5AW6B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw6B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw6B02
3B8EB 5AW0B 2W6AA 3V5BA 2JJLA 3L37A 2R5BA 1GU5A 5AW5B 1OWAA 1SLQA 3A3YB 3M0DA 2QM7A 3P32A 3V4QA 2E43A 3VTPC 1HBWA 1T2KC 3A2AA 5AW7B 1HUCA 4I2LC 5CMZA 3HTKA 4B86A 1H89A 2R5DA 5APXA 5APSA 1NWQA 1CI6A 2WPSA 1J2JB 3HE4A 5AVWB 3MD0A 5APTA 1GK6A 5APWA 3I5CA 5AVQB 2YNYA 2R3CA 1CZQA 5AVVB 3WGUB 3O8ZA 2C9LY 3L36A 3L35A 3KQGA 1MV8A 5AW3B 5AVZB 3TNUB 2R32A 2WWWA 4JYCA 5AW6B 1CSBA 2Q5UA 4DZOA 1GTWA 1FOSF 2XU6A 3WGVB 4XE5B 1NAFA 3LIEA 5APVA 2QM8A 1GU4A 1JUNA 3M91A 3HE5B 4C7NB 2XV5A 1YYCA 3T97A 4RESB 5APQA 2WT7A 5AW4B 4GKGA 2VRSA 2P7JA 1MUUA 2N9BA 2ZXEB 3VMZA 1HWTC 1KQLA 1H8AA 3SWFA 1GK4A 5AW9B 1S9KD 4GT1A 3TNUA 1HJBA 5AW1B 3KDPB 5AVSB 1SP4A 2IPPA 2YO2A 1FAVA 4LC1A 4KHXA 4AYCA 1S9KE 2YO3A 1A02J 2E42A 3NFQA 2P67A 2Q7CA 3LIDA 5AVXB 1CI6B 3VMXA 3HE4B 2WTYA 4HYTB 4C46A 4JYBA 5AW2B 3MGNA 4I6MC 2P2UA 1H88A 3NMDA 3IR9A 3M06A 4M3LA 5APUA 5AVTB 2Z5HA 2KP8A 2ZFCA 3VYIA 5AVYB 5AW8B 1MFZA 3NTNA 1A02F 1G2CB 3UIAA 1IO4A 1DH3A 1GZLA 3VN0A 2Z5IA 2C9NY 3P8MC 3M9HA 5AVRB 3P7KA 2XZRA 3V4WA 1OXZA 3M9BA 5AVUB 2W27A 4EOTA 2Q3IA 4AQRD 3TK1A 2WPRA 2WPQA 1FOSE 5APYA 1JNMA 3VMYA 3OAKA 4RETB 3A5TA 3A7OA 3M0AA 1GD2E 2WT7B 4AUWA 2BASA 1X8YA 3HE5A 1T2KD 4C7NA 2H7HA 3TYYA 3NXSA
chains in the Genus database with same CATH superfamily
3GKZA 4BFEA 1ADQL 4RNRA 5DHMC 3BRTB 2W9LA 3BWUF 2O01J 2Y7SA 4PAZA 3PDGA 5T1DL 1UM5H 2V3DA 4PQXA 4NBXB 3GMLA 1S7RA 2MCAA 1MRFL 2CIKA 4E5XB 1TZAA 1PL5A 1DSFL 1M7LA 1WIPA 2DTMH 1XF5B 4POYA 3KLHD 2WQUA 1HESA 4P3CL 5IOKA 1PD0A 4NQDE 4HGMA 4N6JA 2JJWA 4L0PB 4FLRA 1GHFH 3EXJA 1F4WL 1JZJA 3QW9A 4N2CA 3SPGA 3RZCA 4OLVL 2QGDA 2CM5A 4QR7A 4W9KC 1TTGA 1ODUA 2CCVA 1OTUD 1CK0L 4EEEA 4MMZC 3EZJB 2P5EA 1OO2A 4UUJA 2IWEA 2YIHA 2PCYA 3EHBD 2CLVA 3GJFA 3ZTDC 5D4HA 1Z66A 2RQEA 1SQXK 4S2SB 2NY4B 3TNUB 4DP6X 2DQDH 1J5CA 1HCVA 1PIGA 5LXGH 4JPIB 2DQEL 3TCXA 4NJ9L 4XAWH 5HXMA 2XNAA 3SIKA 5CD3B 3UDWA 4HS3A 4U1KA 2EVJA 4D8OA 1U91B 3FTGB 1HH9B 3B1UA 4JPSA 4HS6A 2X1XR 2K45A 1XXFC 2IGTA 3QXAA 5JNYA 4IKJA 5G4MA 4PD4D 2R2BA 4L4TE 1IAIH 2EXYD 3FSZA 4ERSL 1U92A 5BV7H 4OVNF 4GO8A 4R7XA 1OP3H 3V8CA 1FFTB 3K0WA 4YHML 5I1AB 1A4CA 2VDNH 2PR4H 3PWNA 3GHEH 1U33A 1UT9A 5I71C 4DK5A 1D7DA 5E94A 5H37G 4C83A 4HIHB 1L6PA 3MZWB 3LQAL 4JREC 5D70H 4MJIE 2GUOB 4JFFE 1J9CT 1S2EA 1XGTB 3QDGB 3MUDA 1F6LL 1YEWA 4E9LA 2Y3NA 4XN4A 3PQYA 5AAPA 4M6OH 4M3LA 1QBAA 3BKCH 1N2DC 1T83A 4K3JL 5FKAB 4MAYC 4A7PA 1XF1A 3D0VB 2AJUL 5IW6A 3QHFL 4KK6D 3SGJC 4MBRA 4L8BA 2X87A 3ECUA 3SDAD 3TPUA 3NA9H 2AEIT 3II1A 1UUSA 5EZIH 5B1AB 2HG5A 2VLRD 4LHUB 1S9XA 4X4MA 1OSPH 1T7WA 4H0LC 1DVFD 3BFOA 4PGBA 1X3DA 3FF7A 3RL0D 4S0TD 3TBYB 8FABA 4F3FB 2EDOA 1BCCE 1ZWIB 3VFGL 5K1JA 2X0UA 1K05A 5DUPL 2KSEA 2X10A 2W6AA 3O0RL 4S10A 5CEZD 2AJVH 2F0CA 2MKLC 3RUGF 3RX9A 1UGNA 1RUQL 2YK1L 1J9TA 5LNEA 1UWXK 3FQYA 4MMZB 1IGJB 1HK6A 4PIBA 4PRHB 1AZUA 1TQCC 5TJWK 1OE3A 3CPUA 3OR6B 3IFPA 1T1YB 5GTHH 2O5XL 1DBAL 2BSED 4ODXA 3CWBE 5EU7E 5IB2A 2FQFA 1AQTA 2DM7A 1I9JL 2O5NA 1DHKA 2N7BA 5E8NA 3THMH 3ZTEA 4YSAA 2XQYK 2DD8L 4DCQB 3US0A 3QCTH 5DUBA 1JTTA 5FYLH 4YSPA 3QNYB 5IF0A 4NPKA 1JTHA 3IXAA 4G6FB 5DD3L 5HGDA 5F1SA 3HJEA 3RGVC 3WIAA 3P0VL 1NGZB 5ID0B 4NKOA 2H0FA 3V4VB 1DL7H 2XRAH 4FG0A 1J5HA 3DX9A 2FYUK 3QQ9D 5MEPA 1MIEL 1RUKH 1U3HA 4OZFB 4QRTA 5EBLA 2Y7NA 5MERB 5HJ3B 3GMPA 1D2PA 1DQTA 4DP2X 3QWQB 3GSXA 4HOZA 1OALA 4G7VL 3O3DA 4NBYB 3UAFA 5I71B 3ORJA 5C0RH 3LKQA 4H5SA 1D5IH 3NDZE 4ODSH 4G43B 4P57B 3TO4C 1FA4A 3GBLA 4JREB 4PJCE 4QRRD 2GIYA 2ED6A 4L76A 1EUUA 1SXZA 3BE1H 4FQLH 5DWPA 3TL5A 1PAZA 2OTJP 4WBAA 2YMXH 4NLAA 2FYZA 4ZO9A 3BT2H 3FFOA 3W9EB 1GOGA 3HI6H 2QBWA 1QNIA 5B5EH 2BEZF 1H8AA 2DQJL 1R47A 2DMCA 1BEXA 1AQDB 4KZDL 4MAYB 4MSWA 2CHNA 3EFFK 1RZIB 4NPDA 2BSRA 1DJIA 4OV5A 1U8QB 3SO5A 2AHIA 4MXVE 1A1MA 1SVFA 1CGUA 1NTKK 4ZTPL 4GXFA 3BX7C 1NINA 1NLBH 3DVNA 1AA0A 2UZYA 4R83A 3A23A 3QZBA 4ILDA 2LGNA 1P6AB 3NJHA 3P30H 2G2NA 3P8CD 3ESPA 4QHMA 1EDIA 3KXDA 4PJ6A 2FAUA 3WFDH 1A4JB 2PPCA 1ERNA 1SRDA 1KYDA 2FDBP 3FN3A 3EOTL 2GI0A 2NTFB 3FPXA 4UTCA 1M57B 1HYSC 4OFKA 1ZA3B 4NJAL 2EP6A 3EJJX 2CXGA 1DEBA 1ZLDA 1OGTB 1PZDA 1SZNA 2F5BH 3CX5H 1A0QL 2OMUB 3HMXL 1FLRL 4R26H 4IU2A 4X8CA 4D9RE 1G7HB 4KTDH 4TLTA 5TPWH 3F7YA 2YWZA 3ULVE 4CPGA 1BXAA 2GBTA 4H44D 2L3BA 4G8GD 5D2LB 2FJFA 1FHNA 3B9KA 5K69A 4B9GA 3TYGH 2LVCA 4OF0A 1KZUB 1EEYB 1M53A 4IRJD 1B4JH 4ZKPA 1G2CA 3TJEH 3ZKND 3OKOA 2GUSA 3CD4A 1ZR2A 2DMHA 4BDVB 4P46A 3CFDA 2WBKA 3P69A 3M0DA 5DD6B 5F1NA 1R34A 3ZE2E 1W16A 3RGVB 1NO4A 4ONGH 2XWEA 5IK3A 3TBVB 1E3FA 5HHOA 3A2AA 4L29B 5C39A 3OLDA 3Q0HA 2BINA 2LT9A 2ZYHA 3BVVA 2NYKA 4D9LL 3TZVD 2XPYA 4KTYA 4EN2A 2WZPD 1S7SA 4X7TB 4QTHB 2X4NA 4KI1A 5APTA 2X6VA 4B9PA 4ABVA 3USSA 4N2DA 1OW0A 3TO4B 4HLZG 3F2LA 3TA4D 1MEXL 2OMVA 1H5BA 5DUJA 4NUJB 4LMQI 3ALPA 4WQOA 4OBRA 3QFJA 2HVKB 3CHXA 5FYKD 1JNHA 3VD7A 2V3FA 5K9JL 1ROWA 2B3IA 4G72B 2B3RA 4ZOBA 3A6BH 4LLUB 1V55B 1FVDB 4RMRA 1IVTA 1E90A 1CFQA 2FJSA 2Y07H 4JHUA 5FCSH 4QLRA 2IBZE 3FS9A 3HN8A 2Y25A 5AEAA 4KKQA 3QYMA 2Q10A 5JHLH 2X4PA 1MWAL 32C2B 3AE4C 2A38A 4LKXA 5KS9E 1CL7L 1FV1A 1MUUA 5HGHB 3FB8B 5I75C 2IQAA 1MG3C 1SBSH 5IW1A 3IGUA 3MRGA 3MRKB 1KTLA 4WKZA 3JVGA 3ABVC 4OZGB 4YHZH 5HBBA 3DMMD 5FW8A 2XNDH 2F61A 5C07D 3QHZL 5EB9A 2EAEA 5M95B 5DD5L 1IGTA 5I8OL 3OC8A 4YX2L 3NMDA 2KZKA 3UOAB 3VFOB 3WBDA 4UTAL 5KVEL 1JN6B 3B3BA 3QDGE 2WXOA 4BFGA 5C6TH 3GMNA 2F9BT 4DQAA 4XZUA 4BK4A 4E9VA 1SVBA 4TT3H 1BZ7A 2VLJB 4KRLB 4ZFQA 5HHQA 2BXYA 4ENED 3TCLA 4WFFE 2J1WA 5KAFE 1U8LA 4K5LA 3H85A 3A0BE 2YD1A 3HUJE 4GI6A 4HQQL 1P5UC 2Y7QB 2FYNC 1VQ7P 3EDKA 4FG6D 4DPCX 2DEXX 5CFHA 2LU4A 4RFOH 1FZGA 5HYSB 4Y4FC 5AZ2L 3PIQA 3VXSE 2EYTA 3H4HA 4JO5A 2O5YL 1PGPA 5IT2L 2IPKB 5JR1L 3G3ZA 4KDTC 2A06G 4IMKA 1AGCA 3VFTB 4Y16A 2LV4A 3MOAH 5CLWA 3J2PA 3U1CA 3DJRA 1VPCA 1UD3A 4YDVB 2VUOA 5MEQA 4MN4C 2WM0A 4F33B 2C3XA 5E4OA 3KL0A 3QS2A 4AM0Q 5IJVA 4JK0D 3M17B 4IMLB 2E75B 4NBZB 3BFQG 4J1UA 1OIOA 2QLVB 2YPLB 2NT0A 2WO4A 1FG2B 5IFJA 1FO0L 2ZIDA 4WU7A 1VGKB 3SE3A 3RBZA 1NLDL 1ND0B 2F7QA 4UOJA 4O58H 3BO8B 2QVAA 4HJ1A 1FL3B 2BY2A 3UAJA 1M1XB 1A7NL 2R0WH 3H9SB 4G6KL 5CZVH 4HCGA 4B86A 2C26A 4KBPA 4WY4C 4PTTA 1LE9A 5F71A 4L9LA 3MA9H 3Q8FA 4PRHE 2ZOOA 1UZ6E 3MXVL 7FABL 1IFMA 5FDWB 3T1FA 2NYYD 4IIQC 3QCVH 1P84I 2UZXB 2CBOA 1AE6L 1FYHB 4U1MB 4R9HA 3RJOA 4U6HA 5AW3B 4LAQH 1F6AA 5JXAH 2NY6D 1CLYH 3AMKA 4NXSA 4N87A 3CN1A 1K72A 1TZGL 2WBJC 3DIVA 2BRQA 5F9DC 3QUXD 5E2VH 5J12B 4AVHA 3II6A 2Z9TA 1GGCL 3BJLA 4N78D 3JWOH 1PPJG 3MODL 1XX9C 3QR1A 5I75B 3IGLA 4TNWK 1D9KD 4BK8A 5GRVL 1FFPA 1F90L 4EUPG 3D1MC 4B60A 1C5CH 4GFTB 1E9PA 2GUVA 1IM3D 1TQWA 3V55A 3OZ9L 1X4YA 3PU7A 4L74A 1CVSC 2NY2C 3FTSA 2H88C 3UTTE 2V2XB 2KBGA 3HHSB 3BVTA 3UIYA 4KHXL 4IOFC 2EUVA 5IHWA 1AXSB 1FN4B 4XCCH 3DVGB 2QSCL 5GSRA 2K9JA 4F2MB 1ZLVH 1P5UB 1OT2A 2RMNA 2FYNB 3APNA 1R33A 3KCPB 1ZA6B 2X3AA 4PLKC 4AXWB 5AUMA 4Y4FB 1RUAL 2YKQA 4OFDA 2VJXA 5IKCA 1GXEA 4JM2A 3V4LA 5E8OB 4OLWL 2OMZB 1JGUH 3WJJC 4AIZA 2CA3A 3F6IA 4FHJA 3GXDA 1PG7H 1A7RH 5JHLA 5ENWB 1MCBA 4GRLC 4PJAF 2IH3B 3WMQA 2MOQA 1FRGH 1BP3B 2D7QA 1THAA 1NC4B 5ILTL 2DQGH 3TGUD 2YKLL 1OOWA 1MH5B 4NQEB 5IESH 3L3GB 4LSQH 3VFWB 3G9RA 3JV0A 3FDWA 5APYA 1COBA 1SQXJ 3CK0L 4FNQA 4QAWA 3REWA 2D3JA 1KCWA 3U9PH 5K9KA 2FNWA 2VRAA 2EEDA 4WFHE 2H7HA 4WY4B 1N70A 3CHRA 1PKQB 2FL5B 2PO6A 1IBFA 1JRHL 1KB9D 1DQJA 2VDMB 3OSKA 5H2BA 1AXIB 3RUGA 1B4RA 1K6QH 2VR5A 1INDL 3FONA 2F5AH 3AG4B 4KKLC 5D2LE 3RIKA 4X5RA 3BGMB 5L4FA 3V5KB 4BKSC 3BZEA 3G71P 5I0XA 3U7YL 2ZJSE 2YEZB 4FYRA 2Z8WC 2IG2L 3LEVL 4U1HB 1S7XB 5IVZB 4KX8A 5I15H 2Z7ZA 3CIQA 1OAQH 4PD4I 2WO2B 4HKZA 2DEYX 4M03A 3LD8B 4LLWB 5ESVA 2VQ4A 4YDMA 1HWHB 1S7VB 5HJBA 2F54B 2R1WB 4XMLH 3QIWD 3LEYH 4JN2A 5DR5H 3BH4A 2V7HB 4H7VA 1U8NA 1FH5H 3OBAA 1AGBA 1LP1B 3FUKA 3VW3H 3RWEA 3QUMH 4OTXH 3RNQA 4Z6AT 3X13A 3L7EB 4OWFA 4FQHB 3FQWA 2FRGP 1DJGA 2VXUH 3BAJA 3O9WA 5D96C 5MEOB 2WZ0A 3WKML 3QZNA 2NY2B 4I0PD 3WD5H 3ULUE 4I3SH 3L48A 2JXMB 2VRKA 3PJSA 2FIKA 1QFUL 3EH4B 4GKZA 4KXZI 4EQ2A 3S36X 1RSYA 4MD0B 1KQSO 4PB0L 4YIQA 4AC4A 4Y1SA 1JFHA 4LSRL 3MTXA 2GTQA 3ZW3A 2WKOF 4LPTA 3RQ3A 1QABA 2ZF8A 5EIVA 1XR8B 2F6AA 1PIXA 1IGFH 2GT9B 5DQJA 4YBQC 1HEZA 1P7KA 5EEWA 4ALAC 3OKMA 4PJFF 2N9BA 3K6IA 4C7RA 1RIUH 4RWYH 4NGHL 2ZKHL 3L7FA 4XB3A 4PWJA 3G7TA 2YBRB 4X7DC 4DSYA 1NDMA 4ZYKA 4GRLB 1KUMA 1WS8A 1MZ9A 3GSNL 3U7WH 4BFIB 1ZVSB 2CDGB 2GSGB 5FM4A 3FSVA 5AG9A 4D6TJ 1Y7VA 1CGSL 2W90A 1F58H 5J6HA 4ANUA 1WLHA 3V8OA 1WFTA 4R8WH 1M1SA 4HJTA 2AJXH 4LFHD 2OM5A 4KWUA 5CINH 5KJ7D 5EUOB 3WG7B 5I1DB 1F2XK 3W1ZA 1AGEA 5L0QC 1MRCH 4JG1L 1DQMH 1MG2C 3MUGA 3KWVA 1I8AA 2VN4A 4XI5D 2FBRA 4YNYB 1HNFA 4HWNA 3BEVA 2VLJE 1RZGA 4KXAA 3SYPA 2C0WA 1XL4A 2XN2A 4YR6B 2FYUJ 2NUTA 3TBBA 2XWBB 1VFOA 3ULSA 1BD2D 4LDLB 1CTNA 1W0VB 1WWCA 3NCCB 4KV5E 5HDOA 4JO4H 2ENJA 3EJYD 1E4HA 3GB7A 2Z92A 4D9QD 2Z34A 3TYYA 1QLFB 3VXRE 5AOIA 4TULL 1T7XA 1KCRH 5JIHA 2JJLA 3C87A 3EFFB 5DGRA 1KYAA 4HUUA 4EJ1C 3AS1A 4EDFA 1PPJD 5I76A 1RMFH 1IC4H 3DX1A 1F4YH 4LBEB 3VFSB 3WFBH 4HUWB 2YPLE 1Q0XH 5TE7H 1D5BA 1B2WH 3L5XL 1EHLL 3F7KA 4UYQA 5L8LB 4O2CA 2XA8H 5D7HA 2Q7YB 3TA3B 5EU3B 5D96B 3V6FB 1MREH 2JI1A 3H2PA 1SBBA 2QPSA 1NBQA 2J88L 4N5UA 3GM8A 4D0CB 3BD3A 4MTMA 4ZMDA 4W6WB 4DP0X 2L91A 3S36H 1DQQB 1T1ZB 2AMUA 3C9NA 3NJMA 1NTKJ 3WN6A 1E43A 1GKOA 2ZPKH 1RV6X 4ZFOA 3VB9A 4U1SB 3EFDL 3NFNA 3WTVA 3MNVB 1UGKA 4HC1L 4UQ3A 4MNHB 5ALBL 4P2OC 4HP5A 2PP8A 3WTXA 4WHYG 1WJ3A 3CMOH 5E70A 1S3KL 2EXYC 4FQXB 2FX8L 3W39B 1NDGB 3WUZA 1WDAA 1HEJC 5APVA 1ZTMA 2OQQA 3CCEP 1CCZA 1AGDA 1SM3H 4Z78A 5D1XA 3Q7JA 2X2HA 4Y9EA 3ZN6A 1NJ9B 2G4GA 2E6QA 1G7MB 1BGYJ 2J6EH 1AQKL 4OZHF 1HSBB 4QRPB 3GO1L 2XZAL 4TSBL 5KYWB 4YC2C 3T2NH 2P26A 4MASA 3VVVA 3QUMA 2R4SL 5E6YA 1LTJC 4ZMZA 3QR2A 1QA9B 1MHCB 2VSKB 5L0QB 1J9RA 1GL2D 1R1CA 5DYOB 1U7JA 1IQDA 2WQVA 3NJIA 5KOVC 2DF3A 2OSLA 3MPCA 5TDOB 4ZX4A 1CO1A 2X4UA 3CFBB 3L70G 1ZJBA 1J8HB 1XZ0B 3C08H 3OQ3B 4E41B 3LOWA 3T0EC 3TF5A 1AHWA 4HOMA 5IG7A 4YWGH 1P4IH 2WC7A 3SQBA 2OR7A 4G1MA 3WTWA 1CU4H 1HINH 2P46B 4RAVA 1RZ7L 5IMLA 3RL0C 5M94B 3KAAA 4ZO8A 5GSVB 3AY4C 1OP3K 5B7MA 4PJIA 4MJHA 4JGMA 2GIMA 4AYID 1EXUB 3RNKB 3FCSB 1OAYL 4MX7B 4S1DC 2K70A 2FEDC 1D6VL 1DBJH 4NQEE 2Q7AA 4R7NA 2FIRT 3U6XA 3D4ZA 1F4XL 2BMKA 3MLSH 4YDKL 5I8EA 1YIJP 3VFVB 1DCEA 1DN2A 3I02A 1Q7YQ 4QRSA 5HJGA 5KVGE 1GJWA 2YKKA 4XC3L 3W0WA 2J59M 1HT6A 2AXWA 3KLSA 1PKQE 1U8CB 2E27H 4I88A 3B5HA 3OWRA 5E4AA 1PFIA 2GI7A 1FL5B 3PNRB 4PJ5A 4CN4A 3H1IJ 1PSKL 5APXA 1X9VA 4V11A 4E0RA 5DC4B 4FQCL 3DXAD 3VFNB 1LMKA 3IMTA 3EO1B 5I30H 5IEHA 1BIHA 3KXFA 4LVNB 4F9PA 15C8L 2AEWA 2V7NA 4KJYB 4KJPD 4LLVB 3QPXH 3V9CA 4G9DB 1A1OB 2F54E 4H26A 4FN0A 1HH6A 4MAZA 5F3HB 1X4XA 3VE0A 2LU5A 4CRPA 1IL1B 5DHVH 1GYAA 2BC4A 2IBBA 4DZOA 3SOBH 1LTJB 1NAFA 2I9LA 3EF4A 2R56L 4DN3L 4FI7A 1FNEB 3MGTA 3KGTA 3QEUA 5J6GB 3DYOA 5F7YC 4P4KD 1IE4A 3TIEB 4QJ5B 4ZUSA 1TTUA 2QA4P 3GHPA 4RMSA 2BVUA 5IVXF 3D2UD 2ZYIA 1BZ9B 1IKNC 5DJ8B 5K59F 1T66D 3ULUL 4DVBA 2VERA 3LTVA 4JCWA 4XPTH 3BZFA 5AKTA 1AVOA 4ABUA 2BCKB 3MLRL 5GZNA 3A21A 3KVDD 2WQAA 3T0EB 5MENB 2CJTA 3UTQB 3LRHA 1DLHA 5EZJB 3RA7L 5EO9B 1KTDA 2GKIA 3Q44A 1TZHB 2HUEA 2KPWA 3D52A 3AXIA 5SX4I 1HL4A 1L5GA 4M7ZC 3RPKA 3UJTL 1M1JC 1MI5A 3CFJB 1RULL 4F7MB 5E08L 2OMWA 4JFOA 4G59C 5DVOA 4PUBL 3T2QA 1KBGL 5DWUL 2M1KA 1KG0B 1S8DA 1AMYA 1E5ZA 2ZUSA 5ICZB 1DANU 3V4PH 3MRBB 4H25A 1RK0A 1TYJA 2DJ4A 3B7TA 1VJSA 3QJOA 3VXMD 2YGQA 4KRPC 2ZYGA 1G7LB 1R3HB 2MPAH 4ODWB 5D7JD 4M1GH 3RGBA 3CZUB 1EJ6A 3V6OA 4EI6B 1KB5L 2Z4QA 3EO0B 4MNQE 1CXFA 5CWSA 3T3MF 5ABDE 4JO8A 3B8SA 4ZMOA 3ABKB 5KLVE 2FYUE 1MQKH 1UZGA 1LWRA 3LNGA 1UASA 3M1OA 5L88L 1NUDA 1SQQG 3VU1A 2NX5D 4G5ZL 3CLEH 5DVNA 5EUOE 4EI5D 3WUWG 1L4IA 4NCC1 2ROXA 3HD7D 1NOFA 2Y23A 2HVJB 3AU1B 1A1NB 1IIKA 3BKJH 3BPOB 3NIFB 4HMEA 4Z9KB 5ICUA 1NEZB 3ZKNC 1GCFA 1KYFA 3OXRA 4NWUL 4RKUJ 1M90Q 4FJZA 1BMZA 3FX0A 1E4WH 2XV3A 4XR8C 1GS7A 4IKIA 5E2TH 5C0IB 2HFEA 4P3DA 1BVKA 3II2A 2H2SC 3NH7L 1NTMG 5ERWB 2FO4B 5C09D 3T04D 1SDDA 3O2VL 3UDWC 2BSSB 3ERXA 5IM7B 4RSVA 2Y0SA 3HPJB 2WVVB 5A2BA 4G83A 4FFVC 2AXTH 1P84H 4JRYB 3A0HH 3VP9A 1DFBH 1IAOB 1MRDL 3GTVA 4Q7DA 3QRFM 5HD8C 2WINB 4YHPA 4PMFA 2OYKA 3T65A 5F3FA 5ELIA 2R39A 1H89A 4GOEA 3ZGHA 1FYTA 2BW4A 1NTKE 1FORH 3VFUA 2HKHH 5GZOD 4YSQA 4RDQF 3P2BA 1F0LA 3CX5K 4PS8A 1RUMH 2XWTB 5DFWH 4Y9GA 3DTXA 4FQQB 2ZX5A 2J5WA 1E3XA 1MFEH 5KVFH 4QOKB 3EQ2A 2CWRA 3RILA 1R3JA 3MUDC 2D7TH 4M1CC 1ETJA 1HHIA 4Z7NB 2V9TA 4ZFGH 2ZD0A 1BF5A 4EI2A 4IOIB 3RWCA 1Q0EA 1IBDA 1L9MA 3NFSL 1MHEA 3OAUH 1M9WA 2Z91B 4M7ZB 1GC1L 4BFKA 5DQDL 1M1JB 5JIQA 3ZKSD 1T21B 3CVHB 5EA0H 4UQAA 2WKOA 3L3IA 1N7SA 3RTQD 5K9OA 4NKIH 4R4FL 4MZIA 2QZ5A 2EIEA 4RNRB 3HLKA 2YOCA 1JCCA 4PJ9B 4PS3A 1CD8A 2XIIA 1IQWH 4HCIA 4PJFA 5EC1A 4R4ND 5GIRB 4OD3H 5CJOH 3IFOA 2R0ZH 3Q8AA 4KRPB 3GMLB 3PHSA 1S7RB 1O7DC 4QRPE 2CIKB 2OXHA 4LLAA 5CILH 1QHOA 1AG6A 1NKZB 5KYYA 2V7QJ 4UYPA 1KIUA 1L2PA 5CBOA 1MY5A 3CDYA 5DHVA 3ZKXC 4P9ML 4KKAD 4PW9A 2O6FA 1G43A 3UZVB 1RQUA 1KB9I 4ZPTA 5D71H 2YLKA 2CDEB 3DRQA 1NTDA 3RZCB 4AL8L 3F89A 4XMKL 1CLVA 1OSEA 1VAHA 4MA1B 5KYNA 2P5EB 1JHKL 4XCFL 4UUJB 2F15A 1CFTB 3GLZA 2CLVB 3GJFB 4FQ1L 4KK9C 3I3EA 3PGDA 3TF7C 1ZVHA 2WSPA 2XTSA 2WP3O 4G80B 4JPQA 4BWWA 7PAZA 4ZUWA 4P2YA 1XF2A 5ITBH 4HS3B 1T0PB 2MOGA 4U1KB 1O75A 3CXDL 3QPQC 4CAGA 4OCXL 3CWBG 2GJ6A 3VGHA 1AOHA 4H0HB 1RZJL 3V4PA 5JNYB 1CI5A 4LOUD 2R2BB 3L72E 1JE6A 4PD4H 3OMNB 4I3RL 3EKCA 5EZLA 1L0LG 2OL3H 1DSWA 1ZV5A 4JZOA 1ZCRA 2C4FU 1B0RA 4BWTA 1GRWA 1N59A 1R9FA 3RK2D 2IMMA 5E94B 3U48A 4PJGA 5ICYA 1N26A 3IF4A 2W07B 4Y19E 4K23L 3BP7A 1H3XA 1KCSL 5C2UB 3DPDA 4FLSA 3BAKA 2WBXA 1U57A 5LBSH 1ZLWK 4K35A 4UB6E 1BMWA 1CS6A 5AOMA 2E74B 1MFBH 2K7QA 1MHPH 4J23A 2IF7A 3QC5X 2KZWA 4ZKUA 1CXHA 1AC6A 2ZX8A 2ALAA 3PQYB 3QQ3B 3D3VD 4M5ZH 2MTPA 4X7EC 3E1IA 1JPFA 1OCWL 3KYKL 1WT5A 4M00A 3QXUA 3GXMA 4KXZH 2NDFA 2CO7A 4DZBA 4HJEA 4A2GA 1Q1JL 3E6FB 3MHZA 4M62L 1W2EA 2ZUVA 4IRSA 1X5LA 1YN6A 5HDBB 5IB1A 5IW6B 2VKXA 4L8BB 1A5FH 2CQVA 1Q9WA 2HSIA 4K94L 1HQ4A 2NYZA 2PUQT 4BJLA 2E8ZA 4NPFX 3ETBF 2HG5B 3P9WB 1S9XB 2P8MA 3AT9A 4K73A 3IWVA 3FQTA 4HSQA 4PGBB 1GZHA 1BQLH 4HZ1A 2R27A 5HYQA 5EOCJ 8FABB 2ADIA 4HKJB 3PYCA 2X2YA 1UD8A 3V2PA 3OMIB 4R5VA 3V0FA 1CQYA 1NIAA 4P2CG 1SQQD 3NRPA 3X11A 1AFOA 3KPRD 4YUEH 4EXKA 1KYOJ 4JDEB 2VRSA 4W7ZA 2DL9A 2HTKC 2L4OA 4R7VA 4XXDA 2B59A 1CF8L 4LNVA 2ZXEB 5I5MA 4TNVF 4ZNCA 1NQBA 3AU0A 1OSZA 4B50A 3BCCD 3T0EE 3X12A 1LM8V 5MENE 3IFPB 1KLUB 1L0NK 4PRIE 1YEEL 4ODBD 3WN5B 5IB2B 1NTMD 1D5MA 3AQDA 3WSQH 5E8NB 4QHLA 4RCAA 3X1GA 1FE6A 2V17H 4IDJH 4P46C 4K55A 5I1CH 3V5DA 4UB8E 5L6YL 5IF0B 3M0DC 4XNXL 3IXAB 1IKFL 1YEGH 3MLWL 5HGDB 3DV4A 4X99A 2OQJA 4NKOB 3IMWA 1H8LA 1CIDA 3KPNA 5MEPB 2XPZA 5GTIE 4LLHA 2DJSA 1U3HB 5KSUB 2Y6SC 5EBLB 4NPEA 1EDHA 4UF7C 3CFEB 4M7JL 4XRCA 4ACPA 2DDQL 2Q2LA 1J11A 2XXFA 3GSXB 4OUUB 3BZ5A 3O3DB 3O8XB 3LKQB 4H5SB 1DX7A 1OW0C 4G5AA 1XXDC 1C16B 1DZ0A 1YMMA 4N2NA 4NO2A 1H5BC 1RJLA 1A66A 2XACC 2HR3A 1KTMA 1DEDA 2FQEA 1NMAH 2RMZA 3NIFE 2AQPA 3LPWA 4GAFB 2B9BA 3EO9L 1P7QA 2BNQD 1M7IB 4N2IA 3SFDC 3ZXAC 3MBXL 4B0MM 2XNXA 1J86A 4BQ8A 2YQ2A 4HULB 5F7MC 1OWWA 4PHZA 1QZ1A 3VYPA 2H0PA 4KXCA 2NR6A 1EJOL 4MSWB 1XH3A 1IC5H 2XKUA 4LCWD 4PJHF 4LQFH 1YNKL 3UBXA 2RH0A 1HQRA 3H53A 4OV5B 1OAZL 3JTSA 3MBED 3QDJA 3WNOA 4X7SL 3NA4A 5EH1A 3WNKA 3CSYA 4BELD 4JUSA 1A1MB 3ZDXB 1JV5A 5A2CA 1NFAA 4JRYE 2UZYB 2Q8BL 5IVNA 4OGXL 1B6UA 2Z1PA 2QMJA 3PPSA 2BIMA 4I0PC 1FGVL 4QHMB 5BV7B 2KK7A 5CSZA 1PPIA 3JVGC 2OL3A 2PPAA 4L4VD 3WHE0 5IMMA 1WC7A 5I0VA 1QKZL 2VDNB 5C2BL 3MNWA 3L35A 2BHYA 5MP6H 3JV4A 5AVZB 4G9FA 3HRPA 4GRWF 4WFGD 2NY5H 1WF5A 2WXQA 1BOYA 5KWYC 2EEAA 4NENA 3S37X 2DOCA 3RWHA 3WO4C 3PV6A 3FTYA 5LBSA 2O93L 3KHQA 1JZFA 4F1ZA 1UWGH 5KAIE 3F7YB 4AM0A 1MELA 4M1DL 4E36A 5HGBA 4N0YH 1QFWM 2FJFB 2CO6A 2DN7A 3B9KB 1NCAH 4MA8L 2UZIL 4W9ZA 2KS0A 4XPBL 4YGVA 5CR1A 3OKOB 3LW5H 4HCRL 1LEGA 2Q2EB 3APCA 4NQSA 4P46B 3U0TB 2XWJA 3CFDB 4IMKC 1F13A 4N2MA 5F1NB 4JO2H 4AKQA 4Y16C 4OCYH 2EH8L 2Z65C 2ED9A 5IK3B 4W80A 1HJBA 1QSFE 2CJUH 2BNRA 5HHOB 2IWFA 4HH9A 2VZTA 5TE4H 2E9IA 5LGHL 4JHAH 3BAXA 1L0LD 2EDNA 1HAUA 1JXGA 2WTYA 1S7SB 3FSWA 2X4NB 3TX4A 1G1OA 4MNGA 2VWEC 1T4WA 3BH8B 3VB8A 3VJ6B 3GBEA 4M61A 3CDZA 3DIDA 3GBNH 3SE3C 5H37H 5KSBF 1S9KC 2H3NB 2I25N 1U6AH 2KLSA 2OMVB 1NBVH 4XMPH 4EDWH 1H5BB 3UAJC 5D1QA 4ZAKA 3FFCA 4WY7H 4GBXD 1GW6A 3QFJB 3ARDA 5FX3A 4L9LC 1JNHB 3HG1A 3EJYC 4W4OA 2HAZA 2X3BA 5D7IB 3QJSB 4HIJA 1UJ3A 5LG6A 3GKWH 1A4AA 2G2RB 4S1SH 1CFQB 3QP3A 1FC2C 2IWKA 1TU2A 3TVMA 3L9EA 5IHUH 3JWNE 1NCBH 1E79H 1RIVL 2JVUA 5SWSD 1CICB 3QO0A 4JMXA 4QKTA 1UCBH 4YXLH 1QMUA 3S98A 4OKVA 2YD6A 5DEFB 4LKXB 3IRZA 4KZEH 1FV1B 4WI5A 3BIAX 2YN3A 4NM4L 1M7DA 4GLRI 4CJ1A 2E76C 4R84A 3MI6A 3NP4A 3MRGB 5GGVL 1KTLB 4PRNA 2IZ1A 1FZMA 4FFYH 1DEEG 1DN0A 1MCPL 1Z7JA 3LIZH 4LSTH 4WKZB 4B9CA 3UTSA 4Y7MA 3ILQD 2NY3D 2YMOA 1YNLH 2AK1H 4CKQA 1BWMA 2JWDA 2DQHL 1IGTB 4FJYA 3C5ZD 1PY9A 2ZP8A 5I1EL 4O02L 3FSAA 3GS7A 1UH3A 3UMTA 4PV1C 3WO4B 3B9EA 4ONOA 4O5LH 3G4SP 3LMJH 3GMNB 4MXWH 1PBYA 7CGTA 2Y7OA 5HHQB 1BZ7B 3QFGA 1IK9A 3O8ZA 4A2HA 1FZOA 3VOPA 2JTDA 2VDRL 2ZCHH 1F3RB 1KQGB 2B0SL 2BCMA 1EGJL 2ZCKH 3TCLB 1X5GA 1T5KA 4WUUA 1HKFA 4IBVA 1MCOL 2CMRH 5DCCA 3PHQB 2HMIC 3QDMD 1SJVA 1HN1A 4YXDC 2AQSA 3PIQB 4POZD 1IBBA 4DJGA 2EYTB 4HPOH 4Z76A 3U59A 4JGNA 4JM2C 3OKDA 5T3ZH 2DQUL 4JFYA 4LL9A 1AGCB 1PY0A 1USQA 5D1ZI 1N6VA 5SX4H 4Y16B 4RIRA 2XG4A 2MKVA 1DBKL 2B1HH 2KXPB 1PZBA 4NNYA 3N7NA 2DW5A 5MEQB 1VADB 4NHUA 1PGOA 2JWAA 2XV5A 4MQTB 4NWTH 5GS3A 1T3JA 5KJRL 5IJVB 1O7DE 5F1IA 4A38A 4AV4A 4DPBX 1BQKA 1IZJA 2EE9A 4J1UB 4PVBA 1YTZT 4PW4A 1I7RA 1PNDA 5DK2A 5IFJB 4DN4H 4X5WB 1WT6A 4LPYA 4Z3FA 3PAYA 1T04A 5DS8A 1YEFL 1OB0A 2XZCL 4DZ8A 5DO8A 2D2CC 5AKRA 5GS1C 1Q1PA 2GIXA 2QFPA 5E9DA 4KDWA 2Y22A 2I5YH 4U6XA 4PTTB 1JM0A 1LE9B 4L9LB 2PO6C 4KMTL 2FNBA 2YXVA 4QAMB 5J13C 1RJYA 4GW5A 1EHXA 3R4DA 1HZHH 3S4SA 3ZUNC 3BUTA 3PG2A 3BSGA 3GF7A 5F9WB 3HE7A 3RWFA 1ACYL 1B0IA 4LCIL 3VTTA 2AXCA 1VQNP 4UNTA 3WUUA 2K1MA 5HDLA 2D03L 4U6HB 3KMDA 1GYUA 2I07A 3D71A 1JPGB 4Y4KB 1WISA 3CHPA 3H32B 4UWQB 4N2AA 5AAWA 4ACTA 5CJ5A 3T4AB 1NBCA 2Q6WA 3OPUA 1JZ6A 2W27A 3MJ7A 1HKLH 2JKXA 4GFXA 4JFDD 5DUMH 3VYNA 3ZL4L 3GT6A 5JOPD 2E76B 4A2EA 4UBDD 5I73B 2V2TB 3OF6D 3C6EA 3FSOA 5E56A 4QT5A 2Y2WA 1FFPB 4I3GA 4XC1H 2A6JA 1U95B 4HF5H 1A6UL 3O9WC 5F7DA 3MNZA 5H37A 2E7HA 4GAJH 1BVLA 1EERB 1OHQA 4YXWH 3NEXA 4H88L 4P2AA 4AX3A 3L6FA 4PJ7F 5I82A 2N56A 1ET5A 4MB3A 2GHZA 4GRWH 4PV1B 4L3CB 3WEXA 3QEGL 1YYLH 3TOPA 2J44A 3CZNA 4OV6F 4WI0A 4C4KT 2M3BA 5GSRB 3TNNB 2K9JB 3OZLA 4BUHA 4NCDA 4NZRH 5AW7B 2LLGA 2XU9A 5AUMB 1MJJA 1MPAH 1PX4A 3R0MA 3IN6A 5CU5A 5IKCB 2RQ8A 2PRRA 2DLTA 1QI5A 2DH2A 3QJRB 2F2HA 3SEPA 3ZDXE 1S7UA 2V4HA 4Z7WF 2H2PD 4BSWA 5FO7B 43CAA 4UT9H 5FYJD 4HDIA 3OG6B 4LEXH 1NVOA 4PJBF 3TEUA 3GZQA 1FE8L 4FMKA 3JWOC 1WEJH 1DD4A 2EO9A 3WKYA 1M1KQ 2XIDA 2BNRD 2MHAA 3LIZA 1Q9OA 2KUTA 2DI9A 2N0MA 5T8IA 3ZPDA 4HLZH 4YDJA 3MRIA 2EINB 2D2CB 5D8JH 2F19L 2O4EA 4KHTH 5HTSA 3L9YA 1GGYA 1UYWL 2R0KL 4IBYA 1UA6H 1GW4A 3HNTL 4D0BA 5K9KB 5LDSA 3QORA 1KMGA 4OFQA 4KDVA 2ED8A 1T5XA 4NO0D 4KX9A 3D87B 1FZEA 1CLCA 2HT2C 1E4JA 3RKDC 3KVQA 2PO6B 3UL4A 1YLBB 5J13B 1DQJB 1ROCA 4OD1H 1KB9H 3HAEA 4K7FA 5H2BB 3RUGB 5C86A 5EORL 3EWKA 3GMQA 2YSTA 3FONB 3BWAA 2HLFC 3U82B 3HNSL 2W9DL 4FFWD 3D25A 1QYGL 5B38G 3VCLA 4HPYH 4XVSL 3CSPA 3X17A 1LEIA 1I3GL 2PWEA 4PGDA 4JO3H 2XSKA 5ESVB 5BUGA 2V5RA 5JA8B 4I77H 1K2DA 5HHOE 4N0CC 2F7IA 4PEEA 2IDUA 3H1JE 1UG9A 3IR9A 4WUKH 3G5YA 1J5OH 2X9XA 3GNMH 4BFBD 1XIWD 1AGBB 3RWEB 4EOWH 3RNQB 3DUSA 5E4EC 1OCOB 4WTXA 3FQWB 1LO0H 3O9WB 2G5BA 1U30A 3LKPA 2X1QA 2M8XA 3STBA 3PJSB 3QNFA 3Q48A 2VDKL 4NP9A 2Y5TA 1H6FA 3QFJE 2ODHA 5G4NA 1RP8A 5JZ7D 5DJ0B 5E5MA 1J0KA 4RETB 1BJ8A 4FTVD 5D7IE 1SUHA 1A14H 5ABAA 4HXAH 4EXPX 1TUPA 3TFKC 4ANXA 5GTHE 3K4AA 4C7NA 4EF3A 1QRKA 3GSUB 3MLPA 2D2OA 1FNGA 5DQJB 1P7KB 4AJ0A 5IY5B 3OKMB 4OLYL 1QI4A 3DJTA 2ARJQ 3L7FB 5FYLE 2LKMA 2ZXQA 1FDLH 2KNCA 1NDMB 2J5LC 5D1XC 3TH4T 5EEXA 2WB1A 2E9WA 3S35L 1N5AA 3EDDA 2HYMA 1EVUA 2C7FA 4I5BA 4BK5A 1ZPLA 2GITB 1P4BH 5J6HB 1EV2E 2JKRM 5IQ9A 3H1HJ 5BZDA 2P52A 1OW6A 4OVUA 1LT1A 4E9WA 1L0NJ 5GISH 4TSAH 4IKNA 4L8SA 2KHAA 2OJEA 5EPMA 4I13B 1AGEB 1JFQH 1MCHA 2VIRA 3QUYB 3WTUA 2AXJA 4A2MA 5J3HC 1LHZA 2KI7B 3AWEA 2W38A 3QJHA 1JMMA 1XGUA 1RZGB 3BEVB 4TS6A 3UC0H 1E67A 1TQUA 2NUTB 4K8RL 3SPJA 4EYYQ 3R8BB 5B5EE 3SDYH 4Q2ZA 1GU4A 1ESOA 1P84K 4NKQB 3GB7B 5EOCL 2NPSD 1VFUA 3GRWL 4P23B 3TN0D 1CL7I 1YUKB 1URZA 5CD5D 1E2VA 2BIPA 4BE6A 4FD0A 4UOW0 1MAJA 1XD1A 5FM5M 4HUUB 4JHWL 5B1KA 1N0LA 4LKCA 1I8MB 4QXTB 4ZW3A 1ML0A 3MLTA 2X41A 3TWYA 1T2QL 1SQXG 2YUVA 2VWEE 2HLEB 1D5BB 3KPSD 5E4EB 4EUPH 1J0HA 2BS71 3WIFA 4AYCA 2XDJA 1S9KE 3CCJP 2WQWA 3NFQA 3UBHA 3QC6X 4AVJA 4P2QA 1QFWL 3M06A 3CX5E 1Z32X 3EJQA 3HG4A 4B3EA 3A4DA 3C9NB 3FULA 1HZKA 2YAMA 5CSGA 4XHJC 3NFNB 4FXLA 4UQ3B 2OTKE 3LDBC 1HXYB 3B9DA 3PWPD 1RJZA 4LGRB 2YKOA 4JZNB 1MNUL 1XMEB 3NCWA 2Z4EA 4X5LA 3IVKA 4NX0A 3B6SA 2BP0B 4IRZH 3N91A 4F9PC 3UP6A 4Z78B 1AGDB 5D1XB 2DWDA 2J5LB 2BM3A 1XB8A 2YGOA 5E7FA 3LXAA 1NSNH 4KQ4L 1YJDL 3MYJB 2ZWSA 3QEQA 3FT3A 5GQBA 5KSAA 3C6LB 4HXBH 4RGOH 3VXOA 1VZHA 2ORBL 3ARBD 3MV9A 4Y2OA 3S2AA 3CI9A 1UM5L 5E8PA 3QUMB 2FH6A 4X6EB 3A47A 1TVBA 1FZKA 1ZIBA 2G9HA 2IDCA 3GXNA 2B5IB 2DTML 5F7HA 4IFDK 2GSMB 3AXHA 1Z5YD 2I26N 5JUEL 4UIMA 1KN4L 4S1RL 3LXBA 3S0PA 1HBWA 2OSLB 4IOSD 1SJHA 4FERA 3CZKA 2RB8A 1XEUA 4X2UA 4RX4A 1NFIB 5CCJA 1YSOA 5I8KL 5AB1A 2DWYA 4EQ3A 1AHWB 5I74C 4DUWA 5MHSE 3ZDZF 5FUCC 1ZVYA 4QRUA 3RVVC 3EYSL 3SKJL 4G1MB 1ZXKA 3PDOA 3TT1L 2OMTA 3FCBA 3BUPA 3N55A 4ZTOL 4PD4K 4A63A 2VN7A 1E8XA 1HXMA 5I19H 4R90L 3H3KA 2ZG3A 1ZE3C 2VH5H 3CNKA 2JJVA 4JFQA 1MLBB 1FOSF 5E8DL 2D31A 1BBDH 2HRHA 2M5AA 1C08A 4AYGA 3L54A 1LEKA 1EDQA 3K5RA 3GMMA 3O6FA 4G6MH 3DX4A 4DAGL 1YEDB 3ZIMA 2WXNA 3UMNA 2IDFA 1L0XA 2W65B 2LABA 2XQYG 3K6FA 2WXHA 1SQPJ 3Q2YA 3OB8A 4O2EB 5I8EB 3I02B 2VDNL 2PR4L 3L5IA 4QRSB 2FX9H 3MYZA 3W0WB 1FZBA 1EHAA 1T03L 1BPLB 3FT2A 4ZG1A 5HDQL 2CBMA 2FYUG 3K6OA 5D70L 2OK0H 2C9VA 4KK5D 3RUGE 1ZHNA 2DH3A 3QEHA 2IANA 2CPBA 1KCVL 4YXKL 4PJ5B 1FPTH 1LO3L 3LDBB 4AE1A 5LXVA 2RJMA 2XXGA 2YSSA 3C6SA 2EDXA 3STZB 4E0RB 4M6OL 3BKCL 1P5VA 4I6MC 5I18L 2W94A 3N1FC 3KXFB 2VL5A 3RB7A 3A4AA 4G7YH 3FQUA 4JANA 4M56A 3N43F 2F8VA 3D05A 3FB6A 4H26B 5ANHA 2CHXA 1ADQH 4XX1E 1GZLA 1DDTA 4PY7A 4BRYA 4RISL 5A1AA 3VE0B 5T1DH 4Y2DB 2BC4B 2PYEA 1CUOA 4A7GA 1MRFH 2KPNA 2I9LB 4JDZA 3SKOA 4CUCA 1C9SA 4GLRH 1KN2L 1KPUB 3MGTB 2HLOA 2XYBA 3QEUB 1VFMA 3GZPA 2GPZA 2ITAA 1IFGA 1FNAA 1NTKG 4L37B 4UB0H 4Z7OF 3OJ2C 5D7LB 4DVBB 2OZ4L 4CGUB 2XQ0A 1TZIB 3BZFB 1J0YA 4PWEA 1OFCX 1DLHB 2XBZA 3VD1A 1CK0H 4JE4B 3OA7A 1KTDB 5B39A 3IJHB 4BQ9A 1TMCB 1QR1A 2RBLA 3LKOA 1L5GB 1JNLL 1ID5I 2N1TA 4L1SA 1MI5B 3EGSB 1R3KA 3T0BA 2OMWB 2UXFA 3PHOA 4JFOB 2RHEA 3MLYL 1I9RL 4HOXA 1N7SC 1MCFA 1MDTA 2BSCA 3HI5L 1FF5A 2WXJA 4L18A 1K8DB 1S8DB 1BGYG 2D7NA 2DQEH 2WXIA 3F84A 4NJ9H 4NKDA 3I75A 4RBPK 2APXA 2KLTA 1RK0B 1KV4A 3L17A 4U3CA 4V1DD 3UZEA 3QI9A 5FYLL 3P4MB 3WJLA 3HCVA 5JHBA 4WO4D 4J4PD 3HW7A 3TV3L 4WHCA 1T22A 2Z4QB 4PJAB 5CWSB 4F8NA 2XRAL 2OMXA 1G7PA 1RUKL 2ZUUA 3X2QB 4XNBA 4XWOC 3FH7A 5F89B 2H32H 4A39A 2XIBA 3FW6A 1BQ5A 1UWEL 4M7KL 3HS8A 2DM3A 3MRPA 4GKOA 4ODSL 3OXRB 3KPMA 1E2WA 2TRHA 5ECGA 3T6ZA 3BE1L 4JKLA 1BVKB 3BZ4A 3L4YA 2ZWKA 2FSEA 3MCYA 3W11D 1G7JA 1KLGB 4ZXBD 3TT3L 3D4CA 3U1SH 4KKBC 4WHYH 1SDDB 5T3XD 5C0BA 4MA7L 4NQUA 1G9NL 3MRMB 4HUXA 1HS6A 3DHUA 4J3WA 5D7SL 2CNYA 2AJUH 5EG6C 4XA4A 1CN4A 1L7IL 2G3ZA 2Q3EA 3QHFH 1HOEA 3NPSB 4XAKD 3ZKQD 1IFPA 2YFNA 3CDFA 4HWBL 4OQTH 4BFJA 2AXHA 1IFJA 1VPOL 3FU0A 4WHDA 3TJHD 2C9SA 2YEVB 1NLBL 3VFUB 4NAQA 2Q87A 5I1LA 3DDGA 1SLVA 4FF9A 2R15A 2K6YA 3EBIA 3DTXB 4N26A 1VQLP 4UMSA 3BD4A 3L72G 5H94B 2BLFA 4HIEA 3VFGH 5DUPH 3WNMA 1SS1A 5JO5A 1GGIL 3REVA 3ZTNL 1R3JB 3VRJA 4AH2A 1HSAA 2BFVL 4NZJA 1YNTF 2H5UA 3M86A 3RBXA 3RWCB 4BZ2L 1OGAD 4XN2A 3H1IG 2PXYA 1RUQH 2YK1H 2F5BL 5CCGE 4XNZB 4MDJA 4MZ3A 4R26L 2OYOA 1MHEB 1MJ7L 1WT5C 3NCFB 3L45A 4M02A 4HUCA 4JVUA 3L3IB 2O5XH 1DBAH 1N7SB 4IRSC 2DYPA 4GSDL 1SN5A 4BWNA 1Z3GL 4U3FJ 4WI2A 3L73D 5DRNA 5C0AE 5K9OB 1I9JH 1YYML 3G08B 4Z1MH 4ANWA 4D6TD 4PJFB 3LQZA 1BZEA 5CN2A 2QJKC 5D1XE 4EKJA 1PMYA 1R19A 3IFOB 5D72L 5DD3H 3FQRA 3UBFA 4JFED 5KYYB 1GZHC 3P0VH 1ADQA 8PAZA 3Q2VA 4AOFA 1TYRA 1KIUB 2WIIA 5DURD 4LHQB 1ZGLB 5DHVB 1SFDA 1EHKB 1GZPA 4HWZB 2BOBA 2CCLA 4G1EB 3TWCL 2ZT9D 1U8PA 1QRND 1S7QB 3OKYA 4PN6A 3UGEA 4ZPTB 1WAEA 1WBZA 2DJMA 4AV5A 3DRQB 1CYGA 1MJ8L 3DYMA 1ZLSH 2BVEA 4LIQL 2HYNA 2B2XL 3BDBA 4DJMA 2YS4A 3PGDB 2C3HA 3ARTA 3A4FA 4XOCA 5C7XL 2FTAA 2X53A 4WGKA 4TF4A 2HFTA 4N68A 4NN6C 4ZUWB 3R0NA 3D39A 2RGSA 3ABGA 3K71A 5AB9A 3H2QA 4H8WC 3T6XA 1BQRA 3V2NA 4W6XB 4NP4L 1A22B 4DFHA 1P1ZA 4L2LA 1J05A 1MOEA 1HTLC 2J25A 2GJ6B 3SBRA 3MP7B 2FT6A 3APDA 3D85A 1GJUA 3V4PB 4NRYA 4ZTPH 4F15C 4AIEA 1PV3A 3HE6B 4JZOB 3TJPA 5D1ZA 3FN9A 4P4RA 1MFAL 4QWWC 1B0RB 5FV2A 1G7QB 1T6AA 1M56B 4JHZA 1T20A 5I6XC 5ICYB 3KNBA 2XICA 2WTPA 4BSJA 3QPKA 2HRGA 3EOTH 2WSKA 3W0WE 3L71J 5DHYA 4CSTA 1BDYA 4JKWA 2NXYD 3MU3A 3QHTC 4NQCD 1BECA 1XGPB 1ACZA 1A0QH 1L3WA 1CXLA 4YHOL 1FLRH 1JPFB 3BRDA 3PL6D 3VWJD 2AXFA 3NGBB 1H88A 1GKEA 2NR6C 2N7SA 2PABA 4ATTA 1XSJA 2CO7B 4DZBB 5C6TL 5BVPH 5A7BA 1YN6B 5IB1B 1R5SA 1Q9WB 2V8MA 1HQ4B 2FVNA 4RFOL 1DSYA 3VH8G 3H56A 3X3GL 4ONFH 3BDYL 1RPKA 3MRJA 4XPAL 2P8MB 2H47C 3FQTB 3CXHJ 1JHLL 5HYQB 4JFZL 3C2SA 3O4OC 5IBLD 3QXTA 2JQMA 4A6YL 3SDDD 3T4YB 1OM3L 4D9LH 5IMOA 3FQXA 4RAUA 3ESVF 4U4IA 5T1LA 3OKKB 1AGFA 4H8QA 2EO7A 4AITA 1G7IA 1WAPA 4KVNL 4W93A 4LOEA 5T5FA 2MQ3A 2WKLA 1IFDA 2O5ZH 3MHVA 3UXFA 1MEXH 1F2QA 3VXUD 5D7LE 3GSVA 3O6KH 1OSZB 3L5WA 3QJFA 4WTWA 2P5WA 1Q38A 2PWGA 2W60A 4Y5VA 4BKLA 5E2UH 5FUCE 4ETQA 1DLFL 2EDMA 1OF0A 1D5MB 4F92B 5K9JH 3MA9L 2DWEA 4HJ0D 4QHLB 1DE4A 1MI5E 4UM9D 3H1LE 4JRXA 1GL4B 4I1RA 2KZJA 3SZ6A 4IU3B 3DV4B 4WCYH 5EMYA 3I5CA 2B08A 1TSHA 5E1AA 1HJBC 1HH0A 5HHPA 1NUFA 4HK0A 3IU4L 3KPNB 2C7UA 3KWXA 5CMAA 5A16A 2BSTA 4W6YB 4F37F 1MWAH 1PEWA 3EGXA 5JXAL 1CL7H 4PJAE 1F1AA 4X42A 2Z0BA 5KZCB 5IFHL 4JW3A 1SQVD 1RH5B 2L7JA 1CSBA 3KJ4C 1R5IA 2EEXA 3NN8A 4WI8A 1YMMB 5DRZA 3ZHLA 1E5WA 4NO2B 3PHLA 4DQOL 1RJLB 5I5RA 4YDIH 1OOAA 1PL3A 5D1QC 2WNGA 2XN0A 3QHZH 2AP2A 2WANA 5DD5H 5I8OH 3ARDC 1P7QB 6FABL 4YX2H 1AH1A 1A6AA 3KGUA 3H1ID 4HGWA 1E2ZA 1V10A 4W4OC 5SWZA 2EUZA 3COOA 3BSZL 4XVUD 5KVEH 3IEAA 1UJ3C 2IAMA 1ZLUK 3HKZA 1IRAY 3TM6A 1XH3B 5DHXB 3TVMC 3UBXB 4LAJH 1HCYA 4HQQH 1HQRB 2L8AA 4C56A 3JTSB 1OZTG 3QDJB 1XIWC 4OGYL 2CKBL 2XWCA 5CBEA 3CSYB 4YHKH 4W9GC 3W81A 4YJZL 1JV5B 1SJMA 3BP5A 4C4UA 3FO0L 6PAZA 5IT2H 2AV7A 1NTZD 2O5YH 2ATKA 4KK8D 1WUNT 4J3OD 3L75E 4HYTB 4Z3GA 2HODA 2JFCA 4JY5L 3AY2A 4P5TA 1IGIL 1SY6H 1H8OA 2R29L 3GSQA 5LAXA 5IMMB 2OL3B 1VQ6P 4L05A 2HPCA 3ZTCC 1KIQB 4X8JA 4N20A 1FNFA 1FRGL 2ZSVA 4WW1A 2ICWI 2BS8A 4A1RA 2I1KA 2XFGB 4K3HA 3P8MC 4G9FB 1FO0H 2DQGL 1T0NA 1KB9K 1NLDH 2MRYA 2P10A 5IESL 4IGBA 1N86A 1NMCB 4LSQL 4OB5L 3PV6B 3I6LE 5B4MD 3OX8A 2BDNL 5FLUA 3O81A 4AM0B 1QEWA 1TENA 1A7NH 5IVXB 5HGBB 4TXVB 3VMYA 5JIPA 3BMWA 4K5OA 2CO6B 1BJMA 3HMXA 2ZVOB 4LMQE 4YGVB 3IE4A 3MXVH 7FABH 1LEGB 1W2BO 4K3EH 2COQA 4NQSB 4BZ1H 2EIZA 2XWJB 3AEAC 1Z1WA 4OFVA 5DVKA 5T5NG 3B5ND 3RVWD 4PJFE 2QM7A 4HH9B 3WI9A 5I15L 3QWOA 4ES9A 3OAYH 5KZCD 4WK2B 5LWYL 5CMZA 4GSUA 3AAZA 4UDTB 1TZGH 2HT3D 1X0TA 4XMLL 1GGCH 3E1F1 2WPSA 3MODH 2IC2A 3KJ4B 1NFDF 2B15A 3PF2A 3T3MB 1CI3M 5DR5L 4PREA 3QZPA 3BPLC 2PPFA 1F90H 1VESA 3M8OL 2YQ3A 5D1QB 2NZ1A 4ZAKB 3FFCB 2J8OA 2HJLA 5DFVC 3WUWA 2NY5C 2CSPA 1KGJA 4EIZC 4HETA 3OZ9H 3ARDB 2JIXD 5EUKA 2DM4A 3HG1B 4WU5A 3WD5L 1H8SA 3T0AA 3S88L 1UD2A 2R4RL 4P2RD 4HIJB 3HE7C 2C3VA 1UJ3B 3US1A 4KHXH 1URQD 4WJ5A 1GTFA 1TU2B 3TVMB 2QSCH 1IC1A 1AO7D 4AQ1B 3M91A 1TEYA 2FCBA 2MH4A 3QO0B 4CW1A 1W8OA 4OKVB 1DP0A 1LTXA 1RUAH 3PGCA 4OY9A 4PBWD 4S1QL 1KC8Q 5AAWC 4WI7A 4MJJA 2VITA 1CXIA 1LWJA 2GJ6E 3B3IA 4OLWH 1E5UI 3L71E 1M7DB 2EXWC 4L73A 1KGXA 4I1LA 3HZ3A 4IKLA 1AHMA 4L75A 1MWAA 1KQLA 1E65A 2YXWA 2KLRA 4PVNA 2BIHA 1UH2A 3UTSB 5LN8A 1T1XA 2A4EA 2X28A 5E0QA 2EIBA 2VO5A 1WCBA 5ILTH 2YKLH 4XB7A 4A66A 3N04A 3PNWB 4KJQD 4L4TA 2Z7WA 4FLQA 2PTTB 1WZMA 4KY1H 5SWQA 3ZQ9A 4R3SA 4I87A 1XAKA 4HBCL 1MWOA 1AXTL 1FZOB 4N2FA 1MRCL 1E27B 2I1JA 1A9BA 3WDJA 3QIUA 3LH2L 4LSSL 4UTAA 4WUUB 4XPGH 1JRHH 1O5DT 3QQDA 4MJIA 4P3WA 4JFFA 4LDEB 1INDH 2BCCE 2O01H 2VXSH 3B2UD 4HWUA 3CN4A 4JFYB 4PW3A 2IG2H 3P4OA 5FUZL 3W2DL 3HS0B 1CTOA 4RIRB 3SGKA 2ADYA 1AD0A 4JO4L 2H6PA 4XP5L 1P84E 2DEWX 4NHUB 3A0HE 3GIZL 4HWEL 4HUMB 2WWMD 4OGZA 4FHBD 5EBWA 5I66B 1GW0A 4H0GA 4TV3A 3Q05A 3GXPA 2HRPH 1A8ZA 4OZHE 1CGXA 4V33A 1JY2P 1MZYA 3WS3B 5DS8B 1T04B 1TJIL 1OKEA 3LEXA 5C8JA 3CSBA 2CO2A 1ZSHA 3B56A 2NCMA 2UYLB 3CVIL 4YSOA 3FBKA 4MZRA 1OPGH 3CCRP 3WFBL 1NU1D 2M83A 3D0LA 4M7LT 5E9DB 5LKNA 1Q0XL 1LILA 3QORC 4UT6L 3LS5L 4QRAA 2D4DA 3L13A 5KVFE 4U6XB 3D69B 4TLKA 1RF1A 3FAWA 2I60L 1JXDA 2A0LD 3WKMH 3MV8A 3CL3D 3ISYA 3GPSA 5I8CB 2AGJL 1RJYB 4GW5B 4RLDA 2R1YA 1QFUH 4FG4A 3OPZH 3HE7B 3RWFB 3LQMA 4G8GB 1EJ8A 4PB0H 1UENA 4LSRH 3S36L 1ZDQA 3GJEB 4RRPG 1OE2A 1DO6A 3BLBA 1J1DB 1NKOA 2I07B 1SXNA 2ZUQC 1INEL 3ECBA 5EOQL 5DMKB 5IV2A 3TIDA 4WWKD 2CRMA 3ROOB 5TDNA 2I32A 3CMGA 2YIUB 1DUYB 1WYJA 2CUAA 2GB2A 3B2VL 2WTRB 4M6ML 2Q6WB 4DGWC 1ZGLP 4NGHH 2VZOA 3SOTA 2GK0B 1U58A 1E0OB 5DC2A 4YSUA 5BJTA 3GSNH 1L0PA 2TSAA 4UZSA 2J12B 2A6JB 3ZDMA 3RGUA 4J6RH 3GUFA 5F7DB 1CDCA 3MNZB 5BMFL 1FAIL 1YMME 1BVLB 2ARJA 3T2NL 5A2KH 2CRZA 1PP9D 3DPBA 1JCKA 2XTJD 1K4DB 3WEXB 2X0WA 4H20H 1J88A 4NRXB 2WLMA 1E40A 2WHVA 3CH8A 3UAAA 4JE0A 1ILUA 1SF5A 4WI0B 3BVHA 1MUJA 5GGTH 3INOA 4XBGA 4K3AA 3KYNB 4L4JA 3MJWA 1SNRA 5DEGA 4PJCA 4MQ7B 4KHXA 1NEUA 2ITCA 1H6TA 1B0GA 3N40F 4M7LL 2AKRA 2BP8A 3JZYA 3OC5A 2LR2A 2WNWA 3NJKA 1P4IL 5FYJU 3QDJE 5CGTA 4N2EA 3GQFA 4B95C 4BSWB 1CU4L 5H35A 2RA1A 5IBTL 1YN7A 2CHDA 4WIQA 1OIPA 4APQD 3O4LA 4YL9A 4TULH 3T8MA 4HAKA 5E4IA 4BK5C 1F4HA 4PD4E 4KO5A 1TZ8A 1UC6A 3GM0A 1VF5C 1KYOD 1V7ML 1S72P 3AE3C 1Q9OB 3DMMB 5E6UB 1JZ5A 2ZSWA 3QYCA 4L8SC 1G0XA 3L5XH 4XP4L 4G9FE 1EHLH 1HE8A 1DBJL 2C5DC 5HVWA 2VLKD 4HB1A 2NUPA 4MJ2A 4R2GD 4HJGH 5HJDA 4N22A 3M0AA 1NGMB 2J88H 5IVXE 3VSQA 1XTMA 3GMQB 2D0HA 4ASWA 5K59E 2OYMA 5AQ0A 3BWAB 5GS2D 3GFUA 4Y4HD 1X9UA 1A47A 1CJYA 5DZVA 3D25B 2K9FB 3IMSA 1KPVA 2AAAA 3I50L 5FAAA 3VCLB 3QIBD 2E27L 1AMXA 1N4XL 1LEIB 1ZS8A 2ZUQB 3EFDH 4NQDD 4PGDB 3SCMA 4HC1H 3TTYA 3DGCR 5T1MB 4P59H 4EDXA 2FSDA 1UOVA 2Y5QA 3L3OA 1K2DB 4FXGA 3MUZ1 1S3KH 3VI3F 3ARED 2FX8H 1DANT 5T1KD 5I30L 3VWKA 5E24E 3MGOA 5AVWB 5KTBA 1K73Q 4OBSA 3VU2A 2Z7YA 2HKFL 3QUZA 2HWZL 3DUSB 4LP5A 3GO1H 4YSSA 3WY1A 3Q01A 4AJYV 3ZZLA 5F7KC 3GXFA 3T3ME 2OYHA 1YY8A 3GI9H 2YMYA 2G5BB 2JKWA 4PJDF 1NCWL 1H3WM 2HRLA 3NEOA 3WENA 5D1QE 2OBGA 3FFCE 5DGQA 4Y5YB 3SWKA 2Y5TB 4PVLA 4ATWA 1S5IL 1XF5A 3O3EA 5DZLA 4PRPD 2XFXA 2ATPA 3HG1E 2ESVD 5E5MB 4LSPH 4JFHD 3B8YA 2XY1A 1OW8A 2N59A 1JUFB 1OD9A 2LHAA 3FH8A 1PIFA 4C7NB 1AAJA 5FWQA 1FNGB 5F97E 1ZOXA 2W91A 5IZ7A 4PJHB 3HHRB 2P7JA 2FBJH 1G4RA 3AUVA 2GTZB 2KNCB 5E79H 1RZ7H 3TNUA 1RERA 5I1JL 5AW1B 2PP9A 1N5AB 4OFYD 1FVCB 3GC3A 4U1JA 5KSAC 4U7SA 5IHBA 5IQ9B 4CGTA 1VF5B 3NIDF 5DJ6A 2K9UA 4FKKA 1D9KB 2DLGA 4DK3A 1M2OA 1U91A 4JS7A 1OAYH 3CLQA 2A74A 3FTGA 1J1PL 2OJEB 4L8SB 5EPMB 5KS9A 2GA1A 4YPGA 5JW4R 2YXRB 2VIRB 4PG9B 3S3BB 4ZS6C 2WYIA 1F4XH 3EBHA 4HT1L 3FCUB 4YDKH 2MMXA 3DHJA 2QPFA 2KS1A 2YD0A 3QDAA 3QJHB 3CLEL 1XGUB 1HGZA 4XC3H 2WVUA 2X70A 3BKJL 2VM3A 4XB8A 3FRUA 5DA0B 4WUUE 1K5WA 4FNRA 4Q2ZB 1NAYA 2HFGH 4P8QA 5C08B 4YH6A 4KGJA 1BCCD 5DXWA 3QDGA 3WNLA 1PSKH 1I85A 1Y0LA 4GEJA 5L7XL 2XXCB 3RVUC 1I1AD 1O5PA 3C60D 1DD3A 1E8WA 4FQCH 3HUJA 5LCVH 4APXA 4DWHA 4TTDC 1F97A 1N0LB 4LKCB 4EPSA 3O2DL 4E9RA 3F64A 1YMHA 1FJ1A 2YD8A 5KBLA 3MLTB 4G8IA 3VXSA 3D0VA 3P8CE 3O6FC 5HHNA 5IR1B 1BXUA 3A67L 4KT0J 4FX5A 2NMSA 4ALAL 4QHUB 3SPVA 3MJ8A 1Q90D 1HILB 2HKHL 5E9DE 1KTCA 1DJHA 1JY2O 2R56H 1X5ZA 4WI6A 1PQZB 4DN3H 3N44F 2WVSA 2IV8A 3TBYA 3QYNA 1FNSH 5HGGS 4F3FA 3S3JA 5E2JA 2ICES 3BQUA 1ZWIA 1MFEL 2PW2A 2C0XA 2JQAA 3QUKB 2XWXA 2E7LA 2XJKA 4G8GE 1BA9A 2D7TL 1X22A 1PGRB 3DUUA 3RA7H 1WIUA 1U93B 3IVKB 3MBWA 2DMBA 3UJTH 1TVDA 3NCMA 4PRHA 3GI8L 3OAUL 1BQHG 3Q8CA 1RULH 4B3VA 1JNNL 2YOAA 1XGQB 1BVNT 3F6LA 2R9HD 4HC1A 2DWDB 5E08H 5EA0L 4PUBH 1GYVA 3MKKA 4B9KC 1KBGH 4MJ5A 4NZDA 1KB9J 4LT7A 1OD7A 5F7AA 3P3YA 5BVJB 3FT3B 2LFEA 5CKAA 1H6UA 1RQVA 3HBPA 5KSAB 4DCQA 1IQWL 1QP1A 3MV9B 4Y2OB 3VXOB 2VSMB 1DEEA 5E8PB 4Q8BA 2IDBA 1H3VA 1TVBB 1KB5H 2G9HB 3R7QA 1NGZA 1JAEA 5C0CB 1FBIL 4UIMB 2Z31A 2AERT 3BYTA 4JFPA 3LRGA 4R4MA 1YJ9P 2W59A 1EEZB 4ODTL 3EBAA 43C9B 5IQLA 3K8KA 1JY3P 4P57A 2ALWA 1KOAA 4NWUH 4QRUB 1G9ML 4JJHA 1BDDA 4YDNA 5HI5C 2Y7LA 1DTUA 3MLVL 2N1TC 1LP9F 4WW2C 5TF0A 3UTTA 3C75A 4L0YA 2NY0D 1IAIM 3PDOB 4U6TA 1RE4A 1WS7A 2OMTB 4H1LG 4AEFA 5DJ2A 1T2JA 3NH7H 4U6VL 1V27A 1PDKA 2AEJA 1R4XA 2B1AL 1V8HA 4MCNA 1KCBA 4MRBA 1HXMB 2QR0A 4DF9A 3O2VH 4JJOA 2N3JA 3UZEC 3QI9C 3WJLC 4JFQB 3H1HG 1XCTB 2M5AB 1C08B 3NG5A 3EYOA 2JR8A 1R6VA 4GG8A 1LEKB 3ULVD 1L0NG 3TC9A 3GMMB 3O6FB 4PMEA 4LLMA 4OIFA 5J9PA 5D5MF 3EGDA 2VUKA 4GKSA 2F53A 3SYOA 3NP3A 3SY6A 4UILL 4HVBA 4GUPA 1YTZI 1SUJA 1A02N 3FT2B 1C1EL 2AZUA 3KCWA 3KPOA 2BNUB 5JW4N 3LNEA 2DQFA 1A4JA 1OZUA 1N6UA 3F5HA 1T6WA 1ZHNB 2XVKA 3KM1A 5BZZA 2H9GA 5JPNA 1CMOA 3IDGA 3MROA 1MFBL 2YRBA 3BEWA 5EBMB 2YSSB 3C6SB 2X12A 1QQDA 2OMUA 3ZE0F 3WEOA 1RCYA 1IJDB 3SPIA 1G7HA 1TDQA 1GC1H 1UA3A 1TO5A 3GSWB 5DQDH 1C5DA 2VL5B 4ODUB 1KWKA 3FQUB 5HGAA 1DDHA 1AKJA 4OJYA 4JANB 1JF1A 2MQ0A 5CD3A 2A9BA 2HVBA 2QZQA 3CCUP 2ZZUT 4R4FH 1EEYA 2OS7A 3FB6B 3HG2A 3IFLL 4C4BA 1XTGB 1A5FL 4BRYB 3IS0X 4LVOC 1SQQK 3HC4L 4B41A 2PYEB 1NCDL 3SKOB 3VXTA 3DX6A 4EUPB 2NY4D 3IS1X 2LAGB 4P9MH 1AANA 2QM8A 2JJSA 1DQIA 4BEIA 4X7TA 4PJ7B 1WPCA 1NTMK 4AL8H 4A68A 1JZGA 1GS6X 2PXYC 4XMKH 1NBZA 5CEZL 3CIAA 4ZX3A 1JHKH 3NUKA 4XCFH 1KCUL 1QSEA 1QR1B 3LKOB 1RHHA 4FQ1H 2N1TB 1EFXA 1R3KB 1NOHA 2OX5A 4XVTL 4B5EA 1ORSB 5E1QA 3V6BR 1TZOA 4QD2E 4PJHE 1R17A 1UVQA 3UCQA 3WSQL 4NKDB 3I75B 4CSSA 4LLUA 1U8HA 3AE6C 4S0SD 5I1CL 4M48L 3QI9B 4AZ8A 3CXDH 4P05A 3HCVB 1J5DA 4Z7WB 4XP9H 5CSBA 2Z93A 5BVZA 1RZJH 4N78E 2I9TA 2OMXB 4NUMA 5JDJA 3W57A 1N8ZA 1G7PB 4PJBB 4YZFF 1W2KT 4I3RH 4U7MA 4YFEA 1Q0YL 4JFXA 3IF1A 1SOSA 3GYRA 4YFDB 1KB5A 4P07A 1YVLA 2V4LA 5FGCB 3KM2A 1N0XL 5E6IA 5JXED 3OLGA 3MRPB 3OR7A 4KY2A 1ODAA 3FB8A 1ILSA 3MMEB 3VRLF 4K23H 1LL1A 1KCSH 4GRWE 4P5RA 3KPMB 4X80H 4AQRD 4AGLA 2P3YA 4JKPH 3DSFL 3UTPD 3KYOB 1N10A 1A3LL 2E47A 3BZ4B 4LHUD 4WWOA 3OAKA 4YVNA 2FSEB 4PSRA 4URTB 4LL1A 2JSFA 1G7JB 1XGYL 1FZAA 3F7PC 5B38A 1HWWA 3VFOA 5C08E 4LP8A 5C0BB 3KYKH 5T3XH 1G5GA 1JN6A 1XB3A 2ICCA 4HUXB 2VLJA 1Q1JH 1ZW0A 4M62H 1LTBC 1IC5L 2X1PA 1RSFA 1KNOB 3RK3B 2X6AA 2VXQA 2E43A 2Q86B 3SZKC 3HUSA 1T1WB 3CC1A 4I89A 3RU8H 5IIEA 3GSRB 4LVOB 2CKNA 5D1ZC 4ZFFB 2IPKA 3BN9C 1SQPG 5I1LB 3VFTA 3TGUE 3VXRA 2P8PB 2XG5B 4W9CC 4YAQA 3HE4A 3N1QC 3VNZA 4BHUA 3LNDA 3UG3A 1XF4A 3B71A 3NZ8A 4AC2A 4HIEB 5GGRA 5HI4C 5JO5B 5KSBE 3WAJA 5LBVA 3ZDYF 4IMLA 3C1LA 3H0TB 5IROA 1HSAB 4G6FD 2WKGA 3LQAC 3QWRA 5DJYA 1VGKA 4M93C 4QYAA 1KB9E 4MDJB 3EZ8A 2A9NL 1CFVL 3A5VA 2WAHA 1WFMA 1QLEB 4FQPA 4J28A 2VDOL 3S5YA 2CJSA 4QY8A 3LIEA 1DVSA 5ALCL 3C9IA 2DYPB 5DRNB 1NCAL 3F7QA 5HYJD 4HMCA 3OAYK 4QI3A 3HRZB 3B37A 4GAYA 1L0LK 4J3OF 4AV0A 3LQZB 5FFLA 3AE8C 5L6YH 1L4AA 1KYOI 1EXIA 1NL0L 3NACL 4XNXH 4QXGL 1QOKA 3FQRB 1IKFH 3MLWH 4JO2L 2K3HA 5H8DA 2V2WA 4Q6YA 2F1BA 2R2HA 2OULB 5GRVK 3RL1A 3MV9E 1LTIC 1GMJA 2ZNXA 5CZRA 5DQ9B 2DDQH 4LO9A 1EO5A 2BOBB 3VFMA 3K81A 1LO4L 1U8PB 4MAYD 5JDSA 1WBZB 3UJIL 2WQ8A 5C0CE 1QFWI 1WBXA 1WWBX 4NC1C 1KENH 3GBNL 1SMAA 4X7FC 1U6AL 1VFBA 3SHSA 1QBBA 5BUPA 5M7QA 5DA4A 5C9JA 2Q8AL 2EDEA 4Y5VC 3EO9H 1AHKA 1IC0A 1NCCL 3MBXH 4H0LD 2YA0A 4BCZA 3JTTB 5FYKL 1BBJA 2V2XA 3D39B 1RP9A 1BGXL 3KPEA 1KSRA 1R3IL 3PP5A 1FBMA 4WWIA 1JY3O 2M8RA 2FEEL 1EJOH 1OXZA 2A06E 3NQIA 1YNKH 1J05B 1M57D 3DVGA 2LU3A 5ESAA 5IHUL 1OAZH 3GLDA 5KVMC 3VQ1C 4CVWA 3D85B 4X7SH 5JMRA 2AC0A 3KCPA 1ZA6A 4AXWA 1JWSA 2DKUA 2NQ3A 4Z1PA 5D1ZB 2Q8BH 4P4RB 4OGXH 3ROLA 1WFUA 1AP2A 2ZAEB 2KIKA 1LWHA 2AANA 2EDKA 2ENSA 5D4IA 5E8OA 2N9YB 1OSYA 2FWLB 2OMZA 2BP5M 1FGVH 3KNBB 3V0DA 4TM9A 5DJXA 5K39B 2E9GA 5ENWA 4ZNEE 3CTTA 1QKZH 5C2BH 2IH3A 5KJ7E 4Q0XL 4DTGL 4BSVA 2QG4A 1IE5A 4X9FA 4ZTEA 3V4QA 3WIHL 4EZMA 2ZXWB 3E1RA 5DHYB 3HD7B 3SE9L 2BY0A 1YJWP 1MH5A 2FUTA 4NQEA 5G55A 3G5XB 3RGVD 2IBGA 3K6NA 3L3GA 3P1VA 3DSNA 3KJ6L 1J8RA 2WOYA 3S37L 2UWEF 4CKVX 2AXFB 5K9QI 2IAMC 1NA8A 4M1DH 2FE0A 4DGUA 3ILPA 4Z7AA 5KTEL 2FECI 1M05B 2RR3A 2UZIH 3WL9A 1SMOA 3BAYA 4XPBH 3RPBA 4XO4A 1RIHL 5DRWA 1SVZA 3TO4D 2PETA 5L8RJ 3RWDB 3BHBA 2YXMA 3MRJB 4F37K 3BGMA 3V5KA 3VMNA 2OW6A 2YEZA 2PKDA 4P5TC 2V9UA 4U1HA 3NSDA 1S7XA 2B1HL 1PPJE 2XTJC 5IVZA 1JK9B 3KS0J 4U0RC 3EYQC 1RQ5A 2GM4A 3FQXB 4OSUH 4Y99B 4RAUB 1AG0A 4GG6F 2J4WL 5T1LB 1AGFB 2VM9A 4ES8A 1O6VA 1G7IB 5GPRA 2R1WA 1MAKA 2PCFA 1JMBA 1BV8A 4IGBC 4JZJA 3ATFA 1YQ2A 2UY6A 1KGCE 3GSVB 1LP1A 4PJ7E 3L5WB 2Z3FA 4ZUTA 3PAVA 1ZKAA 3QJFB 1F5WA 5AAMA 2W60B 4Y5VB 2I5YL 1QL1A 1CE1H 1I4FB 4U3FG 2DWEB 2YA2A 3IYLW 4FNPA 4OZIF 5TGBA 1AZBA 2ZYSA 3FUEA 1SQBJ 2BO0A 5A2JH 1LP9A 2WXLA 4K5MA 5A6MA 3LN4B 1HYSD 4OVVA 4HK0B 5CMAB 1OHZA 5A16B 3LY6A 2BSTB 5J8OA 3QWOC 2ZOKB 3JV6A 4KJWD 2YZ8A 1XR8A 3MUY1 3EGXB 4Z7WE 1KFGA 3ZE1F 4ZMNA 1NCNA 5KBPA 4AUJA 1U9KA 1SQPD 4WSKA 4PP2A 4R2GC 2P43B 1HKLL 4PJBE 1SFCA 1TTFA 1QFHA 1WBYA 2BZCA 5EZOH 3NN8B 5GGVH 4BZYA 4PGZA 5DRZB 3OJAB 1MCPH 3NSCA 3L2MA 3LNFA 4MCYB 2XQYA 4YLBA 2YAOA 5FGCE 2A9DA 4ONHA 2CDGA 3H7BA 2I69A 3F83A 4KUZL 1O0VA 2YJQA 4M8RA 2FHBA 2VC2L 1A6ZA 4MNQA 4M6NL 5GGRY 1A6AB 3ZL2A 1SJXA 3G6DL 1GGUA 1Y18A 4HGWB 4O02H 4RMUA 5KLIB 4Y5XC 4X8GA 3VSTA 4XN1A 3B8EB 2RTTA 4ZW6A 5LN4A 2VDRH 2XX1A 2B0SH 3TSIA 2VQUA 2YPLD 1MNNA 4QYOA 1MCOH 1WHPA 5C0BE 1USDA 2E56A 5CBEB 1IKOP 3D18A 3OKNB 2F1AA 4K0OA 5ICXA 3BP5B 3TGXA 2AV7B 1MPAL 3B4SA 2ATKB 2JKLA 2H4EA 4IJTA 3RK3E 4XXWA 1RJCA 4J3OH 5A6LA 1LMIA 3H9SD 1D5ZA 2CJ3A 1VLXA 1E28B 2X9WA 4P5TB 1DBKH 4EVNB 2J57A 1GK6A 4FXKA 3L4CA 3L5HA 4KKNA 5LAXB 4UQIM 4KTEL 5AVVB 4XGZB 2FGWL 4X8JB 3WLWD 4KQ0A 1QLFA 4WW1B 3IAGC 1TQSA 1IV8A 4DESA 3L3DA 3L71G 2H1XA 3EFFA 1WEJL 5E9NA 1I9EA 1QATA 2Y0DA 4IGBB 4TQEL 4XCEA 3OX8B 4LBEA 1U2CA 1QEWB 4OLZL 3CCMP 1FZJA 1XF3B 5C0DA 2Z1KA 3QQXA 3EIFA 4Z7OB 3QIUC 5JIIA 3UBGA 3TA3A 4KMTH 3LVTA 3QG6A 5JLZA 4NZUL 2ZAHA 4OD1L 4AT6B 3OB0K 5T5NF 2O6PA 2VW7A 1ACYH 2APVA 4JDTL 2EIZB 1LE5B 4D0CA 4PJEF 4LCIH 2OZNA 3AVEA 2GEEA 3SGKC 1DQQA 3WUTA 2Y9RT 3RVTC 2D03H 4M5TA 4TPRH 3CC2P 4HCRA 2IXQA 4GAAA 4JQ0D 3M46A 1XMWA 2HT4D 1G5AA 3IWUA 4ENZA 4IHOB 1RD6A 3ZY7A 1BFTA 2E9BA 3ARZA 3LN5A 5KUMA 3OJMB 3ZU8A 4FQXA 3EJUA 4OW6A 3STLA 1TQVA 1JWMA 4GUOA 3K0YA 4LRIA 4WUKL 1N6QL 4PREB 1J5OL 3GNML 3GHGA 3AQZA 4JFTA 4Y4FD 2CLZB 4FJ6A 1ETZA 1P4UA 4EOWL 3WUWB 1HSBA 1T8ZA 1PCSA 2HJLB 1A6UH 1QHQA 2QFRA 4JLRB 1RF1C 1F86A 1KFAL 4H88H 4XCYA 2B4CH 5I1KL 4FYSA 2QGEA 1JDCA 4X6CF 3QEGH 1SHXA 3OJVC 5CLZA 4U31A 4WJ5B 5ISZA 3LIUA 1KMIZ 1NC4D 1L3NA 3D39E 3V7MA 1EZUA 3CFBA 4HXAL 1MW2A 1XZ0A 3PGCB 1QSVA 5F88B 3KE0A 4CJ0A 3BPNB 2ZG1A 4ANKA 1JD7A 2COVD 2VITB 2XETA 3N1PC 1VB9A 5TFSL 4TRPL 3E9TA 4ESKA 1SVCP 1LK2A 4IIZA 1FHGA 1MFNA 4W9EC 3V5HA 2FXMA 3BCCJ 4WY4D 2E5TA 1A6TB 1MWAB 3O3BA 5E1HB 3S35X 5IJCC 5DJAA 4DKDC 2QE7H 1T1XB 4F2EA 4FP8H 1FE8H 2GJPA 1WCBB 3L74J 1VQOP 2NZIA 1DUZA 1JD9A 1P4BL 2QVMA 1F8TL 2NX5E 4N90D 5SWQB 4PSPA 3FCSA 2F19H 5GISL 3DA0A 2C8NA 5I16B 3VGAC 2ZF9A 3LZFL 4LEEA 1A9BB 5BS0A 5HVFB 3QIUB 4O02A 2F54D 2WBJD 1AS7A 4Y19A 4FQJH 4MKMA 4X4YA 3QQDB 3VFVA 4U3FD 4MJIB 1W72L 5FO9B 2C1OA 1ZEAL 4JFFB 5EORH 3P02A 2EDRA 3F7LA 4JL2A 3TYFB 4EMZA 5CBNA 3HNSH 4PV9B 1EGJA 4HOWA 1QYGH 3P4OB 2H8PA 2WZ5A 2D7MA 5IUCA 5ACMA 1LGVA 4FYQA 4XVSH 3SDYL 3LB6C 2XU6A 1AD0B 5IWLA 2NY2D 1I3GH 1OXYA 1YJNP 2D8KA 2V7QH 1FL5A 1EZVD 1KPRA 2FJHB 3OV6A 5GJTL 4J12A 4UTBA 1JUNA 4WTQA 3T6VA 5EBWB 3OWEA 4IOFD 4QXVA 5DZNA 1Z9MA 1TR7A 1TFHA 3S8FB 2CRIA 3EO1A 2F7RA 4CVXB 5C8JB 3LEXB 4GQPH 3MV7D 4FFZL 4PLKD 1TO4A 3KYAA 4N86A 1XR9B 3KHOA 3D0LB 5T1JA 1FO0B 4P06A 4FYTA 3V0EA 4CMHC 2D0FA 1RF1B 2XVLA 5DEZA 3R8QA 4YL4A 3MV8B 3BN3B 3L70E 1G0YR 1ZP0C 1X6LA 1X5FA 2R1YB 2VDKH 4GRLD 4E2OA 1M42A 3B5GA 1ANUA 2OTLP 1KZYA 1IEBB 1I7TA 5BZXA 3ZDZE 4AMWA 3DO4A 2ZCLL 5HPMA 1YQ3C 3ECBB 5KLVD 5IV2B 3BI9X 4G7RB 3EJZC 5GS0C 3SCMC 3ULVC 1A2YA 5TDNB 3NCXA 1RZPA 3L3OC 3WS6A 4FXGC 3UTQA 5MENA 2XN9D 5CLXA 5EZJA