5AX8A

Recombinant expression, purification and preliminary crystallographic studies of the mature form of human mitochondrial aspartate aminotransferase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
401
structure length
401
Chain Sequence
b'SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase, mitochondrial
publication title Recombinant expression, purification and crystallographic studies of the mature form of human mitochondrial aspartate aminotransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5ax8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ax8A01
1B9HA 4EU1A 2HP2A 3WGBA 3FFRA 3FZ8A 3CBFA 2X3LA 3RI6A 1VP4A 1RVUA 3QPGA 4OBUA 1O4SA 2CSTA 1AY8A 3FVXA 8AATA 2VMSA 2Z67A 4N0WA 2AEUA 2ZJGA 1G7XA 3GJUA 3WCNA 5FT8A 3DXVA 4E3RA 2Z61A 3DC1A 2HOYA 3E2ZA 4OC9A 4RAEA 1X0MA 2AY6A 4LNJA 3WLXA 1IX6A 3ASAA 2X8UA 3A9ZA 1CL2A 2PB0A 4WB0B 1GD9A 4DQ6A 4GDYA 3LVLB 4JEXA 3P6KA 2Z9VA 4TMRA 4LW4A 3VK2A 4IXZA 3OP7A 4MKKA 4JF1A 4B9BA 5FT5A 1RV4A 5M46A 2YHKA 2YOBA 4ZWMA 4Q6RA 1I43A 1GC3A 3KE3A 4GEBA 3FZ6A 1V2FA 4IXOA 4K2BA 3BC8A 4K2IA 4F5IA 2VMQA 1IAXA 2VGSA 2Z9XA 4A0FA 3AELA 2VMPA 4RIZA 1QITA 2BI5A 3TCMA 4AO9A 4BHDA 3TFUA 3PAAA 3TFTA 3FD0A 1M0OA 2D64A 2EO5A 3E2ZB 1ELUA 3GR9A 3FQAA 2ZY3A 4OYTA 4K2MA 4IYOA 1UKJA 3MKJA 3AENA 3IF2A 4WLHA 3MAFA 2BI3A 3MBBA 2QB2A 4M2MA 2BI2A 5DB5A 3HBXA 2AATA 1E5EA 2O1BA 3FSLA 4ZM3A 4AZJA 2VGWA 1C7NA 4NOGA 2V0YA 5FT4A 5AX8A 1JF9A 1W7NA 3PDBA 1AICA 1KKJA 3E77A 4MGRA 4MY5A 1IBJA 4GE4A 2EPJA 3GWPA 1KKPA 3WZFA 1AMQA 1ZC9A 3OKSA 4A6UA 4BQ0A 1YAAA 1ELQA 1N8PA 2E7JA 2W7HA 1ECXA 2W7IA 3QN6A 4U2HA 2CANA 2W8TA 1SZUA 3FZ7A 4F5MA 1BJOA 3DR4A 3A9XA 4W8IA 1TOEA 1E5FA 1CQ6A 4IYOB 3AENB 5G4JA 1AHYA 2YKUA 3E2YA 1N2TA 3G0TA 1GEWA 4MQRA 3N0LA 2WKAA 1OXOA 2W7MA 3B1DA 2W7LA 3VP6A 3FQ8A 4HVKA 2ZP7A 5EIGA 1TPLA 5I92A 1KL2A 3RBFA 3JZLA 4W91A 4ZASA 2O7CA 3ELEA 3F0HA 3H14A 3QGUA 4EMYA 1MLYA 3PDBB 4IW7A 3NX3A 3BWNC 3QI6A 3AEMA 1MLZA 3ZRQA 4JEYA 3LWSA 4ITXA 1ASFA 2QBTA 4EB5A 3FTBA 3PGYA 3WKSA 3ZZJA 2AY4A 2VMZA 2GB3A 1KL1A 4ZWVA 2HUIA 3FVUA 2PO3A 2VGZA 3JU7A 3EI5A 4U1TA 5M4DA 1D7VA 4BMKA 1BJOB 1YIZA 4RM1A 1AHEA 1ARSA 1BJWA 1IJIA 1WYVA 2JJHA 2VYCA 4ZDPA 1OATA 3FDDA 1B5PA 3AEJC 2OGAA 4AH3A 3VK3A 3B8XA 3Q8NA 4J5UA 3AATA 4KAMA 1MAQA 2EZ2A 3FKDA 4OT8A 3NDNA 4BA4A 4F5JA 3RQ1A 3JWBA 4WLJA 5DX5A 5G4IA 4AZKA 1M32A 1SF2A 2DKJA 3HMUA 1N31A 2OQXA 4BA5A 2HOZA 3WGCA 4CVQA 3EI8A 1MDZA 4EFFA 2HOXA 1I41A 2R0TA 3B1CA 4JF0A 2XH1A 2BI1A 2EZ1A 3BCAA 2YRRA 4W1XA 5J8QA 3TATA 1BQDA 1AHFA 1C4KA 1MAPA 1TOGA 2DOUA 4IXSA 4WYDA 2DGKA 2VLFA 2JGTA 4E77A 2ZSLA 3HDOA 3BS8A 5HHYA 1C7GA 1QZ9A 5G0AA 4Q31A 4RKCA 4XJPA 2OKKA 1M4NA 4O6ZA 3KGXA 1T3IA 1AAWA 2VMVA 2D7ZA 2GSAA 3N75A 4M2KA 3ATHA 4F5GA 1GCKA 3GSBA 2G6WA 4P7YA 5G2PA 4JE5A 3UWCA 4A6TA 4MQQA 4AO4A 4ZDOA 1GEXA 1RV3A 2D65A 1GC0A 3E9KA 5F8VA 1KMJA 3DU4A 3AEMC 3EUCA 1ASAA 3JTXA 2OKJA 2BWNA 1ASLA 4MSOA 1AIBA 3ZZKA 1DKAA 2E7IA 1Z7DA 4WBTA 4A6RA 4B98A 4A00A 2BI9A 3NU7A 2BIGA 2FN6A 3ELPA 2VMNA 1WYTA 1QGNA 2V1PA 4M2JA 4TV7A 5C6UA 1EQBA 3AEOA 3H7FA 3B1EA 3B46A 1PG8A 3NYUA 1O61A 2QLRA 3F6TA 1AKAA 3WX9A 4AOAA 2FNUA 1LW5A 1TOJA 2JJEA 2GQNA 3BWNA 1QISA 4LW2A 4WYFA 3DXWA 4KYOA 1AHGA 1FC4A 3GZCA 1BS0A 1EG5A 4GSAA 1C7OA 2BYLA 1AMSA 1IX8A 3FQ7A 4GRXA 4A0GA 1GEYA 3ECDA 4JEZA 2HUUA 1ARHA 1BT4A 1C0NA 2JJGA 3W1JA 2JISA 2W8JA 3I5TA 1S09A 1BJ4A 4UHMA 4XJMA 5LH9A 3HL2A 1TASA 1ASDA 4JEVA 1S08A 3NUBA 3PIUA 3AEJA 4ADDA 1SPAA 2ZUKA 1ASEA 4Q76A 1AMRA 2QMAA 9AATA 2CY8A 3MAUA 1M6SA 3LVMA 4KXKA 1M0PA 3I4JA 2ZY2A 3RBLA 4LNLA 1ASMA 1JG8A 2AY8A 2HORA 1QJ3A 1PMOA 2DGMA 4DBCA 4L0OA 2C44A 4W1WA 3USFA 4OTLA 4IX8A 5K8BA 3F9TA 5DJ1A 2YKXA 2W8VA 2W7FA 1AKBA 1DJUA 1ASNA 3R4TA 4OBVA 2F8JA 3FVSA 5DJ9A 3MAFB 5EUDA 3QM2A 1CS1A 1W7MA 2C0RA 3VAXA 1ARTA 1AIAA 5EFSA 2D63A 2CH1A 4ZSWA 2BIEA 3KGWA 2BKWA 1RVYA 2FQ6A 2YCTA 3JW9A 4A0RA 3WY7A 1AY5A 4WYAA 3ZRPA 3A8UX 4R8DA 3E6GA 1GC2A 3G8MA 2CFBA 2ZC0A 5EAAA 1UU1A 2VMTA 2VGVA 2AEVA 3ASBA 3HLMA 2JJFA 4EB7A 1M7YA 1AJRA 2ZY5A 2WK9A 3GZDA 1B5OA 1YOOA 1JS6A 4GE9A 1YJSA 4UHOA 1X28A 1ORDA 4E1OA 4ATPA 4H51A 5G2QA 2CB1A 3UAKA 2DGLA 1V72A 4J8LA 3II0A 4P3MA 2BWPA 3BWOA 1WKGA 3DYDA 2FYFA 2BIAA 5EIGB 4ZDLA 1ARGA 3QBOA 2E7UA 3QHXA 1CL1A 1S0AA 3R9AA 3DZZA 3PA9A 1VJOA 2CJDA 4I8AA 4ADEA 1IVRA 4GE7A 3LVJA 4ISYA 2AY9A 4JEWA 1QJ5A 2D66A 1G4VA 1GC4A 3FRKA 3LG0A 4RKDA 3UE8A 3EZSA 1WYUA 2FNIA 1C9CA 1OHWA 2R5EA 4JE5D 4XJOA 4CXRA 1D2FA 2WK7A 1AHXA 1WSTA 1SVVA 2QA3A 1DFOA 3PDXA 1VEFA 1MDOA 1ZOBA 2YCNA 2ZSMA 1G7WA 1CJ0A 3FFHA 1WYVB 4W5KA 2GMSA 2CJGA 3DRDA 3HQTA 3MADA 2CTZA 2AY5A 2VMXA 4OMAA 1YNUA 1ASBA 5EAVA 2HUFA 4HF8A 1O69A 4XJLA 4E3QA 3EIBA 4FL0A 3CQ5A 4WP0A 5IWQA 3AV7A 1BW0A 2D7YA 4F5LA 1YIYA 4RJYA 3T32A 3EZ1A 1LW4A 3NNKA 3RUYA 3MC6C 2D5YA 1DJ9A 3NRAA 4PFFA 1FG3A 1H1CA 5G09A 1WYUB 3GZDC 5FT6A 1CQ8A 2X5DA 1D7SA 1DGDA 3VK4A 3GETA 3LV2A 3NYSA 1MDXA 3E2FA 1LS3A 2CJHA 2W8WA 4RJ0A 1XI9A 2PB2A 1BQAA 3NUIA 1IUGA 4ADBA 1G4XA 1ZODA 2VMOA 1LC8A 1YJZA 1YJYA 2OATA 2W7JA 2YKVA 4PIWA 4Y0DA 5M4BA 1TATA 3KKIA 2VGTA 1AMAA 2QB3A 4F5HA 2R5CA 3A9YA 1TARA 3LY1A 4A0HA 3AOVA 4ADCA 1P3WA 1UU2A 2W7GA 1GDEA 4LC3A 2VIBA 2W7EA 4PVFA 1V2EA 2C81A 1J04A 1IAYA 3ACZA 3BN1A 4WXFA 3NTJA 1WYTB 3BCBA 3FCRA 1S07A 4Q75A 1AY4A 5BJ3A 4R5ZA 3CAIA 1LKCA 1M0NA 1FG7A 5EQCA 1JS3A 2AY2A 3DR7A 4ZLVA 3PD6A 3ZRRA 5BJ4A 1U08A 2WK8A 4OCAA 1B8GA 1MGVA 2VIAA 3G7QA 3RCHA 1M0QA 2D61A 2ORDA 3W1HA 3L8AA 4W1VA 4WD2A 5EUEA 4XQ2A 2W7DA 2R5CB 1ASCA 3L44A 2NMPA 4N0BA 4UOYA 1CZCA 1B9IA 4FFCA 4A72A 2VI8A 1W7LA 1V2DA 1D7RA 2E54A 3DODA 1ASGA 4ZM4A 5EUNA 4F5FA 2YRIA 2W8UA 2VMWA 3P1TA 1I48A 1QIRA 2JG2A 5D95A 1LK9A 2R2NA 3I16A 3WKRA 2AY7A 4WYCA 3VOMA 1H0CA 1SFFA 1EJIA 4XAUA 1DTYA 3N5MA 3WCOA 4R2NA 3IHJA 3K40A 3PD6B 5LHAA 4MKJA 1OXPA 3ISLA 2GMUA 2HP1A 2AY3A 2Z1ZA 4TN4A 1AKCA 5E4ZA 3RCHB 4CXQA 2Z1YA 3A2BA 2CINA 3FDBA 3MC6A 2RFVA 2ZYJA 3NU8A 4ZSYA 3M5UA 2ZY4A 3CQ4A 2VMRA 1GBNA 4ZAHA 3D6KA 3EI6A 3TQXA 2OGEA 3EI7A 4MQPA 4WYEA 4WXGA 4F5KA 5HXXA 2Z20A 3PJ0A 5TF5A 1PFFA 1D7UA 1UU0A 1LC7A 2Z9WA 3NYTA 4Y0IA 4ATQA 2YKYA 5F9SA 4F4EA 1DGEA 2Q7WA 1WKHA 2TPLA 5HDMA 2YCPA 1CQ7A 2VGUA 4LNMA 4XK1A 5E5IA 1S06A 1CZEA 4UHNA 1I29A 2BWOA 1Z3ZA 1OHYA 3PPLA 1XEYA 5D5SA 2VLHA 4DGTA 1W23A 4PFNA 5M49A 1AJSA 3CQ6A 3EIAA 2Z9UA 3HVYA 1AAMA 1B4XA 1OHVA 1SZSA 2EH6A 3K7YA 1ARIA 1DJEA 1KMKA 2AY1A 4RLGA 2W7KA 1J32A 4Y0HA 2DR1A 4XEWA 1SZKA 1BKGA 4CBRA 4WXBA 4QGRA 1X2AA 7AATA 2BHXA 2DKBA 3JWAA 3COGA 1IX7A 2HZPA 2VMUA 2O0RA 3BV0A 5E3KA 3MEBA 4UQVA 1O62A 2CH2A 3AEPA 2X5FA 5JAYA 4ITGA 1TOKA 3BCXA 3EI9A 2VMYA 3AOWA 2VI9A 1W3UA 2EGYA 1PMMA 2BYJA 1AX4A 3GBXA 4RITA 3HT4A 4R5FA 4WYGA 3W1IA 4WB0A 1AJSB 1BJNA 2FM1A 3BB8A 1TOIA 3LVKA 1X29A 1LC5A 4CBSA 3K28A 4IY7A 2C7TA 2XBNA 1Y4IA
chains in the Genus database with same CATH superfamily
1B9HA 4EU1A 2HP2A 3WGBA 3FFRA 3FZ8A 3CBFA 2X3LA 3RI6A 1VP4A 1RVUA 3QPGA 4OBUA 1O4SA 2CSTA 1AY8A 3FVXA 8AATA 2VMSA 2Z67A 4N0WA 2AEUA 2ZJGA 1G7XA 3GJUA 2KFPA 3WCNA 5FT8A 3DXVA 4E3RA 2Z61A 3DC1A 2HOYA 3E2ZA 4OC9A 4RAEA 1X0MA 2AY6A 4LNJA 3WLXA 1IX6A 3N4XA 3ASAA 2X8UA 3A9ZA 1CL2A 2PB0A 4WB0B 1GD9A 4DQ6A 4GDYA 3LVLB 4JEXA 3P6KA 2Z9VA 4TMRA 4LW4A 3VK2A 4IXZA 3OP7A 4MKKA 4JF1A 4B9BA 5FT5A 1RV4A 5M46A 2YHKA 2YOBA 4ZWMA 4Q6RA 1I43A 1GC3A 3KE3A 4GEBA 3FZ6A 1V2FA 4IXOA 4K2BA 3BC8A 4K2IA 4F5IA 2VMQA 1IAXA 2VGSA 2Z9XA 4A0FA 3AELA 2VMPA 4RIZA 1QITA 2BI5A 3TCMA 4AO9A 4BHDA 3TFUA 3PAAA 3TFTA 3FD0A 1M0OA 2D64A 2EO5A 4H63Q 3E2ZB 1ELUA 3GR9A 3FQAA 2ZY3A 4OYTA 4K2MA 4IYOA 1UKJA 3MKJA 3AENA 3IF2A 4WLHA 3MAFA 2BI3A 3MBBA 2QB2A 4M2MA 2BI2A 5DB5A 3HBXA 2AATA 1E5EA 2O1BA 3FSLA 4ZM3A 4AZJA 2VGWA 1C7NA 4NOGA 2V0YA 5FT4A 5AX8A 1JF9A 1W7NA 3PDBA 1AICA 1KKJA 3E77A 4MGRA 4MY5A 1IBJA 4GE4A 2EPJA 3GWPA 1KKPA 3WZFA 1AMQA 1ZC9A 3OKSA 4A6UA 4BQ0A 1YAAA 1ELQA 1N8PA 2E7JA 2W7HA 1ECXA 2W7IA 3QN6A 4U2HA 2CANA 2W8TA 1SZUA 3FZ7A 4F5MA 1BJOA 3DR4A 3A9XA 4W8IA 1TOEA 1E5FA 1CQ6A 4IYOB 3AENB 5G4JA 1AHYA 2YKUA 3E2YA 1N2TA 3G0TA 1GEWA 4MQRA 3N0LA 2WKAA 1OXOA 2W7MA 3B1DA 2W7LA 3VP6A 3FQ8A 4HVKA 2ZP7A 5EIGA 1TPLA 5I92A 1KL2A 3RBFA 3JZLA 4W91A 4ZASA 2O7CA 3ELEA 3F0HA 3H14A 3QGUA 4EMYA 1MLYA 3PDBB 4IW7A 3NX3A 3BWNC 3QI6A 3AEMA 1MLZA 3ZRQA 4JEYA 2WB6A 3LWSA 4ITXA 1ASFA 2QBTA 4EB5A 3FTBA 3PGYA 3WKSA 2G7JA 3ZZJA 2AY4A 2VMZA 2GB3A 1KL1A 4ZWVA 2HUIA 3FVUA 2PO3A 2VGZA 3JU7A 3EI5A 4U1TA 5M4DA 1D7VA 4BMKA 1BJOB 1YIZA 4RM1A 1AHEA 1ARSA 1BJWA 1IJIA 1WYVA 2JJHA 2VYCA 4ZDPA 1OATA 3FDDA 1B5PA 3AEJC 2OGAA 4AH3A 3VK3A 3B8XA 3Q8NA 4J5UA 3AATA 4KAMA 1MAQA 2EZ2A 3FKDA 4OT8A 3NDNA 4BA4A 4F5JA 3RQ1A 3JWBA 4WLJA 5DX5A 5G4IA 4AZKA 1M32A 1SF2A 2DKJA 3HMUA 1N31A 2OQXA 4BA5A 2HOZA 3WGCA 4CVQA 3EI8A 1MDZA 4EFFA 2HOXA 1I41A 2R0TA 3B1CA 4JF0A 2XH1A 2BI1A 2EZ1A 3BCAA 2YRRA 4W1XA 5J8QA 3TATA 1BQDA 1AHFA 1C4KA 1MAPA 1TOGA 2DOUA 4IXSA 4WYDA 2DGKA 2VLFA 2JGTA 4E77A 2ZSLA 3HDOA 3BS8A 5HHYA 1C7GA 1QZ9A 5G0AA 4Q31A 4RKCA 4XJPA 2OKKA 1M4NA 4O6ZA 3KGXA 1T3IA 1AAWA 2VMVA 2D7ZA 2GSAA 3N75A 4M2KA 3ATHA 4F5GA 1GCKA 3GSBA 2G6WA 4P7YA 5G2PA 4JE5A 3UWCA 4A6TA 4MQQA 4AO4A 4ZDOA 1GEXA 1RV3A 2D65A 1GC0A 3E9KA 5F8VA 1KMJA 3DU4A 3AEMC 3EUCA 1ASAA 3JTXA 2OKJA 2BWNA 1ASLA 4MSOA 1AIBA 3ZZKA 1DKAA 2E7IA 1Z7DA 4WBTA 4A6RA 4B98A 4A00A 2BI9A 3NU7A 2BIGA 2FN6A 3ELPA 2VMNA 1WYTA 1QGNA 2V1PA 4M2JA 4TV7A 5C6UA 1EQBA 3AEOA 3H7FA 3B1EA 3B46A 1PG8A 3NYUA 1O61A 2QLRA 3F6TA 1AKAA 3WX9A 4AOAA 3H9XA 2FKIA 2FNUA 1LW5A 1TOJA 2JJEA 2GQNA 3BWNA 1QISA 4LW2A 4WYFA 3DXWA 4KYOA 1AHGA 1FC4A 3GZCA 1BS0A 1EG5A 4GSAA 1C7OA 2BYLA 1AMSA 1IX8A 3FQ7A 4GRXA 4A0GA 1GEYA 3ECDA 4JEZA 2HUUA 1ARHA 1BT4A 1C0NA 2JJGA 3W1JA 2JISA 2W8JA 3I5TA 1S09A 1BJ4A 4UHMA 4XJMA 5LH9A 3HL2A 1TASA 1ASDA 4JEVA 1S08A 3NUBA 3PIUA 3AEJA 4ADDA 1SPAA 2ZUKA 1ASEA 4Q76A 1AMRA 2QMAA 9AATA 2CY8A 3MAUA 1M6SA 3LVMA 4KXKA 1M0PA 3I4JA 2QSRA 3RBLA 4LNLA 2ZY2A 1ASMA 1JG8A 2AY8A 2HORA 1QJ3A 1PMOA 2DGMA 4DBCA 4L0OA 2C44A 4W1WA 3USFA 4OTLA 4IX8A 5K8BA 3F9TA 5DJ1A 2YKXA 2W8VA 2W7FA 1AKBA 1DJUA 1ASNA 3R4TA 4OBVA 2F8JA 3FVSA 5DJ9A 3MAFB 5EUDA 3QM2A 1CS1A 1W7MA 2C0RA 3VAXA 1ARTA 1AIAA 5EFSA 2D63A 2CH1A 4ZSWA 2BIEA 3KGWA 2BKWA 1RVYA 2FQ6A 2YCTA 3JW9A 4A0RA 3WY7A 1AY5A 4WYAA 3ZRPA 3A8UX 4R8DA 3E6GA 1GC2A 3G8MA 3N4RA 2CFBA 2ZC0A 5EAAA 1UU1A 2VMTA 2VGVA 2AEVA 3ASBA 3HLMA 2JJFA 4EB7A 1M7YA 1AJRA 2ZY5A 2WK9A 3GZDA 1B5OA 1YOOA 1JS6A 4GE9A 1YJSA 4UHOA 1X28A 1ORDA 4E1OA 4ATPA 4H51A 5G2QA 2CB1A 3UAKA 2DGLA 1V72A 4J8LA 3II0A 4P3MA 2BWPA 3BWOA 1WKGA 3DYDA 2FYFA 2BIAA 5EIGB 4ZDLA 1ARGA 3QBOA 2E7UA 3QHXA 1CL1A 1S0AA 2A1VA 3R9AA 3DZZA 3PA9A 1VJOA 2CJDA 4I8AA 4ADEA 1IVRA 4GE7A 3LVJA 4ISYA 2AY9A 4JEWA 1QJ5A 2D66A 1G4VA 1GC4A 3FRKA 3LG0A 4RKDA 3UE8A 3EZSA 1WYUA 2FNIA 1C9CA 1OHWA 2R5EA 4JE5D 4XJOA 4CXRA 1D2FA 2WK7A 1AHXA 1WSTA 1SVVA 2QA3A 1DFOA 3PDXA 1VEFA 1MDOA 1ZOBA 2YCNA 2ZSMA 1G7WA 1CJ0A 3FFHA 1WYVB 4W5KA 2GMSA 3N7NA 2CJGA 3N4SA 3DRDA 3HQTA 3MADA 2CTZA 2AY5A 2VMXA 4OMAA 1YNUA 1ASBA 5EAVA 2HUFA 4HF8A 1O69A 4XJLA 4E3QA 3EIBA 4FL0A 3CQ5A 4WP0A 5IWQA 3AV7A 1BW0A 1KAFA 2D7YA 4F5LA 1YIYA 4RJYA 3T32A 3EZ1A 1LW4A 3NNKA 3RUYA 3MC6C 2D5YA 1DJ9A 3NRAA 4PFFA 1FG3A 1H1CA 5G09A 1WYUB 3GZDC 5FT6A 1CQ8A 2X5DA 1D7SA 1DGDA 3VK4A 3GETA 3LV2A 3NYSA 1MDXA 3E2FA 1LS3A 2CJHA 2W8WA 4RJ0A 1XI9A 2PB2A 1BQAA 3NUIA 1IUGA 4ADBA 1G4XA 1ZODA 2VMOA 1LC8A 1YJZA 1YJYA 2OATA 2W7JA 2YKVA 4PIWA 4Y0DA 5M4BA 1TATA 3KKIA 2VGTA 1AMAA 2QB3A 4F5HA 2R5CA 3A9YA 1TARA 3LY1A 4A0HA 3AOVA 4ADCA 1P3WA 1UU2A 4K05A 2W7GA 1GDEA 4LC3A 2VIBA 2W7EA 4PVFA 1V2EA 2C81A 1J04A 1IAYA 3ACZA 3BN1A 4WXFA 3NTJA 1WYTB 3BCBA 3FCRA 1S07A 4Q75A 1AY4A 5BJ3A 4R5ZA 5KTBA 3CAIA 1LKCA 1M0NA 1FG7A 5EQCA 1JS3A 2AY2A 3DR7A 4ZLVA 3PD6A 3ZRRA 5BJ4A 1U08A 2WK8A 4OCAA 1B8GA 1MGVA 2VIAA 3G7QA 3RCHA 1M0QA 2D61A 2ORDA 3W1HA 3L8AA 4W1VA 4WD2A 5EUEA 4XQ2A 2W7DA 2R5CB 1ASCA 3L44A 2NMPA 4N0BA 4UOYA 1CZCA 1B9IA 4FFCA 4A72A 2VI8A 1W7LA 1V2DA 1D7RA 2E54A 3DODA 1ASGA 4ZM4A 5EUNA 4F5FA 2YRIA 2W8UA 2VMWA 3P1TA 1I48A 1QIRA 2JG2A 5D95A 1LK9A 2R2NA 3I16A 3WKRA 2AY7A 4WYCA 3VOMA 1H0CA 1SFFA 1EJIA 4XAUA 1DTYA 3N5MA 3WCOA 4R2NA 3IHJA 3K40A 3PD6B 5LHAA 4MKJA 1OXPA 3ISLA 2GMUA 2HP1A 2AY3A 2Z1ZA 4TN4A 1AKCA 5E4ZA 3RCHB 4CXQA 2Z1YA 3A2BA 2CINA 3FDBA 3MC6A 2RFVA 2ZYJA 3NU8A 4ZSYA 3M5UA 2ZY4A 3CQ4A 2VMRA 1GBNA 4ZAHA 3D6KA 3EI6A 3TQXA 2OGEA 3EI7A 4MQPA 4WYEA 4WXGA 4F5KA 5HXXA 2Z20A 3PJ0A 5TF5A 1PFFA 2EYQA 1D7UA 1UU0A 1LC7A 2Z9WA 3NYTA 4Y0IA 4ATQA 2YKYA 5F9SA 4F4EA 1DGEA 2Q7WA 1WKHA 2TPLA 5HDMA 2YCPA 1CQ7A 2VGUA 4LNMA 4XK1A 5E5IA 1S06A 1CZEA 4UHNA 1I29A 2BWOA 1Z3ZA 1OHYA 3PPLA 1XEYA 5D5SA 2VLHA 4DGTA 1W23A 4PFNA 5M49A 1AJSA 3CQ6A 3EIAA 2Z9UA 3HVYA 1AAMA 1B4XA 1OHVA 1SZSA 2EH6A 3K7YA 1ARIA 1DJEA 1KMKA 2AY1A 4RLGA 2W7KA 1J32A 4Y0HA 2DR1A 4XEWA 1SZKA 1BKGA 4CBRA 4WXBA 4QGRA 1X2AA 7AATA 2BHXA 2DKBA 3JWAA 3COGA 1IX7A 2HZPA 2VMUA 2O0RA 3BV0A 5E3KA 3MEBA 4UQVA 1O62A 2CH2A 3AEPA 2X5FA 5JAYA 4ITGA 1TOKA 3BCXA 3EI9A 2VMYA 3AOWA 2VI9A 1W3UA 2EGYA 1PMMA 2BYJA 1AX4A 3GBXA 4RITA 3HT4A 4R5FA 4WYGA 3W1IA 4WB0A 1AJSB 1BJNA 2FM1A 3BB8A 1TOIA 3LVKA 1X29A 1LC5A 4CBSA 3K28A 4IY7A 2C7TA 2XBNA 1Y4IA
chains in the Genus database with same CATH topology
1B9HA 4EU1A 2HP2A 3WGBA 3FFRA 3FZ8A 3CBFA 2X3LA 3RI6A 1VP4A 1RVUA 3QPGA 4OBUA 1O4SA 2CSTA 1AY8A 3FVXA 8AATA 2VMSA 2Z67A 4N0WA 2AEUA 2ZJGA 1G7XA 3GJUA 2KFPA 3WCNA 5FT8A 3DXVA 4E3RA 2Z61A 3DC1A 2HOYA 3E2ZA 4OC9A 4RAEA 1X0MA 2AY6A 4LNJA 3WLXA 1IX6A 3N4XA 3ASAA 2X8UA 3A9ZA 1CL2A 2PB0A 4WB0B 1GD9A 4DQ6A 4GDYA 3LVLB 4JEXA 3P6KA 2Z9VA 4TMRA 4LW4A 3VK2A 4IXZA 3OP7A 4MKKA 4JF1A 4B9BA 5FT5A 1RV4A 5M46A 2YHKA 2YOBA 4ZWMA 4Q6RA 1I43A 1GC3A 3KE3A 4GEBA 3FZ6A 1V2FA 4IXOA 4K2BA 3BC8A 4K2IA 4F5IA 2VMQA 1IAXA 2VGSA 2Z9XA 4A0FA 3AELA 2VMPA 4RIZA 1QITA 2BI5A 3TCMA 4AO9A 4BHDA 3TFUA 3PAAA 3TFTA 3FD0A 1M0OA 2D64A 2EO5A 4H63Q 3E2ZB 1ELUA 3GR9A 3FQAA 2ZY3A 4OYTA 4K2MA 4IYOA 1UKJA 3MKJA 3AENA 3IF2A 4WLHA 3MAFA 2BI3A 3MBBA 2QB2A 4M2MA 2BI2A 5DB5A 3HBXA 2AATA 1E5EA 2O1BA 3FSLA 4ZM3A 4AZJA 2VGWA 1C7NA 4NOGA 2V0YA 5FT4A 5AX8A 1JF9A 1W7NA 3PDBA 1AICA 1KKJA 3E77A 4MGRA 4MY5A 1IBJA 4GE4A 2EPJA 3GWPA 1KKPA 3WZFA 1AMQA 1ZC9A 3OKSA 4A6UA 4BQ0A 1YAAA 1ELQA 1N8PA 2E7JA 2W7HA 1ECXA 2W7IA 3QN6A 4U2HA 2CANA 2W8TA 1SZUA 3FZ7A 4F5MA 1BJOA 3DR4A 3A9XA 4W8IA 1TOEA 1E5FA 1CQ6A 4IYOB 3AENB 5G4JA 1AHYA 2YKUA 3E2YA 1N2TA 3G0TA 1GEWA 4MQRA 3N0LA 2WKAA 1OXOA 2W7MA 3B1DA 2W7LA 3VP6A 3FQ8A 4HVKA 2ZP7A 5EIGA 1TPLA 5I92A 1KL2A 3RBFA 3JZLA 4W91A 4ZASA 2O7CA 3ELEA 3F0HA 3H14A 3QGUA 4EMYA 1MLYA 3PDBB 4IW7A 3NX3A 3BWNC 3QI6A 3AEMA 1MLZA 3ZRQA 4JEYA 2WB6A 3LWSA 4ITXA 1ASFA 2QBTA 4EB5A 3FTBA 3PGYA 3WKSA 2G7JA 3ZZJA 2AY4A 2VMZA 2GB3A 1KL1A 4ZWVA 2HUIA 3FVUA 2PO3A 2VGZA 3JU7A 3EI5A 4U1TA 5M4DA 1D7VA 4BMKA 1BJOB 1YIZA 4RM1A 1AHEA 1ARSA 1BJWA 1IJIA 1WYVA 2JJHA 2VYCA 4ZDPA 1OATA 3FDDA 1B5PA 3AEJC 2OGAA 4AH3A 3VK3A 3B8XA 3Q8NA 4J5UA 3AATA 4KAMA 1MAQA 2EZ2A 3FKDA 4OT8A 3NDNA 4BA4A 4F5JA 3RQ1A 3JWBA 4WLJA 5DX5A 5G4IA 4AZKA 1M32A 1SF2A 2DKJA 3HMUA 1N31A 2OQXA 4BA5A 2HOZA 3WGCA 4CVQA 3EI8A 1MDZA 4EFFA 2HOXA 1I41A 2R0TA 3B1CA 4JF0A 2XH1A 2BI1A 2EZ1A 3BCAA 2YRRA 4W1XA 5J8QA 3TATA 1BQDA 1AHFA 1C4KA 1MAPA 1TOGA 2DOUA 4IXSA 4WYDA 2DGKA 2VLFA 2JGTA 4E77A 2ZSLA 3HDOA 3BS8A 5HHYA 1C7GA 1QZ9A 5G0AA 4Q31A 4RKCA 4XJPA 2OKKA 1M4NA 4O6ZA 3KGXA 1T3IA 1AAWA 2VMVA 2D7ZA 2GSAA 3N75A 4M2KA 3ATHA 4F5GA 1GCKA 3GSBA 2G6WA 4P7YA 5G2PA 4JE5A 3UWCA 4A6TA 4MQQA 4AO4A 4ZDOA 1GEXA 1RV3A 2D65A 1GC0A 3E9KA 5F8VA 1KMJA 3DU4A 3AEMC 3EUCA 1ASAA 3JTXA 2OKJA 2BWNA 1ASLA 4MSOA 1AIBA 3ZZKA 1DKAA 2E7IA 1Z7DA 4WBTA 4A6RA 4B98A 4A00A 2BI9A 3NU7A 2BIGA 2FN6A 3ELPA 2VMNA 1WYTA 1QGNA 2V1PA 4M2JA 4TV7A 5C6UA 1EQBA 3AEOA 3H7FA 3B1EA 3B46A 1PG8A 3NYUA 1O61A 2QLRA 3F6TA 1AKAA 3WX9A 4AOAA 3H9XA 2FKIA 2FNUA 1LW5A 1TOJA 2JJEA 2GQNA 3BWNA 1QISA 4LW2A 4WYFA 3DXWA 4KYOA 1AHGA 1FC4A 3GZCA 1BS0A 1EG5A 4GSAA 1C7OA 2BYLA 1AMSA 1IX8A 3FQ7A 4GRXA 4A0GA 1GEYA 3ECDA 4JEZA 2HUUA 1ARHA 1BT4A 1C0NA 2JJGA 3W1JA 2JISA 2W8JA 3I5TA 1S09A 1BJ4A 4UHMA 4XJMA 5LH9A 3HL2A 1TASA 1ASDA 4JEVA 1S08A 3NUBA 3PIUA 3AEJA 4ADDA 1SPAA 2ZUKA 1ASEA 4Q76A 1AMRA 2QMAA 9AATA 2CY8A 3MAUA 1M6SA 3LVMA 4KXKA 1M0PA 3I4JA 2QSRA 3RBLA 4LNLA 2ZY2A 1ASMA 1JG8A 2AY8A 2HORA 1QJ3A 1PMOA 2DGMA 4DBCA 4L0OA 2C44A 4W1WA 3USFA 4OTLA 4IX8A 5K8BA 3F9TA 5DJ1A 2YKXA 2W8VA 2W7FA 1AKBA 1DJUA 1ASNA 3R4TA 4OBVA 2F8JA 3FVSA 5DJ9A 3MAFB 5EUDA 3QM2A 1CS1A 1W7MA 2C0RA 3VAXA 1ARTA 1AIAA 5EFSA 2D63A 2CH1A 4ZSWA 2BIEA 3KGWA 2BKWA 1RVYA 2FQ6A 2YCTA 3JW9A 4A0RA 3WY7A 1AY5A 4WYAA 3ZRPA 3A8UX 4R8DA 3E6GA 1GC2A 3G8MA 3N4RA 2CFBA 2ZC0A 5EAAA 1UU1A 2VMTA 2VGVA 2AEVA 3ASBA 3HLMA 2JJFA 4EB7A 1M7YA 1AJRA 2ZY5A 2WK9A 3GZDA 1B5OA 1YOOA 1JS6A 4GE9A 1YJSA 4UHOA 1X28A 1ORDA 4E1OA 4ATPA 4H51A 5G2QA 2CB1A 3UAKA 2DGLA 1V72A 4J8LA 3II0A 4P3MA 2BWPA 3BWOA 1WKGA 3DYDA 2FYFA 2BIAA 5EIGB 4ZDLA 1ARGA 3QBOA 2E7UA 3QHXA 1CL1A 1S0AA 2A1VA 3R9AA 3DZZA 3PA9A 1VJOA 2CJDA 4I8AA 4ADEA 1IVRA 4GE7A 3LVJA 4ISYA 2AY9A 4JEWA 1QJ5A 2D66A 1G4VA 1GC4A 3FRKA 3LG0A 4RKDA 3UE8A 3EZSA 1WYUA 2FNIA 1C9CA 1OHWA 2R5EA 4JE5D 4XJOA 4CXRA 1D2FA 2WK7A 1AHXA 1WSTA 1SVVA 2QA3A 1DFOA 3PDXA 1VEFA 1MDOA 1ZOBA 2YCNA 2ZSMA 1G7WA 1CJ0A 3FFHA 1WYVB 4W5KA 2GMSA 3N7NA 2CJGA 3N4SA 3DRDA 3HQTA 3MADA 2CTZA 2AY5A 2VMXA 4OMAA 1YNUA 1ASBA 5EAVA 2HUFA 4HF8A 1O69A 4XJLA 4E3QA 3EIBA 4FL0A 3CQ5A 4WP0A 5IWQA 3AV7A 1BW0A 2D7YA 4F5LA 1YIYA 4RJYA 3T32A 3EZ1A 1LW4A 3NNKA 3RUYA 3MC6C 2D5YA 1DJ9A 3NRAA 4PFFA 1FG3A 1H1CA 5G09A 1WYUB 3GZDC 5FT6A 1CQ8A 2X5DA 1D7SA 1DGDA 3VK4A 3GETA 3LV2A 3NYSA 1MDXA 3E2FA 1LS3A 2CJHA 2W8WA 4RJ0A 1XI9A 2PB2A 1BQAA 3NUIA 1IUGA 4ADBA 1G4XA 1ZODA 2VMOA 1LC8A 1YJZA 1YJYA 2OATA 2W7JA 2YKVA 4PIWA 4Y0DA 5M4BA 1TATA 3KKIA 2VGTA 1AMAA 2QB3A 4F5HA 2R5CA 3A9YA 1TARA 3LY1A 4A0HA 3AOVA 4ADCA 1P3WA 1UU2A 4K05A 2W7GA 1GDEA 4LC3A 2VIBA 2W7EA 4PVFA 1V2EA 2C81A 1J04A 1IAYA 3ACZA 3BN1A 4WXFA 3NTJA 1WYTB 3BCBA 3FCRA 1S07A 4Q75A 1AY4A 5BJ3A 4R5ZA 5KTBA 3CAIA 1LKCA 1M0NA 1FG7A 5EQCA 1JS3A 2AY2A 3DR7A 4ZLVA 3PD6A 3ZRRA 5BJ4A 1U08A 2WK8A 4OCAA 1B8GA 1MGVA 2VIAA 3G7QA 3RCHA 1M0QA 2D61A 2ORDA 3W1HA 3L8AA 4W1VA 4WD2A 5EUEA 4XQ2A 2W7DA 2R5CB 1ASCA 3L44A 2NMPA 4N0BA 4UOYA 1CZCA 1B9IA 4FFCA 4A72A 2VI8A 1W7LA 1V2DA 1D7RA 2E54A 3DODA 1ASGA 4ZM4A 5EUNA 4F5FA 2YRIA 2W8UA 2VMWA 3P1TA 1I48A 1QIRA 2JG2A 5D95A 1LK9A 2R2NA 3I16A 3WKRA 2AY7A 4WYCA 3VOMA 1H0CA 1SFFA 1EJIA 4XAUA 1DTYA 3N5MA 3WCOA 4R2NA 3IHJA 3K40A 3PD6B 5LHAA 4MKJA 1OXPA 3ISLA 2GMUA 2HP1A 2AY3A 2Z1ZA 4TN4A 1AKCA 5E4ZA 3RCHB 4CXQA 2Z1YA 3A2BA 2CINA 3FDBA 3MC6A 2RFVA 2ZYJA 3NU8A 4ZSYA 3M5UA 2ZY4A 3CQ4A 2VMRA 1GBNA 4ZAHA 3D6KA 3EI6A 3TQXA 2OGEA 3EI7A 4MQPA 4WYEA 4WXGA 4F5KA 5HXXA 2Z20A 3PJ0A 5TF5A 1PFFA 2EYQA 1D7UA 1UU0A 1LC7A 2Z9WA 3NYTA 4Y0IA 4ATQA 2YKYA 5F9SA 4F4EA 1DGEA 2Q7WA 1WKHA 2TPLA 5HDMA 2YCPA 1CQ7A 2VGUA 4LNMA 4XK1A 5E5IA 1S06A 1CZEA 4UHNA 1I29A 2BWOA 1Z3ZA 1OHYA 3PPLA 1XEYA 5D5SA 2VLHA 4DGTA 1W23A 4PFNA 5M49A 1AJSA 3CQ6A 3EIAA 2Z9UA 3HVYA 1AAMA 1B4XA 1OHVA 1SZSA 2EH6A 3K7YA 1ARIA 1DJEA 1KMKA 2AY1A 4RLGA 2W7KA 1J32A 4Y0HA 2DR1A 4XEWA 1SZKA 1BKGA 4CBRA 4WXBA 4QGRA 1X2AA 7AATA 2BHXA 2DKBA 3JWAA 3COGA 1IX7A 2HZPA 2VMUA 2O0RA 3BV0A 5E3KA 3MEBA 4UQVA 1O62A 2CH2A 3AEPA 2X5FA 5JAYA 4ITGA 1TOKA 3BCXA 3EI9A 2VMYA 3AOWA 2VI9A 1W3UA 2EGYA 1PMMA 2BYJA 1AX4A 3GBXA 4RITA 3HT4A 4R5FA 4WYGA 3W1IA 4WB0A 1AJSB 1BJNA 2FM1A 3BB8A 1TOIA 3LVKA 1X29A 1LC5A 4CBSA 3K28A 4IY7A 2C7TA 2XBNA 1Y4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9H A;  4EU1 A;  2HP2 A;  3WGB A;  3FFR A;  3FZ8 A;  3CBF A;  2X3L A;  3RI6 A;  1VP4 A;  1RVU A;  3QPG A;  4OBU A;  1O4S A;  2CST A;  1AY8 A;  3FVX A;  8AAT A;  2VMS A;  2Z67 A;  4N0W A;  2AEU A;  2ZJG A;  1G7X A;  3GJU A;  3WCN A;  5FT8 A;  3DXV A;  4E3R A;  2Z61 A;  3DC1 A;  2HOY A;  3E2Z A;  4OC9 A;  4RAE A;  1X0M A;  2AY6 A;  4LNJ A;  3WLX A;  1IX6 A;  3ASA A;  2X8U A;  3A9Z A;  1CL2 A;  2PB0 A;  4WB0 B;  1GD9 A;  4DQ6 A;  4GDY A;  3LVL B;  4JEX A;  3P6K A;  2Z9V A;  4TMR A;  4LW4 A;  3VK2 A;  4IXZ A;  3OP7 A;  4MKK A;  4JF1 A;  4B9B A;  5FT5 A;  1RV4 A;  5M46 A;  2YHK A;  2YOB A;  4ZWM A;  4Q6R A;  1I43 A;  1GC3 A;  3KE3 A;  4GEB A;  3FZ6 A;  1V2F A;  4IXO A;  4K2B A;  3BC8 A;  4K2I A;  4F5I A;  2VMQ A;  1IAX A;  2VGS A;  2Z9X A;  4A0F A;  3AEL A;  2VMP A;  4RIZ A;  1QIT A;  2BI5 A;  3TCM A;  4AO9 A;  4BHD A;  3TFU A;  3PAA A;  3TFT A;  3FD0 A;  1M0O A;  2D64 A;  2EO5 A;  3E2Z B;  1ELU A;  3GR9 A;  3FQA A;  2ZY3 A;  4OYT A;  4K2M A;  4IYO A;  1UKJ A;  3MKJ A;  3AEN A;  3IF2 A;  4WLH A;  3MAF A;  2BI3 A;  3MBB A;  2QB2 A;  4M2M A;  2BI2 A;  5DB5 A;  3HBX A;  2AAT A;  1E5E A;  2O1B A;  3FSL A;  4ZM3 A;  4AZJ A;  2VGW A;  1C7N A;  4NOG A;  2V0Y A;  5FT4 A;  5AX8 A;  1JF9 A;  1W7N A;  3PDB A;  1AIC A;  1KKJ A;  3E77 A;  4MGR A;  4MY5 A;  1IBJ A;  4GE4 A;  2EPJ A;  3GWP A;  1KKP A;  3WZF A;  1AMQ A;  1ZC9 A;  3OKS A;  4A6U A;  4BQ0 A;  1YAA A;  1ELQ A;  1N8P A;  2E7J A;  2W7H A;  1ECX A;  2W7I A;  3QN6 A;  4U2H A;  2CAN A;  2W8T A;  1SZU A;  3FZ7 A;  4F5M A;  1BJO A;  3DR4 A;  3A9X A;  4W8I A;  1TOE A;  1E5F A;  1CQ6 A;  4IYO B;  3AEN B;  5G4J A;  1AHY A;  2YKU A;  3E2Y A;  1N2T A;  3G0T A;  1GEW A;  4MQR A;  3N0L A;  2WKA A;  1OXO A;  2W7M A;  3B1D A;  2W7L A;  3VP6 A;  3FQ8 A;  4HVK A;  2ZP7 A;  5EIG A;  1TPL A;  5I92 A;  1KL2 A;  3RBF A;  3JZL A;  4W91 A;  4ZAS A;  2O7C A;  3ELE A;  3F0H A;  3H14 A;  3QGU A;  4EMY A;  1MLY A;  3PDB B;  4IW7 A;  3NX3 A;  3BWN C;  3QI6 A;  3AEM A;  1MLZ A;  3ZRQ A;  4JEY A;  3LWS A;  4ITX A;  1ASF A;  2QBT A;  4EB5 A;  3FTB A;  3PGY A;  3WKS A;  3ZZJ A;  2AY4 A;  2VMZ A;  2GB3 A;  1KL1 A;  4ZWV A;  2HUI A;  3FVU A;  2PO3 A;  2VGZ A;  3JU7 A;  3EI5 A;  4U1T A;  5M4D A;  1D7V A;  4BMK A;  1BJO B;  1YIZ A;  4RM1 A;  1AHE A;  1ARS A;  1BJW A;  1IJI A;  1WYV A;  2JJH A;  2VYC A;  4ZDP A;  1OAT A;  3FDD A;  1B5P A;  3AEJ C;  2OGA A;  4AH3 A;  3VK3 A;  3B8X A;  3Q8N A;  4J5U A;  3AAT A;  4KAM A;  1MAQ A;  2EZ2 A;  3FKD A;  4OT8 A;  3NDN A;  4BA4 A;  4F5J A;  3RQ1 A;  3JWB A;  4WLJ A;  5DX5 A;  5G4I A;  4AZK A;  1M32 A;  1SF2 A;  2DKJ A;  3HMU A;  1N31 A;  2OQX A;  4BA5 A;  2HOZ A;  3WGC A;  4CVQ A;  3EI8 A;  1MDZ A;  4EFF A;  2HOX A;  1I41 A;  2R0T A;  3B1C A;  4JF0 A;  2XH1 A;  2BI1 A;  2EZ1 A;  3BCA A;  2YRR A;  4W1X A;  5J8Q A;  3TAT A;  1BQD A;  1AHF A;  1C4K A;  1MAP A;  1TOG A;  2DOU A;  4IXS A;  4WYD A;  2DGK A;  2VLF A;  2JGT A;  4E77 A;  2ZSL A;  3HDO A;  3BS8 A;  5HHY A;  1C7G A;  1QZ9 A;  5G0A A;  4Q31 A;  4RKC A;  4XJP A;  2OKK A;  1M4N A;  4O6Z A;  3KGX A;  1T3I A;  1AAW A;  2VMV A;  2D7Z A;  2GSA A;  3N75 A;  4M2K A;  3ATH A;  4F5G A;  1GCK A;  3GSB A;  2G6W A;  4P7Y A;  5G2P A;  4JE5 A;  3UWC A;  4A6T A;  4MQQ A;  4AO4 A;  4ZDO A;  1GEX A;  1RV3 A;  2D65 A;  1GC0 A;  3E9K A;  5F8V A;  1KMJ A;  3DU4 A;  3AEM C;  3EUC A;  1ASA A;  3JTX A;  2OKJ A;  2BWN A;  1ASL A;  4MSO A;  1AIB A;  3ZZK A;  1DKA A;  2E7I A;  1Z7D A;  4WBT A;  4A6R A;  4B98 A;  4A00 A;  2BI9 A;  3NU7 A;  2BIG A;  2FN6 A;  3ELP A;  2VMN A;  1WYT A;  1QGN A;  2V1P A;  4M2J A;  4TV7 A;  5C6U A;  1EQB A;  3AEO A;  3H7F A;  3B1E A;  3B46 A;  1PG8 A;  3NYU A;  1O61 A;  2QLR A;  3F6T A;  1AKA A;  3WX9 A;  4AOA A;  2FNU A;  1LW5 A;  1TOJ A;  2JJE A;  2GQN A;  3BWN A;  1QIS A;  4LW2 A;  4WYF A;  3DXW A;  4KYO A;  1AHG A;  1FC4 A;  3GZC A;  1BS0 A;  1EG5 A;  4GSA A;  1C7O A;  2BYL A;  1AMS A;  1IX8 A;  3FQ7 A;  4GRX A;  4A0G A;  1GEY A;  3ECD A;  4JEZ A;  2HUU A;  1ARH A;  1BT4 A;  1C0N A;  2JJG A;  3W1J A;  2JIS A;  2W8J A;  3I5T A;  1S09 A;  1BJ4 A;  4UHM A;  4XJM A;  5LH9 A;  3HL2 A;  1TAS A;  1ASD A;  4JEV A;  1S08 A;  3NUB A;  3PIU A;  3AEJ A;  4ADD A;  1SPA A;  2ZUK A;  1ASE A;  4Q76 A;  1AMR A;  2QMA A;  9AAT A;  2CY8 A;  3MAU A;  1M6S A;  3LVM A;  4KXK A;  1M0P A;  3I4J A;  2ZY2 A;  3RBL A;  4LNL A;  1ASM A;  1JG8 A;  2AY8 A;  2HOR A;  1QJ3 A;  1PMO A;  2DGM A;  4DBC A;  4L0O A;  2C44 A;  4W1W A;  3USF A;  4OTL A;  4IX8 A;  5K8B A;  3F9T A;  5DJ1 A;  2YKX A;  2W8V A;  2W7F A;  1AKB A;  1DJU A;  1ASN A;  3R4T A;  4OBV A;  2F8J A;  3FVS A;  5DJ9 A;  3MAF B;  5EUD A;  3QM2 A;  1CS1 A;  1W7M A;  2C0R A;  3VAX A;  1ART A;  1AIA A;  5EFS A;  2D63 A;  2CH1 A;  4ZSW A;  2BIE A;  3KGW A;  2BKW A;  1RVY A;  2FQ6 A;  2YCT A;  3JW9 A;  4A0R A;  3WY7 A;  1AY5 A;  4WYA A;  3ZRP A;  3A8U X;  4R8D A;  3E6G A;  1GC2 A;  3G8M A;  2CFB A;  2ZC0 A;  5EAA A;  1UU1 A;  2VMT A;  2VGV A;  2AEV A;  3ASB A;  3HLM A;  2JJF A;  4EB7 A;  1M7Y A;  1AJR A;  2ZY5 A;  2WK9 A;  3GZD A;  1B5O A;  1YOO A;  1JS6 A;  4GE9 A;  1YJS A;  4UHO A;  1X28 A;  1ORD A;  4E1O A;  4ATP A;  4H51 A;  5G2Q A;  2CB1 A;  3UAK A;  2DGL A;  1V72 A;  4J8L A;  3II0 A;  4P3M A;  2BWP A;  3BWO A;  1WKG A;  3DYD A;  2FYF A;  2BIA A;  5EIG B;  4ZDL A;  1ARG A;  3QBO A;  2E7U A;  3QHX A;  1CL1 A;  1S0A A;  3R9A A;  3DZZ A;  3PA9 A;  1VJO A;  2CJD A;  4I8A A;  4ADE A;  1IVR A;  4GE7 A;  3LVJ A;  4ISY A;  2AY9 A;  4JEW A;  1QJ5 A;  2D66 A;  1G4V A;  1GC4 A;  3FRK A;  3LG0 A;  4RKD A;  3UE8 A;  3EZS A;  1WYU A;  2FNI A;  1C9C A;  1OHW A;  2R5E A;  4JE5 D;  4XJO A;  4CXR A;  1D2F A;  2WK7 A;  1AHX A;  1WST A;  1SVV A;  2QA3 A;  1DFO A;  3PDX A;  1VEF A;  1MDO A;  1ZOB A;  2YCN A;  2ZSM A;  1G7W A;  1CJ0 A;  3FFH A;  1WYV B;  4W5K A;  2GMS A;  2CJG A;  3DRD A;  3HQT A;  3MAD A;  2CTZ A;  2AY5 A;  2VMX A;  4OMA A;  1YNU A;  1ASB A;  5EAV A;  2HUF A;  4HF8 A;  1O69 A;  4XJL A;  4E3Q A;  3EIB A;  4FL0 A;  3CQ5 A;  4WP0 A;  5IWQ A;  3AV7 A;  1BW0 A;  2D7Y A;  4F5L A;  1YIY A;  4RJY A;  3T32 A;  3EZ1 A;  1LW4 A;  3NNK A;  3RUY A;  3MC6 C;  2D5Y A;  1DJ9 A;  3NRA A;  4PFF A;  1FG3 A;  1H1C A;  5G09 A;  1WYU B;  3GZD C;  5FT6 A;  1CQ8 A;  2X5D A;  1D7S A;  1DGD A;  3VK4 A;  3GET A;  3LV2 A;  3NYS A;  1MDX A;  3E2F A;  1LS3 A;  2CJH A;  2W8W A;  4RJ0 A;  1XI9 A;  2PB2 A;  1BQA A;  3NUI A;  1IUG A;  4ADB A;  1G4X A;  1ZOD A;  2VMO A;  1LC8 A;  1YJZ A;  1YJY A;  2OAT A;  2W7J A;  2YKV A;  4PIW A;  4Y0D A;  5M4B A;  1TAT A;  3KKI A;  2VGT A;  1AMA A;  2QB3 A;  4F5H A;  2R5C A;  3A9Y A;  1TAR A;  3LY1 A;  4A0H A;  3AOV A;  4ADC A;  1P3W A;  1UU2 A;  2W7G A;  1GDE A;  4LC3 A;  2VIB A;  2W7E A;  4PVF A;  1V2E A;  2C81 A;  1J04 A;  1IAY A;  3ACZ A;  3BN1 A;  4WXF A;  3NTJ A;  1WYT B;  3BCB A;  3FCR A;  1S07 A;  4Q75 A;  1AY4 A;  5BJ3 A;  4R5Z A;  3CAI A;  1LKC A;  1M0N A;  1FG7 A;  5EQC A;  1JS3 A;  2AY2 A;  3DR7 A;  4ZLV A;  3PD6 A;  3ZRR A;  5BJ4 A;  1U08 A;  2WK8 A;  4OCA A;  1B8G A;  1MGV A;  2VIA A;  3G7Q A;  3RCH A;  1M0Q A;  2D61 A;  2ORD A;  3W1H A;  3L8A A;  4W1V A;  4WD2 A;  5EUE A;  4XQ2 A;  2W7D A;  2R5C B;  1ASC A;  3L44 A;  2NMP A;  4N0B A;  4UOY A;  1CZC A;  1B9I A;  4FFC A;  4A72 A;  2VI8 A;  1W7L A;  1V2D A;  1D7R A;  2E54 A;  3DOD A;  1ASG A;  4ZM4 A;  5EUN A;  4F5F A;  2YRI A;  2W8U A;  2VMW A;  3P1T A;  1I48 A;  1QIR A;  2JG2 A;  5D95 A;  1LK9 A;  2R2N A;  3I16 A;  3WKR A;  2AY7 A;  4WYC A;  3VOM A;  1H0C A;  1SFF A;  1EJI A;  4XAU A;  1DTY A;  3N5M A;  3WCO A;  4R2N A;  3IHJ A;  3K40 A;  3PD6 B;  5LHA A;  4MKJ A;  1OXP A;  3ISL A;  2GMU A;  2HP1 A;  2AY3 A;  2Z1Z A;  4TN4 A;  1AKC A;  5E4Z A;  3RCH B;  4CXQ A;  2Z1Y A;  3A2B A;  2CIN A;  3FDB A;  3MC6 A;  2RFV A;  2ZYJ A;  3NU8 A;  4ZSY A;  3M5U A;  2ZY4 A;  3CQ4 A;  2VMR A;  1GBN A;  4ZAH A;  3D6K A;  3EI6 A;  3TQX A;  2OGE A;  3EI7 A;  4MQP A;  4WYE A;  4WXG A;  4F5K A;  5HXX A;  2Z20 A;  3PJ0 A;  5TF5 A;  1PFF A;  1D7U A;  1UU0 A;  1LC7 A;  2Z9W A;  3NYT A;  4Y0I A;  4ATQ A;  2YKY A;  5F9S A;  4F4E A;  1DGE A;  2Q7W A;  1WKH A;  2TPL A;  5HDM A;  2YCP A;  1CQ7 A;  2VGU A;  4LNM A;  4XK1 A;  5E5I A;  1S06 A;  1CZE A;  4UHN A;  1I29 A;  2BWO A;  1Z3Z A;  1OHY A;  3PPL A;  1XEY A;  5D5S A;  2VLH A;  4DGT A;  1W23 A;  4PFN A;  5M49 A;  1AJS A;  3CQ6 A;  3EIA A;  2Z9U A;  3HVY A;  1AAM A;  1B4X A;  1OHV A;  1SZS A;  2EH6 A;  3K7Y A;  1ARI A;  1DJE A;  1KMK A;  2AY1 A;  4RLG A;  2W7K A;  1J32 A;  4Y0H A;  2DR1 A;  4XEW A;  1SZK A;  1BKG A;  4CBR A;  4WXB A;  4QGR A;  1X2A A;  7AAT A;  2BHX A;  2DKB A;  3JWA A;  3COG A;  1IX7 A;  2HZP A;  2VMU A;  2O0R A;  3BV0 A;  5E3K A;  3MEB A;  4UQV A;  1O62 A;  2CH2 A;  3AEP A;  2X5F A;  5JAY A;  4ITG A;  1TOK A;  3BCX A;  3EI9 A;  2VMY A;  3AOW A;  2VI9 A;  1W3U A;  2EGY A;  1PMM A;  2BYJ A;  1AX4 A;  3GBX A;  4RIT A;  3HT4 A;  4R5F A;  4WYG A;  3W1I A;  4WB0 A;  1AJS B;  1BJN A;  2FM1 A;  3BB8 A;  1TOI A;  3LVK A;  1X29 A;  1LC5 A;  4CBS A;  3K28 A;  4IY7 A;  2C7T A;  2XBN A;  1Y4I A; 
#chains in the Genus database with same CATH topology
 1B9H A;  4EU1 A;  2HP2 A;  3WGB A;  3FFR A;  3FZ8 A;  3CBF A;  2X3L A;  3RI6 A;  1VP4 A;  1RVU A;  3QPG A;  4OBU A;  1O4S A;  2CST A;  1AY8 A;  3FVX A;  8AAT A;  2VMS A;  2Z67 A;  4N0W A;  2AEU A;  2ZJG A;  1G7X A;  3GJU A;  2KFP A;  3WCN A;  5FT8 A;  3DXV A;  4E3R A;  2Z61 A;  3DC1 A;  2HOY A;  3E2Z A;  4OC9 A;  4RAE A;  1X0M A;  2AY6 A;  4LNJ A;  3WLX A;  1IX6 A;  3N4X A;  3ASA A;  2X8U A;  3A9Z A;  1CL2 A;  2PB0 A;  4WB0 B;  1GD9 A;  4DQ6 A;  4GDY A;  3LVL B;  4JEX A;  3P6K A;  2Z9V A;  4TMR A;  4LW4 A;  3VK2 A;  4IXZ A;  3OP7 A;  4MKK A;  4JF1 A;  4B9B A;  5FT5 A;  1RV4 A;  5M46 A;  2YHK A;  2YOB A;  4ZWM A;  4Q6R A;  1I43 A;  1GC3 A;  3KE3 A;  4GEB A;  3FZ6 A;  1V2F A;  4IXO A;  4K2B A;  3BC8 A;  4K2I A;  4F5I A;  2VMQ A;  1IAX A;  2VGS A;  2Z9X A;  4A0F A;  3AEL A;  2VMP A;  4RIZ A;  1QIT A;  2BI5 A;  3TCM A;  4AO9 A;  4BHD A;  3TFU A;  3PAA A;  3TFT A;  3FD0 A;  1M0O A;  2D64 A;  2EO5 A;  4H63 Q;  3E2Z B;  1ELU A;  3GR9 A;  3FQA A;  2ZY3 A;  4OYT A;  4K2M A;  4IYO A;  1UKJ A;  3MKJ A;  3AEN A;  3IF2 A;  4WLH A;  3MAF A;  2BI3 A;  3MBB A;  2QB2 A;  4M2M A;  2BI2 A;  5DB5 A;  3HBX A;  2AAT A;  1E5E A;  2O1B A;  3FSL A;  4ZM3 A;  4AZJ A;  2VGW A;  1C7N A;  4NOG A;  2V0Y A;  5FT4 A;  5AX8 A;  1JF9 A;  1W7N A;  3PDB A;  1AIC A;  1KKJ A;  3E77 A;  4MGR A;  4MY5 A;  1IBJ A;  4GE4 A;  2EPJ A;  3GWP A;  1KKP A;  3WZF A;  1AMQ A;  1ZC9 A;  3OKS A;  4A6U A;  4BQ0 A;  1YAA A;  1ELQ A;  1N8P A;  2E7J A;  2W7H A;  1ECX A;  2W7I A;  3QN6 A;  4U2H A;  2CAN A;  2W8T A;  1SZU A;  3FZ7 A;  4F5M A;  1BJO A;  3DR4 A;  3A9X A;  4W8I A;  1TOE A;  1E5F A;  1CQ6 A;  4IYO B;  3AEN B;  5G4J A;  1AHY A;  2YKU A;  3E2Y A;  1N2T A;  3G0T A;  1GEW A;  4MQR A;  3N0L A;  2WKA A;  1OXO A;  2W7M A;  3B1D A;  2W7L A;  3VP6 A;  3FQ8 A;  4HVK A;  2ZP7 A;  5EIG A;  1TPL A;  5I92 A;  1KL2 A;  3RBF A;  3JZL A;  4W91 A;  4ZAS A;  2O7C A;  3ELE A;  3F0H A;  3H14 A;  3QGU A;  4EMY A;  1MLY A;  3PDB B;  4IW7 A;  3NX3 A;  3BWN C;  3QI6 A;  3AEM A;  1MLZ A;  3ZRQ A;  4JEY A;  2WB6 A;  3LWS A;  4ITX A;  1ASF A;  2QBT A;  4EB5 A;  3FTB A;  3PGY A;  3WKS A;  2G7J A;  3ZZJ A;  2AY4 A;  2VMZ A;  2GB3 A;  1KL1 A;  4ZWV A;  2HUI A;  3FVU A;  2PO3 A;  2VGZ A;  3JU7 A;  3EI5 A;  4U1T A;  5M4D A;  1D7V A;  4BMK A;  1BJO B;  1YIZ A;  4RM1 A;  1AHE A;  1ARS A;  1BJW A;  1IJI A;  1WYV A;  2JJH A;  2VYC A;  4ZDP A;  1OAT A;  3FDD A;  1B5P A;  3AEJ C;  2OGA A;  4AH3 A;  3VK3 A;  3B8X A;  3Q8N A;  4J5U A;  3AAT A;  4KAM A;  1MAQ A;  2EZ2 A;  3FKD A;  4OT8 A;  3NDN A;  4BA4 A;  4F5J A;  3RQ1 A;  3JWB A;  4WLJ A;  5DX5 A;  5G4I A;  4AZK A;  1M32 A;  1SF2 A;  2DKJ A;  3HMU A;  1N31 A;  2OQX A;  4BA5 A;  2HOZ A;  3WGC A;  4CVQ A;  3EI8 A;  1MDZ A;  4EFF A;  2HOX A;  1I41 A;  2R0T A;  3B1C A;  4JF0 A;  2XH1 A;  2BI1 A;  2EZ1 A;  3BCA A;  2YRR A;  4W1X A;  5J8Q A;  3TAT A;  1BQD A;  1AHF A;  1C4K A;  1MAP A;  1TOG A;  2DOU A;  4IXS A;  4WYD A;  2DGK A;  2VLF A;  2JGT A;  4E77 A;  2ZSL A;  3HDO A;  3BS8 A;  5HHY A;  1C7G A;  1QZ9 A;  5G0A A;  4Q31 A;  4RKC A;  4XJP A;  2OKK A;  1M4N A;  4O6Z A;  3KGX A;  1T3I A;  1AAW A;  2VMV A;  2D7Z A;  2GSA A;  3N75 A;  4M2K A;  3ATH A;  4F5G A;  1GCK A;  3GSB A;  2G6W A;  4P7Y A;  5G2P A;  4JE5 A;  3UWC A;  4A6T A;  4MQQ A;  4AO4 A;  4ZDO A;  1GEX A;  1RV3 A;  2D65 A;  1GC0 A;  3E9K A;  5F8V A;  1KMJ A;  3DU4 A;  3AEM C;  3EUC A;  1ASA A;  3JTX A;  2OKJ A;  2BWN A;  1ASL A;  4MSO A;  1AIB A;  3ZZK A;  1DKA A;  2E7I A;  1Z7D A;  4WBT A;  4A6R A;  4B98 A;  4A00 A;  2BI9 A;  3NU7 A;  2BIG A;  2FN6 A;  3ELP A;  2VMN A;  1WYT A;  1QGN A;  2V1P A;  4M2J A;  4TV7 A;  5C6U A;  1EQB A;  3AEO A;  3H7F A;  3B1E A;  3B46 A;  1PG8 A;  3NYU A;  1O61 A;  2QLR A;  3F6T A;  1AKA A;  3WX9 A;  4AOA A;  3H9X A;  2FKI A;  2FNU A;  1LW5 A;  1TOJ A;  2JJE A;  2GQN A;  3BWN A;  1QIS A;  4LW2 A;  4WYF A;  3DXW A;  4KYO A;  1AHG A;  1FC4 A;  3GZC A;  1BS0 A;  1EG5 A;  4GSA A;  1C7O A;  2BYL A;  1AMS A;  1IX8 A;  3FQ7 A;  4GRX A;  4A0G A;  1GEY A;  3ECD A;  4JEZ A;  2HUU A;  1ARH A;  1BT4 A;  1C0N A;  2JJG A;  3W1J A;  2JIS A;  2W8J A;  3I5T A;  1S09 A;  1BJ4 A;  4UHM A;  4XJM A;  5LH9 A;  3HL2 A;  1TAS A;  1ASD A;  4JEV A;  1S08 A;  3NUB A;  3PIU A;  3AEJ A;  4ADD A;  1SPA A;  2ZUK A;  1ASE A;  4Q76 A;  1AMR A;  2QMA A;  9AAT A;  2CY8 A;  3MAU A;  1M6S A;  3LVM A;  4KXK A;  1M0P A;  3I4J A;  2QSR A;  3RBL A;  4LNL A;  2ZY2 A;  1ASM A;  1JG8 A;  2AY8 A;  2HOR A;  1QJ3 A;  1PMO A;  2DGM A;  4DBC A;  4L0O A;  2C44 A;  4W1W A;  3USF A;  4OTL A;  4IX8 A;  5K8B A;  3F9T A;  5DJ1 A;  2YKX A;  2W8V A;  2W7F A;  1AKB A;  1DJU A;  1ASN A;  3R4T A;  4OBV A;  2F8J A;  3FVS A;  5DJ9 A;  3MAF B;  5EUD A;  3QM2 A;  1CS1 A;  1W7M A;  2C0R A;  3VAX A;  1ART A;  1AIA A;  5EFS A;  2D63 A;  2CH1 A;  4ZSW A;  2BIE A;  3KGW A;  2BKW A;  1RVY A;  2FQ6 A;  2YCT A;  3JW9 A;  4A0R A;  3WY7 A;  1AY5 A;  4WYA A;  3ZRP A;  3A8U X;  4R8D A;  3E6G A;  1GC2 A;  3G8M A;  3N4R A;  2CFB A;  2ZC0 A;  5EAA A;  1UU1 A;  2VMT A;  2VGV A;  2AEV A;  3ASB A;  3HLM A;  2JJF A;  4EB7 A;  1M7Y A;  1AJR A;  2ZY5 A;  2WK9 A;  3GZD A;  1B5O A;  1YOO A;  1JS6 A;  4GE9 A;  1YJS A;  4UHO A;  1X28 A;  1ORD A;  4E1O A;  4ATP A;  4H51 A;  5G2Q A;  2CB1 A;  3UAK A;  2DGL A;  1V72 A;  4J8L A;  3II0 A;  4P3M A;  2BWP A;  3BWO A;  1WKG A;  3DYD A;  2FYF A;  2BIA A;  5EIG B;  4ZDL A;  1ARG A;  3QBO A;  2E7U A;  3QHX A;  1CL1 A;  1S0A A;  2A1V A;  3R9A A;  3DZZ A;  3PA9 A;  1VJO A;  2CJD A;  4I8A A;  4ADE A;  1IVR A;  4GE7 A;  3LVJ A;  4ISY A;  2AY9 A;  4JEW A;  1QJ5 A;  2D66 A;  1G4V A;  1GC4 A;  3FRK A;  3LG0 A;  4RKD A;  3UE8 A;  3EZS A;  1WYU A;  2FNI A;  1C9C A;  1OHW A;  2R5E A;  4JE5 D;  4XJO A;  4CXR A;  1D2F A;  2WK7 A;  1AHX A;  1WST A;  1SVV A;  2QA3 A;  1DFO A;  3PDX A;  1VEF A;  1MDO A;  1ZOB A;  2YCN A;  2ZSM A;  1G7W A;  1CJ0 A;  3FFH A;  1WYV B;  4W5K A;  2GMS A;  3N7N A;  2CJG A;  3N4S A;  3DRD A;  3HQT A;  3MAD A;  2CTZ A;  2AY5 A;  2VMX A;  4OMA A;  1YNU A;  1ASB A;  5EAV A;  2HUF A;  4HF8 A;  1O69 A;  4XJL A;  4E3Q A;  3EIB A;  4FL0 A;  3CQ5 A;  4WP0 A;  5IWQ A;  3AV7 A;  1BW0 A;  1KAF A;  2D7Y A;  4F5L A;  1YIY A;  4RJY A;  3T32 A;  3EZ1 A;  1LW4 A;  3NNK A;  3RUY A;  3MC6 C;  2D5Y A;  1DJ9 A;  3NRA A;  4PFF A;  1FG3 A;  1H1C A;  5G09 A;  1WYU B;  3GZD C;  5FT6 A;  1CQ8 A;  2X5D A;  1D7S A;  1DGD A;  3VK4 A;  3GET A;  3LV2 A;  3NYS A;  1MDX A;  3E2F A;  1LS3 A;  2CJH A;  2W8W A;  4RJ0 A;  1XI9 A;  2PB2 A;  1BQA A;  3NUI A;  1IUG A;  4ADB A;  1G4X A;  1ZOD A;  2VMO A;  1LC8 A;  1YJZ A;  1YJY A;  2OAT A;  2W7J A;  2YKV A;  4PIW A;  4Y0D A;  5M4B A;  1TAT A;  3KKI A;  2VGT A;  1AMA A;  2QB3 A;  4F5H A;  2R5C A;  3A9Y A;  1TAR A;  3LY1 A;  4A0H A;  3AOV A;  4ADC A;  1P3W A;  1UU2 A;  4K05 A;  2W7G A;  1GDE A;  4LC3 A;  2VIB A;  2W7E A;  4PVF A;  1V2E A;  2C81 A;  1J04 A;  1IAY A;  3ACZ A;  3BN1 A;  4WXF A;  3NTJ A;  1WYT B;  3BCB A;  3FCR A;  1S07 A;  4Q75 A;  1AY4 A;  5BJ3 A;  4R5Z A;  5KTB A;  3CAI A;  1LKC A;  1M0N A;  1FG7 A;  5EQC A;  1JS3 A;  2AY2 A;  3DR7 A;  4ZLV A;  3PD6 A;  3ZRR A;  5BJ4 A;  1U08 A;  2WK8 A;  4OCA A;  1B8G A;  1MGV A;  2VIA A;  3G7Q A;  3RCH A;  1M0Q A;  2D61 A;  2ORD A;  3W1H A;  3L8A A;  4W1V A;  4WD2 A;  5EUE A;  4XQ2 A;  2W7D A;  2R5C B;  1ASC A;  3L44 A;  2NMP A;  4N0B A;  4UOY A;  1CZC A;  1B9I A;  4FFC A;  4A72 A;  2VI8 A;  1W7L A;  1V2D A;  1D7R A;  2E54 A;  3DOD A;  1ASG A;  4ZM4 A;  5EUN A;  4F5F A;  2YRI A;  2W8U A;  2VMW A;  3P1T A;  1I48 A;  1QIR A;  2JG2 A;  5D95 A;  1LK9 A;  2R2N A;  3I16 A;  3WKR A;  2AY7 A;  4WYC A;  3VOM A;  1H0C A;  1SFF A;  1EJI A;  4XAU A;  1DTY A;  3N5M A;  3WCO A;  4R2N A;  3IHJ A;  3K40 A;  3PD6 B;  5LHA A;  4MKJ A;  1OXP A;  3ISL A;  2GMU A;  2HP1 A;  2AY3 A;  2Z1Z A;  4TN4 A;  1AKC A;  5E4Z A;  3RCH B;  4CXQ A;  2Z1Y A;  3A2B A;  2CIN A;  3FDB A;  3MC6 A;  2RFV A;  2ZYJ A;  3NU8 A;  4ZSY A;  3M5U A;  2ZY4 A;  3CQ4 A;  2VMR A;  1GBN A;  4ZAH A;  3D6K A;  3EI6 A;  3TQX A;  2OGE A;  3EI7 A;  4MQP A;  4WYE A;  4WXG A;  4F5K A;  5HXX A;  2Z20 A;  3PJ0 A;  5TF5 A;  1PFF A;  2EYQ A;  1D7U A;  1UU0 A;  1LC7 A;  2Z9W A;  3NYT A;  4Y0I A;  4ATQ A;  2YKY A;  5F9S A;  4F4E A;  1DGE A;  2Q7W A;  1WKH A;  2TPL A;  5HDM A;  2YCP A;  1CQ7 A;  2VGU A;  4LNM A;  4XK1 A;  5E5I A;  1S06 A;  1CZE A;  4UHN A;  1I29 A;  2BWO A;  1Z3Z A;  1OHY A;  3PPL A;  1XEY A;  5D5S A;  2VLH A;  4DGT A;  1W23 A;  4PFN A;  5M49 A;  1AJS A;  3CQ6 A;  3EIA A;  2Z9U A;  3HVY A;  1AAM A;  1B4X A;  1OHV A;  1SZS A;  2EH6 A;  3K7Y A;  1ARI A;  1DJE A;  1KMK A;  2AY1 A;  4RLG A;  2W7K A;  1J32 A;  4Y0H A;  2DR1 A;  4XEW A;  1SZK A;  1BKG A;  4CBR A;  4WXB A;  4QGR A;  1X2A A;  7AAT A;  2BHX A;  2DKB A;  3JWA A;  3COG A;  1IX7 A;  2HZP A;  2VMU A;  2O0R A;  3BV0 A;  5E3K A;  3MEB A;  4UQV A;  1O62 A;  2CH2 A;  3AEP A;  2X5F A;  5JAY A;  4ITG A;  1TOK A;  3BCX A;  3EI9 A;  2VMY A;  3AOW A;  2VI9 A;  1W3U A;  2EGY A;  1PMM A;  2BYJ A;  1AX4 A;  3GBX A;  4RIT A;  3HT4 A;  4R5F A;  4WYG A;  3W1I A;  4WB0 A;  1AJS B;  1BJN A;  2FM1 A;  3BB8 A;  1TOI A;  3LVK A;  1X29 A;  1LC5 A;  4CBS A;  3K28 A;  4IY7 A;  2C7T A;  2XBN A;  1Y4I A; 
#chains in the Genus database with same CATH homology
 1B9H A;  4EU1 A;  2HP2 A;  3WGB A;  3FFR A;  3FZ8 A;  3CBF A;  2X3L A;  3RI6 A;  1VP4 A;  1RVU A;  3QPG A;  4OBU A;  1O4S A;  2CST A;  1AY8 A;  3FVX A;  8AAT A;  2VMS A;  2Z67 A;  4N0W A;  2AEU A;  2ZJG A;  1G7X A;  3GJU A;  2KFP A;  3WCN A;  5FT8 A;  3DXV A;  4E3R A;  2Z61 A;  3DC1 A;  2HOY A;  3E2Z A;  4OC9 A;  4RAE A;  1X0M A;  2AY6 A;  4LNJ A;  3WLX A;  1IX6 A;  3N4X A;  3ASA A;  2X8U A;  3A9Z A;  1CL2 A;  2PB0 A;  4WB0 B;  1GD9 A;  4DQ6 A;  4GDY A;  3LVL B;  4JEX A;  3P6K A;  2Z9V A;  4TMR A;  4LW4 A;  3VK2 A;  4IXZ A;  3OP7 A;  4MKK A;  4JF1 A;  4B9B A;  5FT5 A;  1RV4 A;  5M46 A;  2YHK A;  2YOB A;  4ZWM A;  4Q6R A;  1I43 A;  1GC3 A;  3KE3 A;  4GEB A;  3FZ6 A;  1V2F A;  4IXO A;  4K2B A;  3BC8 A;  4K2I A;  4F5I A;  2VMQ A;  1IAX A;  2VGS A;  2Z9X A;  4A0F A;  3AEL A;  2VMP A;  4RIZ A;  1QIT A;  2BI5 A;  3TCM A;  4AO9 A;  4BHD A;  3TFU A;  3PAA A;  3TFT A;  3FD0 A;  1M0O A;  2D64 A;  2EO5 A;  4H63 Q;  3E2Z B;  1ELU A;  3GR9 A;  3FQA A;  2ZY3 A;  4OYT A;  4K2M A;  4IYO A;  1UKJ A;  3MKJ A;  3AEN A;  3IF2 A;  4WLH A;  3MAF A;  2BI3 A;  3MBB A;  2QB2 A;  4M2M A;  2BI2 A;  5DB5 A;  3HBX A;  2AAT A;  1E5E A;  2O1B A;  3FSL A;  4ZM3 A;  4AZJ A;  2VGW A;  1C7N A;  4NOG A;  2V0Y A;  5FT4 A;  5AX8 A;  1JF9 A;  1W7N A;  3PDB A;  1AIC A;  1KKJ A;  3E77 A;  4MGR A;  4MY5 A;  1IBJ A;  4GE4 A;  2EPJ A;  3GWP A;  1KKP A;  3WZF A;  1AMQ A;  1ZC9 A;  3OKS A;  4A6U A;  4BQ0 A;  1YAA A;  1ELQ A;  1N8P A;  2E7J A;  2W7H A;  1ECX A;  2W7I A;  3QN6 A;  4U2H A;  2CAN A;  2W8T A;  1SZU A;  3FZ7 A;  4F5M A;  1BJO A;  3DR4 A;  3A9X A;  4W8I A;  1TOE A;  1E5F A;  1CQ6 A;  4IYO B;  3AEN B;  5G4J A;  1AHY A;  2YKU A;  3E2Y A;  1N2T A;  3G0T A;  1GEW A;  4MQR A;  3N0L A;  2WKA A;  1OXO A;  2W7M A;  3B1D A;  2W7L A;  3VP6 A;  3FQ8 A;  4HVK A;  2ZP7 A;  5EIG A;  1TPL A;  5I92 A;  1KL2 A;  3RBF A;  3JZL A;  4W91 A;  4ZAS A;  2O7C A;  3ELE A;  3F0H A;  3H14 A;  3QGU A;  4EMY A;  1MLY A;  3PDB B;  4IW7 A;  3NX3 A;  3BWN C;  3QI6 A;  3AEM A;  1MLZ A;  3ZRQ A;  4JEY A;  2WB6 A;  3LWS A;  4ITX A;  1ASF A;  2QBT A;  4EB5 A;  3FTB A;  3PGY A;  3WKS A;  2G7J A;  3ZZJ A;  2AY4 A;  2VMZ A;  2GB3 A;  1KL1 A;  4ZWV A;  2HUI A;  3FVU A;  2PO3 A;  2VGZ A;  3JU7 A;  3EI5 A;  4U1T A;  5M4D A;  1D7V A;  4BMK A;  1BJO B;  1YIZ A;  4RM1 A;  1AHE A;  1ARS A;  1BJW A;  1IJI A;  1WYV A;  2JJH A;  2VYC A;  4ZDP A;  1OAT A;  3FDD A;  1B5P A;  3AEJ C;  2OGA A;  4AH3 A;  3VK3 A;  3B8X A;  3Q8N A;  4J5U A;  3AAT A;  4KAM A;  1MAQ A;  2EZ2 A;  3FKD A;  4OT8 A;  3NDN A;  4BA4 A;  4F5J A;  3RQ1 A;  3JWB A;  4WLJ A;  5DX5 A;  5G4I A;  4AZK A;  1M32 A;  1SF2 A;  2DKJ A;  3HMU A;  1N31 A;  2OQX A;  4BA5 A;  2HOZ A;  3WGC A;  4CVQ A;  3EI8 A;  1MDZ A;  4EFF A;  2HOX A;  1I41 A;  2R0T A;  3B1C A;  4JF0 A;  2XH1 A;  2BI1 A;  2EZ1 A;  3BCA A;  2YRR A;  4W1X A;  5J8Q A;  3TAT A;  1BQD A;  1AHF A;  1C4K A;  1MAP A;  1TOG A;  2DOU A;  4IXS A;  4WYD A;  2DGK A;  2VLF A;  2JGT A;  4E77 A;  2ZSL A;  3HDO A;  3BS8 A;  5HHY A;  1C7G A;  1QZ9 A;  5G0A A;  4Q31 A;  4RKC A;  4XJP A;  2OKK A;  1M4N A;  4O6Z A;  3KGX A;  1T3I A;  1AAW A;  2VMV A;  2D7Z A;  2GSA A;  3N75 A;  4M2K A;  3ATH A;  4F5G A;  1GCK A;  3GSB A;  2G6W A;  4P7Y A;  5G2P A;  4JE5 A;  3UWC A;  4A6T A;  4MQQ A;  4AO4 A;  4ZDO A;  1GEX A;  1RV3 A;  2D65 A;  1GC0 A;  3E9K A;  5F8V A;  1KMJ A;  3DU4 A;  3AEM C;  3EUC A;  1ASA A;  3JTX A;  2OKJ A;  2BWN A;  1ASL A;  4MSO A;  1AIB A;  3ZZK A;  1DKA A;  2E7I A;  1Z7D A;  4WBT A;  4A6R A;  4B98 A;  4A00 A;  2BI9 A;  3NU7 A;  2BIG A;  2FN6 A;  3ELP A;  2VMN A;  1WYT A;  1QGN A;  2V1P A;  4M2J A;  4TV7 A;  5C6U A;  1EQB A;  3AEO A;  3H7F A;  3B1E A;  3B46 A;  1PG8 A;  3NYU A;  1O61 A;  2QLR A;  3F6T A;  1AKA A;  3WX9 A;  4AOA A;  3H9X A;  2FKI A;  2FNU A;  1LW5 A;  1TOJ A;  2JJE A;  2GQN A;  3BWN A;  1QIS A;  4LW2 A;  4WYF A;  3DXW A;  4KYO A;  1AHG A;  1FC4 A;  3GZC A;  1BS0 A;  1EG5 A;  4GSA A;  1C7O A;  2BYL A;  1AMS A;  1IX8 A;  3FQ7 A;  4GRX A;  4A0G A;  1GEY A;  3ECD A;  4JEZ A;  2HUU A;  1ARH A;  1BT4 A;  1C0N A;  2JJG A;  3W1J A;  2JIS A;  2W8J A;  3I5T A;  1S09 A;  1BJ4 A;  4UHM A;  4XJM A;  5LH9 A;  3HL2 A;  1TAS A;  1ASD A;  4JEV A;  1S08 A;  3NUB A;  3PIU A;  3AEJ A;  4ADD A;  1SPA A;  2ZUK A;  1ASE A;  4Q76 A;  1AMR A;  2QMA A;  9AAT A;  2CY8 A;  3MAU A;  1M6S A;  3LVM A;  4KXK A;  1M0P A;  3I4J A;  2QSR A;  3RBL A;  4LNL A;  2ZY2 A;  1ASM A;  1JG8 A;  2AY8 A;  2HOR A;  1QJ3 A;  1PMO A;  2DGM A;  4DBC A;  4L0O A;  2C44 A;  4W1W A;  3USF A;  4OTL A;  4IX8 A;  5K8B A;  3F9T A;  5DJ1 A;  2YKX A;  2W8V A;  2W7F A;  1AKB A;  1DJU A;  1ASN A;  3R4T A;  4OBV A;  2F8J A;  3FVS A;  5DJ9 A;  3MAF B;  5EUD A;  3QM2 A;  1CS1 A;  1W7M A;  2C0R A;  3VAX A;  1ART A;  1AIA A;  5EFS A;  2D63 A;  2CH1 A;  4ZSW A;  2BIE A;  3KGW A;  2BKW A;  1RVY A;  2FQ6 A;  2YCT A;  3JW9 A;  4A0R A;  3WY7 A;  1AY5 A;  4WYA A;  3ZRP A;  3A8U X;  4R8D A;  3E6G A;  1GC2 A;  3G8M A;  3N4R A;  2CFB A;  2ZC0 A;  5EAA A;  1UU1 A;  2VMT A;  2VGV A;  2AEV A;  3ASB A;  3HLM A;  2JJF A;  4EB7 A;  1M7Y A;  1AJR A;  2ZY5 A;  2WK9 A;  3GZD A;  1B5O A;  1YOO A;  1JS6 A;  4GE9 A;  1YJS A;  4UHO A;  1X28 A;  1ORD A;  4E1O A;  4ATP A;  4H51 A;  5G2Q A;  2CB1 A;  3UAK A;  2DGL A;  1V72 A;  4J8L A;  3II0 A;  4P3M A;  2BWP A;  3BWO A;  1WKG A;  3DYD A;  2FYF A;  2BIA A;  5EIG B;  4ZDL A;  1ARG A;  3QBO A;  2E7U A;  3QHX A;  1CL1 A;  1S0A A;  2A1V A;  3R9A A;  3DZZ A;  3PA9 A;  1VJO A;  2CJD A;  4I8A A;  4ADE A;  1IVR A;  4GE7 A;  3LVJ A;  4ISY A;  2AY9 A;  4JEW A;  1QJ5 A;  2D66 A;  1G4V A;  1GC4 A;  3FRK A;  3LG0 A;  4RKD A;  3UE8 A;  3EZS A;  1WYU A;  2FNI A;  1C9C A;  1OHW A;  2R5E A;  4JE5 D;  4XJO A;  4CXR A;  1D2F A;  2WK7 A;  1AHX A;  1WST A;  1SVV A;  2QA3 A;  1DFO A;  3PDX A;  1VEF A;  1MDO A;  1ZOB A;  2YCN A;  2ZSM A;  1G7W A;  1CJ0 A;  3FFH A;  1WYV B;  4W5K A;  2GMS A;  3N7N A;  2CJG A;  3N4S A;  3DRD A;  3HQT A;  3MAD A;  2CTZ A;  2AY5 A;  2VMX A;  4OMA A;  1YNU A;  1ASB A;  5EAV A;  2HUF A;  4HF8 A;  1O69 A;  4XJL A;  4E3Q A;  3EIB A;  4FL0 A;  3CQ5 A;  4WP0 A;  5IWQ A;  3AV7 A;  1BW0 A;  2D7Y A;  4F5L A;  1YIY A;  4RJY A;  3T32 A;  3EZ1 A;  1LW4 A;  3NNK A;  3RUY A;  3MC6 C;  2D5Y A;  1DJ9 A;  3NRA A;  4PFF A;  1FG3 A;  1H1C A;  5G09 A;  1WYU B;  3GZD C;  5FT6 A;  1CQ8 A;  2X5D A;  1D7S A;  1DGD A;  3VK4 A;  3GET A;  3LV2 A;  3NYS A;  1MDX A;  3E2F A;  1LS3 A;  2CJH A;  2W8W A;  4RJ0 A;  1XI9 A;  2PB2 A;  1BQA A;  3NUI A;  1IUG A;  4ADB A;  1G4X A;  1ZOD A;  2VMO A;  1LC8 A;  1YJZ A;  1YJY A;  2OAT A;  2W7J A;  2YKV A;  4PIW A;  4Y0D A;  5M4B A;  1TAT A;  3KKI A;  2VGT A;  1AMA A;  2QB3 A;  4F5H A;  2R5C A;  3A9Y A;  1TAR A;  3LY1 A;  4A0H A;  3AOV A;  4ADC A;  1P3W A;  1UU2 A;  4K05 A;  2W7G A;  1GDE A;  4LC3 A;  2VIB A;  2W7E A;  4PVF A;  1V2E A;  2C81 A;  1J04 A;  1IAY A;  3ACZ A;  3BN1 A;  4WXF A;  3NTJ A;  1WYT B;  3BCB A;  3FCR A;  1S07 A;  4Q75 A;  1AY4 A;  5BJ3 A;  4R5Z A;  5KTB A;  3CAI A;  1LKC A;  1M0N A;  1FG7 A;  5EQC A;  1JS3 A;  2AY2 A;  3DR7 A;  4ZLV A;  3PD6 A;  3ZRR A;  5BJ4 A;  1U08 A;  2WK8 A;  4OCA A;  1B8G A;  1MGV A;  2VIA A;  3G7Q A;  3RCH A;  1M0Q A;  2D61 A;  2ORD A;  3W1H A;  3L8A A;  4W1V A;  4WD2 A;  5EUE A;  4XQ2 A;  2W7D A;  2R5C B;  1ASC A;  3L44 A;  2NMP A;  4N0B A;  4UOY A;  1CZC A;  1B9I A;  4FFC A;  4A72 A;  2VI8 A;  1W7L A;  1V2D A;  1D7R A;  2E54 A;  3DOD A;  1ASG A;  4ZM4 A;  5EUN A;  4F5F A;  2YRI A;  2W8U A;  2VMW A;  3P1T A;  1I48 A;  1QIR A;  2JG2 A;  5D95 A;  1LK9 A;  2R2N A;  3I16 A;  3WKR A;  2AY7 A;  4WYC A;  3VOM A;  1H0C A;  1SFF A;  1EJI A;  4XAU A;  1DTY A;  3N5M A;  3WCO A;  4R2N A;  3IHJ A;  3K40 A;  3PD6 B;  5LHA A;  4MKJ A;  1OXP A;  3ISL A;  2GMU A;  2HP1 A;  2AY3 A;  2Z1Z A;  4TN4 A;  1AKC A;  5E4Z A;  3RCH B;  4CXQ A;  2Z1Y A;  3A2B A;  2CIN A;  3FDB A;  3MC6 A;  2RFV A;  2ZYJ A;  3NU8 A;  4ZSY A;  3M5U A;  2ZY4 A;  3CQ4 A;  2VMR A;  1GBN A;  4ZAH A;  3D6K A;  3EI6 A;  3TQX A;  2OGE A;  3EI7 A;  4MQP A;  4WYE A;  4WXG A;  4F5K A;  5HXX A;  2Z20 A;  3PJ0 A;  5TF5 A;  1PFF A;  2EYQ A;  1D7U A;  1UU0 A;  1LC7 A;  2Z9W A;  3NYT A;  4Y0I A;  4ATQ A;  2YKY A;  5F9S A;  4F4E A;  1DGE A;  2Q7W A;  1WKH A;  2TPL A;  5HDM A;  2YCP A;  1CQ7 A;  2VGU A;  4LNM A;  4XK1 A;  5E5I A;  1S06 A;  1CZE A;  4UHN A;  1I29 A;  2BWO A;  1Z3Z A;  1OHY A;  3PPL A;  1XEY A;  5D5S A;  2VLH A;  4DGT A;  1W23 A;  4PFN A;  5M49 A;  1AJS A;  3CQ6 A;  3EIA A;  2Z9U A;  3HVY A;  1AAM A;  1B4X A;  1OHV A;  1SZS A;  2EH6 A;  3K7Y A;  1ARI A;  1DJE A;  1KMK A;  2AY1 A;  4RLG A;  2W7K A;  1J32 A;  4Y0H A;  2DR1 A;  4XEW A;  1SZK A;  1BKG A;  4CBR A;  4WXB A;  4QGR A;  1X2A A;  7AAT A;  2BHX A;  2DKB A;  3JWA A;  3COG A;  1IX7 A;  2HZP A;  2VMU A;  2O0R A;  3BV0 A;  5E3K A;  3MEB A;  4UQV A;  1O62 A;  2CH2 A;  3AEP A;  2X5F A;  5JAY A;  4ITG A;  1TOK A;  3BCX A;  3EI9 A;  2VMY A;  3AOW A;  2VI9 A;  1W3U A;  2EGY A;  1PMM A;  2BYJ A;  1AX4 A;  3GBX A;  4RIT A;  3HT4 A;  4R5F A;  4WYG A;  3W1I A;  4WB0 A;  1AJS B;  1BJN A;  2FM1 A;  3BB8 A;  1TOI A;  3LVK A;  1X29 A;  1LC5 A;  4CBS A;  3K28 A;  4IY7 A;  2C7T A;  2XBN A;  1Y4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...