5AXRA

Crystal structure of metallo-beta-lactamase smb-1 bound to 2-mercaptoethanesulfonate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to 2-mercaptoethanesulfonate
rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5axrA00
3ESHA 3KNRA 4EXSA 4V0HA 3T9MA 4C1FA 5ACVA 5B1UA 2BG8A 2P1EA 3SD9A 4PVOA 5EVBA 1VGNA 2XR1A 3AF6A 2BR6A 3ZNBA 5LS3A 4ZO3A 4KEQA 4ZNBA 3I13A 4AWYB 4YSLA 2UYXA 2YZ3A 5HISA 3F9OA 1JT1A 2BC2A 4C1EA 3I11A 1QH5A 1HLKA 2FU6A 1YCFA 5B15A 1X8HA 2CBNA 4Z6XA 4UWSB 4C1DA 3BK1A 2VW8A 1Y44A 2Y8BA 5A0TA 2GKLA 4F6HA 3LVZA 4UAMA 3A4YA 2ZZIA 1ZKPA 1KO2A 3MD7A 4BP0A 5ACRA 5A5ZA 3VQZA 2BFZB 2Y87A 1VMEA 5LE1A 3DHCA 5AEBA 4UWPB 5HH6A 1YCHA 4O98A 2Q0IA 5EV6A 2Q42A 2E7YA 2NYPA 5EW0A 1KO3A 1KR3A 5LLDA 4GYQA 4TZBA 4AWZA 4J5FA 4BZ3A 5AHOA 3X2XA 3PY5A 4TYTA 2WHGA 4CHLA 1DDKA 1K07A 4YSBA 5B3RA 5KIKA 5HIOA 5ACUA 1MQOA 2BGAA 5AXOA 3IOGA 3RPCA 2WRSA 4HKYA 4PVTA 2M5DA 5LCFA 2YNTA 4GCWA 2FU8A 4EFZA 2GFKA 4J5HA 2XF4A 4RBSA 2ZWRA 1QH3A 4Z5YA 2QJSA 5K4NA 4NQ4A 2OHJA 3X30A 1WUOA 4LE6A 2FU7A 3PY6A 3WXCA 3VPEA 3Q6VA 5LM6A 2WYLA 5A0VA 3IE2A 3ZQ4A 2Q9UA 2AIOA 4EYLA 5HH5A 4FR7A 2WYMC 3TP9A 3AJ3A 5EWAA 2I7TA 2GMNA 4RM5A 4DIKA 3G1PA 4AX1B 5LSCA 2R2DA 2QEDA 1WW1A 3SBLA 3R2UA 2DOOA 4C1CA 2Q0JA 5FQCA 3IEMA 1WRAA 3IE1A 1BVTA 1JJTA 3ZWFA 2NZFA 4FSBA 2NZEA 4XWWA 4AX0B 4D1VA 4XWTA 3SFPA 4RL0A 4GYUA 3PG4A 1L9YA 2YNVA 3QH8A 3BC2A 5IQKA 3T3OA 2FK6A 3AF5A 4EXYA 5EVKA 4UWRB 4JO0A 4U4LA 2YCBA 4C1HA 2FHXA 1SMLA 5EHTA 4D1WA 2GCUA 4ZO2A 1YCGA 3DHBA 1BMCA 2ZO4A 2BFLA 2BG6A 4ZEJA 2I7VA 5HH4A 4Z67A 3S0ZA 4C09A 2FHXB 3SRXA 2QDSA 2GFJA 2DKFA 4XUKA 3ADRA 3IDZA 5ACQA 5EVDA 1DXKA 5K0WA 1X8IA 4EYFA 3SW3A 4F6ZA 1ZNBA 3RKKA 3IEKA 5ACPA 4KEPA 5AYAA 3H3EA 3I14A 4TYFA 3X2ZA 2AZ4A 3BV6A 3DH8A 4Z60A 4UBQA 5AHRA 4TZFA 2Y8AA 4HL1A 3L6NA 4FEKA 5EV8A 4Z5ZA 4B87A 2H6AA 2FM6A 1E5DA 2OHIA 2BTNA 2A7MA 5FQAA 3IOFA 1WUPA 3BK2A 4D1UA 2YNVB 5HIQA 2P97A 4AD9A 5EH9A 5LMCA 1VJNA 2OHHA 2BG7A 4RAWA 2FU9A 4TZEA 2YNUA 2BG8B 5HIPA 2BFZA 1XM8A 4RAMA 4Z7RA 4UA4A 2QINA 4WD6A 3I0VA 4EYBA 3P2UA 4TZ9A 4EY2A 2YNWA 3FCZA 5A87A 1A7TA 2P18A 3SPUA 1A8TA 5K4MA 5DPXA 5LCAA 1X8GA 3IELA 3IE0A 2YNTB 2BIBA 5AXRA 3DHAA 4YSKA 2BFKA 5LCHA 4D02A 2WYMA 5K4KA 3FAIA 4P62A 2ZNBA 3KNSA 1M2XA 2M5CA 1P9EA 3JXPA 4NQ5A 4C1GA 3T3NA 2HB9A 4D1TA 2P4ZA 1BC2A 4NQ2A 4UWOB 4RL2A 2BMIA 3ZR9A 5FQBA 5ACWA 4HL2A 4H0DA 3X2YA 3I15A 1ZTCA 3RKJA 5ACTA 5ACSA 4NQ6A 5KILA 1XTOA 5ACXA 1DD6A 3KL7A 4DILA 2NXAA 1JJEA 2QDTA 2I7XA 2BG2A
chains in the Genus database with same CATH superfamily
3ESHA 3KNRA 4EXSA 4V0HA 3T9MA 4C1FA 5ACVA 5B1UA 2BG8A 2P1EA 3SD9A 4PVOA 5EVBA 1VGNA 2XR1A 3AF6A 2BR6A 3ZNBA 5LS3A 4ZO3A 4KEQA 4ZNBA 3I13A 4AWYB 4YSLA 2UYXA 2YZ3A 5HISA 3F9OA 1JT1A 2BC2A 4C1EA 3I11A 1QH5A 1HLKA 2FU6A 1YCFA 5B15A 1X8HA 2CBNA 4Z6XA 4UWSB 4C1DA 3BK1A 2VW8A 1Y44A 2Y8BA 5A0TA 2GKLA 4F6HA 3LVZA 4UAMA 3A4YA 2ZZIA 1ZKPA 1KO2A 3MD7A 4BP0A 4NURA 5ACRA 5A5ZA 3VQZA 2BFZB 2Y87A 1VMEA 5LE1A 3DHCA 5AEBA 4UWPB 5HH6A 1YCHA 4O98A 2Q0IA 5EV6A 2Q42A 2E7YA 2NYPA 5EW0A 1KO3A 1KR3A 5LLDA 4GYQA 4TZBA 4AWZA 4J5FA 4BZ3A 5AHOA 3X2XA 3PY5A 4TYTA 2WHGA 4CHLA 1DDKA 1K07A 4YSBA 5B3RA 5KIKA 5HIOA 5ACUA 1MQOA 2BGAA 5AXOA 3IOGA 3RPCA 2WRSA 4HKYA 4PVTA 2M5DA 5LCFA 2YNTA 4GCWA 2FU8A 4EFZA 2GFKA 4J5HA 2XF4A 4RBSA 2ZWRA 1QH3A 4Z5YA 2QJSA 5K4NA 4NQ4A 2OHJA 3X30A 1WUOA 4LE6A 2FU7A 3PY6A 3WXCA 3VPEA 3Q6VA 5LM6A 2WYLA 5A0VA 3IE2A 3ZQ4A 2CG2A 2Q9UA 2AIOA 2YHEA 4EYLA 5HH5A 4FR7A 2WYMC 3TP9A 3AJ3A 5EWAA 2I7TA 2GMNA 4RM5A 4DIKA 3G1PA 4AX1B 5LSCA 2R2DA 2QEDA 1WW1A 3SBLA 3R2UA 2DOOA 4C1CA 2Q0JA 5FQCA 3IEMA 1WRAA 3IE1A 1BVTA 1JJTA 3ZWFA 2NZFA 4FSBA 2NZEA 4XWWA 4AX0B 4D1VA 4XWTA 3SFPA 4RL0A 4GYUA 3PG4A 1L9YA 2YNVA 3QH8A 5AJLA 3BC2A 5IQKA 3T3OA 2FK6A 3AF5A 4EXYA 5EVKA 4UWRB 4JO0A 4U4LA 2YCBA 4C1HA 2FHXA 1SMLA 5EHTA 4D1WA 2GCUA 4ZO2A 1YCGA 3DHBA 1BMCA 2ZO4A 2BFLA 2BG6A 4ZEJA 2I7VA 5HH4A 4Z67A 3S0ZA 4C09A 2FHXB 3SRXA 2QDSA 2GFJA 2DKFA 4XUKA 3ADRA 3IDZA 5ACQA 5EVDA 1DXKA 5K0WA 1X8IA 4EYFA 3SW3A 4F6ZA 1ZNBA 3RKKA 3IEKA 5ACPA 4KEPA 5AYAA 3H3EA 3I14A 4TYFA 5AIJA 3X2ZA 2AZ4A 3BV6A 3DH8A 2CFUA 4Z60A 4UBQA 5AHRA 4TZFA 2Y8AA 4HL1A 4AV7A 3L6NA 4FEKA 5EV8A 4Z5ZA 2CFZA 4B87A 2H6AA 2FM6A 1E5DA 2OHIA 2BTNA 2A7MA 5FQAA 3IOFA 1WUPA 3BK2A 4D1UA 2YNVB 5HIQA 2P97A 4AD9A 5EH9A 5LMCA 1VJNA 2OHHA 2BG7A 4RAWA 2FU9A 4TZEA 2YNUA 2BG8B 5HIPA 2BFZA 1XM8A 4RAMA 4Z7RA 4UA4A 2QINA 4WD6A 3I0VA 4EYBA 3P2UA 4TZ9A 4EY2A 2YNWA 3FCZA 5A87A 1A7TA 2P18A 3SPUA 1A8TA 5K4MA 5DPXA 5LCAA 1X8GA 3IELA 3IE0A 2YNTB 2BIBA 5AXRA 3DHAA 4YSKA 5A23A 2BFKA 5LCHA 4D02A 2WYMA 5K4KA 3FAIA 4P62A 2ZNBA 3KNSA 1M2XA 2M5CA 1P9EA 3JXPA 4NQ5A 4C1GA 3T3NA 4PDXA 2HB9A 4D1TA 2P4ZA 1BC2A 4NQ2A 2CG3A 4UWOB 4RL2A 2BMIA 3ZR9A 5FQBA 5ACWA 4HL2A 4H0DA 4AXHA 3X2YA 3I15A 1ZTCA 5ACTA 3RKJA 5ACSA 4NQ6A 5KILA 1XTOA 5ACXA 1DD6A 3KL7A 4DILA 2NXAA 1JJEA 2QDTA 2I7XA 2BG2A
chains in the Genus database with same CATH topology
3ESHA 3KNRA 4EXSA 4V0HA 3T9MA 4C1FA 5ACVA 5B1UA 2BG8A 2P1EA 3SD9A 4PVOA 5EVBA 1VGNA 2XR1A 3AF6A 2BR6A 3ZNBA 5LS3A 4ZO3A 4KEQA 4ZNBA 3I13A 4AWYB 4YSLA 2UYXA 2YZ3A 5HISA 3F9OA 1JT1A 2BC2A 4C1EA 3I11A 1QH5A 1HLKA 2FU6A 1YCFA 5B15A 1X8HA 2CBNA 4Z6XA 4UWSB 4C1DA 3BK1A 2VW8A 1Y44A 2Y8BA 5A0TA 2GKLA 4F6HA 3LVZA 4UAMA 3A4YA 2ZZIA 1ZKPA 1KO2A 3MD7A 4BP0A 5ACRA 5A5ZA 3VQZA 2BFZB 2Y87A 1VMEA 5LE1A 3DHCA 5AEBA 4UWPB 5HH6A 1YCHA 4O98A 2Q0IA 5EV6A 2Q42A 2E7YA 2NYPA 5EW0A 1KO3A 1KR3A 5LLDA 4GYQA 4TZBA 4AWZA 4J5FA 4BZ3A 5AHOA 3X2XA 3PY5A 4TYTA 2WHGA 4CHLA 1DDKA 1K07A 4YSBA 5B3RA 5KIKA 5HIOA 5ACUA 1MQOA 2BGAA 5AXOA 3IOGA 3RPCA 2WRSA 4HKYA 4PVTA 2M5DA 5LCFA 2YNTA 4GCWA 2FU8A 4EFZA 2GFKA 4J5HA 2XF4A 4RBSA 2ZWRA 1QH3A 4Z5YA 2QJSA 5K4NA 4NQ4A 2OHJA 3X30A 1WUOA 4LE6A 2FU7A 3PY6A 3WXCA 3VPEA 3Q6VA 5LM6A 2WYLA 5A0VA 3IE2A 3ZQ4A 2Q9UA 2AIOA 4EYLA 5HH5A 4FR7A 2WYMC 3TP9A 3AJ3A 5EWAA 2I7TA 2GMNA 4RM5A 4DIKA 3G1PA 4AX1B 5LSCA 2R2DA 2QEDA 1WW1A 3SBLA 3R2UA 2DOOA 4C1CA 2Q0JA 5FQCA 3IEMA 1WRAA 3IE1A 1BVTA 1JJTA 3ZWFA 2NZFA 4FSBA 2NZEA 4XWWA 4AX0B 4D1VA 4XWTA 3SFPA 4RL0A 4GYUA 3PG4A 1L9YA 2YNVA 3QH8A 3BC2A 5IQKA 3T3OA 2FK6A 3AF5A 4EXYA 5EVKA 4UWRB 4JO0A 4U4LA 2YCBA 4C1HA 2FHXA 1SMLA 5EHTA 4D1WA 2GCUA 4ZO2A 1YCGA 3DHBA 1BMCA 2ZO4A 2BFLA 2BG6A 4ZEJA 2I7VA 5HH4A 4Z67A 3S0ZA 4C09A 2FHXB 3SRXA 2QDSA 2GFJA 2DKFA 4XUKA 3ADRA 3IDZA 5ACQA 5EVDA 1DXKA 5K0WA 1X8IA 4EYFA 3SW3A 4F6ZA 1ZNBA 3RKKA 3IEKA 5ACPA 4KEPA 5AYAA 3H3EA 3I14A 4TYFA 3X2ZA 2AZ4A 3BV6A 3DH8A 4Z60A 4UBQA 5AHRA 4TZFA 2Y8AA 4HL1A 3L6NA 4FEKA 5EV8A 4Z5ZA 4B87A 2H6AA 2FM6A 1E5DA 2OHIA 2BTNA 2A7MA 5FQAA 3IOFA 1WUPA 3BK2A 4D1UA 2YNVB 5HIQA 2P97A 4AD9A 5EH9A 5LMCA 1VJNA 2OHHA 2BG7A 4RAWA 2FU9A 4TZEA 2YNUA 2BG8B 5HIPA 2BFZA 1XM8A 4RAMA 4Z7RA 4UA4A 2QINA 4WD6A 3I0VA 4EYBA 3P2UA 4TZ9A 4EY2A 2YNWA 3FCZA 5A87A 1A7TA 2P18A 3SPUA 1A8TA 5K4MA 5DPXA 5LCAA 1X8GA 3IELA 3IE0A 2YNTB 2BIBA 5AXRA 3DHAA 4YSKA 2BFKA 5LCHA 4D02A 2WYMA 5K4KA 3FAIA 4P62A 2ZNBA 3KNSA 1M2XA 2M5CA 1P9EA 3JXPA 4NQ5A 4C1GA 3T3NA 2HB9A 4D1TA 2P4ZA 1BC2A 4NQ2A 4UWOB 4RL2A 2BMIA 3ZR9A 5FQBA 5ACWA 4HL2A 4H0DA 3X2YA 3I15A 1ZTCA 3RKJA 5ACTA 5ACSA 4NQ6A 5KILA 1XTOA 5ACXA 1DD6A 3KL7A 4DILA 2NXAA 1JJEA 2QDTA 2I7XA 2BG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESH A;  3KNR A;  4EXS A;  4V0H A;  3T9M A;  4C1F A;  5ACV A;  5B1U A;  2BG8 A;  2P1E A;  3SD9 A;  4PVO A;  5EVB A;  1VGN A;  2XR1 A;  3AF6 A;  2BR6 A;  3ZNB A;  5LS3 A;  4ZO3 A;  4KEQ A;  4ZNB A;  3I13 A;  4AWY B;  4YSL A;  2UYX A;  2YZ3 A;  5HIS A;  3F9O A;  1JT1 A;  2BC2 A;  4C1E A;  3I11 A;  1QH5 A;  1HLK A;  2FU6 A;  1YCF A;  5B15 A;  1X8H A;  2CBN A;  4Z6X A;  4UWS B;  4C1D A;  3BK1 A;  2VW8 A;  1Y44 A;  2Y8B A;  5A0T A;  2GKL A;  4F6H A;  3LVZ A;  4UAM A;  3A4Y A;  2ZZI A;  1ZKP A;  1KO2 A;  3MD7 A;  4BP0 A;  5ACR A;  5A5Z A;  3VQZ A;  2BFZ B;  2Y87 A;  1VME A;  5LE1 A;  3DHC A;  5AEB A;  4UWP B;  5HH6 A;  1YCH A;  4O98 A;  2Q0I A;  5EV6 A;  2Q42 A;  2E7Y A;  2NYP A;  5EW0 A;  1KO3 A;  1KR3 A;  5LLD A;  4GYQ A;  4TZB A;  4AWZ A;  4J5F A;  4BZ3 A;  5AHO A;  3X2X A;  3PY5 A;  4TYT A;  2WHG A;  4CHL A;  1DDK A;  1K07 A;  4YSB A;  5B3R A;  5KIK A;  5HIO A;  5ACU A;  1MQO A;  2BGA A;  5AXO A;  3IOG A;  3RPC A;  2WRS A;  4HKY A;  4PVT A;  2M5D A;  5LCF A;  2YNT A;  4GCW A;  2FU8 A;  4EFZ A;  2GFK A;  4J5H A;  2XF4 A;  4RBS A;  2ZWR A;  1QH3 A;  4Z5Y A;  2QJS A;  5K4N A;  4NQ4 A;  2OHJ A;  3X30 A;  1WUO A;  4LE6 A;  2FU7 A;  3PY6 A;  3WXC A;  3VPE A;  3Q6V A;  5LM6 A;  2WYL A;  5A0V A;  3IE2 A;  3ZQ4 A;  2Q9U A;  2AIO A;  4EYL A;  5HH5 A;  4FR7 A;  2WYM C;  3TP9 A;  3AJ3 A;  5EWA A;  2I7T A;  2GMN A;  4RM5 A;  4DIK A;  3G1P A;  4AX1 B;  5LSC A;  2R2D A;  2QED A;  1WW1 A;  3SBL A;  3R2U A;  2DOO A;  4C1C A;  2Q0J A;  5FQC A;  3IEM A;  1WRA A;  3IE1 A;  1BVT A;  1JJT A;  3ZWF A;  2NZF A;  4FSB A;  2NZE A;  4XWW A;  4AX0 B;  4D1V A;  4XWT A;  3SFP A;  4RL0 A;  4GYU A;  3PG4 A;  1L9Y A;  2YNV A;  3QH8 A;  3BC2 A;  5IQK A;  3T3O A;  2FK6 A;  3AF5 A;  4EXY A;  5EVK A;  4UWR B;  4JO0 A;  4U4L A;  2YCB A;  4C1H A;  2FHX A;  1SML A;  5EHT A;  4D1W A;  2GCU A;  4ZO2 A;  1YCG A;  3DHB A;  1BMC A;  2ZO4 A;  2BFL A;  2BG6 A;  4ZEJ A;  2I7V A;  5HH4 A;  4Z67 A;  3S0Z A;  4C09 A;  2FHX B;  3SRX A;  2QDS A;  2GFJ A;  2DKF A;  4XUK A;  3ADR A;  3IDZ A;  5ACQ A;  5EVD A;  1DXK A;  5K0W A;  1X8I A;  4EYF A;  3SW3 A;  4F6Z A;  1ZNB A;  3RKK A;  3IEK A;  5ACP A;  4KEP A;  5AYA A;  3H3E A;  3I14 A;  4TYF A;  3X2Z A;  2AZ4 A;  3BV6 A;  3DH8 A;  4Z60 A;  4UBQ A;  5AHR A;  4TZF A;  2Y8A A;  4HL1 A;  3L6N A;  4FEK A;  5EV8 A;  4Z5Z A;  4B87 A;  2H6A A;  2FM6 A;  1E5D A;  2OHI A;  2BTN A;  2A7M A;  5FQA A;  3IOF A;  1WUP A;  3BK2 A;  4D1U A;  2YNV B;  5HIQ A;  2P97 A;  4AD9 A;  5EH9 A;  5LMC A;  1VJN A;  2OHH A;  2BG7 A;  4RAW A;  2FU9 A;  4TZE A;  2YNU A;  2BG8 B;  5HIP A;  2BFZ A;  1XM8 A;  4RAM A;  4Z7R A;  4UA4 A;  2QIN A;  4WD6 A;  3I0V A;  4EYB A;  3P2U A;  4TZ9 A;  4EY2 A;  2YNW A;  3FCZ A;  5A87 A;  1A7T A;  2P18 A;  3SPU A;  1A8T A;  5K4M A;  5DPX A;  5LCA A;  1X8G A;  3IEL A;  3IE0 A;  2YNT B;  2BIB A;  5AXR A;  3DHA A;  4YSK A;  2BFK A;  5LCH A;  4D02 A;  2WYM A;  5K4K A;  3FAI A;  4P62 A;  2ZNB A;  3KNS A;  1M2X A;  2M5C A;  1P9E A;  3JXP A;  4NQ5 A;  4C1G A;  3T3N A;  2HB9 A;  4D1T A;  2P4Z A;  1BC2 A;  4NQ2 A;  4UWO B;  4RL2 A;  2BMI A;  3ZR9 A;  5FQB A;  5ACW A;  4HL2 A;  4H0D A;  3X2Y A;  3I15 A;  1ZTC A;  3RKJ A;  5ACT A;  5ACS A;  4NQ6 A;  5KIL A;  1XTO A;  5ACX A;  1DD6 A;  3KL7 A;  4DIL A;  2NXA A;  1JJE A;  2QDT A;  2I7X A;  2BG2 A; 
#chains in the Genus database with same CATH topology
 3ESH A;  3KNR A;  4EXS A;  4V0H A;  3T9M A;  4C1F A;  5ACV A;  5B1U A;  2BG8 A;  2P1E A;  3SD9 A;  4PVO A;  5EVB A;  1VGN A;  2XR1 A;  3AF6 A;  2BR6 A;  3ZNB A;  5LS3 A;  4ZO3 A;  4KEQ A;  4ZNB A;  3I13 A;  4AWY B;  4YSL A;  2UYX A;  2YZ3 A;  5HIS A;  3F9O A;  1JT1 A;  2BC2 A;  4C1E A;  3I11 A;  1QH5 A;  1HLK A;  2FU6 A;  1YCF A;  5B15 A;  1X8H A;  2CBN A;  4Z6X A;  4UWS B;  4C1D A;  3BK1 A;  2VW8 A;  1Y44 A;  2Y8B A;  5A0T A;  2GKL A;  4F6H A;  3LVZ A;  4UAM A;  3A4Y A;  2ZZI A;  1ZKP A;  1KO2 A;  3MD7 A;  4BP0 A;  4NUR A;  5ACR A;  5A5Z A;  3VQZ A;  2BFZ B;  2Y87 A;  1VME A;  5LE1 A;  3DHC A;  5AEB A;  4UWP B;  5HH6 A;  1YCH A;  4O98 A;  2Q0I A;  5EV6 A;  2Q42 A;  2E7Y A;  2NYP A;  5EW0 A;  1KO3 A;  1KR3 A;  5LLD A;  4GYQ A;  4TZB A;  4AWZ A;  4J5F A;  4BZ3 A;  5AHO A;  3X2X A;  3PY5 A;  4TYT A;  2WHG A;  4CHL A;  1DDK A;  1K07 A;  4YSB A;  5B3R A;  5KIK A;  5HIO A;  5ACU A;  1MQO A;  2BGA A;  5AXO A;  3IOG A;  3RPC A;  2WRS A;  4HKY A;  4PVT A;  2M5D A;  5LCF A;  2YNT A;  4GCW A;  2FU8 A;  4EFZ A;  2GFK A;  4J5H A;  2XF4 A;  4RBS A;  2ZWR A;  1QH3 A;  4Z5Y A;  2QJS A;  5K4N A;  4NQ4 A;  2OHJ A;  3X30 A;  1WUO A;  4LE6 A;  2FU7 A;  3PY6 A;  3WXC A;  3VPE A;  3Q6V A;  5LM6 A;  2WYL A;  5A0V A;  3IE2 A;  3ZQ4 A;  2CG2 A;  2Q9U A;  2AIO A;  2YHE A;  4EYL A;  5HH5 A;  4FR7 A;  2WYM C;  3TP9 A;  3AJ3 A;  5EWA A;  2I7T A;  2GMN A;  4RM5 A;  4DIK A;  3G1P A;  4AX1 B;  5LSC A;  2R2D A;  2QED A;  1WW1 A;  3SBL A;  3R2U A;  2DOO A;  4C1C A;  2Q0J A;  5FQC A;  3IEM A;  1WRA A;  3IE1 A;  1BVT A;  1JJT A;  3ZWF A;  2NZF A;  4FSB A;  2NZE A;  4XWW A;  4AX0 B;  4D1V A;  4XWT A;  3SFP A;  4RL0 A;  4GYU A;  3PG4 A;  1L9Y A;  2YNV A;  3QH8 A;  5AJL A;  3BC2 A;  5IQK A;  3T3O A;  2FK6 A;  3AF5 A;  4EXY A;  5EVK A;  4UWR B;  4JO0 A;  4U4L A;  2YCB A;  4C1H A;  2FHX A;  1SML A;  5EHT A;  4D1W A;  2GCU A;  4ZO2 A;  1YCG A;  3DHB A;  1BMC A;  2ZO4 A;  2BFL A;  2BG6 A;  4ZEJ A;  2I7V A;  5HH4 A;  4Z67 A;  3S0Z A;  4C09 A;  2FHX B;  3SRX A;  2QDS A;  2GFJ A;  2DKF A;  4XUK A;  3ADR A;  3IDZ A;  5ACQ A;  5EVD A;  1DXK A;  5K0W A;  1X8I A;  4EYF A;  3SW3 A;  4F6Z A;  1ZNB A;  3RKK A;  3IEK A;  5ACP A;  4KEP A;  5AYA A;  3H3E A;  3I14 A;  4TYF A;  5AIJ A;  3X2Z A;  2AZ4 A;  3BV6 A;  3DH8 A;  2CFU A;  4Z60 A;  4UBQ A;  5AHR A;  4TZF A;  2Y8A A;  4HL1 A;  4AV7 A;  3L6N A;  4FEK A;  5EV8 A;  4Z5Z A;  2CFZ A;  4B87 A;  2H6A A;  2FM6 A;  1E5D A;  2OHI A;  2BTN A;  2A7M A;  5FQA A;  3IOF A;  1WUP A;  3BK2 A;  4D1U A;  2YNV B;  5HIQ A;  2P97 A;  4AD9 A;  5EH9 A;  5LMC A;  1VJN A;  2OHH A;  2BG7 A;  4RAW A;  2FU9 A;  4TZE A;  2YNU A;  2BG8 B;  5HIP A;  2BFZ A;  1XM8 A;  4RAM A;  4Z7R A;  4UA4 A;  2QIN A;  4WD6 A;  3I0V A;  4EYB A;  3P2U A;  4TZ9 A;  4EY2 A;  2YNW A;  3FCZ A;  5A87 A;  1A7T A;  2P18 A;  3SPU A;  1A8T A;  5K4M A;  5DPX A;  5LCA A;  1X8G A;  3IEL A;  3IE0 A;  2YNT B;  2BIB A;  5AXR A;  3DHA A;  4YSK A;  5A23 A;  2BFK A;  5LCH A;  4D02 A;  2WYM A;  5K4K A;  3FAI A;  4P62 A;  2ZNB A;  3KNS A;  1M2X A;  2M5C A;  1P9E A;  3JXP A;  4NQ5 A;  4C1G A;  3T3N A;  4PDX A;  2HB9 A;  4D1T A;  2P4Z A;  1BC2 A;  4NQ2 A;  2CG3 A;  4UWO B;  4RL2 A;  2BMI A;  3ZR9 A;  5FQB A;  5ACW A;  4HL2 A;  4H0D A;  4AXH A;  3X2Y A;  3I15 A;  1ZTC A;  5ACT A;  3RKJ A;  5ACS A;  4NQ6 A;  5KIL A;  1XTO A;  5ACX A;  1DD6 A;  3KL7 A;  4DIL A;  2NXA A;  1JJE A;  2QDT A;  2I7X A;  2BG2 A; 
#chains in the Genus database with same CATH homology
 3ESH A;  3KNR A;  4EXS A;  4V0H A;  3T9M A;  4C1F A;  5ACV A;  5B1U A;  2BG8 A;  2P1E A;  3SD9 A;  4PVO A;  5EVB A;  1VGN A;  2XR1 A;  3AF6 A;  2BR6 A;  3ZNB A;  5LS3 A;  4ZO3 A;  4KEQ A;  4ZNB A;  3I13 A;  4AWY B;  4YSL A;  2UYX A;  2YZ3 A;  5HIS A;  3F9O A;  1JT1 A;  2BC2 A;  4C1E A;  3I11 A;  1QH5 A;  1HLK A;  2FU6 A;  1YCF A;  5B15 A;  1X8H A;  2CBN A;  4Z6X A;  4UWS B;  4C1D A;  3BK1 A;  2VW8 A;  1Y44 A;  2Y8B A;  5A0T A;  2GKL A;  4F6H A;  3LVZ A;  4UAM A;  3A4Y A;  2ZZI A;  1ZKP A;  1KO2 A;  3MD7 A;  4BP0 A;  5ACR A;  5A5Z A;  3VQZ A;  2BFZ B;  2Y87 A;  1VME A;  5LE1 A;  3DHC A;  5AEB A;  4UWP B;  5HH6 A;  1YCH A;  4O98 A;  2Q0I A;  5EV6 A;  2Q42 A;  2E7Y A;  2NYP A;  5EW0 A;  1KO3 A;  1KR3 A;  5LLD A;  4GYQ A;  4TZB A;  4AWZ A;  4J5F A;  4BZ3 A;  5AHO A;  3X2X A;  3PY5 A;  4TYT A;  2WHG A;  4CHL A;  1DDK A;  1K07 A;  4YSB A;  5B3R A;  5KIK A;  5HIO A;  5ACU A;  1MQO A;  2BGA A;  5AXO A;  3IOG A;  3RPC A;  2WRS A;  4HKY A;  4PVT A;  2M5D A;  5LCF A;  2YNT A;  4GCW A;  2FU8 A;  4EFZ A;  2GFK A;  4J5H A;  2XF4 A;  4RBS A;  2ZWR A;  1QH3 A;  4Z5Y A;  2QJS A;  5K4N A;  4NQ4 A;  2OHJ A;  3X30 A;  1WUO A;  4LE6 A;  2FU7 A;  3PY6 A;  3WXC A;  3VPE A;  3Q6V A;  5LM6 A;  2WYL A;  5A0V A;  3IE2 A;  3ZQ4 A;  2Q9U A;  2AIO A;  4EYL A;  5HH5 A;  4FR7 A;  2WYM C;  3TP9 A;  3AJ3 A;  5EWA A;  2I7T A;  2GMN A;  4RM5 A;  4DIK A;  3G1P A;  4AX1 B;  5LSC A;  2R2D A;  2QED A;  1WW1 A;  3SBL A;  3R2U A;  2DOO A;  4C1C A;  2Q0J A;  5FQC A;  3IEM A;  1WRA A;  3IE1 A;  1BVT A;  1JJT A;  3ZWF A;  2NZF A;  4FSB A;  2NZE A;  4XWW A;  4AX0 B;  4D1V A;  4XWT A;  3SFP A;  4RL0 A;  4GYU A;  3PG4 A;  1L9Y A;  2YNV A;  3QH8 A;  3BC2 A;  5IQK A;  3T3O A;  2FK6 A;  3AF5 A;  4EXY A;  5EVK A;  4UWR B;  4JO0 A;  4U4L A;  2YCB A;  4C1H A;  2FHX A;  1SML A;  5EHT A;  4D1W A;  2GCU A;  4ZO2 A;  1YCG A;  3DHB A;  1BMC A;  2ZO4 A;  2BFL A;  2BG6 A;  4ZEJ A;  2I7V A;  5HH4 A;  4Z67 A;  3S0Z A;  4C09 A;  2FHX B;  3SRX A;  2QDS A;  2GFJ A;  2DKF A;  4XUK A;  3ADR A;  3IDZ A;  5ACQ A;  5EVD A;  1DXK A;  5K0W A;  1X8I A;  4EYF A;  3SW3 A;  4F6Z A;  1ZNB A;  3RKK A;  3IEK A;  5ACP A;  4KEP A;  5AYA A;  3H3E A;  3I14 A;  4TYF A;  3X2Z A;  2AZ4 A;  3BV6 A;  3DH8 A;  4Z60 A;  4UBQ A;  5AHR A;  4TZF A;  2Y8A A;  4HL1 A;  3L6N A;  4FEK A;  5EV8 A;  4Z5Z A;  4B87 A;  2H6A A;  2FM6 A;  1E5D A;  2OHI A;  2BTN A;  2A7M A;  5FQA A;  3IOF A;  1WUP A;  3BK2 A;  4D1U A;  2YNV B;  5HIQ A;  2P97 A;  4AD9 A;  5EH9 A;  5LMC A;  1VJN A;  2OHH A;  2BG7 A;  4RAW A;  2FU9 A;  4TZE A;  2YNU A;  2BG8 B;  5HIP A;  2BFZ A;  1XM8 A;  4RAM A;  4Z7R A;  4UA4 A;  2QIN A;  4WD6 A;  3I0V A;  4EYB A;  3P2U A;  4TZ9 A;  4EY2 A;  2YNW A;  3FCZ A;  5A87 A;  1A7T A;  2P18 A;  3SPU A;  1A8T A;  5K4M A;  5DPX A;  5LCA A;  1X8G A;  3IEL A;  3IE0 A;  2YNT B;  2BIB A;  5AXR A;  3DHA A;  4YSK A;  2BFK A;  5LCH A;  4D02 A;  2WYM A;  5K4K A;  3FAI A;  4P62 A;  2ZNB A;  3KNS A;  1M2X A;  2M5C A;  1P9E A;  3JXP A;  4NQ5 A;  4C1G A;  3T3N A;  2HB9 A;  4D1T A;  2P4Z A;  1BC2 A;  4NQ2 A;  4UWO B;  4RL2 A;  2BMI A;  3ZR9 A;  5FQB A;  5ACW A;  4HL2 A;  4H0D A;  3X2Y A;  3I15 A;  1ZTC A;  3RKJ A;  5ACT A;  5ACS A;  4NQ6 A;  5KIL A;  1XTO A;  5ACX A;  1DD6 A;  3KL7 A;  4DIL A;  2NXA A;  1JJE A;  2QDT A;  2I7X A;  2BG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...