5AXRA

Crystal structure of metallo-beta-lactamase smb-1 bound to 2-mercaptoethanesulfonate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
b'RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to 2-mercaptoethanesulfonate
rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5axrA00
4ZEJA 5K4NA 2FU9A 2DKFA 5EV6A 1DXKA 4WD6A 5HIOA 3X2XA 2ZNBA 3RPCA 2Y8AA 3P2UA 2BFLA 5EWAA 3IDZA 2YCBA 2UYXA 1X8GA 5A87A 3KNRA 5A0TA 5AHOA 1DDKA 1XTOA 4Z5YA 2QINA 3S0ZA 1QH5A 2BG6A 2YNTB 3IEMA 4C09A 1KR3A 4U4LA 4AWZA 3WXCA 1WRAA 4UWPB 2NXAA 2BFZB 4XWWA 2AIOA 4JO0A 2CBNA 3IE0A 5ACUA 2Q9UA 3IOGA 2FHXB 5FQBA 3SBLA 4UWOB 2XR1A 4C1GA 2FU7A 4ZO2A 5LCHA 1MQOA 3SRXA 2YNWA 2FM6A 3A4YA 1L9YA 3H3EA 4TZEA 5AXOA 3AJ3A 4V0HA 1K07A 1X8IA 3IELA 2BIBA 4NQ2A 4CHLA 4RM5A 3MD7A 5LE1A 5AHRA 4D02A 3X30A 5AEBA 1QH3A 3BK1A 3T9MA 2GFJA 2I7TA 3BK2A 2FK6A 4NQ4A 3KL7A 5KILA 3VPEA 3I14A 5LCAA 1JJTA 2GCUA 2WYMC 4O98A 1JT1A 5B15A 4RBSA 2P4ZA 2AZ4A 3SPUA 4RAMA 4GYUA 3ZNBA 2H6AA 3T3NA 4EYLA 2NZFA 4UWSB 3RKKA 3QH8A 4C1DA 2FU8A 1BMCA 2Q0IA 2YNUA 1WUPA 4BZ3A 2I7VA 2BG8A 2BG2A 3IOFA 4C1HA 2P18A 5ACTA 2QDTA 2I7XA 4GYQA 4TZBA 5FQCA 3FAIA 1A7TA 1XM8A 4EYBA 3TP9A 5EH9A 3X2ZA 4HL1A 2QJSA 5EVKA 2ZO4A 3SD9A 3KNSA 5LLDA 2VW8A 5HIPA 2NYPA 4AWYB 4EFZA 1P9EA 5HH6A 4HL2A 2P1EA 1YCFA 4NQ6A 2Y8BA 4ZO3A 4J5HA 3RKJA 3SW3A 4Z67A 4XUKA 2ZWRA 3PY6A 2WYMA 3L6NA 4UAMA 2XF4A 2GFKA 3Q6VA 4TZ9A 4YSBA 1HLKA 5LS3A 5ACWA 1VJNA 3R2UA 4YSKA 5ACSA 3I13A 2BR6A 4PVOA 3I0VA 3G1PA 2BC2A 5HH5A 2HB9A 4D1TA 2GKLA 1ZNBA 3F9OA 2YNVA 1YCHA 2WYLA 2OHIA 2WHGA 5EVBA 2Q42A 2WRSA 4NQ5A 4GCWA 4DILA 2BG8B 4Z7RA 3IE1A 4EXSA 4C1EA 3I11A 3AF5A 5K4KA 2M5CA 4RAWA 1WW1A 1Y44A 4FR7A 4AD9A 1ZTCA 3X2YA 3T3OA 5ACXA 5HIQA 4F6ZA 5DPXA 2BG7A 2M5DA 2NZEA 4KEPA 3ESHA 2A7MA 5KIKA 2P97A 5IQKA 5ACVA 1KO3A 4RL0A 2QDSA 1ZKPA 1JJEA 4BP0A 4H0DA 1YCGA 3BV6A 2FU6A 2Q0JA 4C1FA 5LM6A 3DHBA 3DHCA 4KEQA 4B87A 5B1UA 4TZFA 2OHJA 5A0VA 3IEKA 5ACQA 2YNVB 5B3RA 1E5DA 3DHAA 4LE6A 5AYAA 5AXRA 1VMEA 3AF6A 1BC2A 3SFPA 2R2DA 5HH4A 5HISA 1A8TA 5ACPA 4XWTA 4F6HA 4HKYA 5FQAA 4EXYA 2OHHA 4C1CA 1DD6A 4TYFA 3VQZA 1M2XA 2DOOA 1SMLA 4FEKA 2BTNA 2BMIA 3DH8A 5ACRA 1WUOA 5LMCA 4Z60A 4FSBA 1X8HA 2ZZIA 3LVZA 3ZR9A 5LSCA 4UA4A 2BFKA 5K4MA 4Z6XA 5EVDA 4Z5ZA 2E7YA 4YSLA 4TYTA 5EV8A 4EYFA 4RL2A 2YNTA 1BVTA 2GMNA 2Y87A 4UWRB 4EY2A 2QEDA 4ZNBA 3I15A 5EW0A 4PVTA 2BFZA 3ZWFA 1KO2A 3IE2A 3BC2A 4DIKA 4P62A 2FHXA 3ADRA 3PY5A 4AX0B 5A5ZA 5EHTA 3ZQ4A 5K0WA 3FCZA 4J5FA 4UBQA 4D1UA 2BGAA 4AX1B 4D1WA 5LCFA 4D1VA 3JXPA 3PG4A 2YZ3A 1VGNA
chains in the Genus database with same CATH superfamily
4ZEJA 5K4NA 2FU9A 2DKFA 5EV6A 1DXKA 2YHEA 4WD6A 5HIOA 3X2XA 2ZNBA 3RPCA 2Y8AA 3P2UA 2BFLA 5AIJA 5EWAA 3IDZA 2YCBA 2UYXA 1X8GA 5A87A 3KNRA 5A0TA 5AHOA 1DDKA 1XTOA 4Z5YA 2QINA 3S0ZA 1QH5A 2BG6A 2YNTB 3IEMA 4C09A 1KR3A 4U4LA 4AWZA 5A23A 3WXCA 1WRAA 4UWPB 2NXAA 2BFZB 4XWWA 2AIOA 4JO0A 2CBNA 3IE0A 5ACUA 2Q9UA 3IOGA 2FHXB 5FQBA 3SBLA 4UWOB 2XR1A 4C1GA 2FU7A 4ZO2A 5LCHA 2CFUA 1MQOA 3SRXA 2YNWA 2FM6A 3A4YA 1L9YA 3H3EA 4TZEA 5AXOA 3AJ3A 4V0HA 1K07A 1X8IA 4AXHA 3IELA 2BIBA 4NQ2A 4CHLA 4RM5A 3MD7A 5LE1A 5AHRA 4D02A 3X30A 5AEBA 1QH3A 3BK1A 3T9MA 2GFJA 2I7TA 3BK2A 2FK6A 2CG2A 4NQ4A 3KL7A 5KILA 3VPEA 3I14A 5LCAA 1JJTA 2GCUA 2WYMC 4O98A 1JT1A 5B15A 4RBSA 2P4ZA 2AZ4A 3SPUA 4RAMA 4GYUA 3ZNBA 2H6AA 3T3NA 4EYLA 2NZFA 4UWSB 3RKKA 3QH8A 4C1DA 2FU8A 1BMCA 2Q0IA 2YNUA 1WUPA 4BZ3A 2I7VA 2BG8A 2BG2A 3IOFA 4C1HA 2P18A 5ACTA 2QDTA 2I7XA 4GYQA 4TZBA 5FQCA 3FAIA 4PDXA 1A7TA 1XM8A 4EYBA 3TP9A 5EH9A 3X2ZA 4HL1A 5AJLA 2QJSA 5EVKA 2ZO4A 3SD9A 3KNSA 5LLDA 2VW8A 5HIPA 2NYPA 4AWYB 4EFZA 1P9EA 5HH6A 4HL2A 2P1EA 1YCFA 4NQ6A 2Y8BA 4ZO3A 4J5HA 3RKJA 3SW3A 4Z67A 4XUKA 2ZWRA 3PY6A 2WYMA 3L6NA 4UAMA 2XF4A 2GFKA 3Q6VA 4TZ9A 4YSBA 1HLKA 5LS3A 5ACWA 1VJNA 3R2UA 4YSKA 5ACSA 3I13A 2BR6A 4PVOA 3I0VA 3G1PA 2BC2A 5HH5A 2HB9A 4D1TA 2GKLA 1ZNBA 3F9OA 2YNVA 1YCHA 2WYLA 2OHIA 2WHGA 5EVBA 2Q42A 2WRSA 4NQ5A 4GCWA 2CG3A 4DILA 2BG8B 4Z7RA 3IE1A 4AV7A 4EXSA 4C1EA 3I11A 3AF5A 5K4KA 2M5CA 4RAWA 1WW1A 1Y44A 4FR7A 4AD9A 1ZTCA 3X2YA 3T3OA 5ACXA 5HIQA 4F6ZA 5DPXA 2BG7A 2M5DA 2NZEA 4KEPA 3ESHA 2A7MA 5KIKA 2P97A 5IQKA 5ACVA 1KO3A 4RL0A 2QDSA 1ZKPA 1JJEA 4BP0A 4H0DA 1YCGA 3BV6A 2FU6A 2Q0JA 4C1FA 5LM6A 3DHBA 3DHCA 4KEQA 4B87A 5B1UA 4TZFA 2OHJA 5A0VA 3IEKA 5ACQA 2YNVB 5B3RA 1E5DA 3DHAA 4LE6A 5AYAA 5AXRA 1VMEA 3AF6A 1BC2A 3SFPA 2R2DA 5HH4A 5HISA 1A8TA 5ACPA 4XWTA 4F6HA 4HKYA 5FQAA 4EXYA 2OHHA 4C1CA 1DD6A 4NURA 4TYFA 3VQZA 1M2XA 2DOOA 1SMLA 2CFZA 4FEKA 2BTNA 2BMIA 3DH8A 5ACRA 1WUOA 5LMCA 4Z60A 4FSBA 1X8HA 2ZZIA 3LVZA 3ZR9A 5LSCA 4UA4A 2BFKA 5K4MA 4Z6XA 5EVDA 4Z5ZA 2E7YA 4YSLA 4TYTA 5EV8A 4EYFA 4RL2A 2YNTA 1BVTA 2GMNA 2Y87A 4UWRB 4EY2A 2QEDA 4ZNBA 3I15A 5EW0A 4PVTA 2BFZA 3ZWFA 1KO2A 3IE2A 3BC2A 4DIKA 4P62A 2FHXA 3ADRA 3PY5A 4AX0B 5A5ZA 5EHTA 3ZQ4A 5K0WA 3FCZA 4J5FA 4UBQA 4D1UA 2BGAA 4AX1B 4D1WA 5LCFA 4D1VA 3JXPA 3PG4A 2YZ3A 1VGNA
chains in the Genus database with same CATH topology
4ZEJA 5K4NA 2FU9A 2DKFA 5EV6A 1DXKA 4WD6A 5HIOA 3X2XA 2ZNBA 3RPCA 2Y8AA 3P2UA 2BFLA 5EWAA 3IDZA 2YCBA 2UYXA 1X8GA 5A87A 3KNRA 5A0TA 5AHOA 1DDKA 1XTOA 4Z5YA 2QINA 3S0ZA 1QH5A 2BG6A 2YNTB 3IEMA 4C09A 1KR3A 4U4LA 4AWZA 3WXCA 1WRAA 4UWPB 2NXAA 2BFZB 4XWWA 2AIOA 4JO0A 2CBNA 3IE0A 5ACUA 2Q9UA 3IOGA 2FHXB 5FQBA 3SBLA 4UWOB 2XR1A 4C1GA 2FU7A 4ZO2A 5LCHA 1MQOA 3SRXA 2YNWA 2FM6A 3A4YA 1L9YA 3H3EA 4TZEA 5AXOA 3AJ3A 4V0HA 1K07A 1X8IA 3IELA 2BIBA 4NQ2A 4CHLA 4RM5A 3MD7A 5LE1A 5AHRA 4D02A 3X30A 5AEBA 1QH3A 3BK1A 3T9MA 2GFJA 2I7TA 3BK2A 2FK6A 4NQ4A 3KL7A 5KILA 3VPEA 3I14A 5LCAA 1JJTA 2GCUA 2WYMC 4O98A 1JT1A 5B15A 4RBSA 2P4ZA 2AZ4A 3SPUA 4RAMA 4GYUA 3ZNBA 2H6AA 3T3NA 4EYLA 2NZFA 4UWSB 3RKKA 3QH8A 4C1DA 2FU8A 1BMCA 2Q0IA 2YNUA 1WUPA 4BZ3A 2I7VA 2BG8A 2BG2A 3IOFA 4C1HA 2P18A 5ACTA 2QDTA 2I7XA 4GYQA 4TZBA 5FQCA 3FAIA 1A7TA 1XM8A 4EYBA 3TP9A 5EH9A 3X2ZA 4HL1A 2QJSA 5EVKA 2ZO4A 3SD9A 3KNSA 5LLDA 2VW8A 5HIPA 2NYPA 4AWYB 4EFZA 1P9EA 5HH6A 4HL2A 2P1EA 1YCFA 4NQ6A 2Y8BA 4ZO3A 4J5HA 3RKJA 3SW3A 4Z67A 4XUKA 2ZWRA 3PY6A 2WYMA 3L6NA 4UAMA 2XF4A 2GFKA 3Q6VA 4TZ9A 4YSBA 1HLKA 5LS3A 5ACWA 1VJNA 3R2UA 4YSKA 5ACSA 3I13A 2BR6A 4PVOA 3I0VA 3G1PA 2BC2A 5HH5A 2HB9A 4D1TA 2GKLA 1ZNBA 3F9OA 2YNVA 1YCHA 2WYLA 2OHIA 2WHGA 5EVBA 2Q42A 2WRSA 4NQ5A 4GCWA 4DILA 2BG8B 4Z7RA 3IE1A 4EXSA 4C1EA 3I11A 3AF5A 5K4KA 2M5CA 4RAWA 1WW1A 1Y44A 4FR7A 4AD9A 1ZTCA 3X2YA 3T3OA 5ACXA 5HIQA 4F6ZA 5DPXA 2BG7A 2M5DA 2NZEA 4KEPA 3ESHA 2A7MA 5KIKA 2P97A 5IQKA 5ACVA 1KO3A 4RL0A 2QDSA 1ZKPA 1JJEA 4BP0A 4H0DA 1YCGA 3BV6A 2FU6A 2Q0JA 4C1FA 5LM6A 3DHBA 3DHCA 4KEQA 4B87A 5B1UA 4TZFA 2OHJA 5A0VA 3IEKA 5ACQA 2YNVB 5B3RA 1E5DA 3DHAA 4LE6A 5AYAA 5AXRA 1VMEA 3AF6A 1BC2A 3SFPA 2R2DA 5HH4A 5HISA 1A8TA 5ACPA 4XWTA 4F6HA 4HKYA 5FQAA 4EXYA 2OHHA 4C1CA 1DD6A 4TYFA 3VQZA 1M2XA 2DOOA 1SMLA 4FEKA 2BTNA 2BMIA 3DH8A 5ACRA 1WUOA 5LMCA 4Z60A 4FSBA 1X8HA 2ZZIA 3LVZA 3ZR9A 5LSCA 4UA4A 2BFKA 5K4MA 4Z6XA 5EVDA 4Z5ZA 2E7YA 4YSLA 4TYTA 5EV8A 4EYFA 4RL2A 2YNTA 1BVTA 2GMNA 2Y87A 4UWRB 4EY2A 2QEDA 4ZNBA 3I15A 5EW0A 4PVTA 2BFZA 3ZWFA 1KO2A 3IE2A 3BC2A 4DIKA 4P62A 2FHXA 3ADRA 3PY5A 4AX0B 5A5ZA 5EHTA 3ZQ4A 5K0WA 3FCZA 4J5FA 4UBQA 4D1UA 2BGAA 4AX1B 4D1WA 5LCFA 4D1VA 3JXPA 3PG4A 2YZ3A 1VGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEJ A;  5K4N A;  2FU9 A;  2DKF A;  5EV6 A;  1DXK A;  4WD6 A;  5HIO A;  3X2X A;  2ZNB A;  3RPC A;  2Y8A A;  3P2U A;  2BFL A;  5EWA A;  3IDZ A;  2YCB A;  2UYX A;  1X8G A;  5A87 A;  3KNR A;  5A0T A;  5AHO A;  1DDK A;  1XTO A;  4Z5Y A;  2QIN A;  3S0Z A;  1QH5 A;  2BG6 A;  2YNT B;  3IEM A;  4C09 A;  1KR3 A;  4U4L A;  4AWZ A;  3WXC A;  1WRA A;  4UWP B;  2NXA A;  2BFZ B;  4XWW A;  2AIO A;  4JO0 A;  2CBN A;  3IE0 A;  5ACU A;  2Q9U A;  3IOG A;  2FHX B;  5FQB A;  3SBL A;  4UWO B;  2XR1 A;  4C1G A;  2FU7 A;  4ZO2 A;  5LCH A;  1MQO A;  3SRX A;  2YNW A;  2FM6 A;  3A4Y A;  1L9Y A;  3H3E A;  4TZE A;  5AXO A;  3AJ3 A;  4V0H A;  1K07 A;  1X8I A;  3IEL A;  2BIB A;  4NQ2 A;  4CHL A;  4RM5 A;  3MD7 A;  5LE1 A;  5AHR A;  4D02 A;  3X30 A;  5AEB A;  1QH3 A;  3BK1 A;  3T9M A;  2GFJ A;  2I7T A;  3BK2 A;  2FK6 A;  4NQ4 A;  3KL7 A;  5KIL A;  3VPE A;  3I14 A;  5LCA A;  1JJT A;  2GCU A;  2WYM C;  4O98 A;  1JT1 A;  5B15 A;  4RBS A;  2P4Z A;  2AZ4 A;  3SPU A;  4RAM A;  4GYU A;  3ZNB A;  2H6A A;  3T3N A;  4EYL A;  2NZF A;  4UWS B;  3RKK A;  3QH8 A;  4C1D A;  2FU8 A;  1BMC A;  2Q0I A;  2YNU A;  1WUP A;  4BZ3 A;  2I7V A;  2BG8 A;  2BG2 A;  3IOF A;  4C1H A;  2P18 A;  5ACT A;  2QDT A;  2I7X A;  4GYQ A;  4TZB A;  5FQC A;  3FAI A;  1A7T A;  1XM8 A;  4EYB A;  3TP9 A;  5EH9 A;  3X2Z A;  4HL1 A;  2QJS A;  5EVK A;  2ZO4 A;  3SD9 A;  3KNS A;  5LLD A;  2VW8 A;  5HIP A;  2NYP A;  4AWY B;  4EFZ A;  1P9E A;  5HH6 A;  4HL2 A;  2P1E A;  1YCF A;  4NQ6 A;  2Y8B A;  4ZO3 A;  4J5H A;  3RKJ A;  3SW3 A;  4Z67 A;  4XUK A;  2ZWR A;  3PY6 A;  2WYM A;  3L6N A;  4UAM A;  2XF4 A;  2GFK A;  3Q6V A;  4TZ9 A;  4YSB A;  1HLK A;  5LS3 A;  5ACW A;  1VJN A;  3R2U A;  4YSK A;  5ACS A;  3I13 A;  2BR6 A;  4PVO A;  3I0V A;  3G1P A;  2BC2 A;  5HH5 A;  2HB9 A;  4D1T A;  2GKL A;  1ZNB A;  3F9O A;  2YNV A;  1YCH A;  2WYL A;  2OHI A;  2WHG A;  5EVB A;  2Q42 A;  2WRS A;  4NQ5 A;  4GCW A;  4DIL A;  2BG8 B;  4Z7R A;  3IE1 A;  4EXS A;  4C1E A;  3I11 A;  3AF5 A;  5K4K A;  2M5C A;  4RAW A;  1WW1 A;  1Y44 A;  4FR7 A;  4AD9 A;  1ZTC A;  3X2Y A;  3T3O A;  5ACX A;  5HIQ A;  4F6Z A;  5DPX A;  2BG7 A;  2M5D A;  2NZE A;  4KEP A;  3ESH A;  2A7M A;  5KIK A;  2P97 A;  5IQK A;  5ACV A;  1KO3 A;  4RL0 A;  2QDS A;  1ZKP A;  1JJE A;  4BP0 A;  4H0D A;  1YCG A;  3BV6 A;  2FU6 A;  2Q0J A;  4C1F A;  5LM6 A;  3DHB A;  3DHC A;  4KEQ A;  4B87 A;  5B1U A;  4TZF A;  2OHJ A;  5A0V A;  3IEK A;  5ACQ A;  2YNV B;  5B3R A;  1E5D A;  3DHA A;  4LE6 A;  5AYA A;  5AXR A;  1VME A;  3AF6 A;  1BC2 A;  3SFP A;  2R2D A;  5HH4 A;  5HIS A;  1A8T A;  5ACP A;  4XWT A;  4F6H A;  4HKY A;  5FQA A;  4EXY A;  2OHH A;  4C1C A;  1DD6 A;  4TYF A;  3VQZ A;  1M2X A;  2DOO A;  1SML A;  4FEK A;  2BTN A;  2BMI A;  3DH8 A;  5ACR A;  1WUO A;  5LMC A;  4Z60 A;  4FSB A;  1X8H A;  2ZZI A;  3LVZ A;  3ZR9 A;  5LSC A;  4UA4 A;  2BFK A;  5K4M A;  4Z6X A;  5EVD A;  4Z5Z A;  2E7Y A;  4YSL A;  4TYT A;  5EV8 A;  4EYF A;  4RL2 A;  2YNT A;  1BVT A;  2GMN A;  2Y87 A;  4UWR B;  4EY2 A;  2QED A;  4ZNB A;  3I15 A;  5EW0 A;  4PVT A;  2BFZ A;  3ZWF A;  1KO2 A;  3IE2 A;  3BC2 A;  4DIK A;  4P62 A;  2FHX A;  3ADR A;  3PY5 A;  4AX0 B;  5A5Z A;  5EHT A;  3ZQ4 A;  5K0W A;  3FCZ A;  4J5F A;  4UBQ A;  4D1U A;  2BGA A;  4AX1 B;  4D1W A;  5LCF A;  4D1V A;  3JXP A;  3PG4 A;  2YZ3 A;  1VGN A; 
#chains in the Genus database with same CATH topology
 4ZEJ A;  5K4N A;  2FU9 A;  2DKF A;  5EV6 A;  1DXK A;  2YHE A;  4WD6 A;  5HIO A;  3X2X A;  2ZNB A;  3RPC A;  2Y8A A;  3P2U A;  2BFL A;  5AIJ A;  5EWA A;  3IDZ A;  2YCB A;  2UYX A;  1X8G A;  5A87 A;  3KNR A;  5A0T A;  5AHO A;  1DDK A;  1XTO A;  4Z5Y A;  2QIN A;  3S0Z A;  1QH5 A;  2BG6 A;  2YNT B;  3IEM A;  4C09 A;  1KR3 A;  4U4L A;  4AWZ A;  5A23 A;  3WXC A;  1WRA A;  4UWP B;  2NXA A;  2BFZ B;  4XWW A;  2AIO A;  4JO0 A;  2CBN A;  3IE0 A;  5ACU A;  2Q9U A;  3IOG A;  2FHX B;  5FQB A;  3SBL A;  4UWO B;  2XR1 A;  4C1G A;  2FU7 A;  4ZO2 A;  5LCH A;  2CFU A;  1MQO A;  3SRX A;  2YNW A;  2FM6 A;  3A4Y A;  1L9Y A;  3H3E A;  4TZE A;  5AXO A;  3AJ3 A;  4V0H A;  1K07 A;  1X8I A;  4AXH A;  3IEL A;  2BIB A;  4NQ2 A;  4CHL A;  4RM5 A;  3MD7 A;  5LE1 A;  5AHR A;  4D02 A;  3X30 A;  5AEB A;  1QH3 A;  3BK1 A;  3T9M A;  2GFJ A;  2I7T A;  3BK2 A;  2FK6 A;  2CG2 A;  4NQ4 A;  3KL7 A;  5KIL A;  3VPE A;  3I14 A;  5LCA A;  1JJT A;  2GCU A;  2WYM C;  4O98 A;  1JT1 A;  5B15 A;  4RBS A;  2P4Z A;  2AZ4 A;  3SPU A;  4RAM A;  4GYU A;  3ZNB A;  2H6A A;  3T3N A;  4EYL A;  2NZF A;  4UWS B;  3RKK A;  3QH8 A;  4C1D A;  2FU8 A;  1BMC A;  2Q0I A;  2YNU A;  1WUP A;  4BZ3 A;  2I7V A;  2BG8 A;  2BG2 A;  3IOF A;  4C1H A;  2P18 A;  5ACT A;  2QDT A;  2I7X A;  4GYQ A;  4TZB A;  5FQC A;  3FAI A;  4PDX A;  1A7T A;  1XM8 A;  4EYB A;  3TP9 A;  5EH9 A;  3X2Z A;  4HL1 A;  5AJL A;  2QJS A;  5EVK A;  2ZO4 A;  3SD9 A;  3KNS A;  5LLD A;  2VW8 A;  5HIP A;  2NYP A;  4AWY B;  4EFZ A;  1P9E A;  5HH6 A;  4HL2 A;  2P1E A;  1YCF A;  4NQ6 A;  2Y8B A;  4ZO3 A;  4J5H A;  3RKJ A;  3SW3 A;  4Z67 A;  4XUK A;  2ZWR A;  3PY6 A;  2WYM A;  3L6N A;  4UAM A;  2XF4 A;  2GFK A;  3Q6V A;  4TZ9 A;  4YSB A;  1HLK A;  5LS3 A;  5ACW A;  1VJN A;  3R2U A;  4YSK A;  5ACS A;  3I13 A;  2BR6 A;  4PVO A;  3I0V A;  3G1P A;  2BC2 A;  5HH5 A;  2HB9 A;  4D1T A;  2GKL A;  1ZNB A;  3F9O A;  2YNV A;  1YCH A;  2WYL A;  2OHI A;  2WHG A;  5EVB A;  2Q42 A;  2WRS A;  4NQ5 A;  4GCW A;  2CG3 A;  4DIL A;  2BG8 B;  4Z7R A;  3IE1 A;  4AV7 A;  4EXS A;  4C1E A;  3I11 A;  3AF5 A;  5K4K A;  2M5C A;  4RAW A;  1WW1 A;  1Y44 A;  4FR7 A;  4AD9 A;  1ZTC A;  3X2Y A;  3T3O A;  5ACX A;  5HIQ A;  4F6Z A;  5DPX A;  2BG7 A;  2M5D A;  2NZE A;  4KEP A;  3ESH A;  2A7M A;  5KIK A;  2P97 A;  5IQK A;  5ACV A;  1KO3 A;  4RL0 A;  2QDS A;  1ZKP A;  1JJE A;  4BP0 A;  4H0D A;  1YCG A;  3BV6 A;  2FU6 A;  2Q0J A;  4C1F A;  5LM6 A;  3DHB A;  3DHC A;  4KEQ A;  4B87 A;  5B1U A;  4TZF A;  2OHJ A;  5A0V A;  3IEK A;  5ACQ A;  2YNV B;  5B3R A;  1E5D A;  3DHA A;  4LE6 A;  5AYA A;  5AXR A;  1VME A;  3AF6 A;  1BC2 A;  3SFP A;  2R2D A;  5HH4 A;  5HIS A;  1A8T A;  5ACP A;  4XWT A;  4F6H A;  4HKY A;  5FQA A;  4EXY A;  2OHH A;  4C1C A;  1DD6 A;  4NUR A;  4TYF A;  3VQZ A;  1M2X A;  2DOO A;  1SML A;  2CFZ A;  4FEK A;  2BTN A;  2BMI A;  3DH8 A;  5ACR A;  1WUO A;  5LMC A;  4Z60 A;  4FSB A;  1X8H A;  2ZZI A;  3LVZ A;  3ZR9 A;  5LSC A;  4UA4 A;  2BFK A;  5K4M A;  4Z6X A;  5EVD A;  4Z5Z A;  2E7Y A;  4YSL A;  4TYT A;  5EV8 A;  4EYF A;  4RL2 A;  2YNT A;  1BVT A;  2GMN A;  2Y87 A;  4UWR B;  4EY2 A;  2QED A;  4ZNB A;  3I15 A;  5EW0 A;  4PVT A;  2BFZ A;  3ZWF A;  1KO2 A;  3IE2 A;  3BC2 A;  4DIK A;  4P62 A;  2FHX A;  3ADR A;  3PY5 A;  4AX0 B;  5A5Z A;  5EHT A;  3ZQ4 A;  5K0W A;  3FCZ A;  4J5F A;  4UBQ A;  4D1U A;  2BGA A;  4AX1 B;  4D1W A;  5LCF A;  4D1V A;  3JXP A;  3PG4 A;  2YZ3 A;  1VGN A; 
#chains in the Genus database with same CATH homology
 4ZEJ A;  5K4N A;  2FU9 A;  2DKF A;  5EV6 A;  1DXK A;  4WD6 A;  5HIO A;  3X2X A;  2ZNB A;  3RPC A;  2Y8A A;  3P2U A;  2BFL A;  5EWA A;  3IDZ A;  2YCB A;  2UYX A;  1X8G A;  5A87 A;  3KNR A;  5A0T A;  5AHO A;  1DDK A;  1XTO A;  4Z5Y A;  2QIN A;  3S0Z A;  1QH5 A;  2BG6 A;  2YNT B;  3IEM A;  4C09 A;  1KR3 A;  4U4L A;  4AWZ A;  3WXC A;  1WRA A;  4UWP B;  2NXA A;  2BFZ B;  4XWW A;  2AIO A;  4JO0 A;  2CBN A;  3IE0 A;  5ACU A;  2Q9U A;  3IOG A;  2FHX B;  5FQB A;  3SBL A;  4UWO B;  2XR1 A;  4C1G A;  2FU7 A;  4ZO2 A;  5LCH A;  1MQO A;  3SRX A;  2YNW A;  2FM6 A;  3A4Y A;  1L9Y A;  3H3E A;  4TZE A;  5AXO A;  3AJ3 A;  4V0H A;  1K07 A;  1X8I A;  3IEL A;  2BIB A;  4NQ2 A;  4CHL A;  4RM5 A;  3MD7 A;  5LE1 A;  5AHR A;  4D02 A;  3X30 A;  5AEB A;  1QH3 A;  3BK1 A;  3T9M A;  2GFJ A;  2I7T A;  3BK2 A;  2FK6 A;  4NQ4 A;  3KL7 A;  5KIL A;  3VPE A;  3I14 A;  5LCA A;  1JJT A;  2GCU A;  2WYM C;  4O98 A;  1JT1 A;  5B15 A;  4RBS A;  2P4Z A;  2AZ4 A;  3SPU A;  4RAM A;  4GYU A;  3ZNB A;  2H6A A;  3T3N A;  4EYL A;  2NZF A;  4UWS B;  3RKK A;  3QH8 A;  4C1D A;  2FU8 A;  1BMC A;  2Q0I A;  2YNU A;  1WUP A;  4BZ3 A;  2I7V A;  2BG8 A;  2BG2 A;  3IOF A;  4C1H A;  2P18 A;  5ACT A;  2QDT A;  2I7X A;  4GYQ A;  4TZB A;  5FQC A;  3FAI A;  1A7T A;  1XM8 A;  4EYB A;  3TP9 A;  5EH9 A;  3X2Z A;  4HL1 A;  2QJS A;  5EVK A;  2ZO4 A;  3SD9 A;  3KNS A;  5LLD A;  2VW8 A;  5HIP A;  2NYP A;  4AWY B;  4EFZ A;  1P9E A;  5HH6 A;  4HL2 A;  2P1E A;  1YCF A;  4NQ6 A;  2Y8B A;  4ZO3 A;  4J5H A;  3RKJ A;  3SW3 A;  4Z67 A;  4XUK A;  2ZWR A;  3PY6 A;  2WYM A;  3L6N A;  4UAM A;  2XF4 A;  2GFK A;  3Q6V A;  4TZ9 A;  4YSB A;  1HLK A;  5LS3 A;  5ACW A;  1VJN A;  3R2U A;  4YSK A;  5ACS A;  3I13 A;  2BR6 A;  4PVO A;  3I0V A;  3G1P A;  2BC2 A;  5HH5 A;  2HB9 A;  4D1T A;  2GKL A;  1ZNB A;  3F9O A;  2YNV A;  1YCH A;  2WYL A;  2OHI A;  2WHG A;  5EVB A;  2Q42 A;  2WRS A;  4NQ5 A;  4GCW A;  4DIL A;  2BG8 B;  4Z7R A;  3IE1 A;  4EXS A;  4C1E A;  3I11 A;  3AF5 A;  5K4K A;  2M5C A;  4RAW A;  1WW1 A;  1Y44 A;  4FR7 A;  4AD9 A;  1ZTC A;  3X2Y A;  3T3O A;  5ACX A;  5HIQ A;  4F6Z A;  5DPX A;  2BG7 A;  2M5D A;  2NZE A;  4KEP A;  3ESH A;  2A7M A;  5KIK A;  2P97 A;  5IQK A;  5ACV A;  1KO3 A;  4RL0 A;  2QDS A;  1ZKP A;  1JJE A;  4BP0 A;  4H0D A;  1YCG A;  3BV6 A;  2FU6 A;  2Q0J A;  4C1F A;  5LM6 A;  3DHB A;  3DHC A;  4KEQ A;  4B87 A;  5B1U A;  4TZF A;  2OHJ A;  5A0V A;  3IEK A;  5ACQ A;  2YNV B;  5B3R A;  1E5D A;  3DHA A;  4LE6 A;  5AYA A;  5AXR A;  1VME A;  3AF6 A;  1BC2 A;  3SFP A;  2R2D A;  5HH4 A;  5HIS A;  1A8T A;  5ACP A;  4XWT A;  4F6H A;  4HKY A;  5FQA A;  4EXY A;  2OHH A;  4C1C A;  1DD6 A;  4TYF A;  3VQZ A;  1M2X A;  2DOO A;  1SML A;  4FEK A;  2BTN A;  2BMI A;  3DH8 A;  5ACR A;  1WUO A;  5LMC A;  4Z60 A;  4FSB A;  1X8H A;  2ZZI A;  3LVZ A;  3ZR9 A;  5LSC A;  4UA4 A;  2BFK A;  5K4M A;  4Z6X A;  5EVD A;  4Z5Z A;  2E7Y A;  4YSL A;  4TYT A;  5EV8 A;  4EYF A;  4RL2 A;  2YNT A;  1BVT A;  2GMN A;  2Y87 A;  4UWR B;  4EY2 A;  2QED A;  4ZNB A;  3I15 A;  5EW0 A;  4PVT A;  2BFZ A;  3ZWF A;  1KO2 A;  3IE2 A;  3BC2 A;  4DIK A;  4P62 A;  2FHX A;  3ADR A;  3PY5 A;  4AX0 B;  5A5Z A;  5EHT A;  3ZQ4 A;  5K0W A;  3FCZ A;  4J5F A;  4UBQ A;  4D1U A;  2BGA A;  4AX1 B;  4D1W A;  5LCF A;  4D1V A;  3JXP A;  3PG4 A;  2YZ3 A;  1VGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...