5AX8A

Recombinant expression, purification and preliminary crystallographic studies of the mature form of human mitochondrial aspartate aminotransferase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
401
structure length
401
Chain Sequence
SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase, mitochondrial
publication title Recombinant expression, purification and crystallographic studies of the mature form of human mitochondrial aspartate aminotransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5ax8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ax8A01
1O61A 2W7DA 1KL1A 3FFHA 1W7MA 4WYDA 1AX4A 3E2ZB 1LK9A 5AX8A 3WGCA 5HXXA 4CXQA 2VGUA 2CH1A 3PDBA 3G0TA 1IJIA 3DZZA 3UAKA 1TATA 3HT4A 3NX3A 1D7UA 3PGYA 1BJNA 1TOJA 4IYOA 3HL2A 1GEXA 3GZDC 4W8IA 2VMXA 1I41A 4XJMA 4UHMA 4K2IA 5G0AA 3MBBA 1GBNA 4OTLA 4OT8A 1C0NA 2AATA 4E1OA 1LS3A 7AATA 3WY7A 4EU1A 1CQ8A 1CZEA 5HHYA 2YRIA 3RI6A 4RM1A 4IXZA 1CQ6A 5J8QA 3BC8A 2R5CA 1LC5A 2PO3A 2VMNA 4GE7A 4AZJA 1WYVB 1AIBA 2BIEA 3E9KA 4MQRA 4XEWA 5G4JA 2XH1A 4F5KA 3NRAA 2EGYA 1DGEA 2JJHA 1LKCA 4ZWVA 3PDBB 2Z9WA 2R2NA 2BI2A 2DGLA 2W7EA 4W1VA 1ASAA 2JJGA 3ELEA 1DJEA 4A6RA 3EZ1A 4WXGA 1DJ9A 3FFRA 1V72A 3W1IA 3GZCA 5TF5A 4EFFA 2BIGA 1QIRA 3K40A 2EO5A 3PD6A 3B1DA 3FVUA 4HVKA 1VJOA 3P1TA 4JEVA 3RCHA 3ZRPA 4EB5A 3KKIA 3NU7A 3AATA 5D5SA 4W91A 1SZKA 2JJEA 2AY9A 4AZKA 4BQ0A 1I43A 2XBNA 2HUUA 1UKJA 2VGVA 2C44A 3IHJA 5LH9A 4F5MA 4L0OA 1AKBA 3PAAA 1WYTA 3VOMA 3AOVA 2GMUA 2VGWA 4I8AA 4PFFA 4DBCA 2VMSA 3LVJA 1YJSA 2D63A 4FL0A 4H51A 3BV0A 2DKBA 3NUBA 2Z9UA 3FSLA 4IXSA 1BJWA 2OQXA 1AHEA 3PPLA 3NTJA 5G2QA 2DGMA 1IX6A 2BHXA 1CZCA 2BWPA 1H1CA 2E7JA 3DU4A 1MGVA 2JJFA 2VGZA 5FT5A 4WB0A 1CJ0A 4IW7A 4B9BA 1M0QA 1RV4A 4XJLA 3GBXA 1SZSA 3B1EA 4TMRA 2V0YA 2BWNA 1S09A 3WLXA 4A0FA 2VMZA 1WYUA 1KL2A 1UU0A 2D66A 2W7FA 1ARSA 3I5TA 5G09A 5DB5A 3VK3A 1J04A 3VK4A 2CJGA 1E5EA 1CL2A 5G2PA 4JEYA 4MKKA 1AIAA 2QMAA 4RJ0A 2JG2A 4Y0DA 5IWQA 4HF8A 1RVYA 1FG3A 1W3UA 4AO9A 4K2BA 2F8JA 5FT6A 1GC4A 3NYTA 4EB7A 2DGKA 2V1PA 1I48A 1TOIA 1BW0A 4OCAA 5JAYA 3AEMC 3HMUA 2HP1A 4IY7A 2Z9XA 2VGSA 4LNMA 4J8LA 2PB0A 4KYOA 4ZWMA 4JEWA 1DJUA 2Z61A 2HOZA 2D64A 1V2DA 3ZRQA 1YIZA 3MC6C 4AOAA 4LNJA 4LW4A 3HLMA 4CBSA 3HDOA 4N0WA 4GEBA 4N0BA 1X28A 4XJOA 2CH2A 3EI7A 1MLYA 4M2KA 5I92A 4ZM3A 4OYTA 1GD9A 2HOXA 2ZSLA 1JS6A 5DX5A 1SPAA 4F5LA 1BT4A 1IBJA 4Q6RA 2GQNA 3VAXA 4WYAA 5E5IA 1ASBA 1JS3A 1WYUB 1UU1A 3ASBA 3ZRRA 3A9YA 4K2MA 3MC6A 2ZC0A 3CBFA 4ZM4A 4J5UA 3QI6A 1S0AA 4XQ2A 1KMJA 3WKSA 1AHFA 4LNLA 4ZASA 2QB3A 2BI5A 3E2FA 4U2HA 3AENA 4JF1A 4MY5A 1M0OA 2AY5A 1D2FA 3TQXA 1IX7A 3CQ4A 4B98A 1AKAA 1AHXA 2ZP7A 3E2YA 3HBXA 4P7YA 4DGTA 2ZY5A 4LC3A 4O6ZA 1M0PA 1ARGA 1W23A 1SFFA 4ZDLA 2VYCA 2DR1A 1PMMA 3MAUA 3D6KA 1ASDA 3CQ5A 1MDOA 1M6SA 2FN6A 4WYEA 3BB8A 1PMOA 2W7MA 3FD0A 2VI9A 5EUNA 3LVMA 4ZDPA 5EAVA 1ARHA 1D7VA 2VMYA 3Q8NA 2ZJGA 4Q76A 4OC9A 1B8GA 3UE8A 2VLHA 1IAXA 3A9XA 3EI6A 1S06A 3OKSA 2DKJA 3BWNA 3A2BA 1BJ4A 4F5JA 3QBOA 3QPGA 5D95A 4R5ZA 1ZOBA 4KAMA 4F5HA 2QBTA 2QB2A 2ZY2A 1G7XA 1GDEA 1U08A 1AKCA 5E3KA 1X2AA 2E7IA 2YHKA 3M5UA 3ZZKA 5F9SA 3COGA 3AENB 3PDXA 1QJ5A 4ZSWA 2VMVA 3JW9A 3WX9A 5EAAA 4GE9A 1XEYA 4R5FA 1Z7DA 3FKDA 1DFOA 5DJ1A 1RVUA 2BYLA 3FZ8A 4W1XA 3BWOA 4ADEA 1O62A 3CQ6A 4RJYA 5EQCA 3EZSA 2ZUKA 3RBFA 1W7LA 5EIGA 3BCBA 2VMQA 2W7GA 2VLFA 5M49A 2E54A 1V2FA 1BKGA 3JWAA 3QGUA 3N0LA 3TFTA 2BIAA 3RQ1A 3MEBA 1YOOA 4F4EA 1TASA 4BA4A 4ZAHA 2ORDA 2D7YA 3OP7A 1DKAA 2BYJA 5F8VA 1B5PA 1QGNA 3G8MA 3ATHA 1AHYA 1GC0A 1EG5A 2GMSA 1ASMA 1TOKA 1PFFA 3IF2A 1WKHA 4OBUA 2BWOA 5M4DA 2YKVA 1AMSA 3GJUA 2CJHA 2QA3A 3JU7A 1X29A 2YCTA 5HDMA 1C4KA 2YRRA 2CJDA 1FC4A 3BCAA 2AY8A 3FVSA 3WCNA 1N2TA 3FRKA 2AY1A 1MLZA 3NNKA 4FFCA 4Y0HA 4DQ6A 1VP4A 5DJ9A 1YJYA 3FDDA 3F0HA 1Z3ZA 2YKUA 4IXOA 1AJRA 1AMQA 1FG7A 2VIAA 4PFNA 1BS0A 1M7YA 5BJ3A 1TOEA 1GEYA 3EIBA 2ZY4A 4GRXA 2E7UA 3MKJA 3JZLA 2CB1A 2DOUA 4F5IA 3FQ7A 3HQTA 4GE4A 2C7TA 3GR9A 4WP0A 2HORA 1LC8A 2X3LA 4R2NA 3GETA 1VEFA 4XJPA 4A00A 2Z20A 4PVFA 4W5KA 5EIGB 1LW4A 2Z1YA 1B5OA 2W7LA 3PIUA 1H0CA 3PA9A 4UHOA 2VMPA 2R5EA 1GCKA 1JG8A 1EJIA 1OHYA 2FNIA 4UHNA 5LHAA 3QHXA 4XK1A 1GEWA 1V2EA 3TCMA 1AMRA 1OHWA 1KKJA 1CQ7A 1XI9A 3BS8A 4WLHA 4EMYA 1N31A 1AY8A 2FQ6A 2X8UA 3VK2A 1SVVA 1B4XA 1GC2A 1CS1A 4ITGA 3FCRA 4F5FA 3FZ6A 4MSOA 4WYFA 3RUYA 1RV3A 4W1WA 3KGXA 5EFSA 2WK9A 3A9ZA 3AV7A 2VMWA 5M4BA 4CBRA 4WBTA 2Z9VA 5BJ4A 2Z1ZA 1C7OA 4R8DA 2HUIA 1ASEA 2HP2A 4RITA 4E3RA 4F5GA 2O7CA 3DRDA 4Q75A 4RKDA 2AY7A 3ISLA 2O1BA 1ZODA 2OGAA 2W8WA 4WXFA 1DTYA 3DR4A 2TPLA 3H7FA 3L44A 1IAYA 1AJSB 4NOGA 4QGRA 4XAUA 4ADDA 4BA5A 2C0RA 2Q7WA 2VMTA 1BJOB 3H14A 1G4VA 3KE3A 4MKJA 2GSAA 3K7YA 3II0A 1S07A 1AY5A 3LV2A 3AELA 1C7GA 1ELUA 1QZ9A 1X0MA 3ELPA 2W7HA 2ZY3A 1N8PA 3E6GA 2VI8A 3AEOA 1YNUA 1SF2A 2W8TA 3AEJA 3PJ0A 1B9IA 4JE5D 4WD2A 1KMKA 5FT8A 3AEPA 5EUEA 3TATA 1KKPA 1JF9A 2R0TA 3G7QA 3ZZJA 5E4ZA 4OBVA 3K28A 3FZ7A 3WKRA 1GC3A 3NYSA 3BWNC 4UQVA 2CFBA 3DYDA 3ECDA 1D7SA 1TARA 2X5FA 1ELQA 4WYCA 2AEVA 2X5DA 1ASFA 2Z67A 1WSTA 8AATA 3DC1A 3A8UX 1EQBA 1E5FA 3EUCA 2HOYA 3MAFA 3LWSA 3GZDA 1WKGA 2CANA 3AOWA 4GSAA 1G4XA 1C7NA 3LVKA 1W7NA 2JISA 3E77A 3FTBA 1DGDA 3JWBA 2ZYJA 4ADBA 2FM1A 1ASCA 3W1JA 1QJ3A 2AY6A 5FT4A 4ATQA 3EI5A 3P6KA 1S08A 2BI9A 4JEZA 4MQQA 2BI3A 5EUDA 3NU8A 3N5MA 2W7IA 1MAPA 4M2MA 2EPJA 1SZUA 2AY2A 1TOGA 1Y4IA 2W8JA 2FNUA 3ASAA 4BHDA 3DR7A 2W8VA 2W7JA 3DXWA 1QISA 2CY8A 4LW2A 3FVXA 3GSBA 4IYOB 1M32A 4E77A 2AEUA 4ISYA 2VIBA 3ACZA 4MQPA 3DXVA 4E3QA 2YKYA 1ASGA 2D65A 2EZ1A 4UOYA 4A6UA 1LW5A 3FQ8A 4Q31A 3T32A 5K8BA 3B46A 2QLRA 3F9TA 1AICA 2WKAA 4WYGA 1OATA 4Y0IA 3I16A 1AAWA 1ECXA 1P3WA 4AH3A 1M4NA 2FYFA 4ADCA 3DODA 4RIZA 1QITA 2AY4A 2C81A 3MAFB 3QN6A 3JTXA 2OATA 3EI8A 4A0RA 2YKXA 4WXBA 2ZSMA 5M46A 4ZLVA 3LG0A 3HVYA 2G6WA 2R5CB 2EZ2A 1OXOA 3W1HA 4AO4A 2YCNA 1IUGA 4JEXA 4A0GA 2OGEA 3NDNA 3F6TA 3UWCA 1AHGA 1BQAA 3GWPA 9AATA 2WK7A 1AJSA 3EI9A 3N75A 2VMOA 1BJOA 4IX8A 1UU2A 3WGBA 4JF0A 4ZSYA 1ARIA 2O0RA 3FQAA 4RLGA 3WCOA 4A6TA 3B1CA 2HUFA 1B9HA 4CXRA 2YOBA 1ZC9A 1MDZA 3USFA 3BCXA 4M2JA 1YAAA 1YJZA 2W8UA 1O69A 3PD6B 2YCPA 2HZPA 3E2ZA 2PB2A 3FDBA 1O4SA 4JE5A 2CINA 4P3MA 1C9CA 3RCHB 1G7WA 1IVRA 3EIAA 2GB3A 3NUIA 3NYUA 1IX8A 2EH6A 2D5YA 3KGWA 3LVLB 4A0HA 2OKKA 3R9AA 1BQDA 3LY1A 1OHVA 3BN1A 1T3IA 4U1TA 1MDXA 3CAIA 1ASNA 1OXPA 4BMKA 1WYTB 2D7ZA 1M0NA 3I4JA 4A72A 4GDYA 4OMAA 4RKCA 2VGTA 4RAEA 5G4IA 5C6UA 3VP6A 2JGTA 1AMAA 1CL1A 4CVQA 4ZDOA 2CTZA 2NMPA 2VMRA 3R4TA 3MADA 3RBLA 1TPLA 2BKWA 2BI1A 1MAQA 3QM2A 1AY4A 3AEJC 3L8AA 2VMUA 4ITXA 1D7RA 1I29A 2AY3A 2RFVA 3B8XA 1PG8A 4WLJA 4PIWA 1AAMA 1ASLA 1YIYA 2D61A 2W7KA 3TFUA 4ATPA 4TN4A 4MGRA 2OKJA 2WK8A 1WYVA 4KXKA 3WZFA 4WB0B 2CSTA 1J32A 1LC7A 1ARTA 3AEMA 1ORDA 4TV7A
chains in the Genus database with same CATH superfamily
1O61A 2W7DA 1KL1A 3FFHA 1W7MA 4WYDA 1AX4A 3E2ZB 1LK9A 5AX8A 3WGCA 5HXXA 4CXQA 2VGUA 2CH1A 3PDBA 3G0TA 1IJIA 3DZZA 3UAKA 1KAFA 1TATA 3HT4A 3NX3A 1D7UA 3PGYA 1BJNA 1TOJA 4IYOA 3HL2A 1GEXA 3GZDC 4W8IA 2VMXA 5KTBA 1I41A 4XJMA 2QSRA 4UHMA 4K2IA 5G0AA 3MBBA 1GBNA 4OTLA 4OT8A 1C0NA 2AATA 4E1OA 1LS3A 7AATA 3WY7A 4EU1A 1CQ8A 1CZEA 5HHYA 2YRIA 3RI6A 4RM1A 4IXZA 1CQ6A 5J8QA 3BC8A 2R5CA 1LC5A 2PO3A 2VMNA 4GE7A 4AZJA 1WYVB 1AIBA 2BIEA 3E9KA 4MQRA 4XEWA 5G4JA 2XH1A 4F5KA 3NRAA 2EGYA 1DGEA 2JJHA 1LKCA 4ZWVA 3PDBB 2Z9WA 2R2NA 2BI2A 2DGLA 2W7EA 4W1VA 1ASAA 2JJGA 3ELEA 1DJEA 4A6RA 3EZ1A 4WXGA 1DJ9A 3FFRA 1V72A 3W1IA 3GZCA 5TF5A 4EFFA 2BIGA 1QIRA 3K40A 2EO5A 3PD6A 3B1DA 3FVUA 4HVKA 1VJOA 3P1TA 4JEVA 3RCHA 3ZRPA 4EB5A 3KKIA 3NU7A 3AATA 5D5SA 4W91A 1SZKA 2JJEA 2AY9A 4AZKA 4BQ0A 1I43A 2XBNA 2HUUA 1UKJA 2VGVA 2C44A 3IHJA 5LH9A 4F5MA 4L0OA 1AKBA 3PAAA 1WYTA 3VOMA 3AOVA 2GMUA 2VGWA 4I8AA 4PFFA 4DBCA 2VMSA 3LVJA 1YJSA 2D63A 4FL0A 4H51A 3BV0A 2DKBA 3NUBA 2Z9UA 3FSLA 4IXSA 1BJWA 2OQXA 1AHEA 3PPLA 3NTJA 5G2QA 2DGMA 1IX6A 2BHXA 1CZCA 2BWPA 1H1CA 2E7JA 3DU4A 1MGVA 2JJFA 2VGZA 5FT5A 4WB0A 1CJ0A 4IW7A 4B9BA 1M0QA 1RV4A 4XJLA 3GBXA 1SZSA 3B1EA 4TMRA 2V0YA 2BWNA 1S09A 3WLXA 4A0FA 2VMZA 1WYUA 1KL2A 1UU0A 2D66A 2W7FA 1ARSA 3I5TA 5G09A 5DB5A 3VK3A 1J04A 3VK4A 2CJGA 1E5EA 1CL2A 5G2PA 4JEYA 4MKKA 1AIAA 2QMAA 4RJ0A 2JG2A 4Y0DA 5IWQA 4HF8A 1RVYA 1FG3A 1W3UA 4AO9A 4K2BA 2F8JA 5FT6A 1GC4A 3NYTA 4EB7A 2DGKA 2V1PA 1I48A 1TOIA 1BW0A 4OCAA 5JAYA 3AEMC 3HMUA 2HP1A 4IY7A 2Z9XA 2VGSA 4LNMA 4J8LA 2PB0A 4KYOA 4ZWMA 4JEWA 1DJUA 2Z61A 2HOZA 2D64A 1V2DA 3ZRQA 1YIZA 3MC6C 4AOAA 4LNJA 4LW4A 3HLMA 4CBSA 3HDOA 4N0WA 2KFPA 4GEBA 4N0BA 1X28A 4XJOA 2CH2A 3EI7A 1MLYA 4M2KA 5I92A 4ZM3A 4OYTA 1GD9A 2HOXA 2ZSLA 1JS6A 5DX5A 1SPAA 4F5LA 1BT4A 1IBJA 4Q6RA 2GQNA 3VAXA 4WYAA 5E5IA 1ASBA 1JS3A 1WYUB 1UU1A 3ASBA 3ZRRA 3A9YA 4K2MA 3MC6A 2ZC0A 3CBFA 4ZM4A 4J5UA 3QI6A 1S0AA 4XQ2A 1KMJA 3WKSA 1AHFA 4LNLA 4ZASA 2QB3A 2BI5A 3E2FA 4U2HA 3AENA 4JF1A 4MY5A 1M0OA 2AY5A 1D2FA 3TQXA 1IX7A 3CQ4A 4B98A 1AKAA 1AHXA 2ZP7A 3E2YA 3HBXA 4P7YA 4DGTA 2ZY5A 4LC3A 4O6ZA 1M0PA 1ARGA 1W23A 1SFFA 4ZDLA 2VYCA 2DR1A 1PMMA 3MAUA 3D6KA 1ASDA 3CQ5A 2G7JA 1MDOA 1M6SA 2FN6A 4WYEA 3BB8A 1PMOA 2W7MA 3FD0A 2VI9A 5EUNA 3LVMA 4ZDPA 5EAVA 1ARHA 1D7VA 2VMYA 3Q8NA 2ZJGA 4Q76A 4OC9A 1B8GA 3UE8A 2VLHA 1IAXA 3A9XA 3EI6A 2A1VA 1S06A 3OKSA 2DKJA 3BWNA 3A2BA 1BJ4A 4F5JA 3QBOA 3QPGA 5D95A 4R5ZA 1ZOBA 4KAMA 4F5HA 2QBTA 2QB2A 2ZY2A 1G7XA 1GDEA 1U08A 1AKCA 5E3KA 1X2AA 2E7IA 2YHKA 3M5UA 3ZZKA 5F9SA 3COGA 3N7NA 3AENB 3PDXA 1QJ5A 4ZSWA 2VMVA 3JW9A 3WX9A 5EAAA 4GE9A 1XEYA 4R5FA 1Z7DA 3FKDA 1DFOA 5DJ1A 1RVUA 2BYLA 3FZ8A 4W1XA 3BWOA 4ADEA 1O62A 3CQ6A 4RJYA 5EQCA 3EZSA 2ZUKA 3RBFA 1W7LA 5EIGA 3BCBA 2VMQA 2W7GA 3N4RA 2VLFA 5M49A 2E54A 1V2FA 1BKGA 3JWAA 3QGUA 3N0LA 3TFTA 2BIAA 3RQ1A 3MEBA 1YOOA 4F4EA 1TASA 4BA4A 4ZAHA 2ORDA 2D7YA 3OP7A 1DKAA 2BYJA 5F8VA 1B5PA 1QGNA 3G8MA 3ATHA 1AHYA 1GC0A 1EG5A 2GMSA 1ASMA 1TOKA 1PFFA 3IF2A 1WKHA 4OBUA 2BWOA 4K05A 5M4DA 2YKVA 1AMSA 3GJUA 2CJHA 2QA3A 3JU7A 1X29A 2YCTA 5HDMA 1C4KA 4H63Q 2YRRA 2CJDA 1FC4A 3BCAA 2AY8A 3FVSA 3WCNA 1N2TA 3FRKA 2AY1A 1MLZA 3NNKA 4FFCA 4Y0HA 4DQ6A 1VP4A 5DJ9A 1YJYA 3FDDA 3F0HA 1Z3ZA 2YKUA 4IXOA 1AJRA 1AMQA 1FG7A 2VIAA 4PFNA 1BS0A 1M7YA 5BJ3A 1TOEA 1GEYA 3EIBA 2ZY4A 4GRXA 2E7UA 3MKJA 3JZLA 2CB1A 2DOUA 4F5IA 3FQ7A 3HQTA 4GE4A 2C7TA 3GR9A 4WP0A 2HORA 1LC8A 2X3LA 4R2NA 3GETA 1VEFA 4XJPA 4A00A 2Z20A 4PVFA 4W5KA 5EIGB 1LW4A 2Z1YA 1B5OA 2W7LA 3PIUA 1H0CA 3PA9A 4UHOA 2VMPA 2R5EA 1GCKA 1JG8A 1EJIA 1OHYA 2FNIA 4UHNA 5LHAA 3QHXA 4XK1A 1GEWA 1V2EA 3TCMA 1AMRA 1OHWA 1KKJA 1CQ7A 1XI9A 3BS8A 4WLHA 4EMYA 1N31A 1AY8A 2FQ6A 2X8UA 3VK2A 1SVVA 1B4XA 1GC2A 1CS1A 4ITGA 3FCRA 4F5FA 3FZ6A 4MSOA 4WYFA 3RUYA 1RV3A 4W1WA 3KGXA 5EFSA 2WK9A 3A9ZA 3AV7A 2VMWA 5M4BA 4CBRA 4WBTA 2Z9VA 5BJ4A 2Z1ZA 1C7OA 4R8DA 2HUIA 1ASEA 2HP2A 4RITA 4E3RA 4F5GA 2O7CA 3DRDA 4Q75A 4RKDA 2AY7A 3ISLA 2O1BA 1ZODA 2OGAA 2W8WA 4WXFA 1DTYA 3DR4A 2TPLA 3H7FA 3L44A 1IAYA 1AJSB 4NOGA 4QGRA 4XAUA 4ADDA 4BA5A 2C0RA 2Q7WA 2VMTA 1BJOB 3H14A 1G4VA 3KE3A 4MKJA 2GSAA 3K7YA 3II0A 1S07A 1AY5A 3LV2A 3AELA 1C7GA 1ELUA 1QZ9A 1X0MA 3ELPA 2W7HA 2ZY3A 1N8PA 3E6GA 2VI8A 3AEOA 1YNUA 1SF2A 2W8TA 3AEJA 3PJ0A 1B9IA 4JE5D 4WD2A 1KMKA 5FT8A 2EYQA 3AEPA 5EUEA 3TATA 1KKPA 1JF9A 2R0TA 3G7QA 3ZZJA 5E4ZA 4OBVA 3K28A 3FZ7A 2WB6A 3WKRA 1GC3A 3NYSA 3BWNC 4UQVA 2CFBA 3DYDA 3ECDA 1D7SA 1TARA 2X5FA 1ELQA 4WYCA 2AEVA 2X5DA 1ASFA 2Z67A 1WSTA 8AATA 3DC1A 3A8UX 1EQBA 1E5FA 3EUCA 2HOYA 3MAFA 3LWSA 3GZDA 1WKGA 2CANA 3AOWA 4GSAA 1G4XA 1C7NA 3LVKA 1W7NA 2JISA 3E77A 3FTBA 1DGDA 3JWBA 2ZYJA 4ADBA 2FM1A 1ASCA 3W1JA 1QJ3A 2AY6A 5FT4A 4ATQA 3EI5A 3P6KA 1S08A 2BI9A 4JEZA 4MQQA 2BI3A 5EUDA 3NU8A 3N5MA 2W7IA 1MAPA 4M2MA 2EPJA 1SZUA 2AY2A 1TOGA 1Y4IA 2W8JA 2FNUA 3ASAA 3H9XA 4BHDA 3DR7A 2W8VA 2W7JA 3DXWA 1QISA 2CY8A 4LW2A 3FVXA 3GSBA 4IYOB 1M32A 4E77A 2AEUA 4ISYA 2VIBA 3ACZA 4MQPA 3DXVA 4E3QA 2YKYA 1ASGA 2D65A 2EZ1A 4UOYA 4A6UA 1LW5A 3FQ8A 4Q31A 3T32A 5K8BA 3B46A 2QLRA 3F9TA 1AICA 2WKAA 4WYGA 1OATA 4Y0IA 3I16A 1AAWA 1ECXA 1P3WA 4AH3A 1M4NA 2FYFA 4ADCA 3DODA 4RIZA 1QITA 2AY4A 2C81A 3MAFB 2FKIA 3QN6A 3JTXA 2OATA 3EI8A 4A0RA 2YKXA 4WXBA 2ZSMA 5M46A 4ZLVA 3LG0A 3HVYA 2G6WA 2R5CB 2EZ2A 1OXOA 3W1HA 4AO4A 2YCNA 1IUGA 4JEXA 4A0GA 2OGEA 3NDNA 3F6TA 3N4SA 3UWCA 1AHGA 1BQAA 3GWPA 9AATA 2WK7A 1AJSA 3EI9A 3N75A 2VMOA 1BJOA 4IX8A 1UU2A 3WGBA 4JF0A 4ZSYA 1ARIA 2O0RA 3FQAA 4RLGA 3WCOA 4A6TA 3B1CA 2HUFA 1B9HA 4CXRA 2YOBA 1ZC9A 1MDZA 3USFA 3BCXA 4M2JA 1YAAA 1YJZA 2W8UA 1O69A 3PD6B 2YCPA 2HZPA 3E2ZA 2PB2A 3FDBA 1O4SA 4JE5A 2CINA 4P3MA 1C9CA 3RCHB 1G7WA 3N4XA 1IVRA 3EIAA 2GB3A 3NUIA 3NYUA 1IX8A 2EH6A 2D5YA 3KGWA 3LVLB 4A0HA 2OKKA 3R9AA 1BQDA 3LY1A 1OHVA 3BN1A 1T3IA 4U1TA 1MDXA 3CAIA 1ASNA 1OXPA 4BMKA 1WYTB 2D7ZA 1M0NA 3I4JA 4A72A 4GDYA 4OMAA 4RKCA 2VGTA 4RAEA 5G4IA 5C6UA 3VP6A 2JGTA 1AMAA 1CL1A 4CVQA 4ZDOA 2CTZA 2NMPA 2VMRA 3R4TA 3MADA 3RBLA 1TPLA 2BKWA 2BI1A 1MAQA 3QM2A 1AY4A 3AEJC 3L8AA 2VMUA 4ITXA 1D7RA 1I29A 2AY3A 2RFVA 3B8XA 1PG8A 4WLJA 4PIWA 1AAMA 1ASLA 1YIYA 2D61A 2W7KA 3TFUA 4ATPA 4TN4A 4MGRA 2OKJA 2WK8A 1WYVA 4KXKA 3WZFA 4WB0B 2CSTA 1J32A 1LC7A 1ARTA 3AEMA 1ORDA 4TV7A
chains in the Genus database with same CATH topology
1O61A 2W7DA 1KL1A 3FFHA 1W7MA 4WYDA 1AX4A 3E2ZB 1LK9A 5AX8A 3WGCA 5HXXA 4CXQA 2VGUA 2CH1A 3PDBA 3G0TA 1IJIA 3DZZA 3UAKA 1TATA 3HT4A 3NX3A 1D7UA 3PGYA 1BJNA 1TOJA 4IYOA 3HL2A 1GEXA 3GZDC 4W8IA 2VMXA 5KTBA 1I41A 4XJMA 2QSRA 4UHMA 4K2IA 5G0AA 3MBBA 1GBNA 4OTLA 4OT8A 1C0NA 2AATA 4E1OA 1LS3A 7AATA 3WY7A 4EU1A 1CQ8A 1CZEA 5HHYA 2YRIA 3RI6A 4RM1A 4IXZA 1CQ6A 5J8QA 3BC8A 2R5CA 1LC5A 2PO3A 2VMNA 4GE7A 4AZJA 1WYVB 1AIBA 2BIEA 3E9KA 4MQRA 4XEWA 5G4JA 2XH1A 4F5KA 3NRAA 2EGYA 1DGEA 2JJHA 1LKCA 4ZWVA 3PDBB 2Z9WA 2R2NA 2BI2A 2DGLA 2W7EA 4W1VA 1ASAA 2JJGA 3ELEA 1DJEA 4A6RA 3EZ1A 4WXGA 1DJ9A 3FFRA 1V72A 3W1IA 3GZCA 5TF5A 4EFFA 2BIGA 1QIRA 3K40A 2EO5A 3PD6A 3B1DA 3FVUA 4HVKA 1VJOA 3P1TA 4JEVA 3RCHA 3ZRPA 4EB5A 3KKIA 3NU7A 3AATA 5D5SA 4W91A 1SZKA 2JJEA 2AY9A 4AZKA 4BQ0A 1I43A 2XBNA 2HUUA 1UKJA 2VGVA 2C44A 3IHJA 5LH9A 4F5MA 4L0OA 1AKBA 3PAAA 1WYTA 3VOMA 3AOVA 2GMUA 2VGWA 4I8AA 4PFFA 4DBCA 2VMSA 3LVJA 1YJSA 2D63A 4FL0A 4H51A 3BV0A 2DKBA 3NUBA 2Z9UA 3FSLA 4IXSA 1BJWA 2OQXA 1AHEA 3PPLA 3NTJA 5G2QA 2DGMA 1IX6A 2BHXA 1CZCA 2BWPA 1H1CA 2E7JA 3DU4A 1MGVA 2JJFA 2VGZA 5FT5A 4WB0A 1CJ0A 4IW7A 4B9BA 1M0QA 1RV4A 4XJLA 3GBXA 1SZSA 3B1EA 4TMRA 2V0YA 2BWNA 1S09A 3WLXA 4A0FA 2VMZA 1WYUA 1KL2A 1UU0A 2D66A 2W7FA 1ARSA 3I5TA 5G09A 5DB5A 3VK3A 1J04A 3VK4A 2CJGA 1E5EA 1CL2A 5G2PA 4JEYA 4MKKA 1AIAA 2QMAA 4RJ0A 2JG2A 4Y0DA 5IWQA 4HF8A 1RVYA 1FG3A 1W3UA 4AO9A 4K2BA 2F8JA 5FT6A 1GC4A 3NYTA 4EB7A 2DGKA 2V1PA 1I48A 1TOIA 1BW0A 4OCAA 5JAYA 3AEMC 3HMUA 2HP1A 4IY7A 2Z9XA 2VGSA 4LNMA 4J8LA 2PB0A 4KYOA 4ZWMA 4JEWA 1DJUA 2Z61A 2HOZA 2D64A 1V2DA 3ZRQA 1YIZA 3MC6C 4AOAA 4LNJA 4LW4A 3HLMA 4CBSA 3HDOA 4N0WA 2KFPA 4GEBA 4N0BA 1X28A 4XJOA 2CH2A 3EI7A 1MLYA 4M2KA 5I92A 4ZM3A 4OYTA 1GD9A 2HOXA 2ZSLA 1JS6A 5DX5A 1SPAA 4F5LA 1BT4A 1IBJA 4Q6RA 2GQNA 3VAXA 4WYAA 5E5IA 1ASBA 1JS3A 1WYUB 1UU1A 3ASBA 3ZRRA 3A9YA 4K2MA 3MC6A 2ZC0A 3CBFA 4ZM4A 4J5UA 3QI6A 1S0AA 4XQ2A 1KMJA 3WKSA 1AHFA 4LNLA 4ZASA 2QB3A 2BI5A 3E2FA 4U2HA 3AENA 4JF1A 4MY5A 1M0OA 2AY5A 1D2FA 3TQXA 1IX7A 3CQ4A 4B98A 1AKAA 1AHXA 2ZP7A 3E2YA 3HBXA 4P7YA 4DGTA 2ZY5A 4LC3A 4O6ZA 1M0PA 1ARGA 1W23A 1SFFA 4ZDLA 2VYCA 2DR1A 1PMMA 3MAUA 3D6KA 1ASDA 3CQ5A 2G7JA 1MDOA 1M6SA 2FN6A 4WYEA 3BB8A 1PMOA 2W7MA 3FD0A 2VI9A 5EUNA 3LVMA 4ZDPA 5EAVA 1ARHA 1D7VA 2VMYA 3Q8NA 2ZJGA 4Q76A 4OC9A 1B8GA 3UE8A 2VLHA 1IAXA 3A9XA 3EI6A 2A1VA 1S06A 3OKSA 2DKJA 3BWNA 3A2BA 1BJ4A 4F5JA 3QBOA 3QPGA 5D95A 4R5ZA 1ZOBA 4KAMA 4F5HA 2QBTA 2QB2A 2ZY2A 1G7XA 1GDEA 1U08A 1AKCA 5E3KA 1X2AA 2E7IA 2YHKA 3M5UA 3ZZKA 5F9SA 3COGA 3N7NA 3AENB 3PDXA 1QJ5A 4ZSWA 2VMVA 3JW9A 3WX9A 5EAAA 4GE9A 1XEYA 4R5FA 1Z7DA 3FKDA 1DFOA 5DJ1A 1RVUA 2BYLA 3FZ8A 4W1XA 3BWOA 4ADEA 1O62A 3CQ6A 4RJYA 5EQCA 3EZSA 2ZUKA 3RBFA 1W7LA 5EIGA 3BCBA 2VMQA 2W7GA 3N4RA 2VLFA 5M49A 2E54A 1V2FA 1BKGA 3JWAA 3QGUA 3N0LA 3TFTA 2BIAA 3RQ1A 3MEBA 1YOOA 4F4EA 1TASA 4BA4A 4ZAHA 2ORDA 2D7YA 3OP7A 1DKAA 2BYJA 5F8VA 1B5PA 1QGNA 3G8MA 3ATHA 1AHYA 1GC0A 1EG5A 2GMSA 1ASMA 1TOKA 1PFFA 3IF2A 1WKHA 4OBUA 2BWOA 4K05A 5M4DA 2YKVA 1AMSA 3GJUA 2CJHA 2QA3A 3JU7A 1X29A 2YCTA 5HDMA 1C4KA 4H63Q 2YRRA 2CJDA 1FC4A 3BCAA 2AY8A 3FVSA 3WCNA 1N2TA 3FRKA 2AY1A 1MLZA 3NNKA 4FFCA 4Y0HA 4DQ6A 1VP4A 5DJ9A 1YJYA 3FDDA 3F0HA 1Z3ZA 2YKUA 4IXOA 1AJRA 1AMQA 1FG7A 2VIAA 4PFNA 1BS0A 1M7YA 5BJ3A 1TOEA 1GEYA 3EIBA 2ZY4A 4GRXA 2E7UA 3MKJA 3JZLA 2CB1A 2DOUA 4F5IA 3FQ7A 3HQTA 4GE4A 2C7TA 3GR9A 4WP0A 2HORA 1LC8A 2X3LA 4R2NA 3GETA 1VEFA 4XJPA 4A00A 2Z20A 4PVFA 4W5KA 5EIGB 1LW4A 2Z1YA 1B5OA 2W7LA 3PIUA 1H0CA 3PA9A 4UHOA 2VMPA 2R5EA 1GCKA 1JG8A 1EJIA 1OHYA 2FNIA 4UHNA 5LHAA 3QHXA 4XK1A 1GEWA 1V2EA 3TCMA 1AMRA 1OHWA 1KKJA 1CQ7A 1XI9A 3BS8A 4WLHA 4EMYA 1N31A 1AY8A 2FQ6A 2X8UA 3VK2A 1SVVA 1B4XA 1GC2A 1CS1A 4ITGA 3FCRA 4F5FA 3FZ6A 4MSOA 4WYFA 3RUYA 1RV3A 4W1WA 3KGXA 5EFSA 2WK9A 3A9ZA 3AV7A 2VMWA 5M4BA 4CBRA 4WBTA 2Z9VA 5BJ4A 2Z1ZA 1C7OA 4R8DA 2HUIA 1ASEA 2HP2A 4RITA 4E3RA 4F5GA 2O7CA 3DRDA 4Q75A 4RKDA 2AY7A 3ISLA 2O1BA 1ZODA 2OGAA 2W8WA 4WXFA 1DTYA 3DR4A 2TPLA 3H7FA 3L44A 1IAYA 1AJSB 4NOGA 4QGRA 4XAUA 4ADDA 4BA5A 2C0RA 2Q7WA 2VMTA 1BJOB 3H14A 1G4VA 3KE3A 4MKJA 2GSAA 3K7YA 3II0A 1S07A 1AY5A 3LV2A 3AELA 1C7GA 1ELUA 1QZ9A 1X0MA 3ELPA 2W7HA 2ZY3A 1N8PA 3E6GA 2VI8A 3AEOA 1YNUA 1SF2A 2W8TA 3AEJA 3PJ0A 1B9IA 4JE5D 4WD2A 1KMKA 5FT8A 2EYQA 3AEPA 5EUEA 3TATA 1KKPA 1JF9A 2R0TA 3G7QA 3ZZJA 5E4ZA 4OBVA 3K28A 3FZ7A 2WB6A 3WKRA 1GC3A 3NYSA 3BWNC 4UQVA 2CFBA 3DYDA 3ECDA 1D7SA 1TARA 2X5FA 1ELQA 4WYCA 2AEVA 2X5DA 1ASFA 2Z67A 1WSTA 8AATA 3DC1A 3A8UX 1EQBA 1E5FA 3EUCA 2HOYA 3MAFA 3LWSA 3GZDA 1WKGA 2CANA 3AOWA 4GSAA 1G4XA 1C7NA 3LVKA 1W7NA 2JISA 3E77A 3FTBA 1DGDA 3JWBA 2ZYJA 4ADBA 2FM1A 1ASCA 3W1JA 1QJ3A 2AY6A 5FT4A 4ATQA 3EI5A 3P6KA 1S08A 2BI9A 4JEZA 4MQQA 2BI3A 5EUDA 3NU8A 3N5MA 2W7IA 1MAPA 4M2MA 2EPJA 1SZUA 2AY2A 1TOGA 1Y4IA 2W8JA 2FNUA 3ASAA 3H9XA 4BHDA 3DR7A 2W8VA 2W7JA 3DXWA 1QISA 2CY8A 4LW2A 3FVXA 3GSBA 4IYOB 1M32A 4E77A 2AEUA 4ISYA 2VIBA 3ACZA 4MQPA 3DXVA 4E3QA 2YKYA 1ASGA 2D65A 2EZ1A 4UOYA 4A6UA 1LW5A 3FQ8A 4Q31A 3T32A 5K8BA 3B46A 2QLRA 3F9TA 1AICA 2WKAA 4WYGA 1OATA 4Y0IA 3I16A 1AAWA 1ECXA 1P3WA 4AH3A 1M4NA 2FYFA 4ADCA 3DODA 4RIZA 1QITA 2AY4A 2C81A 3MAFB 2FKIA 3QN6A 3JTXA 2OATA 3EI8A 4A0RA 2YKXA 4WXBA 2ZSMA 5M46A 4ZLVA 3LG0A 3HVYA 2G6WA 2R5CB 2EZ2A 1OXOA 3W1HA 4AO4A 2YCNA 1IUGA 4JEXA 4A0GA 2OGEA 3NDNA 3F6TA 3N4SA 3UWCA 1AHGA 1BQAA 3GWPA 9AATA 2WK7A 1AJSA 3EI9A 3N75A 2VMOA 1BJOA 4IX8A 1UU2A 3WGBA 4JF0A 4ZSYA 1ARIA 2O0RA 3FQAA 4RLGA 3WCOA 4A6TA 3B1CA 2HUFA 1B9HA 4CXRA 2YOBA 1ZC9A 1MDZA 3USFA 3BCXA 4M2JA 1YAAA 1YJZA 2W8UA 1O69A 3PD6B 2YCPA 2HZPA 3E2ZA 2PB2A 3FDBA 1O4SA 4JE5A 2CINA 4P3MA 1C9CA 3RCHB 1G7WA 3N4XA 1IVRA 3EIAA 2GB3A 3NUIA 3NYUA 1IX8A 2EH6A 2D5YA 3KGWA 3LVLB 4A0HA 2OKKA 3R9AA 1BQDA 3LY1A 1OHVA 3BN1A 1T3IA 4U1TA 1MDXA 3CAIA 1ASNA 1OXPA 4BMKA 1WYTB 2D7ZA 1M0NA 3I4JA 4A72A 4GDYA 4OMAA 4RKCA 2VGTA 4RAEA 5G4IA 5C6UA 3VP6A 2JGTA 1AMAA 1CL1A 4CVQA 4ZDOA 2CTZA 2NMPA 2VMRA 3R4TA 3MADA 3RBLA 1TPLA 2BKWA 2BI1A 1MAQA 3QM2A 1AY4A 3AEJC 3L8AA 2VMUA 4ITXA 1D7RA 1I29A 2AY3A 2RFVA 3B8XA 1PG8A 4WLJA 4PIWA 1AAMA 1ASLA 1YIYA 2D61A 2W7KA 3TFUA 4ATPA 4TN4A 4MGRA 2OKJA 2WK8A 1WYVA 4KXKA 3WZFA 4WB0B 2CSTA 1J32A 1LC7A 1ARTA 3AEMA 1ORDA 4TV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O61 A;  2W7D A;  1KL1 A;  3FFH A;  1W7M A;  4WYD A;  1AX4 A;  3E2Z B;  1LK9 A;  5AX8 A;  3WGC A;  5HXX A;  4CXQ A;  2VGU A;  2CH1 A;  3PDB A;  3G0T A;  1IJI A;  3DZZ A;  3UAK A;  1TAT A;  3HT4 A;  3NX3 A;  1D7U A;  3PGY A;  1BJN A;  1TOJ A;  4IYO A;  3HL2 A;  1GEX A;  3GZD C;  4W8I A;  2VMX A;  1I41 A;  4XJM A;  4UHM A;  4K2I A;  5G0A A;  3MBB A;  1GBN A;  4OTL A;  4OT8 A;  1C0N A;  2AAT A;  4E1O A;  1LS3 A;  7AAT A;  3WY7 A;  4EU1 A;  1CQ8 A;  1CZE A;  5HHY A;  2YRI A;  3RI6 A;  4RM1 A;  4IXZ A;  1CQ6 A;  5J8Q A;  3BC8 A;  2R5C A;  1LC5 A;  2PO3 A;  2VMN A;  4GE7 A;  4AZJ A;  1WYV B;  1AIB A;  2BIE A;  3E9K A;  4MQR A;  4XEW A;  5G4J A;  2XH1 A;  4F5K A;  3NRA A;  2EGY A;  1DGE A;  2JJH A;  1LKC A;  4ZWV A;  3PDB B;  2Z9W A;  2R2N A;  2BI2 A;  2DGL A;  2W7E A;  4W1V A;  1ASA A;  2JJG A;  3ELE A;  1DJE A;  4A6R A;  3EZ1 A;  4WXG A;  1DJ9 A;  3FFR A;  1V72 A;  3W1I A;  3GZC A;  5TF5 A;  4EFF A;  2BIG A;  1QIR A;  3K40 A;  2EO5 A;  3PD6 A;  3B1D A;  3FVU A;  4HVK A;  1VJO A;  3P1T A;  4JEV A;  3RCH A;  3ZRP A;  4EB5 A;  3KKI A;  3NU7 A;  3AAT A;  5D5S A;  4W91 A;  1SZK A;  2JJE A;  2AY9 A;  4AZK A;  4BQ0 A;  1I43 A;  2XBN A;  2HUU A;  1UKJ A;  2VGV A;  2C44 A;  3IHJ A;  5LH9 A;  4F5M A;  4L0O A;  1AKB A;  3PAA A;  1WYT A;  3VOM A;  3AOV A;  2GMU A;  2VGW A;  4I8A A;  4PFF A;  4DBC A;  2VMS A;  3LVJ A;  1YJS A;  2D63 A;  4FL0 A;  4H51 A;  3BV0 A;  2DKB A;  3NUB A;  2Z9U A;  3FSL A;  4IXS A;  1BJW A;  2OQX A;  1AHE A;  3PPL A;  3NTJ A;  5G2Q A;  2DGM A;  1IX6 A;  2BHX A;  1CZC A;  2BWP A;  1H1C A;  2E7J A;  3DU4 A;  1MGV A;  2JJF A;  2VGZ A;  5FT5 A;  4WB0 A;  1CJ0 A;  4IW7 A;  4B9B A;  1M0Q A;  1RV4 A;  4XJL A;  3GBX A;  1SZS A;  3B1E A;  4TMR A;  2V0Y A;  2BWN A;  1S09 A;  3WLX A;  4A0F A;  2VMZ A;  1WYU A;  1KL2 A;  1UU0 A;  2D66 A;  2W7F A;  1ARS A;  3I5T A;  5G09 A;  5DB5 A;  3VK3 A;  1J04 A;  3VK4 A;  2CJG A;  1E5E A;  1CL2 A;  5G2P A;  4JEY A;  4MKK A;  1AIA A;  2QMA A;  4RJ0 A;  2JG2 A;  4Y0D A;  5IWQ A;  4HF8 A;  1RVY A;  1FG3 A;  1W3U A;  4AO9 A;  4K2B A;  2F8J A;  5FT6 A;  1GC4 A;  3NYT A;  4EB7 A;  2DGK A;  2V1P A;  1I48 A;  1TOI A;  1BW0 A;  4OCA A;  5JAY A;  3AEM C;  3HMU A;  2HP1 A;  4IY7 A;  2Z9X A;  2VGS A;  4LNM A;  4J8L A;  2PB0 A;  4KYO A;  4ZWM A;  4JEW A;  1DJU A;  2Z61 A;  2HOZ A;  2D64 A;  1V2D A;  3ZRQ A;  1YIZ A;  3MC6 C;  4AOA A;  4LNJ A;  4LW4 A;  3HLM A;  4CBS A;  3HDO A;  4N0W A;  4GEB A;  4N0B A;  1X28 A;  4XJO A;  2CH2 A;  3EI7 A;  1MLY A;  4M2K A;  5I92 A;  4ZM3 A;  4OYT A;  1GD9 A;  2HOX A;  2ZSL A;  1JS6 A;  5DX5 A;  1SPA A;  4F5L A;  1BT4 A;  1IBJ A;  4Q6R A;  2GQN A;  3VAX A;  4WYA A;  5E5I A;  1ASB A;  1JS3 A;  1WYU B;  1UU1 A;  3ASB A;  3ZRR A;  3A9Y A;  4K2M A;  3MC6 A;  2ZC0 A;  3CBF A;  4ZM4 A;  4J5U A;  3QI6 A;  1S0A A;  4XQ2 A;  1KMJ A;  3WKS A;  1AHF A;  4LNL A;  4ZAS A;  2QB3 A;  2BI5 A;  3E2F A;  4U2H A;  3AEN A;  4JF1 A;  4MY5 A;  1M0O A;  2AY5 A;  1D2F A;  3TQX A;  1IX7 A;  3CQ4 A;  4B98 A;  1AKA A;  1AHX A;  2ZP7 A;  3E2Y A;  3HBX A;  4P7Y A;  4DGT A;  2ZY5 A;  4LC3 A;  4O6Z A;  1M0P A;  1ARG A;  1W23 A;  1SFF A;  4ZDL A;  2VYC A;  2DR1 A;  1PMM A;  3MAU A;  3D6K A;  1ASD A;  3CQ5 A;  1MDO A;  1M6S A;  2FN6 A;  4WYE A;  3BB8 A;  1PMO A;  2W7M A;  3FD0 A;  2VI9 A;  5EUN A;  3LVM A;  4ZDP A;  5EAV A;  1ARH A;  1D7V A;  2VMY A;  3Q8N A;  2ZJG A;  4Q76 A;  4OC9 A;  1B8G A;  3UE8 A;  2VLH A;  1IAX A;  3A9X A;  3EI6 A;  1S06 A;  3OKS A;  2DKJ A;  3BWN A;  3A2B A;  1BJ4 A;  4F5J A;  3QBO A;  3QPG A;  5D95 A;  4R5Z A;  1ZOB A;  4KAM A;  4F5H A;  2QBT A;  2QB2 A;  2ZY2 A;  1G7X A;  1GDE A;  1U08 A;  1AKC A;  5E3K A;  1X2A A;  2E7I A;  2YHK A;  3M5U A;  3ZZK A;  5F9S A;  3COG A;  3AEN B;  3PDX A;  1QJ5 A;  4ZSW A;  2VMV A;  3JW9 A;  3WX9 A;  5EAA A;  4GE9 A;  1XEY A;  4R5F A;  1Z7D A;  3FKD A;  1DFO A;  5DJ1 A;  1RVU A;  2BYL A;  3FZ8 A;  4W1X A;  3BWO A;  4ADE A;  1O62 A;  3CQ6 A;  4RJY A;  5EQC A;  3EZS A;  2ZUK A;  3RBF A;  1W7L A;  5EIG A;  3BCB A;  2VMQ A;  2W7G A;  2VLF A;  5M49 A;  2E54 A;  1V2F A;  1BKG A;  3JWA A;  3QGU A;  3N0L A;  3TFT A;  2BIA A;  3RQ1 A;  3MEB A;  1YOO A;  4F4E A;  1TAS A;  4BA4 A;  4ZAH A;  2ORD A;  2D7Y A;  3OP7 A;  1DKA A;  2BYJ A;  5F8V A;  1B5P A;  1QGN A;  3G8M A;  3ATH A;  1AHY A;  1GC0 A;  1EG5 A;  2GMS A;  1ASM A;  1TOK A;  1PFF A;  3IF2 A;  1WKH A;  4OBU A;  2BWO A;  5M4D A;  2YKV A;  1AMS A;  3GJU A;  2CJH A;  2QA3 A;  3JU7 A;  1X29 A;  2YCT A;  5HDM A;  1C4K A;  2YRR A;  2CJD A;  1FC4 A;  3BCA A;  2AY8 A;  3FVS A;  3WCN A;  1N2T A;  3FRK A;  2AY1 A;  1MLZ A;  3NNK A;  4FFC A;  4Y0H A;  4DQ6 A;  1VP4 A;  5DJ9 A;  1YJY A;  3FDD A;  3F0H A;  1Z3Z A;  2YKU A;  4IXO A;  1AJR A;  1AMQ A;  1FG7 A;  2VIA A;  4PFN A;  1BS0 A;  1M7Y A;  5BJ3 A;  1TOE A;  1GEY A;  3EIB A;  2ZY4 A;  4GRX A;  2E7U A;  3MKJ A;  3JZL A;  2CB1 A;  2DOU A;  4F5I A;  3FQ7 A;  3HQT A;  4GE4 A;  2C7T A;  3GR9 A;  4WP0 A;  2HOR A;  1LC8 A;  2X3L A;  4R2N A;  3GET A;  1VEF A;  4XJP A;  4A00 A;  2Z20 A;  4PVF A;  4W5K A;  5EIG B;  1LW4 A;  2Z1Y A;  1B5O A;  2W7L A;  3PIU A;  1H0C A;  3PA9 A;  4UHO A;  2VMP A;  2R5E A;  1GCK A;  1JG8 A;  1EJI A;  1OHY A;  2FNI A;  4UHN A;  5LHA A;  3QHX A;  4XK1 A;  1GEW A;  1V2E A;  3TCM A;  1AMR A;  1OHW A;  1KKJ A;  1CQ7 A;  1XI9 A;  3BS8 A;  4WLH A;  4EMY A;  1N31 A;  1AY8 A;  2FQ6 A;  2X8U A;  3VK2 A;  1SVV A;  1B4X A;  1GC2 A;  1CS1 A;  4ITG A;  3FCR A;  4F5F A;  3FZ6 A;  4MSO A;  4WYF A;  3RUY A;  1RV3 A;  4W1W A;  3KGX A;  5EFS A;  2WK9 A;  3A9Z A;  3AV7 A;  2VMW A;  5M4B A;  4CBR A;  4WBT A;  2Z9V A;  5BJ4 A;  2Z1Z A;  1C7O A;  4R8D A;  2HUI A;  1ASE A;  2HP2 A;  4RIT A;  4E3R A;  4F5G A;  2O7C A;  3DRD A;  4Q75 A;  4RKD A;  2AY7 A;  3ISL A;  2O1B A;  1ZOD A;  2OGA A;  2W8W A;  4WXF A;  1DTY A;  3DR4 A;  2TPL A;  3H7F A;  3L44 A;  1IAY A;  1AJS B;  4NOG A;  4QGR A;  4XAU A;  4ADD A;  4BA5 A;  2C0R A;  2Q7W A;  2VMT A;  1BJO B;  3H14 A;  1G4V A;  3KE3 A;  4MKJ A;  2GSA A;  3K7Y A;  3II0 A;  1S07 A;  1AY5 A;  3LV2 A;  3AEL A;  1C7G A;  1ELU A;  1QZ9 A;  1X0M A;  3ELP A;  2W7H A;  2ZY3 A;  1N8P A;  3E6G A;  2VI8 A;  3AEO A;  1YNU A;  1SF2 A;  2W8T A;  3AEJ A;  3PJ0 A;  1B9I A;  4JE5 D;  4WD2 A;  1KMK A;  5FT8 A;  3AEP A;  5EUE A;  3TAT A;  1KKP A;  1JF9 A;  2R0T A;  3G7Q A;  3ZZJ A;  5E4Z A;  4OBV A;  3K28 A;  3FZ7 A;  3WKR A;  1GC3 A;  3NYS A;  3BWN C;  4UQV A;  2CFB A;  3DYD A;  3ECD A;  1D7S A;  1TAR A;  2X5F A;  1ELQ A;  4WYC A;  2AEV A;  2X5D A;  1ASF A;  2Z67 A;  1WST A;  8AAT A;  3DC1 A;  3A8U X;  1EQB A;  1E5F A;  3EUC A;  2HOY A;  3MAF A;  3LWS A;  3GZD A;  1WKG A;  2CAN A;  3AOW A;  4GSA A;  1G4X A;  1C7N A;  3LVK A;  1W7N A;  2JIS A;  3E77 A;  3FTB A;  1DGD A;  3JWB A;  2ZYJ A;  4ADB A;  2FM1 A;  1ASC A;  3W1J A;  1QJ3 A;  2AY6 A;  5FT4 A;  4ATQ A;  3EI5 A;  3P6K A;  1S08 A;  2BI9 A;  4JEZ A;  4MQQ A;  2BI3 A;  5EUD A;  3NU8 A;  3N5M A;  2W7I A;  1MAP A;  4M2M A;  2EPJ A;  1SZU A;  2AY2 A;  1TOG A;  1Y4I A;  2W8J A;  2FNU A;  3ASA A;  4BHD A;  3DR7 A;  2W8V A;  2W7J A;  3DXW A;  1QIS A;  2CY8 A;  4LW2 A;  3FVX A;  3GSB A;  4IYO B;  1M32 A;  4E77 A;  2AEU A;  4ISY A;  2VIB A;  3ACZ A;  4MQP A;  3DXV A;  4E3Q A;  2YKY A;  1ASG A;  2D65 A;  2EZ1 A;  4UOY A;  4A6U A;  1LW5 A;  3FQ8 A;  4Q31 A;  3T32 A;  5K8B A;  3B46 A;  2QLR A;  3F9T A;  1AIC A;  2WKA A;  4WYG A;  1OAT A;  4Y0I A;  3I16 A;  1AAW A;  1ECX A;  1P3W A;  4AH3 A;  1M4N A;  2FYF A;  4ADC A;  3DOD A;  4RIZ A;  1QIT A;  2AY4 A;  2C81 A;  3MAF B;  3QN6 A;  3JTX A;  2OAT A;  3EI8 A;  4A0R A;  2YKX A;  4WXB A;  2ZSM A;  5M46 A;  4ZLV A;  3LG0 A;  3HVY A;  2G6W A;  2R5C B;  2EZ2 A;  1OXO A;  3W1H A;  4AO4 A;  2YCN A;  1IUG A;  4JEX A;  4A0G A;  2OGE A;  3NDN A;  3F6T A;  3UWC A;  1AHG A;  1BQA A;  3GWP A;  9AAT A;  2WK7 A;  1AJS A;  3EI9 A;  3N75 A;  2VMO A;  1BJO A;  4IX8 A;  1UU2 A;  3WGB A;  4JF0 A;  4ZSY A;  1ARI A;  2O0R A;  3FQA A;  4RLG A;  3WCO A;  4A6T A;  3B1C A;  2HUF A;  1B9H A;  4CXR A;  2YOB A;  1ZC9 A;  1MDZ A;  3USF A;  3BCX A;  4M2J A;  1YAA A;  1YJZ A;  2W8U A;  1O69 A;  3PD6 B;  2YCP A;  2HZP A;  3E2Z A;  2PB2 A;  3FDB A;  1O4S A;  4JE5 A;  2CIN A;  4P3M A;  1C9C A;  3RCH B;  1G7W A;  1IVR A;  3EIA A;  2GB3 A;  3NUI A;  3NYU A;  1IX8 A;  2EH6 A;  2D5Y A;  3KGW A;  3LVL B;  4A0H A;  2OKK A;  3R9A A;  1BQD A;  3LY1 A;  1OHV A;  3BN1 A;  1T3I A;  4U1T A;  1MDX A;  3CAI A;  1ASN A;  1OXP A;  4BMK A;  1WYT B;  2D7Z A;  1M0N A;  3I4J A;  4A72 A;  4GDY A;  4OMA A;  4RKC A;  2VGT A;  4RAE A;  5G4I A;  5C6U A;  3VP6 A;  2JGT A;  1AMA A;  1CL1 A;  4CVQ A;  4ZDO A;  2CTZ A;  2NMP A;  2VMR A;  3R4T A;  3MAD A;  3RBL A;  1TPL A;  2BKW A;  2BI1 A;  1MAQ A;  3QM2 A;  1AY4 A;  3AEJ C;  3L8A A;  2VMU A;  4ITX A;  1D7R A;  1I29 A;  2AY3 A;  2RFV A;  3B8X A;  1PG8 A;  4WLJ A;  4PIW A;  1AAM A;  1ASL A;  1YIY A;  2D61 A;  2W7K A;  3TFU A;  4ATP A;  4TN4 A;  4MGR A;  2OKJ A;  2WK8 A;  1WYV A;  4KXK A;  3WZF A;  4WB0 B;  2CST A;  1J32 A;  1LC7 A;  1ART A;  3AEM A;  1ORD A;  4TV7 A; 
#chains in the Genus database with same CATH topology
 1O61 A;  2W7D A;  1KL1 A;  3FFH A;  1W7M A;  4WYD A;  1AX4 A;  3E2Z B;  1LK9 A;  5AX8 A;  3WGC A;  5HXX A;  4CXQ A;  2VGU A;  2CH1 A;  3PDB A;  3G0T A;  1IJI A;  3DZZ A;  3UAK A;  1KAF A;  1TAT A;  3HT4 A;  3NX3 A;  1D7U A;  3PGY A;  1BJN A;  1TOJ A;  4IYO A;  3HL2 A;  1GEX A;  3GZD C;  4W8I A;  2VMX A;  5KTB A;  1I41 A;  4XJM A;  2QSR A;  4UHM A;  4K2I A;  5G0A A;  3MBB A;  1GBN A;  4OTL A;  4OT8 A;  1C0N A;  2AAT A;  4E1O A;  1LS3 A;  7AAT A;  3WY7 A;  4EU1 A;  1CQ8 A;  1CZE A;  5HHY A;  2YRI A;  3RI6 A;  4RM1 A;  4IXZ A;  1CQ6 A;  5J8Q A;  3BC8 A;  2R5C A;  1LC5 A;  2PO3 A;  2VMN A;  4GE7 A;  4AZJ A;  1WYV B;  1AIB A;  2BIE A;  3E9K A;  4MQR A;  4XEW A;  5G4J A;  2XH1 A;  4F5K A;  3NRA A;  2EGY A;  1DGE A;  2JJH A;  1LKC A;  4ZWV A;  3PDB B;  2Z9W A;  2R2N A;  2BI2 A;  2DGL A;  2W7E A;  4W1V A;  1ASA A;  2JJG A;  3ELE A;  1DJE A;  4A6R A;  3EZ1 A;  4WXG A;  1DJ9 A;  3FFR A;  1V72 A;  3W1I A;  3GZC A;  5TF5 A;  4EFF A;  2BIG A;  1QIR A;  3K40 A;  2EO5 A;  3PD6 A;  3B1D A;  3FVU A;  4HVK A;  1VJO A;  3P1T A;  4JEV A;  3RCH A;  3ZRP A;  4EB5 A;  3KKI A;  3NU7 A;  3AAT A;  5D5S A;  4W91 A;  1SZK A;  2JJE A;  2AY9 A;  4AZK A;  4BQ0 A;  1I43 A;  2XBN A;  2HUU A;  1UKJ A;  2VGV A;  2C44 A;  3IHJ A;  5LH9 A;  4F5M A;  4L0O A;  1AKB A;  3PAA A;  1WYT A;  3VOM A;  3AOV A;  2GMU A;  2VGW A;  4I8A A;  4PFF A;  4DBC A;  2VMS A;  3LVJ A;  1YJS A;  2D63 A;  4FL0 A;  4H51 A;  3BV0 A;  2DKB A;  3NUB A;  2Z9U A;  3FSL A;  4IXS A;  1BJW A;  2OQX A;  1AHE A;  3PPL A;  3NTJ A;  5G2Q A;  2DGM A;  1IX6 A;  2BHX A;  1CZC A;  2BWP A;  1H1C A;  2E7J A;  3DU4 A;  1MGV A;  2JJF A;  2VGZ A;  5FT5 A;  4WB0 A;  1CJ0 A;  4IW7 A;  4B9B A;  1M0Q A;  1RV4 A;  4XJL A;  3GBX A;  1SZS A;  3B1E A;  4TMR A;  2V0Y A;  2BWN A;  1S09 A;  3WLX A;  4A0F A;  2VMZ A;  1WYU A;  1KL2 A;  1UU0 A;  2D66 A;  2W7F A;  1ARS A;  3I5T A;  5G09 A;  5DB5 A;  3VK3 A;  1J04 A;  3VK4 A;  2CJG A;  1E5E A;  1CL2 A;  5G2P A;  4JEY A;  4MKK A;  1AIA A;  2QMA A;  4RJ0 A;  2JG2 A;  4Y0D A;  5IWQ A;  4HF8 A;  1RVY A;  1FG3 A;  1W3U A;  4AO9 A;  4K2B A;  2F8J A;  5FT6 A;  1GC4 A;  3NYT A;  4EB7 A;  2DGK A;  2V1P A;  1I48 A;  1TOI A;  1BW0 A;  4OCA A;  5JAY A;  3AEM C;  3HMU A;  2HP1 A;  4IY7 A;  2Z9X A;  2VGS A;  4LNM A;  4J8L A;  2PB0 A;  4KYO A;  4ZWM A;  4JEW A;  1DJU A;  2Z61 A;  2HOZ A;  2D64 A;  1V2D A;  3ZRQ A;  1YIZ A;  3MC6 C;  4AOA A;  4LNJ A;  4LW4 A;  3HLM A;  4CBS A;  3HDO A;  4N0W A;  2KFP A;  4GEB A;  4N0B A;  1X28 A;  4XJO A;  2CH2 A;  3EI7 A;  1MLY A;  4M2K A;  5I92 A;  4ZM3 A;  4OYT A;  1GD9 A;  2HOX A;  2ZSL A;  1JS6 A;  5DX5 A;  1SPA A;  4F5L A;  1BT4 A;  1IBJ A;  4Q6R A;  2GQN A;  3VAX A;  4WYA A;  5E5I A;  1ASB A;  1JS3 A;  1WYU B;  1UU1 A;  3ASB A;  3ZRR A;  3A9Y A;  4K2M A;  3MC6 A;  2ZC0 A;  3CBF A;  4ZM4 A;  4J5U A;  3QI6 A;  1S0A A;  4XQ2 A;  1KMJ A;  3WKS A;  1AHF A;  4LNL A;  4ZAS A;  2QB3 A;  2BI5 A;  3E2F A;  4U2H A;  3AEN A;  4JF1 A;  4MY5 A;  1M0O A;  2AY5 A;  1D2F A;  3TQX A;  1IX7 A;  3CQ4 A;  4B98 A;  1AKA A;  1AHX A;  2ZP7 A;  3E2Y A;  3HBX A;  4P7Y A;  4DGT A;  2ZY5 A;  4LC3 A;  4O6Z A;  1M0P A;  1ARG A;  1W23 A;  1SFF A;  4ZDL A;  2VYC A;  2DR1 A;  1PMM A;  3MAU A;  3D6K A;  1ASD A;  3CQ5 A;  2G7J A;  1MDO A;  1M6S A;  2FN6 A;  4WYE A;  3BB8 A;  1PMO A;  2W7M A;  3FD0 A;  2VI9 A;  5EUN A;  3LVM A;  4ZDP A;  5EAV A;  1ARH A;  1D7V A;  2VMY A;  3Q8N A;  2ZJG A;  4Q76 A;  4OC9 A;  1B8G A;  3UE8 A;  2VLH A;  1IAX A;  3A9X A;  3EI6 A;  2A1V A;  1S06 A;  3OKS A;  2DKJ A;  3BWN A;  3A2B A;  1BJ4 A;  4F5J A;  3QBO A;  3QPG A;  5D95 A;  4R5Z A;  1ZOB A;  4KAM A;  4F5H A;  2QBT A;  2QB2 A;  2ZY2 A;  1G7X A;  1GDE A;  1U08 A;  1AKC A;  5E3K A;  1X2A A;  2E7I A;  2YHK A;  3M5U A;  3ZZK A;  5F9S A;  3COG A;  3N7N A;  3AEN B;  3PDX A;  1QJ5 A;  4ZSW A;  2VMV A;  3JW9 A;  3WX9 A;  5EAA A;  4GE9 A;  1XEY A;  4R5F A;  1Z7D A;  3FKD A;  1DFO A;  5DJ1 A;  1RVU A;  2BYL A;  3FZ8 A;  4W1X A;  3BWO A;  4ADE A;  1O62 A;  3CQ6 A;  4RJY A;  5EQC A;  3EZS A;  2ZUK A;  3RBF A;  1W7L A;  5EIG A;  3BCB A;  2VMQ A;  2W7G A;  3N4R A;  2VLF A;  5M49 A;  2E54 A;  1V2F A;  1BKG A;  3JWA A;  3QGU A;  3N0L A;  3TFT A;  2BIA A;  3RQ1 A;  3MEB A;  1YOO A;  4F4E A;  1TAS A;  4BA4 A;  4ZAH A;  2ORD A;  2D7Y A;  3OP7 A;  1DKA A;  2BYJ A;  5F8V A;  1B5P A;  1QGN A;  3G8M A;  3ATH A;  1AHY A;  1GC0 A;  1EG5 A;  2GMS A;  1ASM A;  1TOK A;  1PFF A;  3IF2 A;  1WKH A;  4OBU A;  2BWO A;  4K05 A;  5M4D A;  2YKV A;  1AMS A;  3GJU A;  2CJH A;  2QA3 A;  3JU7 A;  1X29 A;  2YCT A;  5HDM A;  1C4K A;  4H63 Q;  2YRR A;  2CJD A;  1FC4 A;  3BCA A;  2AY8 A;  3FVS A;  3WCN A;  1N2T A;  3FRK A;  2AY1 A;  1MLZ A;  3NNK A;  4FFC A;  4Y0H A;  4DQ6 A;  1VP4 A;  5DJ9 A;  1YJY A;  3FDD A;  3F0H A;  1Z3Z A;  2YKU A;  4IXO A;  1AJR A;  1AMQ A;  1FG7 A;  2VIA A;  4PFN A;  1BS0 A;  1M7Y A;  5BJ3 A;  1TOE A;  1GEY A;  3EIB A;  2ZY4 A;  4GRX A;  2E7U A;  3MKJ A;  3JZL A;  2CB1 A;  2DOU A;  4F5I A;  3FQ7 A;  3HQT A;  4GE4 A;  2C7T A;  3GR9 A;  4WP0 A;  2HOR A;  1LC8 A;  2X3L A;  4R2N A;  3GET A;  1VEF A;  4XJP A;  4A00 A;  2Z20 A;  4PVF A;  4W5K A;  5EIG B;  1LW4 A;  2Z1Y A;  1B5O A;  2W7L A;  3PIU A;  1H0C A;  3PA9 A;  4UHO A;  2VMP A;  2R5E A;  1GCK A;  1JG8 A;  1EJI A;  1OHY A;  2FNI A;  4UHN A;  5LHA A;  3QHX A;  4XK1 A;  1GEW A;  1V2E A;  3TCM A;  1AMR A;  1OHW A;  1KKJ A;  1CQ7 A;  1XI9 A;  3BS8 A;  4WLH A;  4EMY A;  1N31 A;  1AY8 A;  2FQ6 A;  2X8U A;  3VK2 A;  1SVV A;  1B4X A;  1GC2 A;  1CS1 A;  4ITG A;  3FCR A;  4F5F A;  3FZ6 A;  4MSO A;  4WYF A;  3RUY A;  1RV3 A;  4W1W A;  3KGX A;  5EFS A;  2WK9 A;  3A9Z A;  3AV7 A;  2VMW A;  5M4B A;  4CBR A;  4WBT A;  2Z9V A;  5BJ4 A;  2Z1Z A;  1C7O A;  4R8D A;  2HUI A;  1ASE A;  2HP2 A;  4RIT A;  4E3R A;  4F5G A;  2O7C A;  3DRD A;  4Q75 A;  4RKD A;  2AY7 A;  3ISL A;  2O1B A;  1ZOD A;  2OGA A;  2W8W A;  4WXF A;  1DTY A;  3DR4 A;  2TPL A;  3H7F A;  3L44 A;  1IAY A;  1AJS B;  4NOG A;  4QGR A;  4XAU A;  4ADD A;  4BA5 A;  2C0R A;  2Q7W A;  2VMT A;  1BJO B;  3H14 A;  1G4V A;  3KE3 A;  4MKJ A;  2GSA A;  3K7Y A;  3II0 A;  1S07 A;  1AY5 A;  3LV2 A;  3AEL A;  1C7G A;  1ELU A;  1QZ9 A;  1X0M A;  3ELP A;  2W7H A;  2ZY3 A;  1N8P A;  3E6G A;  2VI8 A;  3AEO A;  1YNU A;  1SF2 A;  2W8T A;  3AEJ A;  3PJ0 A;  1B9I A;  4JE5 D;  4WD2 A;  1KMK A;  5FT8 A;  2EYQ A;  3AEP A;  5EUE A;  3TAT A;  1KKP A;  1JF9 A;  2R0T A;  3G7Q A;  3ZZJ A;  5E4Z A;  4OBV A;  3K28 A;  3FZ7 A;  2WB6 A;  3WKR A;  1GC3 A;  3NYS A;  3BWN C;  4UQV A;  2CFB A;  3DYD A;  3ECD A;  1D7S A;  1TAR A;  2X5F A;  1ELQ A;  4WYC A;  2AEV A;  2X5D A;  1ASF A;  2Z67 A;  1WST A;  8AAT A;  3DC1 A;  3A8U X;  1EQB A;  1E5F A;  3EUC A;  2HOY A;  3MAF A;  3LWS A;  3GZD A;  1WKG A;  2CAN A;  3AOW A;  4GSA A;  1G4X A;  1C7N A;  3LVK A;  1W7N A;  2JIS A;  3E77 A;  3FTB A;  1DGD A;  3JWB A;  2ZYJ A;  4ADB A;  2FM1 A;  1ASC A;  3W1J A;  1QJ3 A;  2AY6 A;  5FT4 A;  4ATQ A;  3EI5 A;  3P6K A;  1S08 A;  2BI9 A;  4JEZ A;  4MQQ A;  2BI3 A;  5EUD A;  3NU8 A;  3N5M A;  2W7I A;  1MAP A;  4M2M A;  2EPJ A;  1SZU A;  2AY2 A;  1TOG A;  1Y4I A;  2W8J A;  2FNU A;  3ASA A;  3H9X A;  4BHD A;  3DR7 A;  2W8V A;  2W7J A;  3DXW A;  1QIS A;  2CY8 A;  4LW2 A;  3FVX A;  3GSB A;  4IYO B;  1M32 A;  4E77 A;  2AEU A;  4ISY A;  2VIB A;  3ACZ A;  4MQP A;  3DXV A;  4E3Q A;  2YKY A;  1ASG A;  2D65 A;  2EZ1 A;  4UOY A;  4A6U A;  1LW5 A;  3FQ8 A;  4Q31 A;  3T32 A;  5K8B A;  3B46 A;  2QLR A;  3F9T A;  1AIC A;  2WKA A;  4WYG A;  1OAT A;  4Y0I A;  3I16 A;  1AAW A;  1ECX A;  1P3W A;  4AH3 A;  1M4N A;  2FYF A;  4ADC A;  3DOD A;  4RIZ A;  1QIT A;  2AY4 A;  2C81 A;  3MAF B;  2FKI A;  3QN6 A;  3JTX A;  2OAT A;  3EI8 A;  4A0R A;  2YKX A;  4WXB A;  2ZSM A;  5M46 A;  4ZLV A;  3LG0 A;  3HVY A;  2G6W A;  2R5C B;  2EZ2 A;  1OXO A;  3W1H A;  4AO4 A;  2YCN A;  1IUG A;  4JEX A;  4A0G A;  2OGE A;  3NDN A;  3F6T A;  3N4S A;  3UWC A;  1AHG A;  1BQA A;  3GWP A;  9AAT A;  2WK7 A;  1AJS A;  3EI9 A;  3N75 A;  2VMO A;  1BJO A;  4IX8 A;  1UU2 A;  3WGB A;  4JF0 A;  4ZSY A;  1ARI A;  2O0R A;  3FQA A;  4RLG A;  3WCO A;  4A6T A;  3B1C A;  2HUF A;  1B9H A;  4CXR A;  2YOB A;  1ZC9 A;  1MDZ A;  3USF A;  3BCX A;  4M2J A;  1YAA A;  1YJZ A;  2W8U A;  1O69 A;  3PD6 B;  2YCP A;  2HZP A;  3E2Z A;  2PB2 A;  3FDB A;  1O4S A;  4JE5 A;  2CIN A;  4P3M A;  1C9C A;  3RCH B;  1G7W A;  3N4X A;  1IVR A;  3EIA A;  2GB3 A;  3NUI A;  3NYU A;  1IX8 A;  2EH6 A;  2D5Y A;  3KGW A;  3LVL B;  4A0H A;  2OKK A;  3R9A A;  1BQD A;  3LY1 A;  1OHV A;  3BN1 A;  1T3I A;  4U1T A;  1MDX A;  3CAI A;  1ASN A;  1OXP A;  4BMK A;  1WYT B;  2D7Z A;  1M0N A;  3I4J A;  4A72 A;  4GDY A;  4OMA A;  4RKC A;  2VGT A;  4RAE A;  5G4I A;  5C6U A;  3VP6 A;  2JGT A;  1AMA A;  1CL1 A;  4CVQ A;  4ZDO A;  2CTZ A;  2NMP A;  2VMR A;  3R4T A;  3MAD A;  3RBL A;  1TPL A;  2BKW A;  2BI1 A;  1MAQ A;  3QM2 A;  1AY4 A;  3AEJ C;  3L8A A;  2VMU A;  4ITX A;  1D7R A;  1I29 A;  2AY3 A;  2RFV A;  3B8X A;  1PG8 A;  4WLJ A;  4PIW A;  1AAM A;  1ASL A;  1YIY A;  2D61 A;  2W7K A;  3TFU A;  4ATP A;  4TN4 A;  4MGR A;  2OKJ A;  2WK8 A;  1WYV A;  4KXK A;  3WZF A;  4WB0 B;  2CST A;  1J32 A;  1LC7 A;  1ART A;  3AEM A;  1ORD A;  4TV7 A; 
#chains in the Genus database with same CATH homology
 1O61 A;  2W7D A;  1KL1 A;  3FFH A;  1W7M A;  4WYD A;  1AX4 A;  3E2Z B;  1LK9 A;  5AX8 A;  3WGC A;  5HXX A;  4CXQ A;  2VGU A;  2CH1 A;  3PDB A;  3G0T A;  1IJI A;  3DZZ A;  3UAK A;  1TAT A;  3HT4 A;  3NX3 A;  1D7U A;  3PGY A;  1BJN A;  1TOJ A;  4IYO A;  3HL2 A;  1GEX A;  3GZD C;  4W8I A;  2VMX A;  5KTB A;  1I41 A;  4XJM A;  2QSR A;  4UHM A;  4K2I A;  5G0A A;  3MBB A;  1GBN A;  4OTL A;  4OT8 A;  1C0N A;  2AAT A;  4E1O A;  1LS3 A;  7AAT A;  3WY7 A;  4EU1 A;  1CQ8 A;  1CZE A;  5HHY A;  2YRI A;  3RI6 A;  4RM1 A;  4IXZ A;  1CQ6 A;  5J8Q A;  3BC8 A;  2R5C A;  1LC5 A;  2PO3 A;  2VMN A;  4GE7 A;  4AZJ A;  1WYV B;  1AIB A;  2BIE A;  3E9K A;  4MQR A;  4XEW A;  5G4J A;  2XH1 A;  4F5K A;  3NRA A;  2EGY A;  1DGE A;  2JJH A;  1LKC A;  4ZWV A;  3PDB B;  2Z9W A;  2R2N A;  2BI2 A;  2DGL A;  2W7E A;  4W1V A;  1ASA A;  2JJG A;  3ELE A;  1DJE A;  4A6R A;  3EZ1 A;  4WXG A;  1DJ9 A;  3FFR A;  1V72 A;  3W1I A;  3GZC A;  5TF5 A;  4EFF A;  2BIG A;  1QIR A;  3K40 A;  2EO5 A;  3PD6 A;  3B1D A;  3FVU A;  4HVK A;  1VJO A;  3P1T A;  4JEV A;  3RCH A;  3ZRP A;  4EB5 A;  3KKI A;  3NU7 A;  3AAT A;  5D5S A;  4W91 A;  1SZK A;  2JJE A;  2AY9 A;  4AZK A;  4BQ0 A;  1I43 A;  2XBN A;  2HUU A;  1UKJ A;  2VGV A;  2C44 A;  3IHJ A;  5LH9 A;  4F5M A;  4L0O A;  1AKB A;  3PAA A;  1WYT A;  3VOM A;  3AOV A;  2GMU A;  2VGW A;  4I8A A;  4PFF A;  4DBC A;  2VMS A;  3LVJ A;  1YJS A;  2D63 A;  4FL0 A;  4H51 A;  3BV0 A;  2DKB A;  3NUB A;  2Z9U A;  3FSL A;  4IXS A;  1BJW A;  2OQX A;  1AHE A;  3PPL A;  3NTJ A;  5G2Q A;  2DGM A;  1IX6 A;  2BHX A;  1CZC A;  2BWP A;  1H1C A;  2E7J A;  3DU4 A;  1MGV A;  2JJF A;  2VGZ A;  5FT5 A;  4WB0 A;  1CJ0 A;  4IW7 A;  4B9B A;  1M0Q A;  1RV4 A;  4XJL A;  3GBX A;  1SZS A;  3B1E A;  4TMR A;  2V0Y A;  2BWN A;  1S09 A;  3WLX A;  4A0F A;  2VMZ A;  1WYU A;  1KL2 A;  1UU0 A;  2D66 A;  2W7F A;  1ARS A;  3I5T A;  5G09 A;  5DB5 A;  3VK3 A;  1J04 A;  3VK4 A;  2CJG A;  1E5E A;  1CL2 A;  5G2P A;  4JEY A;  4MKK A;  1AIA A;  2QMA A;  4RJ0 A;  2JG2 A;  4Y0D A;  5IWQ A;  4HF8 A;  1RVY A;  1FG3 A;  1W3U A;  4AO9 A;  4K2B A;  2F8J A;  5FT6 A;  1GC4 A;  3NYT A;  4EB7 A;  2DGK A;  2V1P A;  1I48 A;  1TOI A;  1BW0 A;  4OCA A;  5JAY A;  3AEM C;  3HMU A;  2HP1 A;  4IY7 A;  2Z9X A;  2VGS A;  4LNM A;  4J8L A;  2PB0 A;  4KYO A;  4ZWM A;  4JEW A;  1DJU A;  2Z61 A;  2HOZ A;  2D64 A;  1V2D A;  3ZRQ A;  1YIZ A;  3MC6 C;  4AOA A;  4LNJ A;  4LW4 A;  3HLM A;  4CBS A;  3HDO A;  4N0W A;  2KFP A;  4GEB A;  4N0B A;  1X28 A;  4XJO A;  2CH2 A;  3EI7 A;  1MLY A;  4M2K A;  5I92 A;  4ZM3 A;  4OYT A;  1GD9 A;  2HOX A;  2ZSL A;  1JS6 A;  5DX5 A;  1SPA A;  4F5L A;  1BT4 A;  1IBJ A;  4Q6R A;  2GQN A;  3VAX A;  4WYA A;  5E5I A;  1ASB A;  1JS3 A;  1WYU B;  1UU1 A;  3ASB A;  3ZRR A;  3A9Y A;  4K2M A;  3MC6 A;  2ZC0 A;  3CBF A;  4ZM4 A;  4J5U A;  3QI6 A;  1S0A A;  4XQ2 A;  1KMJ A;  3WKS A;  1AHF A;  4LNL A;  4ZAS A;  2QB3 A;  2BI5 A;  3E2F A;  4U2H A;  3AEN A;  4JF1 A;  4MY5 A;  1M0O A;  2AY5 A;  1D2F A;  3TQX A;  1IX7 A;  3CQ4 A;  4B98 A;  1AKA A;  1AHX A;  2ZP7 A;  3E2Y A;  3HBX A;  4P7Y A;  4DGT A;  2ZY5 A;  4LC3 A;  4O6Z A;  1M0P A;  1ARG A;  1W23 A;  1SFF A;  4ZDL A;  2VYC A;  2DR1 A;  1PMM A;  3MAU A;  3D6K A;  1ASD A;  3CQ5 A;  2G7J A;  1MDO A;  1M6S A;  2FN6 A;  4WYE A;  3BB8 A;  1PMO A;  2W7M A;  3FD0 A;  2VI9 A;  5EUN A;  3LVM A;  4ZDP A;  5EAV A;  1ARH A;  1D7V A;  2VMY A;  3Q8N A;  2ZJG A;  4Q76 A;  4OC9 A;  1B8G A;  3UE8 A;  2VLH A;  1IAX A;  3A9X A;  3EI6 A;  2A1V A;  1S06 A;  3OKS A;  2DKJ A;  3BWN A;  3A2B A;  1BJ4 A;  4F5J A;  3QBO A;  3QPG A;  5D95 A;  4R5Z A;  1ZOB A;  4KAM A;  4F5H A;  2QBT A;  2QB2 A;  2ZY2 A;  1G7X A;  1GDE A;  1U08 A;  1AKC A;  5E3K A;  1X2A A;  2E7I A;  2YHK A;  3M5U A;  3ZZK A;  5F9S A;  3COG A;  3N7N A;  3AEN B;  3PDX A;  1QJ5 A;  4ZSW A;  2VMV A;  3JW9 A;  3WX9 A;  5EAA A;  4GE9 A;  1XEY A;  4R5F A;  1Z7D A;  3FKD A;  1DFO A;  5DJ1 A;  1RVU A;  2BYL A;  3FZ8 A;  4W1X A;  3BWO A;  4ADE A;  1O62 A;  3CQ6 A;  4RJY A;  5EQC A;  3EZS A;  2ZUK A;  3RBF A;  1W7L A;  5EIG A;  3BCB A;  2VMQ A;  2W7G A;  3N4R A;  2VLF A;  5M49 A;  2E54 A;  1V2F A;  1BKG A;  3JWA A;  3QGU A;  3N0L A;  3TFT A;  2BIA A;  3RQ1 A;  3MEB A;  1YOO A;  4F4E A;  1TAS A;  4BA4 A;  4ZAH A;  2ORD A;  2D7Y A;  3OP7 A;  1DKA A;  2BYJ A;  5F8V A;  1B5P A;  1QGN A;  3G8M A;  3ATH A;  1AHY A;  1GC0 A;  1EG5 A;  2GMS A;  1ASM A;  1TOK A;  1PFF A;  3IF2 A;  1WKH A;  4OBU A;  2BWO A;  4K05 A;  5M4D A;  2YKV A;  1AMS A;  3GJU A;  2CJH A;  2QA3 A;  3JU7 A;  1X29 A;  2YCT A;  5HDM A;  1C4K A;  4H63 Q;  2YRR A;  2CJD A;  1FC4 A;  3BCA A;  2AY8 A;  3FVS A;  3WCN A;  1N2T A;  3FRK A;  2AY1 A;  1MLZ A;  3NNK A;  4FFC A;  4Y0H A;  4DQ6 A;  1VP4 A;  5DJ9 A;  1YJY A;  3FDD A;  3F0H A;  1Z3Z A;  2YKU A;  4IXO A;  1AJR A;  1AMQ A;  1FG7 A;  2VIA A;  4PFN A;  1BS0 A;  1M7Y A;  5BJ3 A;  1TOE A;  1GEY A;  3EIB A;  2ZY4 A;  4GRX A;  2E7U A;  3MKJ A;  3JZL A;  2CB1 A;  2DOU A;  4F5I A;  3FQ7 A;  3HQT A;  4GE4 A;  2C7T A;  3GR9 A;  4WP0 A;  2HOR A;  1LC8 A;  2X3L A;  4R2N A;  3GET A;  1VEF A;  4XJP A;  4A00 A;  2Z20 A;  4PVF A;  4W5K A;  5EIG B;  1LW4 A;  2Z1Y A;  1B5O A;  2W7L A;  3PIU A;  1H0C A;  3PA9 A;  4UHO A;  2VMP A;  2R5E A;  1GCK A;  1JG8 A;  1EJI A;  1OHY A;  2FNI A;  4UHN A;  5LHA A;  3QHX A;  4XK1 A;  1GEW A;  1V2E A;  3TCM A;  1AMR A;  1OHW A;  1KKJ A;  1CQ7 A;  1XI9 A;  3BS8 A;  4WLH A;  4EMY A;  1N31 A;  1AY8 A;  2FQ6 A;  2X8U A;  3VK2 A;  1SVV A;  1B4X A;  1GC2 A;  1CS1 A;  4ITG A;  3FCR A;  4F5F A;  3FZ6 A;  4MSO A;  4WYF A;  3RUY A;  1RV3 A;  4W1W A;  3KGX A;  5EFS A;  2WK9 A;  3A9Z A;  3AV7 A;  2VMW A;  5M4B A;  4CBR A;  4WBT A;  2Z9V A;  5BJ4 A;  2Z1Z A;  1C7O A;  4R8D A;  2HUI A;  1ASE A;  2HP2 A;  4RIT A;  4E3R A;  4F5G A;  2O7C A;  3DRD A;  4Q75 A;  4RKD A;  2AY7 A;  3ISL A;  2O1B A;  1ZOD A;  2OGA A;  2W8W A;  4WXF A;  1DTY A;  3DR4 A;  2TPL A;  3H7F A;  3L44 A;  1IAY A;  1AJS B;  4NOG A;  4QGR A;  4XAU A;  4ADD A;  4BA5 A;  2C0R A;  2Q7W A;  2VMT A;  1BJO B;  3H14 A;  1G4V A;  3KE3 A;  4MKJ A;  2GSA A;  3K7Y A;  3II0 A;  1S07 A;  1AY5 A;  3LV2 A;  3AEL A;  1C7G A;  1ELU A;  1QZ9 A;  1X0M A;  3ELP A;  2W7H A;  2ZY3 A;  1N8P A;  3E6G A;  2VI8 A;  3AEO A;  1YNU A;  1SF2 A;  2W8T A;  3AEJ A;  3PJ0 A;  1B9I A;  4JE5 D;  4WD2 A;  1KMK A;  5FT8 A;  2EYQ A;  3AEP A;  5EUE A;  3TAT A;  1KKP A;  1JF9 A;  2R0T A;  3G7Q A;  3ZZJ A;  5E4Z A;  4OBV A;  3K28 A;  3FZ7 A;  2WB6 A;  3WKR A;  1GC3 A;  3NYS A;  3BWN C;  4UQV A;  2CFB A;  3DYD A;  3ECD A;  1D7S A;  1TAR A;  2X5F A;  1ELQ A;  4WYC A;  2AEV A;  2X5D A;  1ASF A;  2Z67 A;  1WST A;  8AAT A;  3DC1 A;  3A8U X;  1EQB A;  1E5F A;  3EUC A;  2HOY A;  3MAF A;  3LWS A;  3GZD A;  1WKG A;  2CAN A;  3AOW A;  4GSA A;  1G4X A;  1C7N A;  3LVK A;  1W7N A;  2JIS A;  3E77 A;  3FTB A;  1DGD A;  3JWB A;  2ZYJ A;  4ADB A;  2FM1 A;  1ASC A;  3W1J A;  1QJ3 A;  2AY6 A;  5FT4 A;  4ATQ A;  3EI5 A;  3P6K A;  1S08 A;  2BI9 A;  4JEZ A;  4MQQ A;  2BI3 A;  5EUD A;  3NU8 A;  3N5M A;  2W7I A;  1MAP A;  4M2M A;  2EPJ A;  1SZU A;  2AY2 A;  1TOG A;  1Y4I A;  2W8J A;  2FNU A;  3ASA A;  3H9X A;  4BHD A;  3DR7 A;  2W8V A;  2W7J A;  3DXW A;  1QIS A;  2CY8 A;  4LW2 A;  3FVX A;  3GSB A;  4IYO B;  1M32 A;  4E77 A;  2AEU A;  4ISY A;  2VIB A;  3ACZ A;  4MQP A;  3DXV A;  4E3Q A;  2YKY A;  1ASG A;  2D65 A;  2EZ1 A;  4UOY A;  4A6U A;  1LW5 A;  3FQ8 A;  4Q31 A;  3T32 A;  5K8B A;  3B46 A;  2QLR A;  3F9T A;  1AIC A;  2WKA A;  4WYG A;  1OAT A;  4Y0I A;  3I16 A;  1AAW A;  1ECX A;  1P3W A;  4AH3 A;  1M4N A;  2FYF A;  4ADC A;  3DOD A;  4RIZ A;  1QIT A;  2AY4 A;  2C81 A;  3MAF B;  2FKI A;  3QN6 A;  3JTX A;  2OAT A;  3EI8 A;  4A0R A;  2YKX A;  4WXB A;  2ZSM A;  5M46 A;  4ZLV A;  3LG0 A;  3HVY A;  2G6W A;  2R5C B;  2EZ2 A;  1OXO A;  3W1H A;  4AO4 A;  2YCN A;  1IUG A;  4JEX A;  4A0G A;  2OGE A;  3NDN A;  3F6T A;  3N4S A;  3UWC A;  1AHG A;  1BQA A;  3GWP A;  9AAT A;  2WK7 A;  1AJS A;  3EI9 A;  3N75 A;  2VMO A;  1BJO A;  4IX8 A;  1UU2 A;  3WGB A;  4JF0 A;  4ZSY A;  1ARI A;  2O0R A;  3FQA A;  4RLG A;  3WCO A;  4A6T A;  3B1C A;  2HUF A;  1B9H A;  4CXR A;  2YOB A;  1ZC9 A;  1MDZ A;  3USF A;  3BCX A;  4M2J A;  1YAA A;  1YJZ A;  2W8U A;  1O69 A;  3PD6 B;  2YCP A;  2HZP A;  3E2Z A;  2PB2 A;  3FDB A;  1O4S A;  4JE5 A;  2CIN A;  4P3M A;  1C9C A;  3RCH B;  1G7W A;  3N4X A;  1IVR A;  3EIA A;  2GB3 A;  3NUI A;  3NYU A;  1IX8 A;  2EH6 A;  2D5Y A;  3KGW A;  3LVL B;  4A0H A;  2OKK A;  3R9A A;  1BQD A;  3LY1 A;  1OHV A;  3BN1 A;  1T3I A;  4U1T A;  1MDX A;  3CAI A;  1ASN A;  1OXP A;  4BMK A;  1WYT B;  2D7Z A;  1M0N A;  3I4J A;  4A72 A;  4GDY A;  4OMA A;  4RKC A;  2VGT A;  4RAE A;  5G4I A;  5C6U A;  3VP6 A;  2JGT A;  1AMA A;  1CL1 A;  4CVQ A;  4ZDO A;  2CTZ A;  2NMP A;  2VMR A;  3R4T A;  3MAD A;  3RBL A;  1TPL A;  2BKW A;  2BI1 A;  1MAQ A;  3QM2 A;  1AY4 A;  3AEJ C;  3L8A A;  2VMU A;  4ITX A;  1D7R A;  1I29 A;  2AY3 A;  2RFV A;  3B8X A;  1PG8 A;  4WLJ A;  4PIW A;  1AAM A;  1ASL A;  1YIY A;  2D61 A;  2W7K A;  3TFU A;  4ATP A;  4TN4 A;  4MGR A;  2OKJ A;  2WK8 A;  1WYV A;  4KXK A;  3WZF A;  4WB0 B;  2CST A;  1J32 A;  1LC7 A;  1ART A;  3AEM A;  1ORD A;  4TV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...