5AXRA

Crystal structure of metallo-beta-lactamase smb-1 bound to 2-mercaptoethanesulfonate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to 2-mercaptoethanesulfonate
rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5axrA00
3ZQ4A 3T3OA 2FU9A 5K4MA 3H3EA 2FU6A 3BK2A 2P1EA 3T3NA 4GCWA 3ZNBA 4GYQA 4Z5ZA 1QH5A 2FHXB 3KNSA 5AYAA 3IDZA 3VPEA 2QINA 3ZWFA 4FEKA 5HH6A 3RKKA 4AWZA 4U4LA 2Q42A 4O98A 4AWYB 4JO0A 4UWSB 2I7XA 5HIOA 2R2DA 3A4YA 3IELA 4Z60A 5K4NA 2ZZIA 4HKYA 2YNUA 1JJTA 3I15A 1WRAA 3Q6VA 4TZ9A 4ZNBA 2BG8B 2HB9A 5B15A 4DILA 2WRSA 1X8HA 1YCFA 3IE2A 2I7TA 4Z5YA 4P62A 3AF6A 5LM6A 5A0TA 2BFZB 5LCFA 3BV6A 4HL2A 2Y8BA 1ZNBA 2E7YA 4PVOA 3BK1A 4C1HA 4RBSA 4NQ6A 2P18A 4RL0A 2OHIA 2FM6A 4C1EA 3FCZA 2Y8AA 4WD6A 2BG7A 4D1TA 2AIOA 2ZWRA 5AXOA 3AJ3A 1BC2A 5FQCA 3RPCA 3WXCA 2BFLA 3PY5A 2ZNBA 4RAMA 4RL2A 3I11A 4NQ2A 2FHXA 2QDSA 3X30A 1M2XA 3IE0A 4ZO2A 3VQZA 4TZBA 5A5ZA 3MD7A 4UA4A 1XM8A 2NYPA 5K4KA 3SRXA 3P2UA 4TZFA 4YSBA 5B3RA 2CBNA 1BVTA 1ZTCA 2BG8A 3F9OA 2A7MA 4D1UA 4EY2A 5ACTA 3X2ZA 3QH8A 2YCBA 4KEPA 4YSLA 5LLDA 4GYUA 2BFZA 4EYFA 2M5CA 2QJSA 3DHAA 5A87A 2ZO4A 4UWOB 5ACVA 1VMEA 3BC2A 3SD9A 4FR7A 3IOGA 1WUOA 3FAIA 1KO3A 3G1PA 5DPXA 2AZ4A 3PG4A 3KNRA 4EXYA 4Z7RA 3X2YA 4NQ5A 4DIKA 5EW0A 2Q0IA 3IEKA 2BR6A 2GFJA 4LE6A 2DKFA 4UWPB 5HIPA 4D1WA 1DXKA 4XWTA 1X8GA 2BC2A 4HL1A 2BGAA 3IEMA 2UYXA 5LMCA 1VGNA 2OHJA 5HH5A 3LVZA 5EWAA 3X2XA 1K07A 2OHHA 3L6NA 2FU8A 5EV8A 1P9EA 2QEDA 4CHLA 1JT1A 2NZFA 1KO2A 3SW3A 5KILA 3T9MA 5LE1A 5IQKA 5KIKA 4TZEA 4AX0B 4ZO3A 5LSCA 3SFPA 2VW8A 3IOFA 3ESHA 1ZKPA 3SBLA 2BFKA 4C1CA 5EVDA 5AHOA 5ACWA 1VJNA 2YNVB 4KEQA 4B87A 4RM5A 5ACUA 5ACRA 3ZR9A 2BTNA 5A0VA 2XF4A 5HIQA 1WW1A 4PVTA 4TYFA 2YNWA 2BG2A 5ACXA 5EVKA 3DH8A 4EXSA 2I7VA 2WHGA 2YZ3A 1MQOA 4UBQA 5HISA 4J5FA 3AF5A 4F6ZA 2NZEA 4V0HA 4XWWA 3DHCA 5AHRA 4EYLA 4EFZA 4D02A 3RKJA 2Y87A 3I0VA 4ZEJA 3S0ZA 4NQ4A 2P97A 1KR3A 3R2UA 2P4ZA 5LS3A 2QDTA 4RAWA 3TP9A 1WUPA 4J5HA 2YNTB 2WYMA 2Q0JA 5EVBA 3PY6A 4UWRB 1SMLA 4BP0A 5ACQA 1YCHA 1XTOA 4BZ3A 1JJEA 5EHTA 5EV6A 4AD9A 2YNVA 3I13A 1A8TA 2GCUA 5LCHA 5HH4A 3DHBA 2XR1A 3I14A 5AXRA 2Q9UA 2GFKA 1E5DA 1YCGA 5AEBA 2FU7A 5LCAA 1Y44A 4C09A 2NXAA 5ACPA 1A7TA 5FQAA 4AX1B 1DD6A 4Z67A 4C1FA 4C1DA 2M5DA 3KL7A 5B1UA 1DDKA 4YSKA 2WYMC 4H0DA 4F6HA 3IE1A 1HLKA 4UAMA 5K0WA 5FQBA 1QH3A 2WYLA 2BG6A 4Z6XA 1L9YA 5ACSA 2GKLA 4XUKA 2YNTA 2BMIA 2DOOA 2BIBA 4FSBA 3ADRA 1X8IA 4EYBA 3JXPA 4D1VA 2FK6A 4C1GA 5EH9A 2GMNA 2H6AA 4TYTA 1BMCA 3SPUA
chains in the Genus database with same CATH superfamily
3ZQ4A 3T3OA 2FU9A 5K4MA 3H3EA 2FU6A 3BK2A 2P1EA 3T3NA 4GCWA 3ZNBA 4GYQA 4Z5ZA 1QH5A 2FHXB 3KNSA 5AYAA 3IDZA 3VPEA 2QINA 3ZWFA 4FEKA 5HH6A 3RKKA 2CFZA 4AWZA 4U4LA 2Q42A 4O98A 4AWYB 4JO0A 4UWSB 2I7XA 5HIOA 2R2DA 3A4YA 3IELA 4Z60A 5K4NA 2ZZIA 4HKYA 2CG2A 2YNUA 1JJTA 3I15A 1WRAA 3Q6VA 4TZ9A 4ZNBA 2BG8B 2HB9A 5B15A 4DILA 2WRSA 1X8HA 1YCFA 3IE2A 2I7TA 4Z5YA 4P62A 3AF6A 5LM6A 5A0TA 2BFZB 5LCFA 3BV6A 4HL2A 2Y8BA 1ZNBA 2E7YA 4PVOA 3BK1A 4C1HA 4RBSA 4NQ6A 2P18A 4RL0A 4AV7A 2OHIA 2FM6A 4C1EA 3FCZA 2Y8AA 4WD6A 2BG7A 4D1TA 2AIOA 2ZWRA 5AXOA 3AJ3A 1BC2A 5FQCA 3RPCA 3WXCA 2BFLA 3PY5A 2ZNBA 4RAMA 4RL2A 3I11A 4NQ2A 2FHXA 2CFUA 2QDSA 3X30A 1M2XA 3IE0A 4ZO2A 3VQZA 4TZBA 5A5ZA 3MD7A 4UA4A 1XM8A 2NYPA 5K4KA 3SRXA 3P2UA 4TZFA 4YSBA 5B3RA 2CBNA 1BVTA 1ZTCA 2BG8A 3F9OA 2A7MA 4D1UA 4EY2A 5ACTA 3X2ZA 3QH8A 2YCBA 4KEPA 4YSLA 5LLDA 4GYUA 2BFZA 4EYFA 2M5CA 2QJSA 3DHAA 5A87A 2ZO4A 4UWOB 5ACVA 1VMEA 3BC2A 3SD9A 4FR7A 3IOGA 1WUOA 3FAIA 1KO3A 2CG3A 3G1PA 5DPXA 2AZ4A 3PG4A 3KNRA 4EXYA 4Z7RA 3X2YA 4NQ5A 4DIKA 5EW0A 2Q0IA 3IEKA 2BR6A 2GFJA 4LE6A 2DKFA 4UWPB 5HIPA 4D1WA 1DXKA 4XWTA 1X8GA 2BC2A 4HL1A 2BGAA 3IEMA 2UYXA 5LMCA 1VGNA 2OHJA 5HH5A 3LVZA 5EWAA 3X2XA 4AXHA 1K07A 2OHHA 3L6NA 2FU8A 5A23A 5AJLA 5EV8A 1P9EA 2QEDA 4CHLA 1JT1A 2NZFA 1KO2A 3SW3A 5KILA 3T9MA 5LE1A 5IQKA 5KIKA 4TZEA 4AX0B 4ZO3A 5LSCA 3SFPA 2VW8A 3IOFA 3ESHA 1ZKPA 3SBLA 2BFKA 4C1CA 5EVDA 4PDXA 4NURA 5AHOA 5ACWA 1VJNA 2YNVB 4KEQA 4B87A 4RM5A 5ACUA 5ACRA 3ZR9A 2BTNA 5A0VA 2XF4A 5HIQA 1WW1A 4PVTA 4TYFA 5AIJA 2YNWA 2BG2A 5ACXA 5EVKA 3DH8A 4EXSA 2I7VA 2WHGA 2YZ3A 1MQOA 4UBQA 5HISA 4J5FA 3AF5A 4F6ZA 2NZEA 4V0HA 4XWWA 3DHCA 5AHRA 4EYLA 4EFZA 4D02A 3RKJA 2Y87A 3I0VA 4ZEJA 3S0ZA 4NQ4A 2P97A 1KR3A 3R2UA 2P4ZA 5LS3A 2QDTA 2YHEA 4RAWA 3TP9A 1WUPA 4J5HA 2YNTB 2WYMA 2Q0JA 5EVBA 3PY6A 4UWRB 1SMLA 4BP0A 5ACQA 1YCHA 1XTOA 4BZ3A 1JJEA 5EHTA 5EV6A 4AD9A 2YNVA 3I13A 1A8TA 2GCUA 5LCHA 5HH4A 3DHBA 2XR1A 3I14A 5AXRA 2Q9UA 1E5DA 2GFKA 1YCGA 5AEBA 2FU7A 5LCAA 1Y44A 4C09A 2NXAA 5ACPA 1A7TA 5FQAA 4AX1B 1DD6A 4Z67A 4C1FA 4C1DA 2M5DA 3KL7A 5B1UA 1DDKA 4YSKA 2WYMC 4H0DA 4F6HA 3IE1A 1HLKA 4UAMA 5K0WA 5FQBA 1QH3A 2WYLA 2BG6A 4Z6XA 1L9YA 5ACSA 2GKLA 4XUKA 2YNTA 2BMIA 2DOOA 2BIBA 4FSBA 3ADRA 1X8IA 4EYBA 3JXPA 4D1VA 2FK6A 4C1GA 5EH9A 2GMNA 2H6AA 4TYTA 1BMCA 3SPUA
chains in the Genus database with same CATH topology
3ZQ4A 3T3OA 2FU9A 5K4MA 3H3EA 2FU6A 3BK2A 2P1EA 3T3NA 4GCWA 3ZNBA 4GYQA 4Z5ZA 1QH5A 2FHXB 3KNSA 5AYAA 3IDZA 3VPEA 2QINA 3ZWFA 4FEKA 5HH6A 3RKKA 4AWZA 4U4LA 2Q42A 4O98A 4AWYB 4JO0A 4UWSB 2I7XA 5HIOA 2R2DA 3A4YA 3IELA 4Z60A 5K4NA 2ZZIA 4HKYA 2YNUA 1JJTA 3I15A 1WRAA 3Q6VA 4TZ9A 4ZNBA 2BG8B 2HB9A 5B15A 4DILA 2WRSA 1X8HA 1YCFA 3IE2A 2I7TA 4Z5YA 4P62A 3AF6A 5LM6A 5A0TA 2BFZB 5LCFA 3BV6A 4HL2A 2Y8BA 1ZNBA 2E7YA 4PVOA 3BK1A 4C1HA 4RBSA 4NQ6A 2P18A 4RL0A 2OHIA 2FM6A 4C1EA 3FCZA 2Y8AA 4WD6A 2BG7A 4D1TA 2AIOA 2ZWRA 5AXOA 3AJ3A 1BC2A 5FQCA 3RPCA 3WXCA 2BFLA 3PY5A 2ZNBA 4RAMA 4RL2A 3I11A 4NQ2A 2FHXA 2QDSA 3X30A 1M2XA 3IE0A 4ZO2A 3VQZA 4TZBA 5A5ZA 3MD7A 4UA4A 1XM8A 2NYPA 5K4KA 3SRXA 3P2UA 4TZFA 4YSBA 5B3RA 2CBNA 1BVTA 1ZTCA 2BG8A 3F9OA 2A7MA 4D1UA 4EY2A 5ACTA 3X2ZA 3QH8A 2YCBA 4KEPA 4YSLA 5LLDA 4GYUA 2BFZA 4EYFA 2M5CA 2QJSA 3DHAA 5A87A 2ZO4A 4UWOB 5ACVA 1VMEA 3BC2A 3SD9A 4FR7A 3IOGA 1WUOA 3FAIA 1KO3A 3G1PA 5DPXA 2AZ4A 3PG4A 3KNRA 4EXYA 4Z7RA 3X2YA 4NQ5A 4DIKA 5EW0A 2Q0IA 3IEKA 2BR6A 2GFJA 4LE6A 2DKFA 4UWPB 5HIPA 4D1WA 1DXKA 4XWTA 1X8GA 2BC2A 4HL1A 2BGAA 3IEMA 2UYXA 5LMCA 1VGNA 2OHJA 5HH5A 3LVZA 5EWAA 3X2XA 1K07A 2OHHA 3L6NA 2FU8A 5EV8A 1P9EA 2QEDA 4CHLA 1JT1A 2NZFA 1KO2A 3SW3A 5KILA 3T9MA 5LE1A 5IQKA 5KIKA 4TZEA 4AX0B 4ZO3A 5LSCA 3SFPA 2VW8A 3IOFA 3ESHA 1ZKPA 3SBLA 2BFKA 4C1CA 5EVDA 5AHOA 5ACWA 1VJNA 2YNVB 4KEQA 4B87A 4RM5A 5ACUA 5ACRA 3ZR9A 2BTNA 5A0VA 2XF4A 5HIQA 1WW1A 4PVTA 4TYFA 2YNWA 2BG2A 5ACXA 5EVKA 3DH8A 4EXSA 2I7VA 2WHGA 2YZ3A 1MQOA 4UBQA 5HISA 4J5FA 3AF5A 4F6ZA 2NZEA 4V0HA 4XWWA 3DHCA 5AHRA 4EYLA 4EFZA 4D02A 3RKJA 2Y87A 3I0VA 4ZEJA 3S0ZA 4NQ4A 2P97A 1KR3A 3R2UA 2P4ZA 5LS3A 2QDTA 4RAWA 3TP9A 1WUPA 4J5HA 2YNTB 2WYMA 2Q0JA 5EVBA 3PY6A 4UWRB 1SMLA 4BP0A 5ACQA 1YCHA 1XTOA 4BZ3A 1JJEA 5EHTA 5EV6A 4AD9A 2YNVA 3I13A 1A8TA 2GCUA 5LCHA 5HH4A 3DHBA 2XR1A 3I14A 5AXRA 2Q9UA 2GFKA 1E5DA 1YCGA 5AEBA 2FU7A 5LCAA 1Y44A 4C09A 2NXAA 5ACPA 1A7TA 5FQAA 4AX1B 1DD6A 4Z67A 4C1FA 4C1DA 2M5DA 3KL7A 5B1UA 1DDKA 4YSKA 2WYMC 4H0DA 4F6HA 3IE1A 1HLKA 4UAMA 5K0WA 5FQBA 1QH3A 2WYLA 2BG6A 4Z6XA 1L9YA 5ACSA 2GKLA 4XUKA 2YNTA 2BMIA 2DOOA 2BIBA 4FSBA 3ADRA 1X8IA 4EYBA 3JXPA 4D1VA 2FK6A 4C1GA 5EH9A 2GMNA 2H6AA 4TYTA 1BMCA 3SPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ4 A;  3T3O A;  2FU9 A;  5K4M A;  3H3E A;  2FU6 A;  3BK2 A;  2P1E A;  3T3N A;  4GCW A;  3ZNB A;  4GYQ A;  4Z5Z A;  1QH5 A;  2FHX B;  3KNS A;  5AYA A;  3IDZ A;  3VPE A;  2QIN A;  3ZWF A;  4FEK A;  5HH6 A;  3RKK A;  4AWZ A;  4U4L A;  2Q42 A;  4O98 A;  4AWY B;  4JO0 A;  4UWS B;  2I7X A;  5HIO A;  2R2D A;  3A4Y A;  3IEL A;  4Z60 A;  5K4N A;  2ZZI A;  4HKY A;  2YNU A;  1JJT A;  3I15 A;  1WRA A;  3Q6V A;  4TZ9 A;  4ZNB A;  2BG8 B;  2HB9 A;  5B15 A;  4DIL A;  2WRS A;  1X8H A;  1YCF A;  3IE2 A;  2I7T A;  4Z5Y A;  4P62 A;  3AF6 A;  5LM6 A;  5A0T A;  2BFZ B;  5LCF A;  3BV6 A;  4HL2 A;  2Y8B A;  1ZNB A;  2E7Y A;  4PVO A;  3BK1 A;  4C1H A;  4RBS A;  4NQ6 A;  2P18 A;  4RL0 A;  2OHI A;  2FM6 A;  4C1E A;  3FCZ A;  2Y8A A;  4WD6 A;  2BG7 A;  4D1T A;  2AIO A;  2ZWR A;  5AXO A;  3AJ3 A;  1BC2 A;  5FQC A;  3RPC A;  3WXC A;  2BFL A;  3PY5 A;  2ZNB A;  4RAM A;  4RL2 A;  3I11 A;  4NQ2 A;  2FHX A;  2QDS A;  3X30 A;  1M2X A;  3IE0 A;  4ZO2 A;  3VQZ A;  4TZB A;  5A5Z A;  3MD7 A;  4UA4 A;  1XM8 A;  2NYP A;  5K4K A;  3SRX A;  3P2U A;  4TZF A;  4YSB A;  5B3R A;  2CBN A;  1BVT A;  1ZTC A;  2BG8 A;  3F9O A;  2A7M A;  4D1U A;  4EY2 A;  5ACT A;  3X2Z A;  3QH8 A;  2YCB A;  4KEP A;  4YSL A;  5LLD A;  4GYU A;  2BFZ A;  4EYF A;  2M5C A;  2QJS A;  3DHA A;  5A87 A;  2ZO4 A;  4UWO B;  5ACV A;  1VME A;  3BC2 A;  3SD9 A;  4FR7 A;  3IOG A;  1WUO A;  3FAI A;  1KO3 A;  3G1P A;  5DPX A;  2AZ4 A;  3PG4 A;  3KNR A;  4EXY A;  4Z7R A;  3X2Y A;  4NQ5 A;  4DIK A;  5EW0 A;  2Q0I A;  3IEK A;  2BR6 A;  2GFJ A;  4LE6 A;  2DKF A;  4UWP B;  5HIP A;  4D1W A;  1DXK A;  4XWT A;  1X8G A;  2BC2 A;  4HL1 A;  2BGA A;  3IEM A;  2UYX A;  5LMC A;  1VGN A;  2OHJ A;  5HH5 A;  3LVZ A;  5EWA A;  3X2X A;  1K07 A;  2OHH A;  3L6N A;  2FU8 A;  5EV8 A;  1P9E A;  2QED A;  4CHL A;  1JT1 A;  2NZF A;  1KO2 A;  3SW3 A;  5KIL A;  3T9M A;  5LE1 A;  5IQK A;  5KIK A;  4TZE A;  4AX0 B;  4ZO3 A;  5LSC A;  3SFP A;  2VW8 A;  3IOF A;  3ESH A;  1ZKP A;  3SBL A;  2BFK A;  4C1C A;  5EVD A;  5AHO A;  5ACW A;  1VJN A;  2YNV B;  4KEQ A;  4B87 A;  4RM5 A;  5ACU A;  5ACR A;  3ZR9 A;  2BTN A;  5A0V A;  2XF4 A;  5HIQ A;  1WW1 A;  4PVT A;  4TYF A;  2YNW A;  2BG2 A;  5ACX A;  5EVK A;  3DH8 A;  4EXS A;  2I7V A;  2WHG A;  2YZ3 A;  1MQO A;  4UBQ A;  5HIS A;  4J5F A;  3AF5 A;  4F6Z A;  2NZE A;  4V0H A;  4XWW A;  3DHC A;  5AHR A;  4EYL A;  4EFZ A;  4D02 A;  3RKJ A;  2Y87 A;  3I0V A;  4ZEJ A;  3S0Z A;  4NQ4 A;  2P97 A;  1KR3 A;  3R2U A;  2P4Z A;  5LS3 A;  2QDT A;  4RAW A;  3TP9 A;  1WUP A;  4J5H A;  2YNT B;  2WYM A;  2Q0J A;  5EVB A;  3PY6 A;  4UWR B;  1SML A;  4BP0 A;  5ACQ A;  1YCH A;  1XTO A;  4BZ3 A;  1JJE A;  5EHT A;  5EV6 A;  4AD9 A;  2YNV A;  3I13 A;  1A8T A;  2GCU A;  5LCH A;  5HH4 A;  3DHB A;  2XR1 A;  3I14 A;  5AXR A;  2Q9U A;  2GFK A;  1E5D A;  1YCG A;  5AEB A;  2FU7 A;  5LCA A;  1Y44 A;  4C09 A;  2NXA A;  5ACP A;  1A7T A;  5FQA A;  4AX1 B;  1DD6 A;  4Z67 A;  4C1F A;  4C1D A;  2M5D A;  3KL7 A;  5B1U A;  1DDK A;  4YSK A;  2WYM C;  4H0D A;  4F6H A;  3IE1 A;  1HLK A;  4UAM A;  5K0W A;  5FQB A;  1QH3 A;  2WYL A;  2BG6 A;  4Z6X A;  1L9Y A;  5ACS A;  2GKL A;  4XUK A;  2YNT A;  2BMI A;  2DOO A;  2BIB A;  4FSB A;  3ADR A;  1X8I A;  4EYB A;  3JXP A;  4D1V A;  2FK6 A;  4C1G A;  5EH9 A;  2GMN A;  2H6A A;  4TYT A;  1BMC A;  3SPU A; 
#chains in the Genus database with same CATH topology
 3ZQ4 A;  3T3O A;  2FU9 A;  5K4M A;  3H3E A;  2FU6 A;  3BK2 A;  2P1E A;  3T3N A;  4GCW A;  3ZNB A;  4GYQ A;  4Z5Z A;  1QH5 A;  2FHX B;  3KNS A;  5AYA A;  3IDZ A;  3VPE A;  2QIN A;  3ZWF A;  4FEK A;  5HH6 A;  3RKK A;  2CFZ A;  4AWZ A;  4U4L A;  2Q42 A;  4O98 A;  4AWY B;  4JO0 A;  4UWS B;  2I7X A;  5HIO A;  2R2D A;  3A4Y A;  3IEL A;  4Z60 A;  5K4N A;  2ZZI A;  4HKY A;  2CG2 A;  2YNU A;  1JJT A;  3I15 A;  1WRA A;  3Q6V A;  4TZ9 A;  4ZNB A;  2BG8 B;  2HB9 A;  5B15 A;  4DIL A;  2WRS A;  1X8H A;  1YCF A;  3IE2 A;  2I7T A;  4Z5Y A;  4P62 A;  3AF6 A;  5LM6 A;  5A0T A;  2BFZ B;  5LCF A;  3BV6 A;  4HL2 A;  2Y8B A;  1ZNB A;  2E7Y A;  4PVO A;  3BK1 A;  4C1H A;  4RBS A;  4NQ6 A;  2P18 A;  4RL0 A;  4AV7 A;  2OHI A;  2FM6 A;  4C1E A;  3FCZ A;  2Y8A A;  4WD6 A;  2BG7 A;  4D1T A;  2AIO A;  2ZWR A;  5AXO A;  3AJ3 A;  1BC2 A;  5FQC A;  3RPC A;  3WXC A;  2BFL A;  3PY5 A;  2ZNB A;  4RAM A;  4RL2 A;  3I11 A;  4NQ2 A;  2FHX A;  2CFU A;  2QDS A;  3X30 A;  1M2X A;  3IE0 A;  4ZO2 A;  3VQZ A;  4TZB A;  5A5Z A;  3MD7 A;  4UA4 A;  1XM8 A;  2NYP A;  5K4K A;  3SRX A;  3P2U A;  4TZF A;  4YSB A;  5B3R A;  2CBN A;  1BVT A;  1ZTC A;  2BG8 A;  3F9O A;  2A7M A;  4D1U A;  4EY2 A;  5ACT A;  3X2Z A;  3QH8 A;  2YCB A;  4KEP A;  4YSL A;  5LLD A;  4GYU A;  2BFZ A;  4EYF A;  2M5C A;  2QJS A;  3DHA A;  5A87 A;  2ZO4 A;  4UWO B;  5ACV A;  1VME A;  3BC2 A;  3SD9 A;  4FR7 A;  3IOG A;  1WUO A;  3FAI A;  1KO3 A;  2CG3 A;  3G1P A;  5DPX A;  2AZ4 A;  3PG4 A;  3KNR A;  4EXY A;  4Z7R A;  3X2Y A;  4NQ5 A;  4DIK A;  5EW0 A;  2Q0I A;  3IEK A;  2BR6 A;  2GFJ A;  4LE6 A;  2DKF A;  4UWP B;  5HIP A;  4D1W A;  1DXK A;  4XWT A;  1X8G A;  2BC2 A;  4HL1 A;  2BGA A;  3IEM A;  2UYX A;  5LMC A;  1VGN A;  2OHJ A;  5HH5 A;  3LVZ A;  5EWA A;  3X2X A;  4AXH A;  1K07 A;  2OHH A;  3L6N A;  2FU8 A;  5A23 A;  5AJL A;  5EV8 A;  1P9E A;  2QED A;  4CHL A;  1JT1 A;  2NZF A;  1KO2 A;  3SW3 A;  5KIL A;  3T9M A;  5LE1 A;  5IQK A;  5KIK A;  4TZE A;  4AX0 B;  4ZO3 A;  5LSC A;  3SFP A;  2VW8 A;  3IOF A;  3ESH A;  1ZKP A;  3SBL A;  2BFK A;  4C1C A;  5EVD A;  4PDX A;  4NUR A;  5AHO A;  5ACW A;  1VJN A;  2YNV B;  4KEQ A;  4B87 A;  4RM5 A;  5ACU A;  5ACR A;  3ZR9 A;  2BTN A;  5A0V A;  2XF4 A;  5HIQ A;  1WW1 A;  4PVT A;  4TYF A;  5AIJ A;  2YNW A;  2BG2 A;  5ACX A;  5EVK A;  3DH8 A;  4EXS A;  2I7V A;  2WHG A;  2YZ3 A;  1MQO A;  4UBQ A;  5HIS A;  4J5F A;  3AF5 A;  4F6Z A;  2NZE A;  4V0H A;  4XWW A;  3DHC A;  5AHR A;  4EYL A;  4EFZ A;  4D02 A;  3RKJ A;  2Y87 A;  3I0V A;  4ZEJ A;  3S0Z A;  4NQ4 A;  2P97 A;  1KR3 A;  3R2U A;  2P4Z A;  5LS3 A;  2QDT A;  2YHE A;  4RAW A;  3TP9 A;  1WUP A;  4J5H A;  2YNT B;  2WYM A;  2Q0J A;  5EVB A;  3PY6 A;  4UWR B;  1SML A;  4BP0 A;  5ACQ A;  1YCH A;  1XTO A;  4BZ3 A;  1JJE A;  5EHT A;  5EV6 A;  4AD9 A;  2YNV A;  3I13 A;  1A8T A;  2GCU A;  5LCH A;  5HH4 A;  3DHB A;  2XR1 A;  3I14 A;  5AXR A;  2Q9U A;  1E5D A;  2GFK A;  1YCG A;  5AEB A;  2FU7 A;  5LCA A;  1Y44 A;  4C09 A;  2NXA A;  5ACP A;  1A7T A;  5FQA A;  4AX1 B;  1DD6 A;  4Z67 A;  4C1F A;  4C1D A;  2M5D A;  3KL7 A;  5B1U A;  1DDK A;  4YSK A;  2WYM C;  4H0D A;  4F6H A;  3IE1 A;  1HLK A;  4UAM A;  5K0W A;  5FQB A;  1QH3 A;  2WYL A;  2BG6 A;  4Z6X A;  1L9Y A;  5ACS A;  2GKL A;  4XUK A;  2YNT A;  2BMI A;  2DOO A;  2BIB A;  4FSB A;  3ADR A;  1X8I A;  4EYB A;  3JXP A;  4D1V A;  2FK6 A;  4C1G A;  5EH9 A;  2GMN A;  2H6A A;  4TYT A;  1BMC A;  3SPU A; 
#chains in the Genus database with same CATH homology
 3ZQ4 A;  3T3O A;  2FU9 A;  5K4M A;  3H3E A;  2FU6 A;  3BK2 A;  2P1E A;  3T3N A;  4GCW A;  3ZNB A;  4GYQ A;  4Z5Z A;  1QH5 A;  2FHX B;  3KNS A;  5AYA A;  3IDZ A;  3VPE A;  2QIN A;  3ZWF A;  4FEK A;  5HH6 A;  3RKK A;  4AWZ A;  4U4L A;  2Q42 A;  4O98 A;  4AWY B;  4JO0 A;  4UWS B;  2I7X A;  5HIO A;  2R2D A;  3A4Y A;  3IEL A;  4Z60 A;  5K4N A;  2ZZI A;  4HKY A;  2YNU A;  1JJT A;  3I15 A;  1WRA A;  3Q6V A;  4TZ9 A;  4ZNB A;  2BG8 B;  2HB9 A;  5B15 A;  4DIL A;  2WRS A;  1X8H A;  1YCF A;  3IE2 A;  2I7T A;  4Z5Y A;  4P62 A;  3AF6 A;  5LM6 A;  5A0T A;  2BFZ B;  5LCF A;  3BV6 A;  4HL2 A;  2Y8B A;  1ZNB A;  2E7Y A;  4PVO A;  3BK1 A;  4C1H A;  4RBS A;  4NQ6 A;  2P18 A;  4RL0 A;  2OHI A;  2FM6 A;  4C1E A;  3FCZ A;  2Y8A A;  4WD6 A;  2BG7 A;  4D1T A;  2AIO A;  2ZWR A;  5AXO A;  3AJ3 A;  1BC2 A;  5FQC A;  3RPC A;  3WXC A;  2BFL A;  3PY5 A;  2ZNB A;  4RAM A;  4RL2 A;  3I11 A;  4NQ2 A;  2FHX A;  2QDS A;  3X30 A;  1M2X A;  3IE0 A;  4ZO2 A;  3VQZ A;  4TZB A;  5A5Z A;  3MD7 A;  4UA4 A;  1XM8 A;  2NYP A;  5K4K A;  3SRX A;  3P2U A;  4TZF A;  4YSB A;  5B3R A;  2CBN A;  1BVT A;  1ZTC A;  2BG8 A;  3F9O A;  2A7M A;  4D1U A;  4EY2 A;  5ACT A;  3X2Z A;  3QH8 A;  2YCB A;  4KEP A;  4YSL A;  5LLD A;  4GYU A;  2BFZ A;  4EYF A;  2M5C A;  2QJS A;  3DHA A;  5A87 A;  2ZO4 A;  4UWO B;  5ACV A;  1VME A;  3BC2 A;  3SD9 A;  4FR7 A;  3IOG A;  1WUO A;  3FAI A;  1KO3 A;  3G1P A;  5DPX A;  2AZ4 A;  3PG4 A;  3KNR A;  4EXY A;  4Z7R A;  3X2Y A;  4NQ5 A;  4DIK A;  5EW0 A;  2Q0I A;  3IEK A;  2BR6 A;  2GFJ A;  4LE6 A;  2DKF A;  4UWP B;  5HIP A;  4D1W A;  1DXK A;  4XWT A;  1X8G A;  2BC2 A;  4HL1 A;  2BGA A;  3IEM A;  2UYX A;  5LMC A;  1VGN A;  2OHJ A;  5HH5 A;  3LVZ A;  5EWA A;  3X2X A;  1K07 A;  2OHH A;  3L6N A;  2FU8 A;  5EV8 A;  1P9E A;  2QED A;  4CHL A;  1JT1 A;  2NZF A;  1KO2 A;  3SW3 A;  5KIL A;  3T9M A;  5LE1 A;  5IQK A;  5KIK A;  4TZE A;  4AX0 B;  4ZO3 A;  5LSC A;  3SFP A;  2VW8 A;  3IOF A;  3ESH A;  1ZKP A;  3SBL A;  2BFK A;  4C1C A;  5EVD A;  5AHO A;  5ACW A;  1VJN A;  2YNV B;  4KEQ A;  4B87 A;  4RM5 A;  5ACU A;  5ACR A;  3ZR9 A;  2BTN A;  5A0V A;  2XF4 A;  5HIQ A;  1WW1 A;  4PVT A;  4TYF A;  2YNW A;  2BG2 A;  5ACX A;  5EVK A;  3DH8 A;  4EXS A;  2I7V A;  2WHG A;  2YZ3 A;  1MQO A;  4UBQ A;  5HIS A;  4J5F A;  3AF5 A;  4F6Z A;  2NZE A;  4V0H A;  4XWW A;  3DHC A;  5AHR A;  4EYL A;  4EFZ A;  4D02 A;  3RKJ A;  2Y87 A;  3I0V A;  4ZEJ A;  3S0Z A;  4NQ4 A;  2P97 A;  1KR3 A;  3R2U A;  2P4Z A;  5LS3 A;  2QDT A;  4RAW A;  3TP9 A;  1WUP A;  4J5H A;  2YNT B;  2WYM A;  2Q0J A;  5EVB A;  3PY6 A;  4UWR B;  1SML A;  4BP0 A;  5ACQ A;  1YCH A;  1XTO A;  4BZ3 A;  1JJE A;  5EHT A;  5EV6 A;  4AD9 A;  2YNV A;  3I13 A;  1A8T A;  2GCU A;  5LCH A;  5HH4 A;  3DHB A;  2XR1 A;  3I14 A;  5AXR A;  2Q9U A;  2GFK A;  1E5D A;  1YCG A;  5AEB A;  2FU7 A;  5LCA A;  1Y44 A;  4C09 A;  2NXA A;  5ACP A;  1A7T A;  5FQA A;  4AX1 B;  1DD6 A;  4Z67 A;  4C1F A;  4C1D A;  2M5D A;  3KL7 A;  5B1U A;  1DDK A;  4YSK A;  2WYM C;  4H0D A;  4F6H A;  3IE1 A;  1HLK A;  4UAM A;  5K0W A;  5FQB A;  1QH3 A;  2WYL A;  2BG6 A;  4Z6X A;  1L9Y A;  5ACS A;  2GKL A;  4XUK A;  2YNT A;  2BMI A;  2DOO A;  2BIB A;  4FSB A;  3ADR A;  1X8I A;  4EYB A;  3JXP A;  4D1V A;  2FK6 A;  4C1G A;  5EH9 A;  2GMN A;  2H6A A;  4TYT A;  1BMC A;  3SPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...