5AW6B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 5.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw6B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw6B02
4JYBA 2R32A 3IR9A 2XV5A 3L37A 1GU5A 2H7HA 4RETB 3NFQA 5APYA 2YO2A 3TYYA 3TNUA 4DZOA 2ZXEB 2WT7A 3V4QA 1A02J 1MUUA 1HUCA 3HE4B 5AW5B 5APUA 5AW7B 1G2CB 1J2JB 4RESB 3WGVB 3L36A 3O8ZA 5APXA 1S9KD 1CZQA 3M0AA 1MFZA 1MV8A 3A3YB 2WPRA 3P7KA 4AYCA 3HE5A 2Z5IA 3M91A 3VMYA 1DH3A 5APQA 3NXSA 2WWWA 2N9BA 1H88A 3V4WA 5AVZB 4JYCA 3P8MC 3VMZA 1GZLA 3TK1A 3TNUB 1SLQA 4XE5B 3A5TA 3B8EB 5AW0B 5AVQB 2XZRA 2WT7B 2QM7A 3A7OA 3P32A 4KHXA 5AVWB 3UIAA 1JNMA 3MGNA 4M3LA 5AVRB 2VRSA 1H8AA 1H89A 4AUWA 4C46A 2P7JA 5AW2B 2Z5HA 1GK4A 3KQGA 3VN0A 2P2UA 3HE5B 2WPQA 2P67A 2XU6A 2IPPA 3T97A 2E42A 2QM8A 5APTA 3NMDA 1GD2E 2Q7CA 2YO3A 4GKGA 3L35A 5AW3B 4AQRD 3KDPB 5APWA 1CI6B 5AW4B 1GTWA 4GT1A 4I6MC 1A02F 3HTKA 1CI6A 1KQLA 2Q3IA 3VTPC 1T2KC 1OXZA 2ZFCA 1HJBA 5AVSB 5AW8B 1NAFA 5CMZA 1GK6A 3VMXA 1SP4A 1OWAA 3LIDA 5APVA 3WGUB 4C7NA 2R5DA 2YNYA 5AW9B 2W6AA 5AVTB 3M9BA 1T2KD 3I5CA 1IO4A 3SWFA 2BASA 1X8YA 1HWTC 4EOTA 1HBWA 2WTYA 1JUNA 2Q5UA 5AVYB 3OAKA 3VYIA 5AW6B 3M9HA 2R3CA 4I2LC 4B86A 1GU4A 3NTNA 4LC1A 2JJLA 3HE4A 1FOSF 2E43A 3LIEA 5AVUB 1FOSE 3V5BA 2W27A 1FAVA 5APSA 5AVVB 4HYTB 4C7NB 1YYCA 2KP8A 5AVXB 1NWQA 3A2AA 1S9KE 5AW1B 3M0DA 2R5BA 1CSBA 2C9LY 3MD0A 3M06A 2C9NY 2WPSA
chains in the Genus database with same CATH superfamily
1A7BA 2IAMC 3DPBA 3MMEA 4XNMA 3N43F 5A2JH 3FMGH 1EDIA 1DEEB 1MXGA 2GCYB 1QL2A 3A6OA 3MVSA 1J5CA 2H2PD 4YSEA 1T3JA 3KBHE 1P84D 3L72J 1VQ7P 1TT6A 4XVJH 3SDCB 1PL5A 3FO2A 3B5ND 1MW2A 4FXTA 3RFZC 2BSBA 5E0QA 5AZEH 3EJSA 4NKMB 4O2CA 3DROB 4B41A 1PDKB 5EU5B 1P4UA 1QPXA 5I74C 2ED7A 3SDAB 3LVEA 3GMLA 3KE0A 1QBLL 1U21A 3NEOA 3QUXC 4K7FA 4LBAA 2QKSA 5EDXA 5CBEB 4HLEA 3LIUA 1DCEA 1DQQA 1JDAA 1NLBH 1V7NH 2ESVD 3F65A 4JRFA 4IS6B 1HXKA 1RULL 2EXYC 4I9XA 3TV3L 4PJFA 1R0AH 4DEPB 2WINB 1F6LL 2BVPA 2Y9RT 4TL4A 2EEAA 4Y88A 3UXFA 1F1AA 2ZCKH 4JFTA 2R0ZL 3SFDC 4MMZB 5D5MF 1OT4A 5JW5A 2BIIA 4X6FB 1M1SA 3EJJX 4GRWE 4KITB 5J11C 5JLZA 1QSFA 4FL4C 1DQML 1KZQA 4J4PC 5CM1A 4U1HA 4G6AD 5IR1B 1BVNT 1DCLA 1FZJB 2OL3L 3GSXA 3VYNA 4EQ3A 1KTBA 4HETA 3VN0A 1BE3D 5K59F 3UZEA 1GH7A 4FQ2H 3BAIA 4C56B 3OA7A 3OR7B 5SWZD 4NLHA 3HLAB 4I1PA 2BSTB 4L9DA 3PS6A 4RNRA 4EZMA 2XLLA 4PJXE 5SWZE 2AK4A 4PRPE 3L3DA 2G5UA 4YXLH 3NJGA 4M7JL 1UFUA 1WFOA 2C4XA 2VLLA 5FYJU 4AJ0A 1WBXB 4M6MH 3UTQA 5L4JA 3QXVA 2TRYA 4P2OA 4F3FB 2A9NL 5LO7A 3VWJC 3K71B 2DY2A 3GMMA 2B1HH 2W0FB 4WEBH 3QEUB 1W2KT 1YJDL 4HWNA 1UWEH 2XFGB 3ATEA 2N7BA 4QHUB 4ALAC 1XEUA 4R2GC 5JHLA 1LE9A 2Z1PA 1AZCA 1T2KD 1IB5A 4JY4B 5L8LB 1INEH 1J1EC 1LWUA 4H0LB 2ED9A 2GITB 3L72G 1T04A 2RR3A 3GGWB 4PRDB 4LO9A 2KLTA 4XBPB 4F5CA 3OMZA 3MGAA 5FYLL 1XTGB 4EVNB 2PWHA 4ZTOL 2YRPA 3BN9D 2OTWA 3L7EB 4U6VL 1SVCP 5C0DA 3C8VA 4EBQL 1T20B 4RQQA 4ZX3A 1UH3A 3AWEA 4X4MA 5GISH 4JGMA 1QPPA 4XMKH 2GFBB 2QVIA 3MNZB 1FL3A 5C0AE 4WY4D 1J9RA 4Q6IA 3FC8A 3IDIB 4JPVH 4L8BB 3LZRA 3Q9PA 4YSDA 2NSXA 1CICA 4XX1G 5KSAB 4HPYL 4JHUA 5SWQA 4PLNC 1BBDL 5I17B 1P6WA 3VH8B 3UC2A 4HJ0C 4TNGA 4X6CE 1G1YA 3L3IA 3VM5A 1E9PB 1N0XH 3KGRA 3L5IA 2IQAB 3ZDYE 2UYLB 5INDB 1JF6A 5KJRL 5C0RL 5K69A 1T7VA 4LOVA 1O9VA 2M0BA 1ML0A 1CLOH 2VDKB 1IGJA 3T4AC 2MSPA 3EYQD 3IE9A 3BP7B 4XNZC 5DEGA 3ZUCA 5F3FA 3UBFA 2QSIA 5B4MD 1M90Q 4IBYA 1TEFA 3NYKA 1IBGL 4HWZB 3N1GC 4JPQA 4U1SB 1BWWA 3DECA 4C58B 2IG2H 1JNHB 2ICWJ 3EF7A 4A6YL 4C57C 2NZ9C 2UY7B 1KGWA 1N18A 2BX5A 2WSPA 4W80A 1MFTA 1MOEA 3WNNA 4XTRC 2R44A 3HAEG 4AI7A 3GBML 1UXWB 1PQZA 1FVEA 5EUOF 4UOQA 2VDLL 4GLRI 3MLSH 4OCYL 4A67A 1UD4A 4NCDA 1X5AA 4XC1L 4BK4A 2JJTC 1MFBH 1CGYA 1EZSA 1UEYA 2CM6A 4LGSB 5FB8A 2QRXA 3NIGB 3RY6C 3QUZC 4CSPA 1JYXA 3VRJA 2CIIA 3UPRB 5I8CA 5IBUG 4B0MM 9CGTA 3WLWC 5CNHA 5T1JA 1A3RL 1X4XA 4R83A 2COVD 3ETSA 1QD0A 1NM9A 2WXKA 4Y2DB 5DEJA 4KTDH 4B9KC 1U58B 3RPBA 3S36L 5K39B 4WU5B 5K9KB 3B7TA 1F4YH 3M0DC 2WGXA 1QFWI 2KUTA 4HPOH 3FU7A 1HEHC 3FUHA 1FFPA 3IDNB 4LEXL 5J0BA 2Q5BA 5D7SL 1A1MB 2YUZA 5GS1C 5EU6E 3LIDA 4PM1A 3OVUB 4NB7A 1F5WA 3ESVF 3RLSA 3VP9A 2HT4D 4W7YA 3WKYA 1NCIA 3K6DA 2HJKA 4NUQA 4U1NB 3ZZQA 2VDNH 1NTME 1BOGA 2WAHA 5J1SC 1OT1A 5LGHH 3BSZL 2ZOUA 4TUJB 4AUYA 5L9DL 3FS9A 1CLYH 5CXPA 1F4WL 4UYQA 4TNWK 3RAJH 3F5HA 5LGYA 1LTAC 1EO7A 5DMKB 1AAJA 1FGVH 4AUUA 4HG4J 4GBXA 4PSPA 1CFVL 3WFBH 4LNRA 2ICWI 5J13B 5D7JC 3S5ZA 2V4HA 1A1NB 5APSA 3N7NA 2GY7B 2D2CD 4U3FD 1U8NB 1OP5H 2JKVA 2FBJL 4GUPA 2AJUH 2E4FA 3S48A 4N78E 1MVUB 4NC2B 4IKIA 3KXFE 2P52A 3UTPD 1KXTB 1UTDA 4Y5XA 3GWJA 3CPLB 3EGSA 4MMXC 4N8VG 4M6AA 2UWEA 4L29A 1DZ0A 1YEHL 5CEYA 5KN5B 1MHEB 1M05B 2N01B 3R06A 1NCWH 2BM3A 3KPRB 5G55A 5JW3H 3WELA 2XWBB 1AGBB 1OT2A 2DDQL 2X7LA 4JVUA 1OP5K 4PFEA 1URQD 5CZXD 2PF6A 2WYTA 5D8JL 1I8KA 3PCYA 2CE6A 1SXCA 3EJUA 3OKYA 1UWGL 4JMXA 4XRCA 4KNUA 1NTMJ 3SKJH 2DWTA 3WDJA 3ZK0A 2WXIA 2XN9E 2EZ0C 3EOYG 4Y19E 5KBKA 1TUPA 3VFVA 3RVTD 1O7SA 4G8IA 3V4UL 4GRLB 4U6HB 5EZOL 2G2RA 3N3EA 5DJDA 5ESVB 4H0LD 1F6FB 4DVRH 5AB0A 4WDIB 3W9EA 1BF2A 2DQDL 4P3DA 4EI0A 1KYOD 4WW1A 5A2KH 5HGAA 1KV4A 1HF9A 3QRGL 4LSDA 5FKAA 2XICA 4AE0A 5I1AB 4ODWB 4Z8FH 3UIAA 4HJUA 5GIRB 1AO7B 4MA1C 4OFQA 4UMGA 3F3HA 4LCWA 2X10A 3WNKA 2Y36L 1M53A 3QORD 3V6ZB 2AJXH 2Y7QB 3ME0A 1CQKA 4G1EB 5GGVL 1J0JA 3QXAB 1DO5A 2EDNA 1ASOA 2SODB 2B1AL 3LKSA 3IU4L 1V3KA 4HMDA 4UT7H 4G1MB 4YHIB 2OMVB 4HOWA 2WPVB 1AG0A 1T7YA 3FBQA 1ZVNA 4KMLB 4WFGE 4PJFE 2ZOOA 2R56L 1N6UA 1CI6A 4LK4A 5E4EC 3FB8A 1IQDB 3PL6A 1D5BB 1NM4A 5T3XH 1BD2A 2V2WA 4F57H 2RD0A 5D1QC 4BFBD 3HE6D 4PLJD 1QSFE 2XWDA 2HTLC 1XT5A 1AJYA 1FUNA 3E8VA 4DT0A 5ERWB 4NAQA 3RWDA 5K5GB 3BWUC 1RSYA 4PQXA 3RL0g 2A9DA 3DVFA 5T8IA 4JHBA 3ZTEA 1SQBE 1GXEA 3AU1B 3QDGA 2BOBB 2Z35B 3N04A 4OKVB 4WVZA 1EZVY 2ZKWA 2F7IA 3QZMA 5E8PA 3UPAA 5KVFL 5CJQL 1A7RH 2OQQA 3MRMB 1TPXB 1KPRB 5I0DA 5DK2A 2R0LH 1UATA 1F56A 3FGAD 3C6LC 1WT6A 2AK4E 1KCUH 4NS0A 3HRZA 1SGKA 2YKLH 3S5LG 4YBHA 1TZ8A 3ZKND 2QV4A 4GAAA 4KJQC 5MP6L 5BV7L 4H1LG 2PFXA 1NTMG 4ZXBD 2UXGA 5DFWH 1UCBL 2WBJA 2ZQKA 1Z3GL 5E5UB 1CL7I 4X4YB 2FT8A 2G75A 4JZJA 2HYMA 2JI2A 1ZS2A 5DUJA 3V55A 3REWA 4BDVB 5E1AB 4NKDB 4IYKA 3SY0B 1BAWA 1XF4B 3FQ2A 4NC1C 5C1MB 3FRPG 5B39A 1EGJA 1CGSH 4P2YA 3MRGA 3U9PL 2OXGB 3UTZA 4NM4H 4Y2DD 4H44C 2C9PA 2ZAGA 4B96A 4DP4X 3TEUA 4F5CE 3PF2A 3GHEL 2OYOA 5TQ0L 4MRBA 4NGHL 1BQHG 4OIAA 2JCCA 2NW3B 3UJIL 5D55A 3X3FH 7TAAA 2H1LM 3VSVA 2XWTA 5FKPB 2EIMB 2VZUA 1R24B 4X4ME 4OGYL 4DP5X 1VKXA 3S2CA 1GKEA 4FQXA 3QG7L 4KRMB 4LFHD 5JXAL 5DU7A 4EKJA 1SQBJ 1NTZD 3RK2C 3U4AA 4IRZH 1NBZB 4L4JA 4NO3B 1WUZA 3UTTE 1U8KA 3GKWL 1KENL 3DUHA 5I1JH 2JKXA 3W57A 1J9SA 2VZSA 3OSKA 5F71A 4ZZKA 1DVZA 3KLQA 1GZQA 3X3GL 4HC1L 4L1TA 4RA3A 4DVBB 3U2JA 5F70A 1LK3L 1ZT4B 2GBUA 5AW2B 3H9YA 1FI8C 5JPMC 2APXA 3D4YA 3MBXH 2FJHB 3DNKA 3O6KL 5KVEE 1ZTXE 5F72S 1YIJP 2BCCE 2EE9A 2PUQT 4XOEA 1CE1H 5FYJD 1U3ZA 3ZSTA 2R27A 2FJUB 1MCBA 1GD2E 1YEDA 3QPQD 4AYFA 1MAMH 2XDHA 3O6FC 1KGYE 2JKNA 1XV8A 3HZKA 5TFSL 5IZ7A 1FDOA 5BCAA 1EVUA 3HTKA 4FQIL 4NQSB 4XHQA 3UYRH 3HG1A 2LU4A 4R5TA 2EVGA 4KXBA 3EYFB 1YEKH 5MEQA 1SXZA 5I6KA 1PCXA 1UZ6E 3FKUS 1KACB 1A3ZA 3RDTC 4WJ5B 2AAVA 4DKEL 5IB5B 4HKJB 4LHUA 1VRSA 4R4FH 4TPRL 3E3QC 1DBML 2CLZA 5IT2H 4L2YA 1DE4B 3QIWC 4K23H 1NLDH 1R47A 2AJSH 2MH4A 4K7PH 2HKHH 1HINL 4AXWA 4QNPE 2AJYH 4P5TA 3DBXA 1RZJL 1A7NH 1SUHA 2ZCLL 3VMNA 4NKQB 3KS0J 4CU6A 3DVNB 3GSNA 1AO7D 4X8JB 3ZOAA 1YNLH 4JFDA 3CLFH 4QJ3B 1A25A 3AGWA 3NOIA 4KRPB 2VQ1A 1SQBG 2BCCJ 1J0ZA 3Q6FA 3TLRA 4ERSH 3U25A 4F7EA 1Q0EA 5E56A 1KYFA 1CLZL 2YPVA 4NPJA 5CCGC 1I1AA 5HDOA 3THMH 4CSSA 4DP0X 5DHXB 2HUHA 4YHOH 2XPGA 2JKTM 4UM9A 2XWJA 3T77A 2VRAA 1Q72H 1S72P 2A06D 4R26L 1CZ8L 5A2FA 1NJ9A 4HHWA 3OXSB 2UVEA 4MA3A 3CBJB 4HFUL 3D0VA 3VOPA 2FWSA 3QDMD 3SE9H 2PP9A 1XTCC 4YHKL 5F7WC 3H3PL 2VMDA 1OXYA 4N5EC 4XP1H 5I73B 1AHWC 2ATKA 3NEEA 4LPVA 3EDJA 4WI4A 3TS8A 1JPEA 4A37A 2C4FU 1L5GA 1E28B 3BRVB 3B2UD 1W0VB 1L6PA 5TH2A 3RI5K 1OCRB 3HLKA 2M5AA 4NO5A 2VDKL 4ZAKD 1KBGH 3DSNA 1KG0A 4FEIA 3FTYA 3GTVA 4JYCA 4JO4H 1YNKH 3QIUA 4E5XA 2UWEE 3SGKA 2HPCB 3V2PA 2EO9A 2F6AA 5GGRA 4JFPA 5ALBL 4LOUD 1NL0H 2OS7A 5AAMA 2CSPA 2EIKB 3ERXA 4EN3A 2PPAA 1TJHH 3L73E 1ODAA 3OKKB 3BUDA 5D1ZA 4BQ6A 1U8IB 2J4WH 1V54B 3VFTB 1YEGH 4B60A 4KX9A 5DQJA 1TJXA 1XFPA 3C5ZA 1RF1A 2XKNB 3GLAA 4NDMB 4OJFH 2PR4L 3ECWA 2YO3A 4U1KA 2XWRA 2AQQA 4YPJA 3RL1B 5HYJE 1CVSC 1FO0A 2E6PA 1OWRM 3T0VA 3MZGB 1UWXH 3PWPD 3EOAA 1FZKA 3L95B 2XV6B 3FT2B 3HHSB 3APFA 4Q6KA 5MEPA 2P45B 2YMXL 4YXKL 5DR5L 2BCCG 3AECC 1A1OB 3DO3A 3HIZA 3I55P 1K5NB 1NU1D 2DQTH 1Q94B 4N2KA 3SE3C 1ORQB 3MJ9H 4BA8A 3GLZA 4LCWE 3PWLA 1KB5A 5I1KH 4YLQT 4TSBL 1Y0LA 3IXTA 2I60H 4BK5C 4F7MB 3CSFA 3MXVH 2EDJA 3DYPA 1KJMB 3MV9B 4B9ZA 4JL2A 1GA2A 3R4RA 5I9QC 5D96C 3SKMA 2VITB 5CBAA 2GEEA 5FO7A 4FFYH 1L9OA 2P8LB 3PJSK 3HNVL 1NHLA 4L3EA 2B1OA 2KLSA 4DQOH 1FNAA 1HS6A 5I8KL 2E76D 4H13C 3IDJB 5FR3A 1BD2E 1NAKL 3B4SA 1R3IH 1BZ8A 3GXMA 3L73J 1W91A 2OZ4H 2V2TA 3JWDL 2VN5A 4JKMA 4DESA 1PSKH 3FO9B 3LIZH 1E6OH 1AA0A 4MNQD 3JC22 5ANMB 3INUH 4ECNA 5FO9A 5E6ZA 4JM2C 4ESKA 1E5AA 5KSVA 2DS4A 2QVMA 5E8NA 3QDGE 3QW9A 3IDYC 3NCXA 4H8WL 2W0LA 5DWPA 3I50L 1N6VA 3VTTA 3CFKA 4DZ8B 5E9DB 3L4XA 3MTXA 3NJVA 2DQHH 4QUOA 3MXWL 4ONHB 4EKXA 1YUHA 2FB4L 1NFDB 4YGVA 1EXUA 1ZHNA 1KNOA 4PLKD 2P80D 1OQXA 3NQKA 2OZNA 2FHFA 5I82A 4N2EA 1ITBB 5HDLA 1V3MA 3VWJA 3OAWA 4PJ7A 2P5EB 3A4EA 3AQDA 1FVDB 1JPSL 1QZNA 3FONA 3KBPA 1AGFB 1LP9A 3CXHD 3IM1A 1II4E 3A6CL 3MCLL 3G5VA 4YQXH 3S3DB 3SZ6A 4F8OA 3A0BH 2VZTA 2AI0H 5IQ7L 5T33L 4XE5B 4IHOB 2Z34A 1HZHH 2YHGA 2OSWA 1FN4B 2DRUA 1ETA1 3IF1A 4QRPE 4E9YA 2JV6A 5CUSL 3GPEA 3RK3D 5H2BA 5IBTL 3GFUA 3LV3B 4HWEL 3BDXA 4ZUUB 3O8XC 2H8PB 3U6XS 4QXUH 1S7XB 4KRPD 3EDFA 2JB6B 2R8SH 3FCTA 4P23A 3VA6A 3V0AC 2HUEA 4WGVB 3HR6A 4G59C 2CBOA 3N1PC 4JB9L 4XXCA 3LRLA 3GS4A 5CLZA 3NIDE 4Y99C 1SFHA 1L7IL 4OVUA 1JWMA 3MBEA 5TDNA 4KOCA 1KLFB 3CMOL 3S8FB 1J8HB 2BFGA 3O6MH 4XC3H 2YXQB 3L73G 1PIGA 3L3OB 5CMAA 1UH2A 2BC4B 4KH2A 2FSDA 4Y4FA 1MJ7H 1XMEB 5GZOA 1LEIB 4OD2B 1JXGA 5F9WC 1HH6B 4Z7UB 4GIFA 5A2AA 1ORSB 4PD4H 1KQFB 2BWQA 3WN5B 2YMOA 4TSAL 1RVFL 4OV5A 5D4IA 4R4MA 2X40A 1GGBL 2F58L 5JIMA 5HJGA 5JZ7C 3VSQA 3EFDH 2XFXA 1U8QA 3H55A 4MD0B 1JCDA 3RWHA 5BVPL 4GI9A 3D2UA 2WWMC 4Z7VA 4HJ1A 2AZAA 1P1VA 1NAMB 2EDDA 1A0QL 3ARDB 3D85A 1MEXL 4NNXB 3A22A 3CXHJ 1M56B 3D1MC 2JJLA 3O4OB 2VLME 5FA3A 2WMPB 3K2MC 2V9UA 4ZSOB 1SQQD 3A4AA 5DJYB 4B97A 3HG0A 2XQYA 4PD4K 2N1TD 4KROD 1S9KE 2C8NA 2CLRA 2VDRH 3QAZB 5DEZA 3U7YH 2ZICA 5CU5A 3L13A 4BFIA 4OD1L 3M6DA 4NJ9H 1OW7A 4PTUB 3ZZSA 5J4MA 3GB7B 4I0PB 4FJYA 4IIZA 2QPSA 2WZ5A 2NPSA 1R5VB 4Z7OF 3ZKMD 1CFSB 4GPVA 3ZGIA 4KUZH 2FIKB 2NY6C 1KC8Q 2AQNA 4FXLA 2YRBA 3HMWH 2YD8A 3ZE0E 4HU2A 1MFZA 3G5XB 1WITA 1A4BA 1EEYA 5HGDB 1DH3A 3CZUB 3VXSD 5ADPL 3VD0A 2CPSA 1N9PA 4JFDE 4JZOA 4HOMA 3CQQA 1DBBL 2WWWA 3G5WA 1G9NC 3LS4H 3N41F 2F8OA 1NPNA 1SQXK 3BCCD 1TCRB 4AEFA 3IXAB 3TA4D 1PX4A 2JKJA 2OJ1A 5E4IA 2ETWA 1LWRA 1S9VB 2X1XR 2YA2A 5HHVL 4Z1MH 4KJPD 1KGCD 4F58H 1FL6B 4KK8D 1N3NA 2J1KA 2A6JB 3GMAA 3O11B 4N2OA 2X4OA 4X6DB 1NGWA 4AENA 1YA5A 4KZDL 3IGKA 4AMKL 1FNFA 3VFWA 3VXTA 1GL2D 4AGOA 3CXHI 4P99A 1JPTH 4P49A 3L48A 3GNMH 4NJAL 3GUFA 4KTGA 4BZ2H 1D9KD 1JD9A 4EYYQ 2Y6SC 5B3JE 4PJCF 1N8ZA 4JO2L 1WG3A 4ZYKB 3H1JD 1G6VK 1M9SA 1KOAA 1ZHBA 2P8PA 3VSUA 2QSCL 1UA6L 1AP2A 2H26B 1X22A 3QI9D 4JM4H 1F02I 4LBEA 5LNEA 1JV5A 3RIFF 4PUBH 2VIRA 5EU4A 3VD3A 3A21A 3PWUA 1I9JH 4FA8A 4EIGB 3IN0A 3KYQA 3ZRFC 5EBMA 3MRLA 1ZLEA 4UT9L 1BXVA 2GJ6D 2LOEA 3BVTA 1OAYL 2DQGH 2IFNA 2BMKA 3CH8A 4L8DA 3ALPA 3LDBB 1H3WM 3H1HE 4XP9L 2BIMA 2O6PA 1D2OA 3WUWG 4WFFD 1MRCH 4NKIL 3D25A 4ELDA 2J3SA 2YQGA 1JWSB 1ZIAA 1AXTH 5BQDA 2F68X 1I1CA 1LE5A 1E6JH 2FQDA 2QEXP 1O9WA 3QB7C 2K37A 1YVLA 1ZXQA 3BISA 5GSVA 3IRZA 5D2NA 4UIKH 3KJ4C 1IGYB 4HZAA 3TO4C 2CBPA 3ZJAA 1J11A 1NEZA 3LQMA 3MFGB 4M1GL 1MKMA 4KK6D 3VGGA 2K4WA 3QEQA 5GGTA 4FA6A 4S1QL 2YPLA 1UJ3B 2MNWA 1OOAA 2Q86A 4KZEH 2R32A 4H0HB 4IGBC 1YQVH 4RRPA 2R2BB 1KXHA 3RUGE 2FWUA 4MTMA 4PW3A 1A9VA 3ULVL 3CBKB 2YD1A 1U3HA 5K5YA 1X6NA 2W88A 1YJDC 1V55B 2KK7A 1OK8A 2Y07L 3CXDH 3GUTB 3HE7B 3H2WA 3NABL 3VI4B 3N40P 3SJVA 1FLTX 4Y5VC 5GQBA 4NRXB 4OWFA 2F74A 4FFVC 4HBCH 1QABA 4BSWB 3GBDA 1PLCA 1MFCL 4FHBD 3IDXH 1HH9B 5IW1B 4L3EE 4Y4KC 2XXMB 4YWGH 3US9A 3H1HJ 2CRZA 3RX8A 4O51B 4A7UA 2ZD0A 3F7VA 5FW6A 3QO1A 3TXAA 1P6AB 2GTZB 1OP9A 2EDEA 2PNDA 5EBLB 4PWKA 2CR3A 5DQDH 5I19L 1HU8A 4U1IB 3GZQA 4K0OA 1HIML 1HQRA 3FU3A 1S7QB 1PGQA 3D30A 2WQSA 3OR6B 4A39A 1X5YA 4OUUB 2WM0A 1QNZH 4OZIF 1O7VA 2A0LC 1LP1B 2HH0L 4IEFB 4P5MB 3HB3C 1HEZB 1USDA 4FP8L 4OJCA 4OCXL 4GQQA 3OD3A 3GSUB 3FO1B 3JV4A 4JQVC 4L37A 4ZUSA 3RGVD 3S8WA 3FT4B 2H89C 5E70A 2KZJA 2UUDH 1IEBA 1DQIA 1LO2H 1L9TA 1P5UB 4JY5L 2VR5A 4PJ7E 4ANXA 4I0PD 5ACLA 4OIIH 1IFJA 4IRZA 1LP9E 5D72L 1TEYA 2APBA 2QVFB 3WY1A 2ZX9A 1YJNP 2VUYA 5JHBA 3S9DB 5TISE 4DZBB 1U4EA 3QT2A 2NUTB 1VDGA 5C0JB 5F7FA 1A7OH 1NDTA 2BVEA 1DVYA 1K8IB 3FYEB 2WVVA 5D93B 1XZ0A 2JKLA 2DQIL 5IV2A 1Q0XH 3CCRP 5J9PA 3PUCA 1FBMA 5F9JA 3ZTJH 4X4KA 1XB8A 3AG1B 2DJMA 2UUDK 4U0RB 3HHRB 5LGJA 3ULUF 3T2NL 3ZVVA 3RZWA 3PHLA 4E5XG 1U8OB 3CWBE 4GP4B 5HD8D 4JKPH 1U6AL 4D8PB 1L6XA 1FYTD 5TF1H 3H1HG 2H2PC 4QCIA 1ZJAA 4AYSA 4XMPL 3CI9A 1KTDA 3F7YA 4ZUVB 1BYNA 5T5FL 3GHBL 2EDTA 1FPTL 3B5NC 4FG0A 3SGEH 2V5RA 3NEXA 1W8EA 5KBMA 3EH1A 4YFLF 5B1KA 1DX7A 3VQ2C 1YN6A 4Q8BA 4I85A 4ODVH 4Q2ZB 1RLBA 2C3WA 2QDVA 3QULB 2F7OA 4F9LA 3LCYA 2PETA 2VR3A 4M6OL 2GK0A 5JOFB 2ZWLT 4R7NB 4ZQTA 3PGCB 1UXSA 1ZA6B 4LASH 1KN4H 4Z7VE 4V2BA 4RMUA 2E4TA 3D8MA 2GUOB 3O4LB 5BZXA 3OKMB 4P2AA 4OZHA 4FQCL 4ADIA 2YRLA 2QJPB 3BEWA 2I26N 5L2JA 3V52H 3GXDA 3P7KA 5FW7A 5MI0B 1LTJA 2LLGA 5IHZB 1V5JA 1TZIA 4LQ1A 3VG9C 3VGAC 2W65B 5IY5B 3QRLA 4G6AC 2R23A 1T6WA 1UM4H 5EOQH 1BZ9A 5MERA 4K8RH 3TPUB 3DWTA 3HJ0A 3OJVC 1JL8A 4GMSL 4AC4A 2QR0B 4KTEH 2YFNA 5B8CC 1D6EA 4CBZA 3QBTB 1HSAA 1A6VH 3V2AR 3CWBJ 3RL2B 4ZOCA 1P7KA 2WUCH 5J56B 2WITA 2Q8AH 5A3ID 4FF9A 4OW6A 4R5VA 3RURA 2VN3A 3G08A 1M3IA 2UX6A 5GS0L 1BCIA 3GINA 1E42A 1SJEA 4BWTA 2JEEA 3FHQA 1DJSA 3JWOH 5DDHA 5DZAA 1YAZA 4QKXB 1DQLL 1GTNA 1SF5A 2Z93A 3WE6B 4PYHA 2B5IC 4TOYH 3T04D 5C0GB 5APTA 3RKPA 4R96B 1SVBA 1XCQA 4LARL 1OPGH 2W59A 5EO9A 2Q7CA 3QFJD 4QT5A 3FT9A 3D51A 4H2AA 4Y7MA 4OLZL 5F7DB 1OCCB 4EZLA 1MCQA 2XNAB 4JM0A 1XH3B 4EUPA 2C1OB 5BXFA 2ORBL 3RB5A 1KLUA 3ORJA 1YEEL 2X4SB 3QFJE 5GRZA 1T2KC 2ZFCA 2R2EA 5AB9A 5K1VA 3HUSC 4DN4L 5F7NC 1B9KA 1MZ9A 4NN7C 1X9LA 1SN0A 3IFLL 3LZLA 1J1OL 1MFNA 1ZJBA 2CK2A 3BN9C 3O6LH 4A2GA 5C8JA 4A2MA 1F3JB 3GIZL 1HC1A 2WXPA 4XNQA 3PP5A 1LWHA 4WHDA 4EIBA 3OHXC 4MNHA 2H6UA 2V17L 2YR3A 5FCUL 1B4RA 2D7TL 3RY4A 3D6YA 2X0UA 1UH4A 2Y2WA 1H5BB 4YL9A 1E4XL 4UDTB 1M9WA 3NCYP 2E27H 3O2DH 2JQZA 1T66D 1NAML 5EEWA 4XAWH 3VVWA 1QLFB 3MUGA 2Q10A 1J1DC 2X05A 5JA8B 1BM7A 4ELMA 1C5CH 2ZT9B 4YDVB 3K74B 1TMQA 1Y07A 4KJWD 2H1XA 1BIIB 3D9AL 3FX0A 2QEJA 3VD2A 4WBAA 5H2FH 5GGSB 1W15A 2BIOA 1D7FA 2BVQA 4HAGA 1Z9SA 1T1ZB 3FBKA 3AS1A 5HHXL 1HHIA 4GG8A 3PWVA 3WEXB 1K4DA 4B0MB 4L5FL 2GJRA 3L37A 4FLOA 5D5MA 3V6IA 1KY6A 1TVHB 3CWBG 3MJ9A 1SLUA 1Z32X 4NQQA 3WY2A 2ZX5A 3EYQC 4YHML 2ID5A 1EAOA 5C0CB 1UQSA 1WISA 3B37A 4KVNL 2BSED 3TYFB 2P1YA 3WIAA 5JHDA 3CZSA 5B4MC 4HZLB 3TCLB 4AGMA 3B9KD 5BRZB 5D2NE 1HHHA 5JIQA 4LVOB 4JFZH 5A2LH 5B1BB 2AAAA 4ZD3L 2R9HD 4X4XA 1WFUA 3MRHB 4BH8A 4ODHH 5DSCA 3V95A 5C7XH 2D8KA 1HEJC 2FLMA 3PQYD 5KYUB 3ZHNA 5T3XE 5BV7C 3KG5A 1I7ZA 2YPLE 2GTWA 1UC6A 4K7PX 3VMPA 2GC7C 1EDQA 1JZDC 3GMQA 2G5BA 4YXHL 3JV6B 1SHXA 2NY0D 4GUCA 5I1GH 1GZLA 4YPCA 3TK1A 4AV0A 2J6EL 5DC0A 3LIZA 1JY2P 1FAKT 1NIAA 3D87B 3AEEC 2IH3B 1WWWX 4XI5D 3RWJA 4J3XA 1WWAX 3U59A 1E5BA 1H0DA 2HG5A 4OAWA 1T03H 2VXUL 1ZLVH 5DWUL 4XPHL 1U3NA 4R7DA 2E7LA 3B8YA 4NC0B 1I9EA 1G9ML 4LVNB 2AVGA 5JIIA 2XQYG 5AENA 1I1YA 4A2LA 1B2WH 1JFQL 1MCPL 2H6PB 3UDWA 2IPUK 1I4FA 2M1KA 3TO2A 3GW6A 3BIKB 3SDDB 1RH5B 1JUFA 4NQUA 4X8XA 4FN0A 4MBOA 2HT4C 4DOJA 1DTUA 3MODL 1X0TA 4ZMOA 5AFAA 4FYSA 4JDTH 3IAOA 3H0TA 1I9IL 3P3TA 2ZSWB 1WF5A 1ZLVK 5JQIB 4W9LC 4M4PA 1GK6A 4DEPC 3O4LD 2XA8H 5EDSA 3CFDB 3T6QC 5DUPH 5DGQA 5KUKA 3OKOA 4MMZC 2LXBA 5GRVK 4X7EC 3TM6A 1PKOA 4BGDA 3VWKB 1B0RB 2YIHA 3W0WB 1B6DA 2CJUL 2VLRA 2AW2A 4N8VB 4N9GB 3RA7H 2D2CC 3IYLW 2H3NB 1IIIA 2WSDA 1NYHA 1GYUA 1ZE3C 5ID0B 4DGWC 2BJML 5DUMH 2KZIA 2FJFA 3MRQA 3R7RA 2K9JB 4UNUA 3VFRA 2EAEA 1TQBB 3VE0A 2OI9C 2O4EA 3MNDA 3QYCA 5DMYA 3HFMH 2PCPB 1OB1A 2IO5A 1RMFL 1TQSA 2VC2H 4XNYL 1HXYB 5AD0B 4QJ4B 3N9GH 2EVIA 4EI5D 1FFNB 3NP4A 2K9YA 3Q43A 3FU6A 1URQC 3E8UL 5CZXC 1MF2L 3ZKSD 1FIGH 2AQTA 2J1WA 2X4RB 1TOXA 1PV3A 4ORZC 4GAYB 1EQWA 2NNAA 4JMNA 1JPFA 2VL4A 2FIRT 3DV4B 5CJ8A 2C4FT 3K2UH 3RVTC 2ATAA 1IBFA 2X70A 1ZPLA 4HAKA 4RMSA 4H0LC 2NZ2A 4BM7A 4NWUH 3SDXA 3HPJB 3KGUA 5DJ8A 5E6ID 4HH9A 3SCMA 3P77B 3TT1L 3CCQP 1A6UL 4BFFA 1VZGA 5IFAH 3IMVA 5C0FB 5FW8A 1NOAA 4GKZA 3HC4H 5LAXA 3VG0H 1AZVA 1MJ8L 1Y6KR 3CDZB 3QPXH 2A6KA 4X0KA 3QORC 1OPOA 3V7AE 1RY3A 4NHUA 2V5YA 1EZVE 3QIBA 1MG3C 3RJDA 4IL6H 5KSUA 3TBWB 3U1AA 4CNIA 1IC4H 5K93A 2WZPA 4PS4L 1THAA 4Z0BH 5ICZA 3L4ZA 2YXFA 2FEDD 2ZX6A 3PJNA 3IT8D 2ZT9D 4M62H 3LH2H 1TF4A 2AJZA 2GUSA 1UWYA 3BZDA 1EFXA 3K8KA 3OKEA 3PHAA 4G6FB 4R7XA 1A14H 1JG9A 4OZHE 4RMQA 3VRIB 2CJ3A 2E42A 1OTUD 4I13B 4HV8A 3X13B 4WW2C 4J2QA 4RRPG 1BG9A 43C9A 1KPVB 3HE6C 3HCVA 4OM1H 3RNQB 3MUZ1 3UJJH 2VAAA 3X17A 3VI3E 3W37A 4G3YL 3QHZH 4UMSA 4XPBH 5FHBL 3WAKA 3WTYA 2XNDH 1IX2A 1CG9A 4LQFL 5C0CD 2AP2A 3TBTB 3BWUF 1S9XB 4QAWA 2IEPA 4M6NL 2YZ1A 1E9QA 1LVEA 4XCNB 1DZBA 5BRZD 5FO8A 1F1DA 3CCUP 1BAGA 3ARFA 3CU1A 5TE6H 1S7SA 4LCIH 3HZVA 1NGYB 4LCYB 5IM7B 4IOIB 2H9GB 1M3JA 3QQDA 3ZKNC 3PLNA 3H9HA 4QTIH 1JSYA 5BZWA 4ZXBC 1KEML 3GIVB 4PRIA 1T7XA 5IB3B 3BVHA 1BXAA 2HODB 3N2JA 2I9LA 4O9HH 5DC9B 3PWNB 2I07B 3TJHD 3VTAA 2CMRH 3BGFB 3DKHA 2NQ3A 3O0RL 4LF3B 1D5IL 1Q4NX 5AEAA 1BQHB 4F15B 3BD4A 5I66B 3B71A 1RQUA 3JT0A 2QKIA 4O4YL 3C08H 3T3PF 4Y2DC 1OTTD 1JGUH 2BPBA 4G71B 1RU9L 3IFPB 4N2AA 1EJOH 3DX0A 3FF7A 1I7TA 3MD0A 1USQA 1HJBC 1ZSDB 4F7PA 2ITDB 5K9OB 2CGRL 3OWRA 4S11A 2GI7A 4IFDK 3FSWA 3RL0B 1OV8A 2P43B 3HI6L 5FYKH 1HJ0A 3TZVA 2VR7A 3IMBA 5HJDA 4ANKA 1T6AA 3CL3D 4L1DA 4MAZA 4OGQD 2YGOA 5CGYD 1G6RB 2V2XB 3RIFK 2XN9B 2R1XA 4Y19B 1MIEL 3BZFA 5IJVB 3DO4A 2ADIB 3BP6A 4MVBD 5T1LA 1KT2B 5CLWA 2VDOB 3BZ4B 5DF0A 5LN4A 4ZT1A 3SPVB 4XNMB 3DPBB 3W0WD 2VSKB 5I8OH 2A74A 2G2PA 5BOPA 4WGWB 5JA9A 3L1FA 4QOKD 1N26A 5JTWA 3FO2B 3JWDC 2O5ZL 5D5ME 3ZQWA 4D7BA 4O00A 2CO3A 4O2CB 1EZVI 3QPQC 5JYMA 3AJ7A 4HQQH 1OKEA 2LVEA 2ED8A 4HISA 4UI2A 3GMLB 3EO0A 5JHDE 1KULA 5K33A 1J87A 3V2RA 4K7FB 3FSAA 1NCCH 2HFEA 2A9MH 5F6HJ 4YEEA 1GHFL 1H3VA 3O6QA 4K2UL 5G4OA 5K59E 4WNJA 2M2DA 3IMWA 5F8QC 4BE5A 2J56A 2HRLA 2KZWA 2ADJA 3V7AG 4H40A 4HCRL 3F7LA 4PJFB 1SQVE 1IVLA 5D4QA 2BVPB 1EZVG 2IXQA 4YSTA 3CLEH 1OVUA 3DARA 4NZFA 5FUCE 5JW5B 2OR9H 3E7KA 2YUVA 4MJIA 5FGRA 4D3CH 2IV8A 3D0LB 4BWUA 4P9HL 1UD5A 3EYSL 5JLZB 1QSFB 1RSFA 5DD5L 3KLSA 3P0VL 4U1HB 3NZSA 1ID2A 3GSXB 5IHUH 2HLAA 4JGJA 3IDMA 1B88A 1Q90D 3P8CE 2WIMA 1IJNA 4YS4A 2O5XL 4UTBL 2O01H 1NWOA 3FU0A 1Q81Q 1PU0A 2IAND 2O6DA 2P42B 1G7JA 3FCGA 2EO1A 4RNRB 3Q6GH 4EDXA 3FU8A 3B9EA 4LIQL 2C9UA 2AK4B 4KO9A 3L3DB 1CPUA 1CTMA 4OB5L 3HUJF 3D39A 4L4TD 2VLLB 3RKDD 1XX9C 2HAZA 3PFQA 3UTQB 4HUWA 2N0KA 4P2OB 4MNGA 2CWRA 1MFEH 4DP9X 3GMMB 2HMID 2PO6A 2IH8A 5IVXF 1JY3N 4W9EC 2WQRA 2X0WA 4Q97A 1K05A 1LE9B 3CD6P 3TT3L 5F6HI 4NFBA 2J59M 1LWUB 3JYBA 1SQVJ 1RUML 1T04B 5FEBA 2O5YL 1IBHA 4PN6A 1LO0L 2VLRE 3OV6A 4XN2A 3LHAA 2XV3A 3B2UC 2HXAA 1BECA 2ZXDA 1CDHA 2OTWB 4ZAKC 5C0DB 4TULL 5FA4A 2CD0A 1L0LE 4RQQB 5ADOL 2X9ZA 4NRYA 2WKOA 3JWNH 3CC5A 5HDBE 1RUPH 4W9DC 1FL3B 5T3ZH 3ULUH 1T22A 2Q76A 4JFSA 4JPWL 4Q6IB 5AUMA 5C08D 4HSQA 4B95C 4RFNC 1KCSL 1CICB 1T5KA 3FOLA 1RE3C 3Q06A 1X7TA 4TLTA 5KLVE 3QR0A 1OM9A 2FX8H 3K6NA 4LOUC 5C08E 1N2DC 3WEMA 3D08A 5I71B 3H3KA 4PD4D 5I6OA 1UKQA 2WO3B 4CDGC 5D7EA 1I8MA 4AL8H 1X5ZA 4OLXL 1SXAA 3L3IB 2NT1A 5HHMD 4LP4A 2A9BA 4KKCD 4LP8A 3T6XA 3Q0HA 5DD3H 4KQ4L 5BS0A 2YKOA 5EFIA 1N7SA 5EUOE 4NP4H 5C09A 1DN2A 3LW5H 2DM3A 3ZL1A 3SDXE 5DEGB 1EDKA 4L23A 3LY6A 2OMUA 1SFDA 2ZWNA 4PJ0H 1BQRA 1AG6A 1OGAD 4M9OA 5B7FA 2Y6TE 4BSVA 1I75A 4OGXH 2JIXD 1R5IA 3AW5A 3GSQB 3OAUL 1QRKA 1BG1A 2AEIT 5EMYA 2HYNA 2EVFA 1SQXD 1IT9L 2R83A 3FN9A 3VXPA 1YPZF 5D6DC 2EDLA 1N73C 3EWKA 1YEWA 1HAUA 5FX3A 1OX3A 1RE4A 3QISA 1PQZB 1FVEB 3ZT7A 3N55A 4J3OD 3CZKA 4JE0A 3LKPA 1CUOA 2B88A 1RJZA 3AEFC 2CXGA 2YD7A 3IE4A 5KAQF 2CUMA 1SQVG 1YYLH 1E5UI 2OR7A 5FB8B 4YUEH 3NCEB 5F7AA 1VFMA 2C3VA 5KLVJ 1XL4A 2AEQL 4WWNA 3VRJB 2CIIB 4CC4C 5I8CB 1ZR4A 1L9SA 2E76C 4FABH 1OANA 4L8SC 4QR7A 1XD0A 4N86A 5CU9A 2Z4EA 3B3BA 3GSOA 4E41D 3P69A 3FU7B 3GF3A 5ISZA 1FFPB 2AXGB 1E4KC 2QTEA 4NUPA 4G7VL 1B2YA 2B08A 1S7VA 3QWOC 4OQTL 5TDPA 4BCXA 4YE0A 4DSYA 2IYOA 2HJKB 4LEEA 1GS6X 2ZG3A 1BOGB 3VFOA 4LLAA 2YQBA 1HYRC 1XHHA 3ZO0A 1AC6A 3FHAA 4XMUA 2DH2A 2XZQL 3KPPA 5CO1A 3CZEA 3VFPA 4AQOA 4ALAH 4PLKC 2YMYA 4AYEC 1NIFA 4FQ1L 3QUKA 3VXNA 3BKYH 4J6IA 3KW7A 3NIFE 3AITA 4GBXB 4PRIE 4RMWA 1HL5A 3AT8A 5FOBA 4ZOBA 3T0EA 1YQ4C 1RPQA 1GL4B 4LNRB 3B2PA 1JERA 3L36A 1SQXJ 3QQNA 2YD2A 3O2DA 3BCFA 3QQ4A 4DFIA 5MENA 3L16A 3MNWA 4OTXH 4GUPB 4AYGA 4NCC2 2F53D 3CX5D 1WAAF 3AE9C 4FA7B 4MJ6A 1OGSA 2JJSA 1WRGA 1G4MA 3L17A 3RK3C 1PG7H 3AUVA 3EGSB 2X4PA 4Y5XB 3X1EA 2UWEB 4L29B 5E95B 4WFED 3U0TA 1AGEA 1FGNL 5A40E 3EFFA 5BRPA 4PJAA 2FYNB 5CEYB 4UTCA 2EDXA 2DM7A 2CA3A 2QL1A 4KRPC 3UERA 1NCAL 2QADB 1L0LG 2LU7A 3LRGA 3NJJA 3R06B 2DLIA 1SFCA 3S8GB 1RI8A 4OLWL 3U2IA 3NJXA 1KJ2H 4IBSA 2ED6A 2X7LB 4XAKD 1I8KB 5LB1A 3MJWA 4NZUH 4XRCB 4JCWA 1ZVHA 2I1JA 1R5LA 5KLVG 3T97A 3C2SA 2BCMA 1RZKH 3BOVA 3MRCA 4YVNA 2ARJQ 3AE8C 3FUKA 3PGFL 3VFVB 2G3NA 4G8IB 1JOCA 1BYOA 3GRWH 4DWHA 1CGVA 2G2RB 3BAEL 5DJDB 1JVKA 5I73C 2WHVA 4P2CG 4W9KC 1ADQH 1ZW0A 4P3DB 1MCOL 3T09A 4WW1B 3S37L 5HGAB 1LGHB 5FKAB 4FKKA 3V6OA 5AW4B 4D9LL 1SEQL 1KBWA 2BCKA 2D4FA 4M48H 3V9FA 3VTPC 2QQLL 3V6BR 3FTXA 1UGKA 2DL9A 3EAKA 4M5ZL 5CR1A 1EDLA 2GHWB 1LO4H 1W2EA 1NSNL 2Q1EA 4N2NA 2G3ZA 4LCWB 3RPIA 1OWAA 3A6BL 5FGCB 3WHXA 1JWUA 4U1LA 3ME0B 2M26A 2A9AA 4FOMA 5CJXC 5SV4A 5DJCA 4ZS6D 2WOYA 2N1KA 1OSPH 5IVNA 25C8L 4X6EA 1U30A 2G60H 3LKSB 3MA9H 4PJBA 3KM2A 2MPAH 2BASA 5BMFH 2IDCA 1PX8A 1JUNA 2E5EA 3UPCA 2N1TC 4KROC 3MJ8B 2R0WL 4H8UA 3HNTL 4DP2X 3FB8B 4S1SH 1CL7L 1FZMB 3L74D 2B4CH 4KPHH 4MJIE 3K46A 2V2WB 4KK9D 1OE3A 4FKHA 5K9JH 3ZKMC 3RWDB 4PJ8D 1NWQA 2BVYA 5INCB 2E74D 1AR1B 5D1XD 3K0WA 3QDGB 1GMJA 4AIEA 4JKWA 3ZYIA 4FADA 1BA9A 3Q01A 5E8PB 1I8UA 4XMVA 2IH1A 4FJZA 5DK2B 1WV7T 2HT3D 3QHFH 5TJWK 3HRZB 4LPCA 3ULAB 1TJIL 3V0IA 3LZQA 1TZAA 4WF7A 3EOTL 4ZODA 4HXAH 1G6RL 2DJ4A 1YNTA 4K9EC 5BUGA 1ZA3A 4KJPC 1XGTB 2WBJB 4KK8C 5IW3A 2G75B 4JZJB 5EU7C 4LVHB 4MNGE 2WBXA 1JM0A 1ZS8A 2Y2TA 4MA7H 2NXZD 3REWB 3RRQA 1GL2C 1LT9B 3NRFA 2VDOL 3L9YA 5EZJA 3CSYA 5LN8A 2RTTA 5B39B 2GIXA 4ES8A 1KXVA 2WWOA 1D9KC 2Z91A 3MRGB 1RIHL 2BNQD 1KUMA 3UTZB 2W8ZA 1SLQA 1A3LH 1RK0A 1EDYA 3M1BA 3TX4A 3MROB 5KVDL 2WSSH 2Q3EA 2EH8H 3MOBH 1N8OE 2OMXA 2AS5M 2WLNA 4M8QA 4M7ZB 3QI9C 4N2LA 2JCCB 3M7FB 5KOMC 3WIHA 4F2FA 1QLEB 2VRQA 1U3YA 2XWTB 1KELL 2WSFJ 1VKXB 4FQXB 2WN3A 4PP1D 4XPAL 3C2AH 1MCLA 5LXGH 2RFXA 3CD4A 5FHAH 3IJ8A 4OZGA 4YSPA 4MYWB 1XTLA 4HHAA 1U8KB 3DXAA 4AH2A 4GKGA 4I88A 3LN5A 1PD6A 3MLUL 3LEVH 4DPBX 3GXPA 3KYNB 4LOFA 5IMMA 1BQ5A 1RF0C 2YBGA 4G5ZL 4X80L 1XIWD 5C0BA 3AEBC 4AK2A 1GZQB 1YEJH 5D2LA 1N4XH 4GBXD 3T2PA 4WO4D 5E7BA 5JHAA 5KJ7A 3POHA 2JWAA 4FTVD 3NJNA 1TQUA 4KDVA 1KILA 3V8OA 2CO2A 3KWUA 5I2IA 3BRDA 4DGVL 1RZQA 4XXWC 2BWIA 4D9QD 3VXME 4DPRA 1MCDA 5C09E 1D6VH 4AYFB 1YEDB 4KMQA 4L8CA 1OCWL 2FEEL 4KK6C 1EANA 3HZKB 2FYUK 4WEEA 1GW0A 4JN2A 2E7MA 1IFGA 2DWEA 3FFCA 3FQNA 4G9DA 4K8RD 4JO8A 3GHGC 2Q6WA 4RMBA 3HTKB 5LWYH 1YY9C 2QADD 4F2MA 4TT3H 3HG1B 1A6ZA 4PCKA 3L7FA 2N3JA 5JUEL 3FWNA 5MEQB 1FZCC 1HHJA 3KL0A 4K71B 4K5NA 4PGZA 3LZPA 4LRIA 5LVEA 1FAVA 1G1JA 1JZFA 3VXRD 1R5SA 2K1MA 4LHUB 5J1TC 5H4ZA 4JRYA 3BE1H 5JHLL 2CLZB 1JGDB 5AYTA 4HS8L 4LPYA 2VT0A 3T5WA 1BAFL 4AXWB 3DVGA 3GHPA 2GABA 3P0YH 4P5TB 4GO8A 3DBXB 4BRVA 2L04A 3ZE0B 3IPBA 3WN5C 1L9RA 3CVHH 3GSNB 1G0XA 3MV01 4HKXA 3BH9A 2BRQA 2V3FA 4OM0H 4PJ5A 4RGMC 3VD5A 2EH7L 2KZ1B 3ATBA 4JFDB 1BJ1H 1G4RA 2UXFA 5AKRA 1JTPA 5ISZE 4PJCA 1TTCA 2VQ1B 2H5UA 2ZYDA 3WIIH 5DJZA 2FNBA 3Q6FB 1L6ZA 1IFNA 4X5RA 4F7EB 5JHMA 1GSKA 3WXWH 2XPGB 4O02H 4FNSA 4WUUD 4UM9B 2R29A 2XWJB 4MASA 4WAFA 4XX5A 3T77B 4OZFH 2VE6A 2W80C 2HRGA 3OC5A 4KHXH 3TEZA 1NJ9B 3MRPA 4MA3B 3JV0A 2IFFL 3D0VB 1OAQL 3B2VL 1X5GA 1RUAL 3LVTA 3RGVC 5E8DL 5PAZA 1XBDA 3EFOA 2ZOTA 3L4VA 3FH5A 1C7TA 3U0WL 4PJ9D 5EWIH 5BUPA 5ESAA 2ATKB 5GRYA 3Q8BA 1UT9A 4UT6A 3ZE1F 5KVEL 4JJ5A 5D7IF 3AY4A 3T0EE 1L5GB 4TL5A 5TH2B 1MLBA 3KGTA 4NO5B 2M5AB 4O2EA 3VXUA 4FZEL 4JPZB 3EADA 1F90L 3DSNB 4ZS7H 1QFUL 5FLVA 4NHCL 4TUUA 2CRMA 3ZTJG 5JDJA 3QIUB 3G6AA 4H20L 5E1IA 1PJWA 1LO3L 3U1PA 4E5XB 1QSEA 4YSQA 4XWGL 5H2FE 1OW0A 1KBVA 1YO4A 2KB7P 1MJUL 4PJAE 1T2QL 1LWJA 5HVWA 1RUQL 4JFPB 3ILQD 3JSVC 1JHLL 4NZRL 4Y9FA 5C97A 4G7YH 4JN1L 3NTCL 5E51A 4ZMQA 2WBKA 4EN3B 5HD8C 2R4SL 4YDLC 1DQDH 5D1ZB 1OL0A 3ARBA 3DGCR 2R0KH 5DVPA 3TPKA 1I3RB 1KB3A 2BP5M 4HJJL 5HYSA 3K4DA 4H8VA 3C5ZB 1RF1B 2YC1A 2EEFA 4U1KB 4RCAA 3TFKD 4JDVA 1FO0B 5TE4H 3H6PA 1YEFL 5E23A 1T89A 4IL6X 4XO9A 1MHPH 3EOAB 2V7QH 1FZKB 4BFEA 4UCFA 4AYBA 1M7XA 4QXGH 4OFPA 1XB6A 3QC6X 5MEPB 4TLKA 1P2CA 1EHXA 1F41A 2E9BA 5DT1L 1ZLWK 1BDYA 2AXJA 1FORL 1QG3A 5F6IB 1L0YA 5FGBA 2YAOA 2GI0A 3NRPA 2X6VA 3MAWA 1NJIQ 3GC3A 4Z95L 4E9WA 3UP6A 1QI5A 4UQ9A 3PWLB 1KB5B 2QBWA 4FQXD 1S7TA 1TFPA 3DO7B 4HLZH 3VNYA 3QDJE 3CVIH 3DJ9A 3ZDZE 1YJWP 3DRQA 1JZIA 4PV1D 4BH7A 2ZUQB 1AVYA 1JRHH 5F96L 2DYRB 3CFCH 3LDBC 4PJBE 3AY2A 4Y1TA 4Z3TA 3US1A 4OZIA 3SKMB 5CBAB 4ENED 2JSFA 5FO7B 4L3EB 4JE4B 1N0LB 4OBRA 2E6QA 1KYUA 4WCYH 3RZCA 3Q8FA 4NERA 1OE2A 1L0NE 4QRRA 1KSRA 3O8ZA 1J5OL 4CPGA 1U2CA 1F8TL 1MV8A 1GW4A 2AABH 2NMSA 4DO6A 3OKNA 2G3XA 3M91A 5I76A 2XJKA 2P24A 2PTUA 5A3IC 2V2TB 3NXSA 4A7VA 2ZE0A 3HJEA 2KS1A 3ZZLA 5FO9B 5KSVB 2VERN 1AH1A 4D6TD 4JQIA 1BMGA 2R3SA 4JG0L 5E8NB 5C6TL 1F2QA 2DI8A 4FQJH 1XL6A 2DKMA 2DD8L 4B27A 1AMYA 2H32H 3CC1A 4OH2A 1FSKB 1NCJA 3B5HA 2EXSA 2ITCA 3CFKB 5I5JA 4HWBL 3HG1D 5D71H 2YAPA 2CK0H 4NFDA 1YUHB 2VDQH 4YGVB 1EXUB 1ESOA 2K1AA 1KNOB 1ZHNB 3EH3B 3HNSH 4G7RB 2D03L 2FWLB 4QYOA 4UOJA 4ODTH 1LJ2A 2DZEA 4JR9L 4A68A 3FQYA 3VWJB 5ITBL 4LHUD 2Q8BL 1WCQA 4LSSH 4PJ7B 5D7LD 3TF4A 1F1GA 3RVVD 3FONB 3C8HA 1MLCA 3LMJH 2WTPA 3GG2A 1LP9B 3L9BA 3G5VB 4DOHE 1MCEA 1VFUA 3UO1L 2GIYA 3IF1B 2FFDA 3MOAH 5A7EA 2VR8A 2FUQA 3KZIH 2BNRA 3ILEA 5JPNA 1AQ8A 3I3BA 3M8OH 3ZKXB 3HG5A 4QTHA 1KIQA 2IAMA 5H2BB 1L0NJ 4AVKA 3T8MA 1FH5H 3ABZA 5E2TL 3KPQA 3CFNA 3DUSB 2GG1A 5LHDA 3QUMH 3VAEA 1T66C 2C3HA 4FXKB 2Z1KA 3CFBA 2ZJSH 3FCTB 1JYNA 3RFZA 1E50A 5AVTB 4XXDA 4EI6A 4LSQL 1Z0NA 5E08L 4KJWC 5F1KC 4UM9D 2J44A 1XH2A 5HHOE 2OYLA 3QUXA 1A8ZA 5AW6B 2OMTA 5J12B 3VW3L 2NDFA 2DQEL 1JWMB 3MBEB 4G6JL 4JRXD 4MAYD 1A4JA 5TDNB 4AW4A 4Z3EA 3HD7D 1RUKH 2P3YA 3V2QA 1KQGB 5EEVA 5C0BE 3EQ2A 2HVJA 5CMAB 1U36A 4Y4FB 1LNQA 4ONOA 3U30B 3V4VA 3A2AA 2CPBA 4U2ZA 5A2CA 3VJ6A 5CKAA 4JFQA 1KLGA 4OV5B 1KILE 3OZ9L 3FZUD 3R1GL 3B9KC 4LLMA 3T6VA 4J4PA 2XFXB 1U8QB 1VFAA 2R9HC 4NPKA 3CHQA 3RWHB 2BFVL 5D93C 4F7CA 3D2UB 4Z7VB 2PWEA 3QIUD 4NZTH 3RBSA 1JY2O 4ADGA 2MJZA 4Z7OE 1M7DA 3FFCE 2GHZA 4O58H 5MHSE 4QHMA 5F9OL 3S35H 1PNCA 4N24A 4U0RC 5FA3B 4PJHA 2NY0C 5DHVH 4F2ME 4XNBA 1TKWA 4KMTL 5IQOA 1GC1L 4GP5B 1JHTA 2B3IA 1P4LA 2JXMA 1OK0A 1S3KH 2CLRB 3LNEA 3IAPA 3KL3A 1F58L 1CXLA 1PF3A 1XXDC 15C8H 2FZ3A 4KFMA 4NI6A 4YO0A 5D1ZD 4ZTPH 4BFIB 2M83A 3KYKH 1R3LA 3G6JA 3C5ZD 1NTKK 4JRYE 4NLAA 1EGJL 2NPSB 1J5DA 4MMYA 4JFHE 4NQDA 1GSMA 3ESPA 3BGMA 1L0NG 3DI2B 4EZKA 5IFHL 3T6WA 4W7ZA 4AUJA 1AQHA 3CFEA 2IWFA 3K2IA 3RTQA 2IX7C 2CBMA 2A1WH 2IIJA 1EEYB 4PJ5E 3SO3B 5CEXA 4X9BA 3WNIA 1QLEL 5CSBA 2OFQA 4JZOB 2UV3A 2Z9TA 3U7WL 4M8VA 1M7LA 4PJCE 1NA8A 3BUYA 4P2QB 2MTPA 4J6RL 4GSDL 4X9IA 5L7XH 3FQWA 5GHWH 1U2HA 2DPKA 1I1FA 4OSUH 2QJPC 1AXIB 1N5YH 3CCSP 4D0CA 3WE1A 1N3NB 3WNJA 4NFCA 3KPNA 4G7QB 5AOZA 2X4OB 4AENB 1NGWB 4XP5H 1AHKA 5DLML 2KOGA 5EU3A 3MV7A 3VFWB 4RX4A 3VXTB 4S0HA 3CTTA 2CJSA 3OX8A 4GXVH 5CMZA 3QJUB 1Q1JH 2GAZA 3MDJA 3QO0A 3VXQA 4N8UA 3DI3B 4L1LA 1JBJA 1TNMA 1WIUA 5FYKE 2R5DA 1KJ2A 1N8ZB 1PPJD 4F27A 1ZHBB 2P8PB 3ABMB 4NZDA 1AP2B 1N7LA 4XPFL 1MI5A 5CS7A 1M1JC 5EORL 2VN7A 3VXUE 2DF3A 4LBEB 1JV5B 3BIAX 5EU4B 3VRLF 2VM4A 3PWUB 1VSCA 1ND0B 3T4AA 5AYQA 4EI5C 2FGWH 1GU4A 1ADQA 1IM3D 4KWUA 5EBMB 4AZ8A 4IBTA 4RLDA 3ASWA 1E2ZA 3FT1A 1ZLSL 4N0UB 4GINA 1JTTA 1K04A 2IDUA 2VXTL 4YDNA 3ZO9A 3V5BA 2BMKB 4L8DB 2CA4A 3HMXH 1NCBH 4OJEH 4Q58C 1OVZA 3N1MC 4QRTB 5CCKH 3TURA 2OK0H 1DQJA 2EXTA 3L5XL 3Q3DA 3D25B 1AS6A 2RBLA 3OQRA 3IWUA 4DIXA 2QJDA 2ZCHH 4LT7A 4KAQL 1LE5B 2W81C 2J88L 5E6IC 1IBDA 5H35A 3UGXA 2QQNH 5GSVB 1SZNA 2FO1A 5D2NB 3VX0A 1MG2C 2J57A 2G30A 3WNOA 4K3JL 2WXLA 3RY6A 3QUZA 1NEZB 2XPYA 1V3LA 3DX6A 3GSNL 1FA4A 4I77H 1JZ7A 2PYFA 4RGND 1NIBA 4KGLA 3QEQB 4PY8J 4WRLA 3D05A 2YPLB 1WK0A 4TTDD 3KWXA 1UFGA 2WSEH 2VUOA 2Q86B 3LNDA 1QVOA 1WGVA 2OV0A 4RGNE 4ZMTA 2FEDC 2YPVL 2F7PA 1GY1A 2OSYA 1NDGA 3MRNA 4PV8A 4DGYL 1GCFA 4Z7NE 3L2LA 4P46A 3BYYA 1U3HB 3P8MC 5F1SA 3UTSA 1BDDA 3SPCA 3BESR 1TTGA 1T1YA 5EF0A 4GUQA 4QHNA 1L4IA 1PD0A 5EOCH 5C0EA 1OTUC 2RHEA 5AL8A 1VQ9P 5DS8A 4DKTA 2K0RA 3GMNA 1E8XA 3BKMH 3ML9A 3SJVB 2EDRA 2FDBP 3B7YA 3KYOA 2F74B 1SOSA 5DURB 5CHXA 4MA8L 1B0GB 1I3VA 3HC0A 4OZIE 2DI9A 4UB6H 1UJTA 4E9XA 3WTSA 2WXRA 3CN2A 1RIUH 3F7VB 3QO1B 1QUPA 2HCZX 2FJSA 2P28B 1J0KA 3IKKA 2WXQA 4L1BA 1BVKA 1G9NH 1HQRB 1OCOB 3KLDA 1H3PH 4N90E 1VB9A 2E86A 1D7DA 1ZKAA 5FUOL 3E38A 2DYPD 2MCG1 3U4BH 3NZHL 1DFBH 1GPOL 5LXVA 5HJ3A 5IMOA 3WS6C 3RHWF 2NNXA 3TJHC 1PG7X 4PVLA 3ZR5A 3PYCA 3JV4B 1WA2X 1CK0L 2Y7NA 4L37B 3H25A 4ZUSB 5T1KD 3ULUD 1FIEA 2GA1A 4PY8I 5T3ZD 1IKNC 4D7PA 2K88A 1XXFC 3NPSC 3VNZA 1HQ4A 1IEBB 1JZ8A 3NIGF 3AU0A 5FM5O 1OTTC 1SS1A 3ARTA 4G8AC 1FO0L 5JQ6H 2O01J 1AD0A 1ZVYA 1E8ZA 4P0DA 2IPKA 4BFOA 4L3AA 2WVVB 3MLZL 1RULH 1XZ0B 5IV2B 3WTVA 4HKZH 3GSWA 4KO5A 5E2WL 2WYIA 3S3PA 4Z1PA 5J9PB 4N87A 5F9JB 1ETZA 4LL1A 1C1EL 4OGQC 2R0ZH 5D6CA 2D9QB 5CGYC 1K73Q 3MPCA 2PWGA 5TGBA 1KB5L 4IBLT 4P2QD 4PRNA 5LGJB 3J2PA 3ZT6A 2FLBT 4DUXA 4FQ2L 4UQIM 5IB1A 2G4EA 2LT9A 3EUDA 4MVBC 4YBLB 4F8TA 4QIRA 2OL3H 2GSGA 1QMUA 5F0PB 4PJ0E 4MS6A 3W1ZA 3JTTA 1IZNB 3MLYL 1WFNA 3P54A 1KV3A 4NQCA 1J1PL 4QCIB 3BATA 4MD4A 3P3YA 3WHE0 1KTDB 3F7YB 1H8NA 2LU5A 1Y47A 5LBSA 1HKFA 1I53A 3M45A 3GF7A 3EUUA 3NJKA 4UBDD 4X50A 1NGQL 3EHBB 5HYSG 4W6XB 1YN6B 1TQBC 2BY3A 3IEAA 5HHPB 2P47B 4M7JH 3F04A 5I1LA 1VDFA 5D1QA 1IAII 4AKOA 2GK0B 2A9NH 1OW8A 4ODUA 1E65A 5AVQB 1PZAA 1KCLA 3V2NA 1UXSB 4YDKL 4Q7DA 1TCMA 4JFEA 1VF5B 2WANA 4E68A 4OLYH 1YJDH 5I5IA 3C60D 1AE6L 5L2JB 3EGXA 2FAUA 3PU7A 3CVHA 1LTJB 1YEIL 1TZIB 3BPOC 2DKUA 1MW3A 1BJ8A 5FYLH 1A7QL 2R23B 2Y9ZA 1AKJD 3ATFA 3C6LA 1BZ9B 1RV6X 4U6VH 2QSVA 4G8GE 5BW7C 3HEIB 5DJ6A 3LKOB 2OTLP 4EBQH 4AQZA 3OLIA 4RAHA 1HGVA 2XN2A 1D6EB 5IOPA 1J8KA 3LW5J 1G87A 1HSAB 1L7TL 3G6JE 4MZ3A 4P57A 1P7KB 3AREB 4I1RA 4NN6C 4OZFA 3MNVA 1D5MA 2K7PA 3EYVA 3DX1A 3G08B 5KG9A 5J6SA 4NQDE 2NXYD 1SJEB 2E56A 2W5PA 4YK4B 5HGGS 5DDHB 4QMAA 3QDHA 3M07A 3FL7A 4HPYH 3WGUB 4A2EA 3D12B 4AIXA 2H6OA 4TXVB 1N0XL 1BBDH 2Z93B 1QRND 1QW9A 1ZT7A 2ENYA 3QEQD 3ATDA 3RKDC 3VACA 2G5RA 4FCHA 4GG6A 1XCQB 5EO9B 1ZXKA 2JDIH 2VQ4A 2DOCA 4POYA 2XNXA 4FHJA 3SE4A 4CC0A 2HMIC 3I9AA 4EUPB 1CB4A 1TR7A 5CR8A 5BXFB 1RJYA 1UASA 1KLUB 1KGJA 2ZNWA 2J8UF 2X0VA 4I87A 4MJ4A 5CGTA 5FXCH 5KJRH 1FNEA 4HIXH 3BLBA 1Z3RA 2R2EB 2YD9A 3PG2A 4IK6A 5AOJA 4JFXA 3POCA 3SJVD 3KEHA 4AYDC 1TQCC 1XQ4A 3KPSD 4N6QA 2IG2L 2LGNA 3WSQL 3QK0A 4JG9A 1MDTA 4NQED 3EDEA 2FYYA 5C8JB 1IBGH 1BGYD 4ZFFA 5LCVA 2FBOJ 4XNQB 5GGUA 2LW3A 4MNHB 5B22A 1JK8A 43CAA 4A6YH 2ZOLA 1SXNA 3L75D 3QFGA 4MZIA 1MI5E 4ZPTA 1CF8L 3GBMH 4YFLI 4LSTH 2ZWZA 2VDLH 4PRHA 3MBWB 3T0BA 4OCYH 3BRGC 4XC1H 1HL9A 3MUGB 2XX0A 4ELMB 1RZIA 4AGQA 1GOHA 3QUHA 1F11A 5EZPA 4PWIA 5APXA 4WHYH 3O6FA 1QI3A 4DK6A 1NQBA 3D50A 3L6FA 4S10A 1LM8V 1F4YL 5KZCB 2BVQB 4HPOL 1Z9SB 1HHIB 4GG8B 3PWVB 4KKCC 1K4DB 4KOBA 5GGVY 2XU9A 2BSDA 1P84H 4C47A 3MLXL 2ALWA 4EE2A 4NXSA 3MYJB 4WV1C 2OTKE 3AG4B 4LEXH 5I0VA 2VQUA 3IETA 1UQSB 4P2RE 4MKMA 3S5YA 3JQOB 4X5XA 3N4XA 3AQZA 2BRRL 1KCRL 2HSIA 3GXFA 3BSZH 3UX9B 2TRHA 3DIDA 5L9DH 4X4XB 3V4PA 2XRAH 3QIWA 4BH8B 5DSCB 3WS3B 1F4WH 2QGBA 4HB1A 4GXUM 3BAXA 2B2XL 1LQSR 2GK2A 1BLNA 2E8YA 1EHAA 1I7ZB 2GTWB 4ZO9A 3RB7A 3GMQB 2G5BB 4J3OC 3EBIA 1BGYJ 1CFVH 1ODUA 5L88L 3CC4P 5KVGL 4DKFL 1HAWA 4HZ1A 4L4VD 2R1YA 3ILDA 1U0QA 1XR8A 5FOJA 3RWJB 1H0DB 4OAWB 2HG5B 1LTTC 3TIDA 5CCGA 4XI5C 4XZ4A 4PJIA 2ZF9A 4R7DB 2M8RA 5KAFH 1MCSA 1KB9E 1I1YB 1YEHH 3STZA 5AKVA 5GS2D 4HD5A 4N2DA 3TO2B 4M1CD 3FTUA 3CMEP 1PGOA 4Y4HA 3EHBD 1S8DA 2UX7A 3WCYA 1AHWA 1H3GA 2XVGA 5E1HB 3WIFA 1BZDA 4ZMZA 5IGXL 3U1QA 5D8JH 3WL9A 3H0TB 3BD3A 1CTNA 5CLTA 1UWGH 3TP4A 2Y7SA 3ETBF 3QDAA 3RY5A 2C0WA 1KYAA 3RX5A 1GW3A 4NBYB 3QWNA 1NUDA 1E79H 3OKOB 2D7PA 1A6AA 4Z8FL 1Q9KA 3PV6A 4TUKL 1ES0A 5C6WH 2XIBA 2DQDH 2DLFL 2VLRB 3RTLA 3QRGH 1G5GA 4JX0A 4DQAA 3CHXA 1JN6A 1EXJA 2HVKA 4Q89A 4ATWA 4CGTA 3L9RA 3LRKA 2OGUA 2D3NA 5DD1L 3UZEC 1WTGT 3MJ7A 2FJFB 3MRQB 4XP4L 4IMKC 2M8XA 2ZKXA 1KC5L 4HJTA 4LU5L 5HDBB 3ARED 3K5RA 3FCSA 3L5WA 4PJGA 3VE0B 1CFQA 2FYUD 2YD3A 5GGVH 1TJGH 4IOSA 1CXFA 2B1AH 3CWGA 1FRGL 1OB1B 1BVZA 3IU4H 1KB9J 4Y1AE 5GGTL 3H6JA 1WFJA 5ICXA 2R56H 1BWMA 3KYMA 1DJZA 1G1OA 4GAFB 4IIQC 2F15A 3GM8A 2XWZA 2NNAB 2XVKA 3ULVF 1JPFB 3D48R 3BUBA 3SE3A 1U8PA 3FSZA 5HGBA 3SKOA 4P4KC 2VRSA 2X70B 2GT9A 1TO5A 1A7RL 4A2FA 2YMKA 1A21A 3F7PC 3SDXB 3HKZA 3NH7L 4QGYA 2WNKA 3CNKA 4MDJA 3SCMB 3OPUA 2NY5L 2J1XA 3JVGC 2CHXA 4NQCE 4AGPA 5KVFH 2NY2B 5CJQH 5L0QB 2XY1A 4GKZB 1W16A 5D70L 1ROWA 5LAXB 3FT3A 4XNDA 4N2GA 2A6KB 3NP3A 4H25A 4X0KB 5C0IA 2VDRB 4I0KA 3OAYH 4PMEA 4AQ1A 4NHUB 3SFEC 4RZCA 3TVMA 4YAQA 5MP6H 3OPZL 5BV7H 3QIBB 4ZS6C 3UIYA 4RWYL 2IFGA 5D1QE 1UCBH 3KLKA 5KSUB 2BS8A 3CFTA 1Z3GH 4CNIB 1GAFH 2C7UA 5BOZG 2IMMA 1B0WA 2VZ3A 1EAQA 3BZ5A 5ICZB 4MCMA 1QSVA 4JM2A 2AJZB 4M8RA 1MQKL 1EFXB 3OKEB 3I2CL 3TA3B 2WB1A 1PAZA 4OLEA 5F7LB 2ZUUA 1FDLL 1VESA 2BOLA 4N0YL 3SY6A 3U9PH 4HV8B 4M5YH 1KB9I 4W6YB 1PFIA 1H3TA 4Q9CA 3RILA 5IESL 1K5WA 1F00I 2JQAA 3C9NA 4KK9C 43C9B 5J6HA 2UZIL 2JKWA 1V10A 1P7QD 5EULV 3HCVB 2AXHA 2G9KA 5TQ0H 5AQ0A 2QHRL 2VAAB 4NGHH 4PJ8C 4DK5A 3U9WA 2E74C 4O2FA 1A7PL 4IRZL 5D1XC 2ZYAA 1CG9B 2DWXA 2WSCH 3HE4A 1EZUA 4OGYH 1SF3A 5JXAH 3QG7H 1E9QB 2FCBA 3F01A 5FO8B 1ZPUA 3TBCA 4K3DH 3ARFB 4CU8A 4A38A 1S7SB 4HOZA 1IAKA 3GKWH 3T3PE 1D2PA 2EIDA 1KENH 3BUIA 2HT3C 1K6QL 3HZVB 2JH2A 4NC1E 4LGPB 3QQDB 3H9HB 5BZWB 3QH3A 3X3GH 1Q9LA 2DAVA 4HC1H 3MBXL 4P06A 2ZXCA 3NIFB 3H8NA 1JF5A 2C5DC 4PRIB 1LK3H 4NM8H 3VCLA 3O8XA 5DK0A 1WHPA 2I9LB 3Q2WA 3MCYA 1FJKA 3OW2O 2NXZC 3FULA 3PNWA 1PYWA 3NJLA 5I16A 3CZLA 2PWDA 3C5XA 2QKIB 2IQ9H 4U6XA 5CSZB 3MGTA 4UINL 1PLBA 3N40F 4PVNA 4EPSA 1JNJA 4AG4L 3BWZA 5TDOA 1I7TB 5TFSH 1RD6A 1BIHA 3HMXA 4F7PB 1PBYA 3IAQA 4YTPC 2YEZA 4IJ3B 1F3RB 3EH2A 4FQIH 2CALA 4PIRF 3DMMA 3TZVB 4H8QA 2KXPB 2R2CA 3VDAA 2J58A 2WOBA 3CQPA 2IWKA 4PP1C 1VCAA 4ZNCA 3UBXI 3D5OF 3NG5A 1L3WA 4PSRA 4K3GA 3BKCL 3EOBA 3SWYA 3OF6D 3L70D 2AJSL 4PRHE 2HKHL 4RIRA 2R1XB 3BZFB 1DBMH 1XIWC 3BP6B 3DTDA 1ZRTD 2VB5A 5T1LB 4Z76A 1NFDF 1RIVL 1U92A 4GBXC 3X12A 1HINH 3UBXG 4WO4C 1UT2A 1KYOH 5LBGA 4FDWA 3BP4A 1DSYA 1FYHB 2A74B 2R59A 3CLFL 3LNGA 2ZCLH 4FG4A 2HKFH 5G5DA 4JFWA 4XB7A 3WJLA 2R69A 3RU8H 4WTZA 2LLLA 2AMUA 3TASA 1ZMEC 2MMXA 3THML 3S35X 4R4ND 4I7ZC 4C4UA 8PAZA 4B9FA 4R7VA 2HX8A 4LL9A 5IREA 3QGVA 1NGPL 3EO0B 1CLZH 3KPOA 2FYNC 2HFEB 1XGPA 4K8RC 4PCYA 3E3QE 3EYOA 2QADC 4MCYA 1WS8A 1KYOK 5ENWA 1Y8AA 4R26H 2ADJB 4XP1L 3D2TA 4HFUH 2IAAC 2IXQB 4YHKH 2P9RA 1N7ML 3H3PH 1FBIL 4MJIB 3FB5A 3KXDA 5KYNA 2F54D 3JWOC 2Q7YA 3QJQB 3HUJE 2X3BA 1SN2A 2YSSA 4FEMA 3APCA 4W4NA 5F7KC 4JO4L 4UM8A 3LIEA 1YNKL 2VDKH 3ARGD 3H4HA 3FN0L 2HLAB 1AQTA 1MFDL 3IDMB 4FX5A 1J05A 3AMLA 5CCGE 4PJIE 2HZHA 2AEMA 1ZEAH 2NY2D 1G7JB 1NL0L 5CCHD 2CHNA 5F1NA 4Z7UF 4EDXB 1U9KA 2OM5A 3K0YA 3L5JA 1IARB 4EDWL 4JF7A 4K5LA 5ALBH 1VPCA 1KTKE 1QX1A 4FFZA 2AXWA 2YWYA 3D39B 2MKVA 3QIBD 2IVFC 4OZFG 4OJFL 4X98A 2Y69B 4XVSL 1HGZA 5HP5A 4HUWB 1AZBA 1LD9A 3NAAH 4WI5A 4MNGB 5EA0H 3WGVB 2PTTA 1G7PA 3QEHA 4JO3L 4AGNA 2VOTA 2PO6B 2Y06L 3WYRA 2P49B 5TK2A 4QXTA 1GGUA 3VMYA 2PR4H 5KW9L 2EDYA 5EO1A 3KZIE 2HRPL 2IGFL 4PJ9C 1RHFA 2Y1YA 2OYHC 1KCWA 1W9XA 2DI7A 2NY1D 4DP1X 4TQIA 1MWOA 2YMXH 1DD3A 3RHWK 4LAQL 5DR5H 5KUMA 3ISYA 4XMZA 3K5BA 2CGYA 1HX0A 4KQ3L 1P1ZA 4N4YB 5FA4B 4WNQA 1SY6L 4NRYB 1E9OA 3CC5B 1A47A 1JMZA 4Q4IA 5CGMA 4I2XB 4PJGE 4ZFQA 4TSBH 2Q76B 5L8RJ 4NAJA 5AUMB 1MFUA 2VMCA 2I5YL 1LMIA 1EVTC 2JLLA 3ILQC 3FOLB 3ETTA 1T6VN 4DQOL 3NGBB 3PAZA 3QJZA 2OTJP 4I1NB 3TO4A 1AGCA 1MY7A 2X41A 1DJYA 1OVVA 1GC1C 5EF1A 1I8MB 1NMBL 1DUZA 1JDDA 3HNVH 4MQ7A 4PCSA 5I18L 5AZ2L 3O41A 2AEPL 4JZJC 4R97B 3SBPA 1IEHA 5I8KH 1S3JA 2XJLA 1NTKD 1OXZA 1NAKH 1RQ5A 1YPZE 1LT9C 1CGXA 4IGBA 4X6DF 2X53A 3KWWA 3JWDH 3WFEL 5BS0B 1NTZK 5EFIB 1N12A 2Z8RA 3KHQA 4LCCC 1IGIL 1N7SB 4WTQA 5C09B 1TTRA 4UZUA 1OSYA 1L0PA 1HYSD 4JBZA 1JRHI 3ZIMA 2OMUB 1BJMA 2ADFH 4BSVB 5LQBH 3I50H 2O6FA 3IFOA 5DRZA 4EIJA 1R5IB 1L4AB 2VISA 1QACA 4Y4KA 3MXWH 3TZVD 2FB4H 2KPWA 3VXPB 4FQXC 3H3BC 1MRFL 5KWYC 2Z31A 1BW8A 2XG4A 4PV1C 4MZRA 4HGMA 5C07D 2FK9A 4EOWL 3AS0A 2PW1A 3LKPB 1F4AA 1RJZB 3MLWL 1HDMA 1AXSB 1ZD6A 3MCLH 2FECL 1URLA 4ENEC 3IS1X 4FQLL 4Y2NA 4N2CA 5IUSA 3KHUA 3M06A 1VACA 3LSOA 2C3VB 5T33H 1NCTA 3DIVA 1ITCA 2JR8A 2XV5A 2H7HA 4QHLA 4F1SA 3NFQA 2V5SA 3VM7A 5CUSH 1NEPA 5CIPA 5IBTH 3UZQA 3TNUA 1ZR2A 3N0AA 3QJVB 3BD5A 4UV4L 4HWEH 3GSOB 4N2BA 4JJHA 5ISZB 3A0HE 4JQVA 1QUNA 3C09B 2APVA 2J5LB 4JY6A 3DOHA 3CV5A 2QT6A 1S7VB 1OVRA 5AAPA 3L3KA 5TDPB 3I56P 4NI3A 3QUYA 2HFED 1TMCB 3VFOB 1T6BX 1QTSA 1X5IA 2H45A 4JB9H 1RZPA 4LKXA 3W2DL 3AC0A 4Z77A 3U6XA 1C12A 1DBKH 1WAAE 4JLRA 2XIDA 4FE9A 1J88A 2N9BA 1L7IH 2F1EA 3Q2YA 3KPPB 3VFPB 4G9FA 2P8MA 2YEVB 3DX4A 3QUKB 4UQ3A 2NY4B 3VXNB 5LKNA 3L1OL 1MRDL 3K72A 4ZFGH 1T8ZA 1JNMA 1IC0A 1P6FA 3D34A 3T0EB 4XNXL 4XZUA 2VRKA 3RVVC 4GXUN 3G6DL 1WS7A 3LH8A 2XTSA 3IGAA 4U1GC 4DAGH 2BIPA 1LJMA 3QQ4B 4TSAH 5F7UA 1RVFH 3VI4F 5MENB 3MNWB 1GGBH 2DMHA 2F58H 2X6BA 1TQWA 4KXCA 2ZWYA 3LQAL 4MJ6B 5BVPH 2WZ0A 4GUOA 4LHJB 4XH2A 3V6FA 2QM8A 2DLGA 2Y22A 5D7KD 4D0BB 1A0QH 1JD7A 1MEXH 3U0TB 1AGEB 3OQ3B 3OSVA 1VIWA 3BT2L 2WLHA 3EFFB 4PJAB 3HZMA 3KDPB 2WXMA 4JL1A 3QWRD 3GS0A 4Z18A 3ML8A 1MHCA 1PJ9A 4M3HA 2ADYA 3D39D 1SFCB 1QLRA 2J25A 5JOPD 4BQ9A 1SMDA 3BFWA 3HAEA 2Z7YA 4WUKH 1NAFA 4A7GA 1WBYA 4JAMA 4WEUD 1CLCA 1WWCA 2RCSL 2SEBA 4XO5A 3PDOA 2DM4A 5LG1A 3UJTL 1YMME 5J3HD 4OD1H 2YNYA 2PO6D 1E30A 3T97B 3L4TA 2K8QA 4MAYC 2X4TA 1BVLA 4DP7X 3MRCB 3IGLA 1MUJA 3HD7C 5GRXG 5L6YL 3MHVA 2BZDA 2ZCZA 3E7JA 2NPLX 2QDWA 35C8H 4CJ1A 5CZVL 1DD4A 2QGDA 1TFHA 2RACA 2IMNA 2BCKB 3ET9F 1A4KA 3FQRA 4FMVA 1KGXA 1RH8A 4I2LC 3FZUC 4H0GA 4H7VA 4I48A 4XN7A 5ADPH 1OARL 5FF6A 4ZUTA 1DBBH 1ECYA 1KTRL 1WE5A 1WBZA 4F58L 1ZXGA 1JWUB 2VO8A 3E2HB 3L9EA 2X2YA 3QIUC 4U1LB 3NJHA 3RQ3A 5B8CA 4ACPA 5DJCB 2Y1ZA 5H37A 1NBCA 3ZDZB 3B2XA 5HHVH 4X6EB 5AL0A 5SWZA 4Y2OA 3O9WA 4PRPA 5A1AA 4PJBB 1BXUA 1Z0MA 3Q44A 4KZDH 4UB6E 3KPTA 4AMKH 1MY5A 1URZA 2OX5B 5AAMC 4JQXC 4KX7A 3CC7P 1S4XA 2HFFA 1NU1K 2DJUA 3TOPA 4NJAH 5D1ZC 1B6UA 3I02A 4TRPL 5AW7B 4JO2H 4LSUL 5LNGA 1RF1C 4U7MA 3LPGA 2C0XA 4XMXA 2CCVA 1B3IA 2QSCH 1UA6H 5BS0D 2W83C 3QXUA 2ISDA 2WPRA 2IDBA 1D5RA 4Z78B 4QLRA 4TVPE 4X8GA 4AM0A 2J12B 1H8OA 2FH6A 5SWSD 2PLTA 1M57B 2ENJA 3OMNB 1KIPA 2ICWA 5E0FA 1HCZA 4NWTL 3HUSA 5DZPA 1X4ZA 2IH1B 3P11H 4UT9H 2N7AA 3H4FA 4MYPA 2CKNA 4BRJA 1L4AD 5CWSA 4AV4A 3GPSA 2WSEJ 4IQHA 4FLSA 5C0AA 4XP9H 4U6YA 4NKIH 4N2FA 1YNTB 2W6JH 1ZA3B 1ZS8B 5EOCJ 3CX2A 4U3SA 3ITKA 1VQNP 3QJHA 4I4WA 3L45A 4DEWA 3G5ZA 4DOHB 3MFFA 5EZJB 3NK3A 4X6CA 3CSYB 3KCPA 4OT1L 3RBXA 2Z91B 3C6SA 1KF9B 2H47C 1QQDA 3AE7C 1RK0B 2XTJD 3M1BB 3G71P 4YSSA 1AACA 4KZEL 5C3LD 4WK4B 2HLEB 3UYOD 4M1GH 1GYCA 1T0MA 3HFFA 2HN7B 5IQMA 2IWEA 2OMXB 4M8QB 5GGQH 3CK0H 4N1EA 4BUQA 3Q2NA 5HYFA 2RALA 2W9EL 2PYED 4NO2A 1S9YA 5J1AA 2VM3A 1KBBA 3WNPA 1W72A 3ULVH 2H3XC 3S36X 5FUZL 4Z3HA 1PG7W 4HBCL 4CVZA 2A6DA 4YIQA 2RFXB 4F33A 1MN4A 3FPXA 1AOZA 4OZGB 2XZCL 4HHAB 3DX9A 2K45A 3DXAB 3WAJA 4AH2B 4Z7AA 3IVKA 3LN5B 2EVJA 3AEAC 2EP6A 5IMMB 2F5BL 4K94L 2CU9A 5C0BB 3BVWA 2NR6A 5JNYA 2FH8A 1CXHA 1JJUA 5D2LB 3NTNA 1K9MQ 1E8WA 3GBNL 3KDMA 4WWKD 2AK1L 2BVTA 2FKWB 3F05A 1EPFA 3D3VD 4CN1A 1Q2NA 4F91B