 1CPUA 1OGAD 5DJZB 1MN4A 4EI5D 1RZ7H 2EXSA 3G5WA 3CPLA 4NPJA 5L2KE 1FZBA 1GW4A 3MUZ1 3SPVB 2C9PA 4MBRA 1DEEA 1YEJH 3VP8A 3CSPA 1X5KA 1ETZB 2BHUA 1QLEL 1SGKA 2ICCA 4U1JB 4UT6L 3HB3D 3UABA 3FN3A 3L3GB 5GRZA 3WLBB 3FFCB 4P4KC 4ECNA 2BY3A 1FS0E 1TO4A 3HBPA 5TF1H 4TUJA 5EIIB 5D7LE 3G6JB 2CUAA 3PHAA 3WY4A 1CE1H 3L4TA 3A0HE 1U8PA 1SJHB 3B34A 1HUCA 5FA3B 3RGVC 3D85B 2YA1A 3V52L 4JFEA 4EIBA 4PJDB 3QORB 3N42B 3ZDYE 1OQXA 2QKSA 4F7MB 1OV8A 3SKOB 4DQAA 1HQRA 4ONHA 1G9NL 1RUKH 4ABVA 2H3XC 1O7DC 2YZ1A 3SPCA 4NJAL 2XFXB 1HZKA 1TETH 1AHWB 1AQDB 4HBCH 4IU2A 4F15B 3PNRB 3TBTB 1KCRH 2NPSD 3MRPA 3PHSA 3CVDA 1XGTB 2WZAA 5EU4B 1FL3A 2QJPB 1EXUA 5K5GB 4GIPD 2E74C 2ZCLH 3ARFB 5DHVA 4OJAA 4P4KD 3C6SA 2V7HA 2YUVA 4FP8L 1CXKA 4JM2C 4ZYKB 3Q13A 1GZPA 5IF0B 2YGVA 3RB7A 4YHOL 4AM0A 3ULUD 4JO1L 2BJMH 1CDUA 2PPFA 3L3IB 3QJHB 4Y1AD 1I1FA 3B7RL 3HFML 3BC9A 4M43L 4O58H 3C09B 2RTTA 4OI9A 2BVYA 4M8QB 3MGOB 3FMGL 4QGYA 2ZVNB 3UJIL 3TEYA 1U21A 3BHBB 4JFPB 4LAQH 2R2EB 3L16A 3UX9B 2B4CL 5HYSB 3CD6P 3WE6A 2BSED 4YJZL 3WNPA 4JFYA 2P5EA 2YQ2A 3NPSC 3RWFA 4PJIB 1Y0LA 1Q9OB 2CDFA 4B5EA 3CDFA 2AAAA 1NUFA 2CJUL 3KPSD 2H26A 1YY8B 2WPGA 5D5MF 2PYFA 4P46B 1WEJL 4HWNA 2ZIDA 3RIAK 4FRWA 2YMXL 1GYWA 3WY1A 2ZXXA 3AWFA 2BVTA 4UINL 4ZX5A 4XBEL 1SHXA 1T1ZB 5FLVA 2G2RA 2GBTA 1G7HA 2F58L 2OMTA 1MJJA 5I15H 2IXQA 4OFPA 4JG0L 1A0QL 4M62L 2NPSC 1FPTH 2ZSVB 1U7JA 3LKSB 1J8SA 5F96L 5FO9B 4YPGA 1I1CA 3THML 1MAMH 1HHGA 5DUBB 3ZK0A 1T3UA 1ILSA 1MQKL 3KPRD 2P49B 4EDXA 4FZEH 5GXBB 1PBYA 1CF1A 5J3HD 2CE6A 3X3FL 4KAQL 4XCYB 3EJQA 4BSJA 3FT2B 5FM8A 2C1PB 1ILUA 3LIZH 4TTDD 3MV11 1SXAA 3DMMB 1OCOB 4DCKA 3C5SB 1R5LA 1WLHA 3KDMA 3KH4A 4I3RL 2W65B 4L37A 1CE1L 5T1KA 1IBGH 4HWZA 2X10A 3FU0A 2E6QA 3MFGB 3T1FA 2B2XL 1DDHA 2VGLM 4OVUA 4K3DH 3HZVB 2PCPB 3MLYL 1ZE3H 2DDQH 3HG0A 5TF0A 3ZQXA 3AT0A 2XNXA 1D5RA 1UB6A 2FQFA 3ETBF 4TVPL 4JFSA 1JNHB 4M7ZB 1A9EB 4UM9D 2K88A 4KFMA 3OB0H 1IAIH 5F1KC 3B6SB 1TENA 2FYVA 3X3GL 3RWHB 4WSKA 1KUMA 1RIVL 2HTKD 1H19A 2VLJD 4ODHL 4OLXH 1NCTA 4X8JB 4XNZB 5DQJA 5I5JA 4XO8A 1WBZA 1QNIA 1EZVX 3GSXA 4AEIL 3HE6B 4YDKH 1KB9J 1NUGA 4NQXB 1E6JH 4RCAA 1AZVA 5GRWA 2X9WA 3PRZA 1MVUB 1FAKT 2YLHA 1AC0A 4N2NA 5D4HA 4U1IA 4U3SB 1CYGA 4FMVA 1K73Q 2ZYRA 2VLJB 4KI5E 1EXJA 3VRLF 5AG8A 1NGXB 3M1BA 2CIIB 2OP4L 3GSOA 1MCWM 2CGRH 4OU3A 2IH8A 1N6VA 5HVGB 2FKWB 2KKQA 4N25A 4KMTL 5CGYC 1MF2H 1W91A 4M1CD 5BZDB 4S2SB 1GL2A 1UOKA 5ACMA 1UWEL 5CZRA 3WLWC 1IGML 1ES0B 3TNNA 1IB5A 3HPLA 3HUSA 3QPQC 2D8KA 4LDEB 3WMSA 3SE6A 2R44A 3IDXH 3TN0B 3AGVA 4E9YA 3PJLA 2ADGB 3HVNA 4DP7X 2AI0H 4GAGH 3VO0A 2YKPA 1BQLH 1HX0A 2V5TA 4OIBA 1EHLH 2LR4A 3QXDB 2N7SA 2CMRH 2ZOTA 2HTKC 3H42H 2MJWA 3LNHA 3ULVC 2AEJA 3VGGA 3IJHB 4IMLA 1UVQA 2ATPA 4WNJA 1QFOA 1H89A 4MMYA 2GK2A 1X7QB 4Y2DC 4MYWB 4Q4IA 4F9LC 1MWAL 3APDA 3H9SE 3ZUNC 3LEVH 5HHVH 1ND0A 3ABLB 3TJHC 3H1KD 5KSUB 2NYZA 3DX6A 4JRXA 4W6WB 3LV3A 3SKJL 3GMPB 1WH0A 2I69A 3ZRSA 3FCBA 3BGFB 3VMZA 2XIBA 5BXFB 3VG0H 5CU9A 3NN8A 3OF6D 1HCVA 1UM6L 4HGMA 3VTMA 3GZQA 2RMNA 1JS4A 1VZIA 2OULB 1EFXB 3SBQA 4Y8AA 1K04A 3BSHA 3I75A 2HYMA 4LLMB 1LWRA 1NKGA 5DMIL 3BASA 4R4BB 5I19H 2ARJA 1S7QB 2X4QB 1DQJB 4IKLA 1KYFA 4IKNA 4TQEL 1PYWA 3SPGA 4JL2A 5EBWB 2BDNH 2ENQA 4UQDA 1WS7A 4KKLC 4I2XA 3BKMH 4N0YH 4YTPC 1SS1A 5I1AB 3BEWB 4RMVA 2YARA 4YSCA 2C3VB 1GD2E 1M2VB 3LSOB 3EJUA 3DTDA 1AH1A 3FQYA 5DYOB 1E4KC 1FJ1A 3X11B 1BF8A 2M8XA 4AZ8A 4FJ6A 5I6XB 3DDGA 3QGVA 1BZ7A 1CLVA 2BSRB 3FDWA 4LHUB 2LFEA 1I85C 1A1NB 1CMOA 4TQPA 4IIQC 4FG4A 1NTDA 4IJ3C 5L8KB 4FLHA 5HDOA 4LE8A 5C08D 2HB0A 2UX7A 4JHAH 4GIFA 4D3CL 1S3RA 1CGUA 3BO8A 3CFEB 1GDTA 1TR7A 3LQAC 1NU1D 3H6JA 3OKOA 3Q9QA 4NZRH 1ZSDB 1HDMA 5DU7A 1F6LL 3ZT6A 2BM3A 3G08B 4F15C 5ADPL 1S5HA 2XYBA 2E75D 2YRPA 1JNMA 1KXHA 3CFCH 3QFJB 2K0RA 4QHNB 2HPTA 5JHAA 4IGBC 1EEYA 1FNGA 2DMKA 4OZ4A 1BXXA 1NSNH 3D8MA 2E0PA 1KYOE 4GO9A 3D39D 1NHLA 4WW2F 4XI5C 1JL8A 3HJ0A 2AKRB 4WW2C 1ZLEA 1DLHB 1H3PL 1A9BB 2VRKA 4JRXD 3SPHA 5FR3A 3CH1A 3D0LB