5AW6B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw6B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw6B02
1FAVA 2WPRA 3M0AA 3KDPB 5APWA 5APUA 1GZLA 1HUCA 5AVQB 5AVTB 3TK1A 1S9KD 5AVXB 3A5TA 3VYIA 2XU6A 1CI6B 3L35A 3I5CA 3NXSA 3T97A 2XZRA 3HTKA 5AVUB 3MGNA 1T2KC 1H8AA 5AVRB 1HBWA 2WPQA 2WT7A 1GTWA 2Q3IA 2WPSA 5AW6B 4JYCA 5AVWB 3M06A 3VMXA 1OWAA 2P67A 4EOTA 1T2KD 4M3LA 1FOSE 2R3CA 2W6AA 4HYTB 3M9HA 1IO4A 4AYCA 3HE5B 3TYYA 2KP8A 5APYA 1SLQA 1NAFA 3KQGA 1A02J 3LIDA 3NMDA 2R32A 3O8ZA 5AW5B 3V5BA 1X8YA 1MFZA 1GU4A 3L37A 3MD0A 1H88A 1HJBA 4AQRD 2JJLA 1CI6A 2W27A 4RESB 4XE5B 5AVZB 1MV8A 1MUUA 3IR9A 1KQLA 1NWQA 1JNMA 1OXZA 5AW2B 2ZXEB 2QM7A 2Z5HA 2VRSA 1GU5A 2R5BA 3NTNA 2P2UA 4C7NA 3TNUB 4KHXA 4C7NB 5AVSB 1A02F 1CSBA 2C9NY 2Q5UA 3L36A 3OAKA 4GT1A 4I2LC 5AW3B 1S9KE 3P8MC 2E43A 2ZFCA 3TNUA 3VMZA 2WTYA 3A2AA 1GK6A 1G2CB 1GK4A 1SP4A 4GKGA 3UIAA 3HE4B 1GD2E 2WWWA 2WT7B 5AW7B 4DZOA 5AVVB 5AW4B 2XV5A 2R5DA 2E42A 3A7OA 2P7JA 3M9BA 5APVA 2H7HA 3P32A 1J2JB 4AUWA 3V4QA 5AW9B 3WGVB 5AW8B 5APXA 4C46A 1HWTC 3HE5A 2N9BA 4B86A 2QM8A 3A3YB 2YO3A 4LC1A 1JUNA 5CMZA 5AW0B 3HE4A 5AW1B 3WGUB 5APTA 3VN0A 2YNYA 1DH3A 3VMYA 5APQA 3M0DA 1H89A 2C9LY 3B8EB 3VTPC 3SWFA 2Z5IA 1FOSF 1YYCA 2IPPA 1CZQA 3NFQA 3V4WA 2YO2A 2Q7CA 3M91A 4RETB 4JYBA 5APSA 2BASA 4I6MC 5AVYB 3LIEA 3P7KA
chains in the Genus database with same CATH superfamily
3KGSA 3VGDA 3DC0A 1NDGB 1AXTL 2GT9B 2MPVA 4KKAC 3FZUD 4YDZA 5SX5H 4S0HA 4PVLA 3APMA 5I1DB 2Z4QA 3QULB 4NUJA 4PJ7B 4UOW0 3C87A 4U0RC 3E6HA 4PHZA 2CA3A 4H8HA 3NJGA 4JFVA 3HHSA 4BRVA 3SJVA 2CO6B 1X5FA 3TWYA 1VF5C 4F57H 4WWPA 3VXPB 2OL3H 5AVRB 2DICA 1DQDH 2OMUA 3OR7B 1HBWA 4LAJH 5FYLE 3HD7D 4AQAB 5JDSB 4X5XA 5HDOA 3TPKA 5H2FE 4JYCA 1TJGL 4JFFA 3VXOB 1L6PA 4DESA 5HXMA 4JDZB 3BSGA 1EA9C 1P4LA 3QWRA 1VPCA 4G7YH 1Q9KA 2BFVL 1IB5A 3SE6A 1UADC 1CW5A 3RDTB 4FFYL 5I73C 4PSPA 1AZBA 1REIA 3GMRB 3J07A 3OGCB 3TS8A 2ICCA 3MACH 2OA9A 2RIKA 2DQIL 3IB4A 3QDGE 1CE1H 3NIDF 4QF1B 4AWJC 4YLCA 4ZMXA 3I6GB 4NXKA 1GU4A 1M1KQ 4L4VB 3TBVA 3OBAA 1XXFC 3TN0A 4X6FB 4WY4A 2KS1B 3PGDA 1KCRH 1W72B 4TOYH 2P47B 4Z7WE 3BHBB 4HT1L 1YAZA 3QWNA 3WTSA 3CIQA 1K6QH 1QFWH 4MNGE 4KRLB 4H13C 1JERA 3BQUB 5T1LB 3L4CA 2QGCA 1RP8A 2J5LB 2AK4E 3ENEA 2EO7A 1AOHA 3IS0X 2BEZF 1Z3RA 5HD8D 5CZVL 3KBFA 1YZZA 1NM4A 2ZFCA 2ZYHA 5LAXA 3I02B 5LHDA 2HPOA 3EHBD 1PBYA 4O02B 4WI2A 4XCCH 3HJ0A 4JUTA 5DHMC 1SBSL 3EGSA 5DHVA 2VMCA 5KLVD 3O0RL 5D2LB 5KAIH 1XSKA 4FQJL 4F7CA 1NKNA 2AAVA 3FH8A 5DMIL 3PJSB 3G71P 5SV4A 4B9JA 1TCRB 4NQTA 2IPUK 4PWGA 3K8MA 1ZSDA 4YDJB 4Y19E 2K9JB 4CW1B 1E2ZA 1YJWP 5LBVA 3LQAH 4PRIA 1I1YB 5J1SC 1CR9L 3K0YA 1QSZA 1G7PB 3RWEB 1CXFA 4OM0H 3NJXA 4J4PC 3D87B 1ZLUH 4PLOB 3RWCA 3IE9A 5I1KL 2E6JA 4EI5B 4GW4B 3KGUA 3IFNL 4ES8A 3V4VH 1N8RQ 2X4OB 1HHGA 5EUKB 1SYVB 3HE6D 4FG6C 1K4DA 3CK0L 5JW4M 3MLWL 3WNKA 2X9WA 2XPZA 5IIEA 4ZO6A 4CSPA 4XPGH 3GBLA 2OSWA 1GW4A 3QXAB 4HK3J 5FS5A 4GSQA 5IMOA 3U6RA 1N73A 3L1FA 3MGAA 1KCBA 5CJBA 1UM5L 1IGTA 3EH1A 5E7BA 4ZQTA 1RQ5A 4YPCA 3TYGL 4JE4B 5ETUB 1KILB 1JGDA 4NFBA 2E7BA 5EOTA 1JXFA 1R5SA 2MKLC 4AVHA 5FB8A 1JK8A 1J0JA 3BT2L 1ERNA 4HK0B 4X80L 4IRSA 1AC0A 1EHAA 2H2SD 2OQJA 2FLMA 3T2LA 3LQZB 4BH8A 1QLFB 2O61B 1JCDA 2CG9X 4UBDD 3IXAA 1N3NA 3T4AC 1MHHB 2BDNH 4BRYB 3FB7B 4KTEH 4U0RB 5IUCA 1MCPH 1ORQB 3U7YH 4Y2DD 4UNVA 2QZ5A 3WFEL 3IF4A 1DLFH 2L8AA 5T3XL 4M1CD 4H26A 4WIQA 4PRPE 2WXPA 4YNYA 5SWQB 4GT7A 4G9FA 3OHXC 5DVOA 2KLVA 3BASA 3ZN6A 4OZ4B 1A9BA 1TQBB 1L4AB 1M1JB 5GGQH 3VI4A 2JCCB 4TQIA 3SKMB 2GYSA 4KRPB 1QR1B 3AROA 4AUUA 5HYJE 1PP9G 4WI7A 2AQ3A 1N5AA 4AJVA 2ZG2A 1FZMB 1W0VA 3MCKB 2QIWA 4NO3A 5DEZA 3FU8A 5HVFB 4B27A 5AW2B 5F7LB 1IFRA 1S7XA 2WNGA 2DI7A 1DE4B 1QLEH 4J8RB 5KG9B 4WHYH 5J9PA 2R5BA 1AHWB 3UTTB 4R4FL 1LWUC 1HIMH 3T3MF 12E8H 3ZUNC 4I88A 5BCAA 3MRQA 3TNNA 4HDIB 4ZOAA 4LPVA 3V4UL 2XWJB 2WWOA 4UNTA 3RWDA 1SM3H 3L5WB 4V1DE 1DJHA 1UD3A 1IGIL 1Q72L 3EZ8A 3MNVA 3H1IE 3LN5A 3S2AA 2XWJA 4IRSD 1FZMA 3GRWH 3RWDB 3ZGHA 4I18A 2PYEE 1SXNA 3O6LL 1FQ9C 1J12A 5C07A 2ENQA 5DO2D 5C0BE 4EBQL 5F97E 4XNYH 3OZ9H 1S72P 1MPAL 5JPNA 3PJNA 2RMZA 3UPRA 5F9OL 3QZNA 5D1QB 3F64A 4XB8A 2FLRT 5EOQL 5LNGA 1UB6A 3CZGA 2ATKB 3DJTA 3HN8A 3MUGA 1JI1A 2B8OT 3VFNB 5KYYA 3B9DA 3NIGB 3RDJA 1IC0A 2AEQH 4H88H 1P7HL 2NY2D 2UV3A 2FJUB 2OZNA 4HBQA 5TDOA 3HB3B 3Q9PA 3QR2A 4G80B 3CZJA 3BCCG 5BOZG 4LVNB 4CNIA 3M88A 5HDQL 2AABL 4GSDH 1X5IA 4UIKL 2LTQC 2CKBL 3R1GL 5CSZB 5ITBH 1QW9A 3FO1A 2YJLA 3PL6D 5FWQA 4DGYL 4ZZKA 3ABKB 1NAKL 1TFPA 1FVEA 3ARDB 1NVOA 1T6AA 1FZOB 3U1QA 3CLFL 3H53A 5J6HA 1QTPA 2AKRB 1HVXA 5I15H 3FUNA 2XZQH 4L8SA 4X7TA 4UF7C 2E56A 5DT1H 1ACCA 1MFCL 2BERA 4IEFB 3H1IG 2YIHA 2GBTA 3S48A 2WP3O 3B2UD 1NBQA 4N2IA 1GTWA 3FN9A 3BWUC 3IXTB 1C7SA 2IZ1A 2WPSA 1A3QA 2WQYC 5GGSY 4KUZL 3F65A 4PVBA 1BCIA 4GP5B 5HHXH 3FCTA 2GJJA 4W6WB 5GISL 1A3RH 2R3CA 4DEWA 1CICD 2KXPB 4RCAA 2E7HA 5I18L 4WI0A 4MB4A 3MYJB 3UGXA 2NRGA 1DUYB 4N90D 1A0QL 4XPHH 2ZKYA 3OKOA 4XHQA 4M6OH 3ULSB 1C12A 2VSMB 3MGOB 3DVIA 3UERA 3B1UA 1QTYT 2QADC 3D50A 2YN3A 3H56A 4MJ4A 1QFHA 4P2CG 5T8IA 4B3EA 4UB8H 2IBBA 5GS1B 5KSAC 1Y6MR 1ZVHA 4OD1H 1YEJH 1DUYA 1Q94A 3BZEB 3M1CA 4C54A 4EI5A 2B1AH 3QUXA 2J58A 4MVBD 1IBZA 5D2LA 3WTUA 2V17L 1G1YA 4DP0X 3QUYA 3UJIL 3LKNB 1XVSA 4O2FA 3RKPA 5DK0A 1ONQA 3B5NA 4PJBA 1BIIA 3QUZA 4OH8B 2G9KA 4APQA 2NYYC 1ZSHA 1A02F 5D8JH 1BGYE 1V5JA 4OFYA 3P9MB 3JV0A 4NRYB 3HR5A 4V1DD 2VLKD 4J6RL 4OQ1A 5DS8A 1RK0B 3QG7L 2OTKE 2WVSA 3QWRD 4WFGE 2IBZI 1X22A 1R75A 3F7YA 3LRHA 1NTDA 5E08H 2ZF9A 2AQTA 1C1EL 3IAPA 4HKZH 5CSZA 4I0KA 3GUTB 4L75A 2FAUA 3OAUL 3L6FA 5EMYA 5F1NA 3HNTH 3WMPA 2B88A 2ZOLA 2QQLH 4AYSA 2KNCB 1G7JA 2I7OA 2HFFB 1BFVH 3LZFL 5I2IB 5AW9B 3LV3A 3O45A 1HWTC 2KDGA 5K9KA 3AB0B 3UZQA 5KW9L 1J88A 2VR4A 3BIAX 3H1IJ 2DJMA 4ZFGL 1BMGA 2YMTA 4LCYB 4NHUB 1KB9H 3L74E 2BCCD 1E90A 1FZKB 1IGFL 2QELA 1NTMJ 3SWFA 1RUAL 2YOAA 4ODVH 4LDEB 4QUOA 5DJ6B 3C5JB 3LPOA 3ESOA 4GOFA 2VDLL 4FERA 4XP4L 1IGIH 3ELAT 3FQNA 3V4LA 2ADJA 3CSGA 4IU2B 3DROA 1AFVH 4JFED 4Y99C 5DJ6A 1CIUA 2J6EL 3PYCA 4LCCB 3O4LD 1KQFB 4PG2C 2XDHA 4NN6B 2E4FA 5BMFL 5J9PB 3UMTA 4WSJA 1F8TL 2WLYA 5A2AA 5T33H 2FQEA 2NTFB 1OCZB 3GJFH 4DGUA 1IRAY 1WFUA 2HTKC 1U6AH 1NBYA 2R29H 3TYFA 4OGYH 4ZRGA 4NJ9L 4K94L 4WWIA 1UKQA 5CJOH 4HF5H 3HTKA 3FRPA 2P48B 2VDRB 1NPNA 2CO6A 1MCWM 2ZCHH 4HAKA 4NZRL 4WO0A 4NQEE 4PJIB 1CYWA 1MJ7L 1PX3A 5EPMB 1HQ4B 1WLHA 5CGYD 3MUDA 4PVMA 1HKLL 3LH2H 4NUJB 4PJ7A 3D9AH 5DS8B 4EE2A 3AVEA 3U59A 2J72A 3VW3L 2R29A 1QX1A 2QJYB 5EN3A 3CX5J 1IGYB 2XQYA 3OHXA 4J3OG 3ZRCC 1FRGL 1XIWB 3TVMB 3GMPB 4P2OB 1AKPA 3KLLA 5DK0B 3WS6A 3BSZH 3R7QA 2G0KA 4FZ8L 2AF2A 2IOOA 5DJAA 1KCVL 5IBTH 1FS0E 3MAWA 5AAWC 1EEYA 2LVEA 2MWCA 5D7KE 4CA4A 2BSDA 5IHHA 4S1SH 4H0HB 5JW4N 1BCCJ 3OQRA 5AAWA 5IFJA 1P5UC 4I13B 1DJWA 4NENA 4DJMA 3ZTJG 4AQZA 1D5ZA 5KN5B 3REWB 4KDTC 5IMOB 3IN6A 5D6DC 4WFFE 4CPGA 3S35X 5F7NC 5BRZD 1OAUH 2W60B 3Q5PA 3OAKA 1DBBH 5TK4A 1NGZB 2BXZA 2ZP0T 4MSWB 4AQ1C 3FSVA 4RA0C 1EXUA 1CXKA 3D4CA 4KJYA 2I07B 4XXWA 1FH5L 5K59F 4ZUUA 4UIMA 3UBFA 3ZO0A 3ROLB 4AUYA 4MMZB 2WKOF 4NKQB 3QGVA 3D3VE 2WITA 5MEPB 3MUHL 5A2CA 2BWIA 2P7JA 4JREB 1VKXA 3FONA 2H9GA 4FKKA 2W90A 4FL4B 3A0BH 4ZUSA 4PJGF 2XV0A 3EFGA 1AMXA 2NQ3A 4PJ6A 4ZUVA 1TYRA 3JZYA 3VXNA 3QWQB 4S1QH 3MLUL 3IWVA 5CP3A 4DVRH 3OXSA 2FNWA 1JWMA 3CE1A 3D2UB 4E41A 1LEGB 2Y5TB 3T1FB 4PB9L 1RPKA 5ICXA 1Y7VA 4YHYC 5LJYH 5GPRA 3ZU8A 3CX5K 4IHOA 4OCRL 2IC2A 5F6IB 5E2WH 5CEZH 4R7NB 2XV6B 4MMXC 2C5DC 3T1WA 1U42A 2DWDA 2FHCA 3X12B 3CDZB 4N5ED 4GO8A 4BV1A 5C86A 5AYQA 4KV5E 1KB3A 2NW3B 3P4MA 4AEIH 3HG1A 1EO8L 3ECWA 3S5LG 1RULH 4GAYB 4N0UE 2DMGA 4X6BA 4FZEL 1Q9OB 1PG7H 3QCUL 2KK7A 4I3SL 4K3DL 3VXME 2C1PB 2MOVA 4Z9KB 1T4KA 4JMNA 1WD8A 5IREA 1CDCA 4LL4A 2QR0B 2X2IA 1BFSA 3ZKSD 1TNMA 2IBGA 4AIXA 1X7QB 1XR8A 5C0IB 3B7UX 1N7SA 1PLGL 3AM8C 3NABL 2OXGA 4H2CA 4KROC 4YX2L 3EQ2A 5CM1A 2XN9D 5DEGB 1RQUA 3L4ZA 3D0VB 4IIQC 3ZQXA 3US9A 4MZRA 4C7RA 3EYSL 4NO0D 4E9WA 3IRPX 2HLOA 1T4WA 3F5HA 3CVIH 4Y8AA 2R59A 1M2VA 1PY0A 2CK3H 4OFDA 5FUZL 4EXPX 4J8QA 1KBBA 1HGVA 5T3ZD 3VCLA 4U1SB 2ZT9C 1XTCC 2CDEB 4DERA 1AIFB 1OK8A 2R29L 4RIRB 3FW6A 4Z77A 1XGTB 2BDNL 5D5MA 3SY6A 2VH5L 5JQ6L 3EHBB 3DETD 3WIFB 1BOGB 4Y4HD 1DJZA 2OL3L 3RWFA 2QJKC 3O4LA 3HR6A 4QOKE 4Y5VC 1EGJA 2GABA 2GI7A 4FA7B 4FFZL 4U1HB 2NMSA 5DJYA 1L3NA 2V3FA 1NAYA 1DVYA 4EXKA 2EVIA 2BY0A 5TE4L 1TQBC 4TPRL 3ZE1F 1PGRB 3A24A 1KZUB 4E9QA 3BKCL 4NOFA 1VGEL 3UACA 4O2EA 1JHTB 4OLXL 5IVZA 1OGAD 4NPFX 4URTB 2OI9B 4HMEA 2BO0A 1K5NB 4JRXD 4LKCA 3MU3A 1NEZB 5IB1B 2Y0CA 5IBTL 4PW9A 5FKPA 2UUDH 5CU5A 4M3HA 4GRLA 4HIIA 5LO7A 3BZFA 2YRBA 1SF5A 3S96B 4WVZA 3VD4A 4YUEL 4IRJD 4K7FB 4PY7A 2X5PA 4KO6A 2J59M 3BE1L 4QWWD 1F45A 2F58H 2BX5A 2XZCH 1BVNP 2Y25A 4BWWA 3DX6A 5I1HL 4R4ND 3H54A 3MLXH 1TZOA 4J3WA 4U6HA 1AYRA 3I3BA 4WFGD 5BJTB 3MJ8A 4Z95L 5D1XE 3T2NH 3D52A 3VFUA 4YHKL 2B3RA 4OFYD 4PBDA 4OGQC 1U8KB 4L4TB 3D5OF 5JIHA 1KTRL 4JHZA 1A5FL 3CWGA 2Z8VC 4XNYL 4RSYA 5D1QC 1IBGL 3PNWA 3UO1L 4A6YA 4JYBA 5F1KC 2VRAA 5ICZA 2OL3A 2YPLA 2XVLA 3FCUB 4EZKA 4L0YA 3WYRA 3VXMD 3QJSB 3QUXD 1A3ZA 4G6KL 2HUHA 3PHQB 3S88H 4QHMB 3P77B 1JMMA 4TMPA 2QR0A 4EYYQ 3QCVH 1KZYA 4I3GA 4N0FA 2FWLB 5CD3A 3H7BA 2YA1A 1WBZA 1DL7L 1JF1A 3BP7A 1KENH 3IRCA 2WUCH 2F5AH 4OCNC 3WJJC 1CDGA 2Q3ZA 3V2PA 3A0HH 2W9EH 2FO1A 3FFCE 2C9QA 1KBWA 1FF5A 3ARBA 3MLWH 3PWPE 1LWRA 3QNYA 1I3GL 2MTAA 4HGMA 4WK4B 3ZXAC 5HSFA 5JLZA 1XF2B 2YR3A 5CBNA 3QJTB 4LRNH 2DYPD 3BWSA 1IFMA 5DMYA 4NT6A 3QT2A 2PPFA 3VGEA 4E9TA 4JO1H 1KOAA 2VZ3A 3GEWB 4ZS6D 2Y7SA 2OSLB 1GY2A 2X88A 5JXAH 2M3EA 4GUPB 3D85A 3O3AB 2Q6WB 4FKHA 4Z7UB 2N56A 5E6UB 5HI3D 2CUIA 3WHE0 1U8OB 2Z7UA 3K2MC 1LEIB 2Q9OA 3RAJL 5BS0D 1BYNA 5KJ7D 1JZ5A 4HIJB 1RIHH 2OTUA 2X3BA 4G6AD 2E7LC 2HUEA 4LLUA 4A7UA 1I3RA 4HUVA 2WIMA 5C3LD 4C7NB 1XTLA 5L9DL 3H42H 1OPGH 4IBQA 4HAGA 4UQ3A 3K6IA 4RGOH 5F3HA 3BJ91 1UT2A 1SP4A 5D7KD 2FY8A 5I1LA 5KYXA 2G60L 1BZ8A 1MCLA 3G04B 4KKCD 1AJ7L 1ID2A 3MFGB 2F19L 3PCYA 1IEBA 1Y0LB 4PAZA 3SJVB 1A1MA 3LXAA 1E9QB 5C07D 1EH9A 3U4AA 1EHLL 4K7PY 3OR6B 3CGTA 1Q0YL 2OARA 3B71A 3G5VA 1OTTD 5DEFB 4ENED 1JM0A 1KIUA 3E6FB 4H4NA 4TPRH 5IP4A 1WHOA 4D3CL 4YOKA 3WHXA 1GCYA 5CIPB 3VWJB 2X0UA 2P5ED 3HE6B 5JMOC 2NY6D 4JHVA 2RCSH 3RWGB 3VTPC 1EZLA 1TIUA 1ZT4B 1BYPA 1OSPL 2C8NA 4B7LA 1NCTA 4JFFE 3E9UA 1MELA 5FYKD 2J4WH 4DKTA 5L7XL 2ENJA 2W9DL 2OV0A 5E8EA 4LHJB 4Z7QB 4YSPA 4NWUL 4WFED 3HFFA 5DJYB 3MNZA 5DGQA 2JCCF 4IQHA 4NERA 2APSA 1L4AC 1M1JC 2F58L 2XZCL 2XSKA 3O4LB 4QRPE 3F58L 5J7CC 1IIIA 1DQMH 3P0VL 1N86A 4EJ1C 2A9CA 1Z9LA 4Z7VF 4IGBA 5H94B 1SOKA 4AE1A 4WCYL 1QEWB 1PAMA 3VWKC 4XHJD 4G42B 3U25A 4UDUA 2XZRA 1M57B 1A1OB 5FFOA 3LD8B 1J9TA 1RUML 3TGUJ 2MKVA 5JZ7D 2B89A 3K5BA 5C0JA 4JN2B 2VDOH 5FLVA 3DDFA 1FZKA 2B1HL 3UJJH 1JGUH 3KPRD 2Z9TA 2DF3A 4KKQA 5HI4C 1UTDA 3AG1B 1HQRB 3QC6X 3UADA 1JXDA 3UGUA 3ZE2B 1E4WH 2D0HA 3MRHB 1NGQL 3ZZSA 3H9YA 2VDKH 4DQAA 2W8CA 2J1XA 4L3FA 1XDTT 5JW3H 3HS0A 3N43B 2N4IA 5C0CE 2KP8A 1MI5E 3HUJF 4AW7A 4LLWA 1UWEL 3MV8A 4PLJD 4W4OA 4WU7B 5BZXA 4WHTB 1RUPH 3KQGA 2DBLH 2DD8H 3MOQA 3CQPA 3O8ZA 3WXWL 3C6SB 3FQRB 1CD1B 2BHZA 2CD0A 1ZV8A 4WTZG 3LH2L 3QZPA 1EMTL 1CI6A 4Y19A 4WTZA 2A73B 2Z8WC 1RCYA 3MRRA 1QA9A 1BQHB 1BSIA 1P5VB 3CQQA 1BA9A 1OW0C 5BV7L 4MQ7A 4U6XA 3WEMA 5DJ2B 2JKJA 4W9LC 5A2KH 5C0RL 2CJ3A 4NAMA 4CSZA 3KYOA 4JB9L 1P1ZB 4PCYA 3IDMB 4TTDD 4TVPD 1AFOA 5EEZA 1AACA 5DURD 5HHPA 1ZLVK 1PSKL 1RZJC 4Z8FL 4A2LA 2FDBP 4F5CE 3PRZA 4G7RB 2R4SH 5EV7A 3ZIMA 3GUTA 2KLUA 4IBZA 1A6UH 1HEHC 1SY6L 1ZVYA 4OD1L 1INDH 4P57A 5AB2A 3HG2A 2DQMA 5C0AA 3E9TA 4DOJA 4JPIB 4NSKB 1KQSO 2XA8L 4MAUL 4Q9RL 1FO0B 5DJ8A 3P32A 4L9LB 3N06B 1VKXB 4PYHA 3HC4H 4XVJH 3G5VB 3AWGA 2EXYD 4KNUA 3IWUA 3QUZB 3TM6A 4M00A 1CYXA 4PJ9B 4HETA 1PTZA 3EO1A 2B15A 2E75C 3DYPA 4KHTH 3MRGA 3T4AB 3MV7A 4ZUUB 2Y6TE 2JKNA 4KTGA 3H3PL 3ZR5A 3STLA 4JREC 2JFCA 4LLVB 1LT9C 3MRBB 2DIBA 3QDGA 1MHPL 1RP9A 4AEHH 1IE5A 3CX5H 4KO7A 3CFMA 1NGZA 4JG5A 2XOTA 3H1JG 2J5UA 2DEWX 2O5ZL 2ZUSA 1FGVL 1BOYA 3QPXH 2VIRA 4ELDA 1LEKA 1PGPA 1LK2B 1MLCA 1FL6A 3GS4A 4M43H 1RURL 4GYBA 2QQLL 4WY4D 4OLYL 5HI3C 1VAHA 1YN7A 4HWUA 1FVEB 4Y1AA 1R3IL 2DBJA 1RZ7L 3T3ME 1G2CA 2X2JA 3ASNB 3FCTB 3L9EA 5IROA 3STLB 2AQ2A 2XG4A 4WEBH 4OB5L 1J0YA 4NRZA 1S9YB 5ISZB 5K9OA 3TLRA 4YAQB 4O5LH 3H1ZA 4OZHA 3N1FC 1OARL 1O5PA 2WC7A 2GI0A 3VG0L 1ODAA 5C9JB 2CRZA 4HJSA 4TUKL 3JCUE 3CHQA 3GTTA 5KJRL 4NUQA 3OLGA 3CMAP 3L17A 4KY1H 2W9DH 2NXYD 4MAZA 4ZUTA 5GS0H 1BVOA 4NWUH 4Y19B 2BNQE 3H4FA 1U8HA 1MAJA 1XX9C 2EINB 4MD4B 3SPVA 3D39B 3VQMA 4XPFH 1KQGB 2E6QA 4UAOB 3D07A 1FG9C 1D2PA 3X13B 3EOBB 4HFWB 4N5UA 4FXLA 1KELH 4Y9FA 1XH2A 3Q8AA 3V2AR 3R18A 3QUXC 5KS9E 4LT7A 2V9RA 4KTEL 4MNHA 4D8OA 3AFLA 1TTAA 4P9HC 3UCRA 5ABDE 5FDWA 2E59A 3QS2A 1XV8A 4OCSH 4FQHB 2ATKA 2NR6C 1CF8L 1QA9B 2VDKB 3RNQB 4D0BB 1MV8A 2XZAL 1ZVSB 1BJ8A 4P2RA 1A6TB 5DD5H 1ZLSH 2WZPA 5I24A 1UQSA 2CIKA 4YL4A 4GKZA 2ZG1A 1UFGA 5D1XB 4OWFA 2VDOB 2IFMA 1ZV5A 4KMTH 2PP6A 1L5GB 5FOBA 3SPHA 2K4WA 2VQ4A 1IQWH 4Q9QL 1ADWA 1T1ZA 3CG8A 5D1XA 3HUJA 3IU4H 1EHXA 2FYNC 1LK3H 4JJ5B 3ARUA 5D6CA 3TEUA 5K1VA 1QZ1A 4TSAH 2PWDA 3U82B 3Q44A 4PW4A 4QAWA 3UZQB 1JPGB 4K07A 3ARDD 4GAGL 5DMKA 3FB5A 2JB5L 5J57B 4IDJL 4BHUA 5I73B 1B3JA 1CPUA 1BQUA 4E41E 3S4SA 3QQ9D 1J1OH 3H55A 1KYUA 3MR9B 3QUGA 4GB9A 4WRLA 3NZ8A 1FO0H 4PREB 1N4XL 1N18A 1OMIA 4AXWB 5C92A 2EDLA 5C0RH 5I71C 2ALWA 4OD3H 1GMIA 3D6YA 5K39B 5BXFB 3QYNA 1L0PA 3SKOA 3MBEB 4XMKH 1OP3H 2AXTH 4OZIF 2FL5A 4IU3B 4G43B 1NC2B 2J88H 5E2UL 4NS0A 3FSOA 1N73C 3PP4L 3ARGA 3JWDH 2O5YH 1LVEA 4KQ3L 3U83A 1G1JA 5JW4Q 3NK3A 1BG1A 1HVVA 4R90L 2QVKA 3SBWA 4W9CC 4RFEA 3RVWC 3WE6B 5K59E 2IWKA 2RGSA 1AD9A 1DQIA 1IEBB 1Y0LA 3VXUA 2P9RA 3LKNA 1DLHB 4JZJB 3QZLA 5JW3L 3AITA 5D72H 4LRIA 1PDKA 3G6DH 3CHXA 3ELQA 3L3OB 3BVWA 4KH9A 3ABVC 1CGWA 1UA6H 4A2DA 1CS6A 3FTSA 5F3HB 3WHXB 1SFDA 4L1BA 4JJOA 1EO5A 3V4PL 1R47A 3V7AE 5IEKA 5C08E 1S5IH 2D2CC 4BSVB 5E6YA 2EYRB 1JZ2A 3WU2H 1NGXB 2AQ1A 3LW5J 1RUKH 1H15A 1MCFA 4JF7A 1GC1H 2FQDA 2NYKA 4AL8C 1UGNA 4LPCA 4DZ8A 5HYSB 3KVQA 4XMZA 1XWVA 1G1IA 2AABH 2ZZUT 4EOTA 3PGCA 1K5WA 1IC4L 3F2LA 4DP5X 4PS8A 2LQRA 1FVCA 4DO6A 4YJZL 4JHAL 3GXIA 3QIBC 1TYJA 1XGRA 4WO4B 3QXDA 4OFIA 2A7BA 1LHZA 1MJ8H 4HKXA 4POZD 5D2LE 2BCMA 4BUQA 3P11L 4Y4KD 5E9NA 4G7VL 1XO8A 4J23A 3ZE0E 1M90Q 2CMRL 3A4EA 5I19L 2CGRL 4LLVA 5IFHL 2V5SA 2CUMA 2EEBA 3OTTA 2B39A 1Q0XL 1V7MH 1NC2D 1WWAX 1I3GH 4ZFFA 1EHKB 1L9OA 5IR1B 5J6SA 3VGBA 4KO5A 1FDLH 3W57A 5FV1L 2PXYA 3KPRE 2JKRM 3VMOA 3CUPA 4W70A 1KBKA 2C3VB 2WN2A 4TL4A 1J9RA 2UWJE 4OI8A 4LKXA 4OJYA 4QRAA 1SFCA 4ONHA 2YD3A 2E5YA 4G8GD 2P3YA 3UABA 3ILDA 3N1QC 2M5AB 1KTDB 3BW9B 3QI9A 3CDZA 5CP3H 4ZI8A 4YLQT 1VSCA 2V7NB 1FIGH 1OP5H 1OD9A 3I3EA 5GGTH 1L6ZA 2R2BB 4LIQH 1WZLA 1QRKA 1QUPA 3A0OA 1FZJA 3O2WL 2JQMA 1R8EA 4F8TA 1YUHA 3UTQB 2K88A 1Z9PA 3H32B 4J4PA 2JLPA 4FFZH 5D8JL 2R83A 4Y5XC 3MV8B 1FFTB 4G8GE 1TT6A 4NZUH 5T1LA 1PYWA 2WBWB 4A04A 2BFGA 4FJZA 4R7LA 1ZIBA 3WKML 4CDGC 5CMZA 4P2QA 3KXFA 5IB4B 5F7EL 1JDDA 1JZDC 4PJ8A 3H2WA 1J48A 4YDMA 5E5MB 5GGTA 5TDNA 3TA3B 1JMZA 4JGNA 3DMMA 2WZ5A 5D9SA 1LK3L 2DYPB 4CMHB 1EZVX 4V33A 7CGTA 1KYOD 3V4WA 1TG8A 1T7YA 2GJRA 1PFCA 2CK0L 2C0WA 2Q7CA 1HCFX 1RHHB 2C7UB 1JY2P 5L8KB 3HHSB 2QPFA 2X2UA 3IDJA 1QASA 3QFJA 5DWUL 3V7AG 4Z7NF 1KN2H 2H8PD 4A7TA 3UX9B 1IAII 1TETL 2X4QA 5E6RB 2I60H 2Z4EA 2WVTA 3REWA 4NQXB 3VXSA 1J11A 1J18A 3CHOA 4ZMTA 1XAKA 3LH8A 1OXYA 1Y47A 4W9ZA 1P4LB 1DBAL 5IBUG 3JWNE 3VX1A 1P6FA 2YZ1A 4XRCA 5H37H 3HKFA 4EMZA 1QEWA 3CFQA 1AE6H 4ZZFA 1NTZJ 2XNAA 1COBA 2B4CL 2CCWA 4NQCE 2KZWA 3EOTH 1A6ZA 2CU9A 3BEWA 1AVYA 2IDSA 2DDQH 2CDFA 2X4PB 3QJHB 2PTTA 5EO9A 4DAGL 5L0QC 4GSUA 3N2JA 1JYXA 2EDNA 2OMYB 4U49A 4H5SA 1T21B 4XPAL 1IC7H 4D94A 1N3NB 2QHRH 3LVEA 5CILL 1BEXA 3ME0A 4WCYH 3TIDA 1U3HD 3TBYA 1U3HC 3VFTB 4FNPA 4MA8L 3VRJA 1NAKH 4UINH 3GF7A 1JWSA 2H6PA 4NKIH 1NAFA 5ANMB 3PHOB 4X6CA 2HP4A 2NNCA 4YE4L 3UTZA 3QIUB 3Q8CA 4QTFA 3B9KC 7TAAA 2Y9ZA 5B4MD 5EWIL 3QBTB 3IM1A 4JM2D 5DRZA 1GYCA 3DX7A 1VFAA 4A55A 3RZCC 1UD6A 2HFEA 1LQBC 4CN4A 4HHAB 3CWBD 1JNMA 2GAZB 2XQYG 3ARWA 3LRLA 3MOAH 3O2VL 5D55A 1XBDA 3V0GA 2WXOA 1N4XH 2W80C 1EDLA 1UWEH 1ZPUA 4LDLB 4ATWA 2EIDA 3FB6B 4FLOA 4QT5A 3US0A 1NANI 4Q4IA 4X7CC 3QFDA 2BNRD 4BKSC 4CMMB 1KLUA 1MH5A 5I1LB 5KYXB 3A6CH 3T0EE 4JRWA 3MOBH 1HSAA 2JDIH 3EFDH 1F3JB 5AOIA 1T5XA 4PWHA 3ILQC 3L73G 5JPNC 1T4KB 2QJPC 2GUOA 1M6OB 4YS4A 1KBGH 1SRDA 3IJ8A 2WQXA 4K5NA 4F7TB 2A45H 4HLZG 5TDNB 5A40E 4UT7L 5IHZB 5IV2B 1J0KA 2CDGA 4AI7A 4NKMB 4KU1A 4H8QA 1B4JH 3B3IA 2R0ZL 2P7TA 1BZDA 2SODB 3P30H 3P3RA 3CHSA 4F7CB 5KVEL 3H8NA 1PX8A 3QDME 3FJTA 3GLDA 1NOLA 4UTAH 3S37H 3MLRH 4MJIE 5EU4A 5E6SB 3QUML 3CH1B 1I7RA 3QDHA 4P46C 5DSCA 1LT9A 5EU6A 2EJ1A 4P23A 1F5WA 1INDL 1XH3A 2YNYA 4RVBA 3CPWO 1QG3A 4JFWA 4ONOA 1FSKC 2CE6A 3U2IA 4FQPA 3QFJD 3L7FA 3BUDA 3LMJL 1R3HB 3STBA 2XXCB 4MKMA 4MQXC 4WFFD 3SYCA 4M62L 5FW6A 4KX9A 5DMIH 1IAMA 2LT9A 2NUPB 2KI7B 1NSNH 4XP1H 3CC2P 1KBPA 4GMSL 3DOSB 4FXGC 1ZHKA 5T1KD 3PY9A 5GZOD 2NY4D 1YHPA 3BFWA 3GFUA 3H0TB 1IM9A 4HJGA 4GG6B 5IROC 1XSIA 4RZKA 5DSCB 3TK1A 3MXWH 3CDGB 2ZWNA 4XP5H 4OM1L 1URZA 2R0KL 3F04A 1QACA 4J4PD 1K9MQ 4R97C 4Z6AT 3GTNA 2ZOWA 5AOZA 3S5LA 1YECH 4MD0A 1HL9A 2WXHA 4GRWH 3FHEA 1LJMA 4QPEA 2WUBH 3LIZA 3MLZL 3BXNA 3NAAL 4FZEH 5EORL 2MNWA 1V7NH 5EIVA 3ZKQD 3QH9A 1Q38A 3TO4B 4WEBL 1FYHB 1H6UA 4XPTL 5EZPA 5HGDB 3VYPA 4KUCD 4DGWC 4BGDA 5C1MB 1UZ8B 2O1JA 4W7ZA 2QSQA 2VN4A 4LEBA 4AIZB 1VHPA 2ZUUA 2ZAIA 1X5YA 3QHZL 3NZHL 3BGAA 3H1JD 1O75A 4EIUA 3V5BA 1T20A 4PJFB 5IEKB 1AQ5A 3KCPB 3ULUD 1WFTA 2E9WA 4JM2F 3MFFB 4N1CA 5AZUA 3MKGA 3NIDB 4E5XB 2NTSP 3WFHA 5F7MC 1AQDB 3V8OA 3NJHA 4XOBA 3FB8A 1E4KA 3BH4A 4XC1L 4AT6B 3QQ3A 2ICEC 2EUVA 2LU3A 4BKLA 1HKLH 2VXTL 1OIPA 4PJ7F 3VFSA 1PPIA 2WVVA 2EDWA 3FOLA 4N2NA 5IMKA 4HD9A 3R0MA 2PWGA 1XGUB 4OJEH 4R6UA 4XNAA 1TTGA 4JFQB 1BX2B 2BS9A 3MRNA 4N8VB 4TLFA 2PF6A 5CZKA 4GKGA 2ICWI 3NQKA 3N85L 3TL5A 1CO1A 2N0KA 1WC7A 4HUUB 5J0BA 4JQVC 1E79H 4ILDA 4GKNA 5INCA 3COOA 2KI6A 4Y0GA 4PJXA 3DROB 1KPUB 5DUMH 3OVUB 3Q8EA 3EJCA 5JPNB 2H7WA 4PJIF 4U1LB 4F27A 2HLFD 5APXA 1D5MB 5JPMA 3HAEH 3FS9A 4BD4A 4JB9H 4LNVA 5AYTA 1U8PB 2F61A 5MI0B 5DGRA 1CFVL 3U4BH 1GL2C 4BK8A 1KXTA 5DMKB 2P8LB 4JZJC 5CHXA 4O58H 3RIAF 2H3KA 5DRXA 5EBLA 1AQHA 1LNUB 4M5ZH 3RVVC 3ZL1A 2CKBA 1LYQA 5HGAA 5TE6H 4BA0A 4DAGH 5CZXD 1VQ6P 4A6YH 2D7MA 1RL1A 1MKFA 5PAZA 3WFDH 3ASWA 4WQOA 3SKJL 4LPYA 3ILEA 2VL5A 3BYTA 4JM2C 5ID1B 4GKSA 3F85A 4OQTH 2DEXX 5CCGA 2W83C 5CSGA 3MLUH 3T09A 1VFOA 4RWYH 4AC4A 1KV4A 1IL1B 1FFOB 4G9DB 4I9XA 2NW2A 4POYA 1RZGA 2VAAA 1X7QA 3NG5A 2DLIA 1SHSA 1X6LA 1XTMA 5GGRB 4RDBA 2CBPA 1BXXA 3SO3B 2HT4D 1FHGA 3H1KE 3EYFB 4ERSH 5ITBL 1B4LA 3CZEA 2EO1A 1BQKA 2P49B 2VN3A 2Z6FA 3CDCA 4AKPA 2DW3A 2IDFA 5KZCB 5IJCC 3OJ2C 4NFDA 3QIBA 5FF6B 4FQQA 1KGYE 1EWHA 5GS2H 3G5WA 1GGIL 5AKRA 1YPZE 3VTMA 1S5IL 4OUUA 2J1YA 1IAOA 3HZ3A 1OP9A 3QDMA 5ICYA 3U2JA 4U3FJ 1CDIA 1O9WA 3VYOA 3Q5SA 1ZTXH 2YMOA 2VSCA 2ZYRA 3N42F 1JK8B 1AGEA 1FNFA 4G8IA 1TJHH 3ITKA 1GW6A 1TZHA 4GSRA 5I1CH 3O2DA 4OIFA 4BZYA 3S2CA 2R1YA 3CCUP 3GSXA 4ORZC 3RY6C 3JWOL 2EKSB 4F7PA 1NCDH 3MV7B 4KMQA 3ZKND 1SJHA 3TBCA 3AQXA 1XCWA 2AAAA 4N2HA 5LWYH 2CNYA 4NWTL 4Z7OE 4KHXA 4TVPL 5FUZH 3V4PA 2EYTA 1TJXA 3Q1EA 4BK5A 1SQBD 2B08A 5ICYB 5I8KL 1V10A 4HOZA 3L9RA 3V52H 1FDLL 3AZUA 4R3SB 2ORBH 5DRNA 1GYVA 3HI6H 3QI9C 3R06B 4AH2A 1NEZG 5I8OL 2Y06H 3TBSB 1P4IH 1IKNC 4MSWA 3BKYH 1BXUA 2ZUYA 1HH6B 4YSUA 3W38A 2R5DA 1OM3H 2YPKA 2CWRA 3UZEA 2FH8A 3H1LE 1E4JA 4JY4B 5IROD 4CMHC 3GI9L 1KGCD 5MENE 4UMSA 4N2DA 5DD6A 5GSRA 1U57A 5AW1B 2EH8H 3DX7B 2ERJC 2HWZL 3B8YA 1VGEH 4HIEB 4MA3B 5BS0E 3IU4L 4GAFB 3MZWB 3CXHI 3LKSB 5EPMA 1KCKA 3V6FB 3SE3A 3UTSB 3PDOB 2HG5A 1XF5B 2FYUK 4MNGA 2Z1PA 4YWGL 2PYFA 4Y4HB 3GG2A 1BXAA 3S3JA 2FGZA 1I75A 1HE7A 2H1PL 2LR4A 3ILQD 4GOEA 1EC5A 5KLVG 4KQ0A 3DUSA 1WS8A 1FGNH 3CVHA 3IMWA 2FYUD 3WY1A 4X4YA 5DJ2A 4PJGE 2OTLP 1UZGA 4PJIA 4JRYD 2NTFA 4UT9H 5HHOD 5KSUB 5KAQG 2WYHA 1P5VA 5E6ID 1LTTC 3BDXA 3E3QC 4JQXC 1XGYL 4L4TE 2NCMA 3NIGF 4K55A 3FUFA 1BAFL 4Z0BL 2DS4A 5KW9H 4HD5A 1F1DA 5I6NA 1AZRA 2WXFA 3Q8BA 3FF7A 3S34H 5MERA 3RTQD 3TV3H 2Y1VA 1J9SA 1F4WL 5C08D 2IXQB 5D1ZC 2PCPA 2QADB 4QXGH 1O0VA 2OSYA 5I9QB 3MRIA 5KYNA 5KSAB 3LHAA 4C4KO 3W9EB 3HUJB 4FQHA 4GT0A 1D5BB 1KG0B 4C56B 5EBMB 4JDZA 5C0DA 5I66A 2E7MA 1PD1A 2UY6A 2X4SA 3RK3B 4ZFOL 4MQTB 3B9KA 1BX2A 1ZJAA 3ZKXB 2G0LA 3AAZA 5HJ3B 2QEXP 4PGBA 5G4MA 2E27L 2VM4A 1XMWA 2JTDA 5KVFL 3KBHE 3AE7C 1Q1JH 1A1OA 3KPTA 2PMZA 3QUZC 4YBQD 3KGTA 3U7YL 4E9YA 5EEXA 3MRKA 2B2XL 3V6ZA 2A6JA 2E7DA 1BZEA 2YAQA 3IVKB 1GIGL 1WAAA 4HG4K 3L74D 3PHAA 5DCCA 1DTUA 2V2WB 3CSYA 4ODSL 3TH2T 1F90L 3QZOA 2FATH 3H32A 2ED8A 1U92A 4PG9B 5DJTB 5IW6B 3ZE1E 3LQAC 2NNRA 2FIKA 4PS3A 3M07A 3GHBH 1XQ4A 1EBAA 1NU1E 3HIZA 1JO5A 4X6DE 4K23H 4Z7UE 2P80A 3RGVB 1BM3H 2BP0B 1ID5I 5DR5L 1T3JA 1U8CB 4XPBH 3SE8L 5CEZE 2HMIC 1A6WL 2K78A 3SZ6A 3WG7B 5JHLH 3UH8A 3NSYA 2CLZA 3RFRA 3WN5B 2J71A 4QYOA 1C5DB 2M5AA 1KTDA 3BW9A 4P5SA 1A21A 3QK0A 1SHWA 3BO8A 4CC1A 2FQGA 2NPSD 3EJZD 3MLYH 2BLFA 4FFVD 1IVTA 5I1CL 4AJ0A 1A6PA 1R3LB 4XP6H 3V4VL 4L73A 2C3VA 5IIEB 1KCRL 4IGBD 1OAXL 4KI1A 3FF8A 3LDBC 4KZDH 4H8PA 2I7SA 3MDJA 4IOSA 3OKLA 3X1GA 1H8OA 4QR7A 1A6UL 1VZGA 1ET5A 3MNMA 4ZW7A 4AGLA 3WGUB 1FLRL 5ID0A 1ZXKA 2HCZX 4D9QD 1ZLWK 1PSKH 4CVXB 3C5ZC 1OSYA 1BBDL 1V54B 1D7BA 4UT7H 3Q2NA 1EEUA 2CPCA 4ANXA 3U1CA 4GNKB 4ALAL 4WI6A 2HT2C 4KGJA 5GZNA 3D7PA 3IRZA 3WUWB 1BF8A 3BVHA 2X4TA 4LF3B 4RETB 1IK7A 1ZEAH 4WWKD 2NUPA 1IX2A 5EU3B 1U95A 4NCDA 5AALA 1HHGB 2CLVA 2I26N 4DP6X 5HGGS 4C58B 3GLAA 3VRIB 4Z7IA 4MCYB 2FEEI 4X4XA 5T3XD 2ZKMX 4KRPD 4ICXA 4GG8B 5C7XH 4PRIB 5T3XH 1A4JB 1Z5LB 3C12A 1U33A 4D8PA 4XXDA 1JZ6A 1BD2B 1EANA 4M62H 2W59A 4X7TB 5CN1A 3CXHJ 3VXQA 1P2CA 2IGFH 3S5ZA 3QRFM 3BP5B 4DN3H 1R5WA 3D18A 2CBQA 1K8DA 3GNML 4XVTL 3V2QA 5TH2B 1JF1B 2F18A 1FE6A 1E6JL 1SJMA 2H6OA 1T7XA 1MFEH 4G70B 4QXUH 1P4BL 1T0NB 3VFNA 4WUUE 3WS6C 4QKTA 1YEHL 1UM5H 2LXBA 2X05A 3CDYA 3VFRB 2HT3C 3SY0B 1UXWA 2A4ZA 2EDBA 5IT2H 4PIBA 5DT1L 4JM4H 4HWZA 2VO8A 3DWTA 3U2SB 1OZHA 1RU9H 4LL9A 4J3TA 5J6GA 3EO9H 1PPJD 1X5AA 5AAMC 1WF5A 4WHTA 1E3FA 2GKIA 4KT0J 2MFNA 3JYBA 3K72A 1MDAA 1EZVG 3AABA 4NOBA 3CXFA 5D70L 4HCFA 2I9LB 2ZKHL 3PGDB 1A1NA 1AV1A 4BSJA 3GGWA 4WU7A 1S7UB 1OTSC 4IOIB 1RIVL 3TWCL 3L4YA 2G75A 2W0LA 2WKLA 4S2SA 3ZHLA 2LVCA 4JAMB 1CSBA 3IGAB 3IJSA 1W2KT 1YJNP 1Z5YD 5DZOA 4BQCA 3H9SA 3GSQB 4KK9D 1TCMA 2B1OA 2VLJB 1JNNH 4Y5XA 1OVUA 3LHPH 4KI5F 4X6CF 5DD5L 2XVBA 4Q6IA 3N91A 1FE8L 1QR1A 3DJ9A 5JUEH 1LP9E 1PIXA 1WHPA 4GUOA 4GUQA 1OL0A 1AZCA 2XVGA 2P58A 2VLLA 4AVKA 3L3GB 3TGUD 1NCBH 2M2DA 1WFIA 5F1SA 1T8ZA 5MEQB 5E8EB 4JFHE 5EHFA 1MAMH 4WY7H 4O4YL 3EJSA 5D93C 4W6YB 1PGJA 2C3HA 3W9DB 1NFDE 2XWRA 3DSNB 4ANUA 4BKLB 3E6HB 3R1GH 4Z7QF 4YK4B 3KYNB 2YBGA 3NSFA 3GSRA 2ZCKL 2X2HA 3HG1E 1J1OL 4N8CH 4FS0A 2B0SH 4PD4J 5DK2A 2F54A 3KWWA 3RK2C 4X50A 1RZFH 3TNMA 4R2GC 1ZDSA 3BC9A 1VGKB 1NTZE 3LZPA 3QQ4A 2A83B 3WNIA 3L3DA 2OPCA 2JCCE 2G3AA 1S3KL 1ZJBA 1J87A 1QD0A 3LIZH 3TFKC 1P0SE 1ZLDA 3T2NL 1XD1A 4LE8A 4U1HA 1TQCC 3MLXL 1FDOA 3FO2B 4BE5A 1IC5L 2XXFA 3K6SA 1EVTC 3H9SE 3OC5A 4F3FB 1ZE3H 1QI3A 1OAKL 2H0FA 1MHPH 4AEHL 3BAXA 1DJSA 4L3EA 1ZE3C 3THMH 1NPUA 4JRXA 1KB5H 2WXLA 1K8IA 1BJ1H 1FFPA 1UJ3A 2GHZA 1T2QL 1OGAA 3FQTA 4IYKA 1U6AL 4YXWH 3AUWB 3P0YH 1NC4B 1J05A 4IKJA 4ZPVA 2OJZH 1SQMA 2BOBB 2YARA 2YXRB 2OTUB 3EYOB 1PNDA 2NUTA 4JY5H 3TONA 1X5XA 5DTFA 2NW3A 3MRFA 3O9WA 3I75B 2V4LA 5FM4A 3RL0g 3VGGA 4U31A 2W6JH 2FEDD 1FVDB 2JWYA 4HS8H 4JCLA 4QI3A 3RY6A 4X9YA 3NYKA 3I9PA 4BFBD 4KZCA 4DEUA 5IHUL 4GO6B 1RPUA 4U1NA 1FSKB 3F5WB 1DBJL 4AYGA 4HX1B 2BY2A 3SD2A 2O6CA 1TO4A 1R6VA 4PJBE 4MCMA 1P9MC 3VU2A 8CGTA 1OV8A 4CN6A 3CC5B 4HSQA 1KEGH 1PNCA 4ZG1A 1LO4H 2NUTB 2OR9L 4KQ4H 1RE4C 1WFJA 2GSIA 3DX4A 1BGYD 2PETA 3HAEA 3LS4L 5CD3B 3P77A 5EU6B 2DZEA 1BSNA 3L81A 3PFUA 3MLPA 1RF0C 4P07A 5ACZA 5EEWA 2COVD 3DX9B 3UTSE 1HC1A 5AVVB 1I9JL 1N7SD 2A0LC 5CXPA 3LIUA 2DM4A 5D2LF 2FYYA 1N70A 1CGVA 3SGJC 4U6XB 3A23A 1AXIB 2UWEF 3BSHA 3WAJA 2QGDA 3OKEA 4NQEB 4ZUVB 3TBBA 2W0FB 3TEYA 3WKPA 1ED3A 2Y5EA 3BAEL 1C08B 3TZVA 1TZIB 4FQ1L 2QVFB 1LMIA 1OCCB 4X99A 4FXGA 3WNPA 1NLDH 3L3HB 3OXRB 3UG4A 2CK2A 3L48A 4M7JL 4TQ8A 1D3CA 3UTSD 2F19H 4R8WH 1IJ9A 4NC0B 1YYCA 1AO7A 4TLUA 2O01H 3EJUA 3AG2B 2P8MB 2CUAA 3NSJA 3TF5A 4EIBA 3TVMC 4X9GA 2WLJA 1T03H 1AGFB 1HWWA 3FUHA 1QSFB 1B0WA 2AV7A 4PY7B 3EH5B 2ATPB 2GAZA 4K5MA 2JXMA 5F7KC 3PH0A 2PXYD 3K2KA 5IQLA 1FFRA 2O6PA 1FAVA 1YQ4C 3ZRFC 4ENEC 1BMWA 3H25A 4N2BA 2OMWB 1L0LD 2KT6A 1OE1A 1NC2A 1G6RH 2IGLA 3JWNG 1K5NA 4LKCB 2XPGA 4PRAB 4NZDA 2QKIA 1F02I 3QIUA 3VP8A 3MHVA 1DFBH 4EIZC 5BO1L 3D6ZA 4OT1L 3TZVD 3ILPB 4FQ2H 4K7FA 3U4EA 5L7XH 4NZJA 2YS4A 4XMXA 4UTCA 5I76A 1K2DB 3BZFB 4UYQA 2YA0A 1ZXQA 3FU7A 1EGJL 1R17A 4KJPC 4YK4C 2CK0H 3M06A 4G6JL 5E99H 1JCKA 2DLGA 2QPDB 2WLIB 1RZKH 4AE0A 2VERN 1LL1A 1PQZB 4ADIA 2WWMD 1TQTA 2P42B 3QVAA 3RIFF 5A2BA 4JPQA 3PJSK 3ZLQC 4TLTA 5I1JL 5HJGA 5HDBF 2X87A 3CC1A 1T1ZB 2GTZB 3TPUB 4ZXBC 1RHHA 1NPJA 1HXMB 3JTTB 3FQUB 2HMID 1FCGA 1YNLL 4NZTH 4HIHB 5CIPA 1RE3C 3M1BB 1X9VA 4RDQG 5I23A 1S9XB 1E4KC 2WD0A 3ZY7A 4N0UB 3RVWD 3VXSB 1I7TA 1UFUA 5AVZB 4JFUA 4JR9L 4PD4D 3P4LA 3MA9L 3NDYE 3NRFA 4LSQL 3PLNA 3VD9A 4GAJL 2VZTA 2AXFB 2BSSB 2IBZX 3NTNA 1FORH 2GFBA 5HPMA 1JY3O 5F6HJ 1BZ9B 2D0GA 3VW3H 4PPTA 5ITFA 1A8JH 2A06G 3BKML 4P2OD 1UWGL 1U2YA 1L3WA 1RHFA 5AZ2L 1FRGH 1NA8A 5DQJB 1TLMA 2CPBA 1HYSD 1W91A 3LDBB 4JQVA 4M6MH 5JPMC 5LDUA 3GO1L 3K72B 2L91A 3MODL 2JR8A 4DQOH 1PF3A 2POHA 4XH2A 4IRJC 4ORGB 2ZT9B 4CADA 1M7DB 3GSWB 2VWEC 1XGQB 4X9FA 3UTQA 2WAHA 4OFPA 1N59A 2X6BA 3DXAE 3E1IA 1KY7A 3D3VD 4FA6A 3F83A 4L18A 2XNDH 2VDQB 1F6AA 5CP7B 4ZO7A 4JDEA 4P3CL 4PV1C 1DANU 1JN6B 2RA1A 4KKBC 3UOAB 5K9OB 1WSST 2XN0A 1WT5A 5L6YL 4HOWA 2EDOA 3TJHC 4FHJA 4AG4L 1DD4A 1JZIA 5C2BH 3W68A 1DH3A 1I8AA 2C9UA 1E8XA 2FYVA 3DYMA 4LEEA 2CUHA 3KPOA 3QEQB 3P4MB 5F1OB 3ALWA 3VMNA 1S78D 1ODUA 1SY6H 3HZKA 5EO1A 3PIQB 1OX3A 2O4EA 5D7JD 4PJ5B 1P84H 1QAWA 3H1HG 3KDMB 3KPQB 3AXHA 3MLRL 3VGFA 2G3MA 3E8VA 1BE3E 2X4TB 2KLRA 1QQDA 3ETSA 3FO0H 3L45A 5D7LB 1YNTF 1KCSL 1UM6L 3P30L 2VMEA 4N8PA 4Z76B 3VXTA 4WI4A 1JCCA 3GXDA 3GRBA 3MYJA 1IFGA 3GB7B 3UEZA 1FVCB 1A7OH 2J7LA 1MCPL 2JWAA 4X4XB 4WNQA 3QUYB 1SOXA 4NKOA 4QJ5B 1QRNE 1JOIA 3EO0A 4E0RA 1EQWA 4PI0A 3ESMA 1TZHB 4AQEA 1BQLL 1QATA 3OF6A 2Q7YB 3LOWA 1DEEA 1MCBA 3SCMC 1SFHA 4HPYL 4HWEL 5HVHB 5IHZA 3H6AA 3I55P 1MI5A 4JDTL 4UZGA 3FN0L 4PJEE 1HINH 2A77H 4Q97A 4LVEA 4XBEH 5D2NE 2KSEA 5CR1A 1A2YA 2XTJB 4EI6A 1W2EA 4LU5L 5HHVH 4V1DA 5I8CA 4M3LA 4ZKUA 1URLA 1H15B 4GEIA 3K6DA 4KK8C 4LSTL 2CO7A 1JWUB 2DWEA 3USSA 1QBMH 2R4RH 3KS0H 1YLBB 4QTHA 3B5ND 4KO9A 1E8ZA 1NHLA 2PP8A 2X09A 3CBRA 4UDTA 4UUJB 5C0EB 4MS8C 4M8VA 1MN4A 3VM5A 1JTOA 4KK9C 1RJYB 4JZOA 2GUSA 3P4NB 3PABA 2ZXQA 3PPEA 1C5DA 4EI0A 1G6RA 4OLXH 1VFAB 1HHKA 3WOVA 1E67A 2QQKL 1M7UA 3R2PA 3OB8A 5DJUB 3GMAA 1RE4A 1JGLL 2YA2A 3EJJX 3IN0A 3IPFA 3MJ7A 2IQ9H 3QQ4B 4LOFA 2QV2A 4NO2B 4QCIA 1G0YR 3DK2A 2FT7A 3OAWA 4LSUL 1H8SA 4M5TA 5C0GB 3EZJB 1CLYH 4WW1A 3HG0A 3V2NA 3KJ4C 4B5EA 3QB7C 3BN9C 1HJ0A 1U8JA 2RB8A 3E38A 4LVHC 3QDGD 4PG9A 4YSEA 4EN3B 5HGHB 3NMEA 1NBYB 5EO0A 4OCSL 4LAQL 4X98A 3TYFB 3POCA 1HF9A 3ZL2A 2OZ4H 3GS7A 3GW6A 5DFVD 1JPGA 3C9NB 3L72E 3MRKB 4HJIA 3V6ZB 3LKRA 3ZYOA 1QSEA 2FUQA 4XO4A 3NH7H 4H8UA 4MXWL 1ZMYA 4JFZH 1M8OB 3NZ8B 4BFJA 1X0TA 5F7FA 5MEQA 2IBZY 1F11B 2JO1A 5C39A 2FATL 2WZ7A 1YJDC 3DI3B 3HD7B 4L76A 3GHEL 1XB6A 1AXSB 4S1RL 3ULVF 4Q6IB 2R56L 4HWNA 4J8RA 2X53A 5D1ZB 4WHDA 4QMAA 5KG9A 2K1MA 1O5DT 4ZTEA 4NUPA 1M6UA 3MNVB 3LRSA 4EKJA 2Y22A 2Q20A 4WI5A 2IXQA 3WNOA 2MIZA 3QCVL 4OD2A 2YGNA 3MTXA 4KHXL 4MDRA 1SDAB 3RURA 3TC9A 1KUMA 1SEQH 2PTVA 3QUMB 4XNZB 1JPFB 3SPIA 1T04A 2ITAA 4HKBB 1A6TA 1U8LB 4ELME 1E5ZA 2ZWZA 4Y19D 1NAMB 2QKIC 2HH0L 3D0VA 5I1GH 1W0WA 5I1JH 1KORA 2ZCKH 5H2FH 3LEYL 3OGOE 4C8XA 2JKWA 2J8UF 1PG7W 5ESVA 4XBGA 4HULB 5JW4R 1NFDA 1CC3A 4WHCA 5F9OH 2GBAA 1FLRH 2Z31B 1OAQL 3A4DA 5C0IA 3IXAB 3WNNA 2IWFA 2AFNA 2NZ1A 3LKPA 3P9LA 4KZEL 5AZEL 3QO0B 4JCMA 1AFVL 4PBXA 1IAIL 1OGPA 2DLHA 1CLOL 4U3FG 4Y4FB 5C0GA 5I6XC 3H3KA 5EOTB 1YEFL 5E9DE 5TE6L 5D72L 2HLFC 3L70D 1NO4A 4H26B 3MNWA 3KPRA 1W15A 1N26A 1URQB 2O6DA 3IMRA 3W67A 2Z8RA 3CLWA 4IRZL 3WN5C 1RE3A 1KCSH 4DPCX 5EZIL 2FJFB 2M0BA 3IK2A 4WTQA 3W11D 5DJXA 1TUPA 1LD9A 2F5AL 4UDTB 1V3MA 4FGMA 1NTMG 4Y2OA 4Q6YA 1NMCC 1KFMA 4YHNA 3WV0A 4DKFH 1HXKA 4LBEA 1AGBB 2AK4B 3PWLB 4XOCA 2WUCL 3WHE1 4OCXH 2AXGA 4U1MB 1FFNA 5IQOA 3L95A 3L1OH 1DCLA 1H19A 1VA9A 2BY3A 4OCMC 1A4BA 4K3JH 2IOMA 2GB2A 3V0DA 5IVOA 4LARH 4ZS7H 1Q0EA 2HSIA 4XNDA 3VXTB 4FNUA 3ARFB 5SWSB 3O8XA 5EF0A 2A45G 1EEZB 1EFXB 3DX8A 1L9NA 1MFDH 1ZDQA 1R5VA 1ZHLB 3A6BH 4N3TA 4S1SL 4Y2DA 2ICEB 4C57C 4DOHB 1FZCB 3M6DA 1EXHA 1GMJA 1AR1C 3OLIA 4I7ZC 1U91B 3UAFA 1UEMA 4U1NB 5BV7H 1S6NA 1WRGA 3FTZA 2NZIA 3OAYH 1MFUA 1YUKB 3AT0A 3QORD 3RDTC 5H35A 2ALAA 4TVSa 2ESVB 5KWYC 3DRTA 2WSFJ 3MBEC 5KVGE 1KLFA 2VLKE 4UOJA 3SJVE 3CX2A 3MLVL 2E76D 1IBBA 1ZR4A 2UXVA 2I9TA 4LP8A 2GIXA 3ALXA 3L3OA 4Z7UF 4B60A 1GMEA 3ZE2E 1O7VA 3HC3L 5CLXA 1AYOA 1AXTH 3F89A 2BOLA 3AREA 2IFFL 1KYAA 5ALCH 2YFNA 2QE7H 3PHQA 1XD0A 4S0TD 1AHKA 1UUNA 5CCGC 3CTTA 4FRWA 5E6IA 3SDYL 3WL9A 5B22A 2YAMA 2OR8A 2Q1EA 3I6GA 5KOVC 1NBCA 1R3JA 2WGNB 2XTJD 1UH2A 1LNQA 4LVHB 3GC3A 2ZJSE 3LKPB 3P9LB 3GZOA 4LK4A 1GOGA 1M7DA 3GSWA 4FFTA 2KS0A 9CGTA 1MRDL 4R7VA 4L23A 5BRZB 3V0WL 4BZ1A 1LT1A 5HDRA 1KB5A 1RK1A 2WTPA 3RA7L 3O4LE 3BH8A 3C08L 4H0LC 1Z1WA 2DLFH 1XMEB 2ZP9A 3D33A 1T80A 3O6FC 5F9WB 2EH8L 3ZBMA 1SQVG 4JL2A 4AEEA 4P5TC 5C0JB 3OW2O 5JW5A 5GGQL 3S4SB 4PRPB 1S5LX 2E5EA 3FB5B 1PZQA 3UTZB 1QSEB 1Z0NA 4G42A 2J1WA 5E9DB 5IB5A 2PPCA 3H1JJ 2XWBA 1VJSA 4J12A 4UYPA 4EOWH 4GRLB 4HIIB 3SKJH 3TNNB 2E7CA 4EI5C 1YBKA 3HLAB 1G9EA 1SJEA 2AXJA 2MCPH 2ARJB 4RNRA 3S8FB 2NY3D 3LZNA 3BT2H 4X80H 5DJZA 4EUPB 1UUSA 1JCVA 1SQPD 2FIRT 3FT4B 1KYOH 2CKNA 4OZGB 1DBBL 3AECC 1MJJB 1DVSA 1NCAH 3F6LA 2DAVA 2R39A 4E2OA 3TDKA 2VZ1A 3RGHA 3K5RA 3Q5TA 4RFOH 2ZCHL 4NZRH 3VXMA 2QHRL 5CILH 4BELD 5E08L 5I1DA 2YPLD 4ONFH 1S7QB 1GHFL 3MFFA 4OFQA 3FYIB 4OZHE 3V5KA 4XNXL 3GIZL 2NRDA 1A14H 5AVSB 1XCQB 2CO7B 2DWEB 3RE0A 1SQVD 4KAQL 4DJGA 4IMKA 4B7IA 5B4MC 4D9QE 3AEDC 1DDTA 4TSCH 3OX8B 4JFFD 4WV1A 2EE0A 4XI5C 3RG1C 3WTTA 4PB9H 3OL2A 4DKFL 3B5NC 3PABB 4R5VA 3QIBD 4U1JB 1OSZB 2HPCA 2WSPA 2BVYA 4HW6A 4KXZI 4YDVB 3SJVD 1J5IA 3K74B 2V7HB 1USDA 2CPUA 4MJJA 5C6TH 1C08A 3TZVB 5AOJA 2YPKB 2OYHB 1IQWL 1HKFA 4Q9QH 1F86A 1N9PA 1AZNA 2JI3A 1DBJH 3GMOB 3L70J 4GRLD 4L1HA 4GP8B 1ES0A 35C8L 5F7BA 9PCYA 1RF1A 3D3VA 3BPNC 2HT4C 4D0CA 5GS3A 1MY5A 5KYWA 1GCFA 1Q72H 5E4OA 1U58B 3KYKL 4M9OA 5DVPA 3WJLC 4HXAH 1UXWB 4DQOL 4DPRA 3IAGC 1N64L 1DQJB 4DWHA 3O4OC 2XZZA 4UU9B 5CCGD 1FH5H 3FTXA 4I4WB 4U3FD 3NFQA 3EH2A 5ESQB 7PAZA 3PIQA 5DHVH 4R96B 4WI0B 1JAEA 2TSBA 3D25B 1SQXG 4DP1X 2Z93B 2OM5A 4BQ8A 1M53A 4HS3B 4Y8DC 5KVEH 2ADYA 4NUMA 5HJBA 3WKYA 2J57A 3BZ4A 2A9MH 3FU5A 1Z66A 5IWLC 4TUJA 1PZ5A 1SDDA 2XY2A 2VB5A 4R0LB 1HDMA 4FXKC 4RAVA 3UROR 2IJ0C 3OZLA 2ZCLL 4DSYA 1DSFL 4XOAA 4R90H 2GC4C 5HY9B 3AADB 3IVKA 2OMVB 4OTXH 5E2WL 3B83A 3D0LB 4MRBA 2UXTA 3UG3A 5FA3A 1YQVH 1JGVH 4AJWA 4CC0A 3KR3L 4R83A 1AI1H 3UMNA 5F9WC 1D9KC 2F7PA 1P7KA 5EC1A 1YCSA 2DQJH 1NIEA 4IMLB 3G5ZB 3BN3B 3KE0A 1QFPA 1VRSA 4W4NA 1F3DH 4P5MB 3LRGA 1W16A 2HVBA 4XHJC 4ZMLA 1KV3A 1SQPE 4ZTPL 1U0QA 3MKKA 1RZGB 4HP5A 2YKKA 2HTLC 2HXAA 3RX7A 5JO5B 5IB3A 3IJYA 3MRJA 1UENA 3EGXB 4OW6A 4TN9A 4CRPA 2ESVD 2KL6A 3KEDA 4FQ2L 5C0CA 2OYHA 1HZHH 2VYRE 5KN5A 2ADFH 5CGBA 3SDDA 5E8NB 1DZ0A 3QA3B 4LRNL 1E28B 4OQTA 4KX8A 1PLBA 2X89A 1W72L 5HDBB 3I2CL 3P2DA 2N7SA 4M4PA 4P5TB 4FQCL 2ENPA 4N2CA 1IE4A 1YPZB 5JDSA 1M56B 1KWKA 3TBTB 3EO9L 3RTQB 3FU0A 3N44F 5TGBB 1BV8A 2ZSWB 1W8OA 1YDPA 4LQFL 4PR5A 5DMGD 3KZIH 3TCTA 1W6LA 1LGVA 2FHFA 2VW6A 2YUVA 2DYRB 5FFGA 2W07B 2FEJA 3Q1MA 3NFSL 5FO2A 3FHQA 5TQ2H 5B3NA 5L2JB 1JGLH 3VDCA 5KTBA 3CVBA 1L6XA 2X28A 5IW1B 1NEZA 2XN1A 4L1TA 5DRZB 3FYEB 3LNFA 1S5LH 3EDKA 5KTEH 1N8ZA 3FWNA 1AP2B 4X5LA 2OMYA 5EZOH 3CFIC 1G7HA 2VISA 4NQUA 4PYGA 1KGXA 3BLKA 3NPSB 3JWDL 4G9FE 5ELIA 1FC2D 2CHNA 3Q9QA 1LE9B 4LO9A 3UO1H 2HAZA 3H1HE 4UILL 5DFAA 2R0LH 3DXAD 4XNZC 2XKUA 4P99A 3GHBL 4JFSA 1I1AA 4HXBH 4NPYB 1SJEB 3FT1A 3X1NA 3TEXA 1S7VB 1NH6A 1WTGT 1II4E 5BRZA 2V8MA 1SQBG 1EHLH 3F7VA 1IM9D 1KNOB 2W65B 3JBG7 1Q7YQ 1JK9B 3T6XA 1EZVY 1G7HB 2VISB 4ZTOL 4F57L 3L3GA 3IGAA 4N1EA 5KSVA 3FB8B 3O41B 1MFAL 1I8KB 2CHZA 1S9KE 3M17B 3QO1A 3WLWC 3WDIA 2W9EL 4QHNA 4W9EC 4JQXA 4AMXA 4BWNA 4TM9A 4KZDL 1M2VB 3HMXL 4MMXA 1KIUB 1I1FB 3CN2A 3EJRA 4I9WD 4UQBA 3GSQA 5FCUL 4TNVF 5KSUA 4XCFH 1KILA 1ZA3A 4TQEH 1VFMA 3NSDA 5TPWL 1KYDA 2NY3B 3OMIB 5FYKH 1NMAL 4WW2B 1CD0A 1PIGA 3HC2A 3BVNB 4DUXA 4GG6F 1R3KA 2HKHH 3B9EA 4QO1A 3TGUE 2BZDA 3G5ZA 5IUSA 2B77A 3B5TA 2WNWA 1WO2A 1Z3GH 3OJDA 2MH4A 5LBSH 1YSOA 1J5OL 1WCBB 3C5XA 1UZ6F 1U8QB 3BKJH 4KOBA 5FGBA 4F20A 4PU2A 1BCCD 1AKJB 4HUXA 2F5BH 1DQDL 3FTGA 4XTRC 3VH8G 5E1GA 2MNUA 3KLSA 3VE0B 1S7RB 1AH1A 4NPKA 4NI3A 1HAWA 3DX9A 4HGKC 2AJVL 2BNQA 4AC2A 5JMRA 2CO1A 4NP4H 1KXQA 4D8PB 4WWKC 4A7GF 1S7TA 1JPEA 1JIBA 1ZR2A 3NCJH 5TD4A 4BKTC 1FJKA 1ZHKB 1DN0A 1L0QA 1DD3A 1VQNP 4NQDD 3UBXB 5IF0A 1L0NK 3QI9B 3GS0A 2FJGB 43CAA 3NIFF 5IHWA 4R96A 5GTHE 4UV4H 3MQIA 3FT0A 4K15A 3ZDZF 3BAIA 3D2UD 4QNPF 2QVTA 1J05B 4MWFB 3QDAA 3V10A 3F6JA 4AVIA 3V9FA 5EF2A 3HLKA 2F6AA 1WA1X 3CBJB 2IMMA 4YPGA 5E5UB 4OAWB 1G9MC 1HDMB 1RU9L 4DF9A 1AQ8A 4PD4I 2DMCA 5GS0C 5IW3A 5F88B 3PJLA 1F1GA 2Y5TA 5FUCE 3T1FA 5IR1A 2V7QH 1N67A 3ARFC 4YGAB 1K04A 5ILTH 5CF3A 4CC4A 3W2DH 1KXVA 4CAGA 1BGXH 1MWOA 1Z7JA 2H9GB 4JEGB 2NPSC 3EJZC 4TVPH 2NNXA 4XXCC 5F0MB 5C3TA 3U0WL 2BOBA 1XSOA 1EX0A 2OW6A 2DWYA 5H2BA 5FXCH 4EQ2A 3AREC 1TQUA 4EN2A 3LEVL 3O3DA 2GUOB 1UB5B 3KZ8A 1JF6A 4R2GD 5C09D 4CGTA 4G82A 4QHNB 5AQ0A 1MIML 3BPCB 2F74A 5GGVL 7PCYA 1UH4A 1E27B 4CMMA 2PO6D 2K3TA 1MCOH 2A3TA 1EEYB 2OZ4L 3VXSD 4W9HC 5E2VH 4MD5B 2OYIA 5FHBH 3H7LA 3QUYD 5CKGA 2VLMD 3NJNA 4NENB 1OT1A 1Q9WA 4HKZB 4QRTA 1JZ4A 1AOZA 4L1LA 4DGVH 4JKKA 2NT1A 5E79E 3KYAA 3RZCB 3DMMD 1LWHA 4NUGL 2PGDA 2HPTA 4Y9EA 1GSMA 3II2A 4IK6A 5E03A 1GS7A 1DSWA 3FXIC 4RMUA 5F7EH 5FYKE 5ANMA 1W0WB 4Z3FA 1GKEA 5EEVA 4X83A 1J8HA 2XG5B 3MBWB 5E23A 1JGEA 4OLYH 3WUUA 1ZHBA 2A4CA 4QRPD 5HJ3A 5M95B 3CXHE 1AQTA 4J3OC 5FM5M 3RPIB 3NT0A 1PG7L 2C9XA 1OF2B 5AFAA 2C9SA 1HT6A 2YRZA 4WUKL 4FAAB 3I6KA 2FVNA 5F93C 5T5FL 4AXWA 2Q3XA 2BWQA 1NU1K 4M5SA 2WJ7A 1KACB 3PP3H 5G4OA 3VTTA 2BHUA 1TZ8A 3IKCA 3KLHC 3MRQB 4XRCB 5ECGA 1P84J 2ITDB 1E65A 5K69A 3ZMRA 5FW7A 1HI6A 1SFCD 4FOMA 1SFCC 1NU1D 4LSSH 5AZEH 1KV7A 3HD7C 2NY1C 4PLKC 4KY1L 4EEEA 4EOWL 1CFTA 3VACA 4JFDA 3NBNA 3UTPE 4KXCA 2NSQA 4F1ZA 3W5MA 4KVNL 1HXYB 4DN4H 3IJSB 3KPSD 3FT3A 4UINL 5E1AB 1WAPA 2HTKD 3SSUA 4AGMA 4M1DL 4R5TA 5MHSE 3KPLB 4HWZB 2WPVB 1GXEA 2AK1L 2QBWA 3GGWB 15C8L 2IAAC 3ZMNA 2J55A 4ZW8A 5KVGL 4L3AA 2Q1KA 1X44A 1BQ5A 4J3OH 1I9RH 3SGDI 4OZFH 5GZND 3ULVL 2WO3B 4ICWA 3B2UC 2WNKA 3PDOA 4PW3A 1T5WB 4ONFL 4ZBJA 2MOQA 2AJVH 1UGKA 2GITB 5DVMA 1SF3A 1V8HA 2D31A 1F3RB 4K3HA 3SE4A 2K7PA 4PCSA 2EXWC 4X7FC 1EJOH 3P9MA 4D9LL 2X1OA 3MV9A 3SWKA 5INDA 1KILE 3UZVA 5GRUH 3KBPA 3DV6A 2VJ8A 4KGLA 4W93A 2BP5M 3SPVB 4RAUA 3BGFB 1X4YA 5HVHC 5I74B 2YO3A 4PWFA 3WL9B 4NRXA 1E9QA 1LXMA 1EZVI 4JPSA 3KM2A 2VLJE 3VUAA 1ND0A 3HPJB 5HDBE 3IPBA 3FSAA 4FTVE 3VRIA 1V3JA 3C60D 4LCVA 2NPSA 3G4SP 4XXCA 2OXHB 3TO4C 1F4XL 3WEXB 1XHHA 2OMXA 2K1AA 4UM9D 1G7QB 4UUJA 5C0EA 1UOWA 3LZOA 5TF1L 1QMUA 1QZNA 2FE0A 1KFGA 1LK2A 1MLCB 2XETA 3QUMH 2F08A 3HKZA 2V37A 4TUKH 1KJ2H 4J1UA 5KJRH 4PJ0E 4OF0A 5D96C 4IBUA 3W81A 4P2QE 1CB4A 3DHJA 4PRDB 1U8OA 2GJ6B 3O3BB 2DKSA 1GY1A 1DQQB 4DPAX 4G5ZL 3U0PA 1N5YH 1U8IA 4MMZA 1VLXA 3O3BA 2ITCA 3QXVA 3QDGB 4JKPL 4X0KA 5CEZD 5FHBL 3B6SA 2CLZB 3WN5A 2P8PA 4P48A 2DQCH 4NQSB 5E4AA 2NOYA 3EGSB 4ZD3L 3GBDA 5JOPE 1UOLA 4YVUA 3ZDZB 4IBWA 3SQBA 2WXJA 3GMLB 1DVZA 1B3IA 4TNGA 2UZYB 3RU8H 3OKLB 4OU3A 1PL5A 4NYLA 2DMKA 1JY3P 4NXSA 2AJSL 4YPGB 1BFOA 2GSGB 4M3JA 4Y2OB 3QZBA 2VN6A 2WXGA 4I2XE 3A4AA 4X9BA 5D1XD 2ATAA 4EKXA 3TGUG 1LTJA 1OGTB 2D31B 4Z7OB 3WIIL 2EABA 3HZKB 4MB5A 4G5AA 3BO8B 3MD0A 3L72D 1S9VB 2XKNB 4GO9A 3SDXB 3P69A 1L0XA 4AQ8A 3PWNA 1CFMA 2WZPD 2WANA 5MI0C 2IBZE 3IR9A 5KLIC 3HBQA 4LB8A 3RVXD 3SDDC 5KSBF 1QRND 1QL1A 2GVYA 4F7TA 5HDLA 4L8BA 4QXTA 1Q86Q 4I87A 4WUKH 5HHOA 3NIGE 5ESAA 3AGVA 2D3NA 2YD0A 5KANI 3ABGA 4APXA 1JPTL 4H8WC 5EBMA 1YAIA 3P8CD 3EJYC 3SGJA 1NFDB 2QQNL 3L2MA 2EVGA 2FH6A 1OTTC 4UWQB 2IVFC 2Q8AH 3NIFE 3MJGX 3HBPA 4FEIA 1SNRA 4DZOA 1A6AA 5FKAB 1MQKH 4YZFF 2ZWYA 5FGSA 4F7EA 3SBRA 1JV5B 3T0EA 2AQRA 5LN4A 3L54A 1JJUA 3MR9A 1OQXA 3ZT7A 3B9KB 4DGVL 3CVDA 3D48R 1DP0A 3QYCA 4C56A 4UV7L 3WLWD 5GGSB 5GZNC 2Y07L 4ZAKC 4KJMA 4A67A 1RY3A 4LCUB 5JIPA 3QH3B 4CJ0A 3ME0B 3VFTA 3G6DL 2ITDA 2MKWA 2VXUH 2A6KA 3QE5A 3UO8B 1EZVE 1CT8B 3MJ6A 5IESL 4OIBA 2NXZC 3BQVA 2NPLX 4MNGB 4W9DC 1SQBJ 4IBYA 4UDUB 1IZNB 3V0HA 1JK9A 1ZIAA 5AKSA 1DR9A 1NBVH 1JPST 3ETBF 1HSBB 5I82A 1CFVH 3SKUD 3U4BL 1MJ7H 1ZN5A 3LSOB 1PQZA 4NM4H 5AVTB 2VR3A 1TYEB 3PAVA 3BPLC 3QYMA 1OOWA 1T66C 4JUSA 3FN3A 4PJHA 4UTBL 1RZQA 3V79C 3G7TA 3LW5H 4XP9H 4E5XA 3MV7D 5AYUL 3T65A 2D4DA 1F3DJ 4NQCA 2QVMA 1LWUB 5KAFH 1ZLVH 3MACL 4PLNC 1MY7A 2BP8A 3C2SA 4PJFF 4PVNA 1U91A 3L73J 4Z3EA 4NQSA 3S0PA 2BVOB 5D2NB 2NQCA 4HCRH 5DS2A 1KGWA 2OMWA 4JFXB 4WEUD 1FPTH 1CG9B 4PS4H 5DEFA 2ZJSH 3BUTA 3LVTA 4PJ8B 2EIEA 4JGMA 1RZPA 3DLQR 2ISDA 4DT2A 5DEGA 3S6CA 4PTUA 2UX7A 2XWZA 2X4OA 1CZ8L 2AJYL 2BVQB 3FQWA 3O0RH 3CN3A 3P3UA 3QNXA 2ORBL 4M93C 2XWTA 4AEFA 5IQ7L 2HJLA 2XFXA 2O5NA 3GSNA 5GS2D 1HINL 4YVNA 5E6ZA 1GW3A 3KR3H 4XCCL 1JHLL 3WUZA 3L72G 3NRPA 4M61B 1S78C 2LU7A 3HNTL 3IETB 2NT0A 2W9LA 1AG6A 3JVGC 4NNYB 1A7RH 3FH7A 2FT8A 3NQIA 1SJHB 2C4FU 1D7DA 3IDXH 1DN2A 1GR7A 2Y1YA 2AJSH 2NPSB 1AD0B 3P8MC 4BA8A 4DCQA 4TNWF 4XCEB 3AE4C 3MRGB 5D7SH 2L7JA 5DZVA 3L08A 3RVVD 2AQPA 3GMMA 1UIIA 3PDGA 1T1WA 4M1CC 5FM5O 3DOSA 1LEGA 3NGBB 4MWFA 1OTUC 1IFHH 3CFKB 1FFOA 3HTLX 4G9DA 2DYSB 4NT6B 2LV4A 3V9EA 3EF7A 2ZYGA 3ZHFA 1FZOA 3NJKA 3T2PA 4O02A 3L3IB 3UEQA 2DRUA 4D0DA 4X2UA 1XT5A 1YJDH 4GKSB 5CIPH 2QVIA 4L29A 2CR0A 4A66A 1NC4A 4B9ZA 1YY8A 1E2WA 4UIMB 4Y1SA 3PF2A 1UWFA 4DZBB 1JZFA 2IPPA 2F53A 4JO8A 4N2OA 5CCKH 5IEHB 1E5CA 1HNGA 1UJTA 2VDNB 2B3IA 1ASQA 3L75E 2ZD0A 2VAAB 5CJOL 4FP8L 4U33A 1GL2B 3AXIA 5ICZB 4JPWH 2BASA 4I6MC 2HRHA 1DLFL 2PYEA 3F12B 4I1RA 2XDJA 3VRLE 3U6XS 3LIEA 3SCMA 1T0OA 1PLCA 3KL5A 3L2NA 5F89A 5L4IA 1BE3J 2BP3A 4DPBX 5EZJA 3OJMB 4LEOB 1OHQA 5CGTA 5DQDL 3FRPG 1NGQH 1KELL 4QRQB 1IC7L 1CL7H 3QO1B 4ODTL 4OLWH 2IQAA 2MCMA 5KVMC 3RHWF 1CYGA 2EE9A 4XVSH 2LGNA 1T2JA 3D39E 1LE5B 4PJ5E 4HZLA 2I85A 3KLAB 1KNOA 2W65A 3AT9A 3TGXA 4MJID 5AUMA 4PJCA 3D70A 3MV9D 4GQ9H 4DK5A 3T08A 5D1ZD 3L74G 4ODXB 3BVUA 5CFHA 5EUOE 1BAGA 3EUDA 1I8KA 1K73Q 1H0TB 1BZ7B 3PHSA 4G11A 1A7QL 3MUDC 3TTYA 1XGUA 2A9AA 5H37G 4MNQB 1KIPA 4PJDB 4NC1C 1LTAC 3GYRA 4N22A 2GTZA 5DD1L 4HEMA 1PV3A 1W5CE 2CDFB 1MSPA 2OYHC 4IGBB 5H94A 4NZ8A 4MJ5B 1SMAA 4UTAA 5EH1A 2VN7A 3MJ7B 3UYRH 2Y3NA 1KB9D 3ZTNL 5IB1A 5F3BB 1IAIH 3SKMA 4FNQA 4OZGF 2ICWA 2YEZB 5CCHC 2MJWA 3EXJA 2L5GB 4WKZA 3M8OL 3P2BA 3EJQA 4BQBA 2ITFA 2WGXA 3OZ9L 4MMYB 3TJEH 2AV7B 3CLEL 4KNSA 5I1HH 4UV7H 3O4OB 3CFEB 2I8DA 4C4KT 5BPPA 1HSBA 1FNGB 4HCRL 5LXVA 4YUEH 3HB3D 4MNQA 4MDIA 4PJDA 4OSUL 1JPSL 4WZ9A 1TVHB 2MQGA 4LQ1A 4M93B 3BAWA 2LLNA 1A7NL 3VOPA 1MDTA 3DHMA 4X6DF 2WK2A 2WTYA 5KBDA 4YGVA 3C5JA 3SBPA 3SQOL 2DQGL 2DLTA 2KQNA 1ZS8A 2DYPA 1GGBL 4WI9A 3INUH 2NXZD 2JMRA 2HLEB 5EDSA 4PJ8C 2JJWA 2B9BA 3RK3D 1BVKB 1P6AB 1TF4A 4IW4C 1H3UA 3QFJB 4P2QB 1WP6A 2R2HA 1Y18B 3MN8A 4ES9A 2M8RA 2M83A 2HFGH 2GHWB 1J8HD 3ZX1A 4BCYA 2YMXL 2OK0L 2VDPB 2EICA 4JFOB 3HPLB 2JTYA 1XB8A 3OQ3B 4FHKA 2D2CD 1LTXA 3RJQB 1NGMB 1H8LA 2ADGB 1U8HB 2WP3T 1RUQH 4LFHD 3S88L 4XPBL 3E8UH 3SE8H 4A63A 5AG9A 5C7XL 1P84K 3ARYA 3EGXA 1QP1A 2UZIH 2XN2A 4IJ3C 4CGUB 3BUPA 4H0LD 3OAZH 1EUUA 1XR8B 1EO7A 4YC2C 3VWJC 2Y7LA 5DURB 4X8GA 4APXB 2EKJA 4IL6X 2AVFA 4JE0A 5CJQH 5G2NA 3CC4P 5HHOB 2B20A 3NDZE 3I50H 4JY6A 4KI5D 3WFZA 4TULH 3V0EA 1F41A 2Y7QB 1MCSA 3T3PE 1PFOA 4ZQKB 3B2VL 3MLSL 5LBSA 5L8LB 1J8KA 1O7DE 4X5WA 1BBDH 4Y16C 5I1EL 3OKDB 2IADB 2ESVE 3K8KA 4G8GB 1SZNA 4W9FC 4OGAD 5DA0B 2J43A 3LB6C 1BD2A 5CGYC 1MZYA 3DETC 3N40F 4NPDA 2VIRB 2X2YA 3RBZA 2E76C 1X9RA 3AG4B 3HFML 4M8UA 4X6EA 3FMGL 2KPWA 1OP5K 3QUHA 1I9EA 4BWTA 3MCLH 3S37X 4CBZA 2XTLA 4MZ3A 4RMRA 5ITFB 1WT6A 3G6JB 3HMWH 4JANA 3IDXL 3HOGA 2O30A 3F7LA 3Q2WA 2Q86A 4WK2B 3ZZLA 4NGHH 1BD2D 1FBIH 1VEOA 5E4IA