5AXRA

Crystal structure of metallo-beta-lactamase smb-1 bound to 2-mercaptoethanesulfonate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to 2-mercaptoethanesulfonate
rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5axrA00
5AXOA 3G1PA 5HH6A 2BTNA 3DHAA 2NXAA 1VJNA 3ZQ4A 2WYMA 4EYFA 3IDZA 5ACVA 4WD6A 4XWWA 4Z5ZA 2BFZA 5AHRA 2I7TA 1XTOA 4DIKA 4HL1A 5AHOA 5LCAA 2YNVA 3SBLA 4J5HA 2P18A 5KILA 3I13A 5FQBA 5K4KA 5ACUA 3I11A 1K07A 1X8HA 2AIOA 1BMCA 4F6ZA 4D02A 4NQ2A 5EV6A 1HLKA 5LM6A 2WYMC 1SMLA 4ZO2A 2UYXA 4RAMA 2P97A 1BC2A 2DOOA 4NQ6A 3ZNBA 4C1CA 4C1FA 2R2DA 2FU8A 3BK1A 2GFKA 1DXKA 2FM6A 4H0DA 4D1WA 4C09A 2XF4A 3RKJA 3KNSA 4C1EA 3IOFA 5B3RA 1DD6A 4RM5A 4TZBA 4D1TA 4D1UA 3S0ZA 2FHXB 4F6HA 1P9EA 1YCFA 4AWZA 2FK6A 2H6AA 4O98A 4AWYB 3RKKA 2FU9A 3H3EA 1A7TA 4LE6A 5ACXA 2BC2A 4FEKA 4KEPA 5ACPA 2OHHA 1MQOA 5AYAA 4BP0A 2QINA 1X8GA 2I7XA 5EHTA 5EV8A 1WRAA 2BG7A 5HH5A 3IE1A 5A5ZA 2FHXA 4XUKA 2WHGA 2OHIA 2BMIA 5ACQA 4Z6XA 2ZWRA 3BK2A 3PY6A 5EVDA 3MD7A 2E7YA 4RL2A 2P4ZA 4TYTA 2WYLA 4Z60A 2NZFA 2BR6A 2QDSA 4UWSB 2Y8BA 2Q0JA 1DDKA 4GYUA 4AX1B 3IE2A 2P1EA 4XWTA 5LSCA 3X30A 4C1GA 1WUOA 2BG8B 2QDTA 4AX0B 2VW8A 1JJTA 2YZ3A 3PY5A 4ZO3A 3VPEA 3SRXA 2GFJA 3WXCA 4ZNBA 2FU6A 3FAIA 1VMEA 4UWPB 1X8IA 4ZEJA 5AXRA 4EYLA 1YCGA 4RBSA 2YNVB 2CBNA 2BG2A 2NZEA 5HISA 4B87A 2Q42A 2QJSA 3AF5A 4UWRB 1JT1A 5HH4A 2QEDA 2BFZB 4YSBA 4DILA 1VGNA 2YNTA 5A0TA 4BZ3A 5LMCA 2XR1A 5ACRA 2GKLA 2DKFA 2I7VA 2YCBA 4EFZA 5DPXA 4TYFA 2BGAA 1L9YA 3BV6A 2ZNBA 5LS3A 5A87A 3P2UA 4J5FA 4PVOA 5K0WA 2ZO4A 3DHBA 4V0HA 1XM8A 4Z67A 3L6NA 4RAWA 4D1VA 3TP9A 5EVKA 3F9OA 5KIKA 2Y8AA 3I15A 4EXYA 2Q9UA 5ACSA 1WW1A 3QH8A 3T3NA 3ZR9A 5LLDA 3AJ3A 1QH3A 3FCZA 1ZNBA 1Y44A 4EY2A 3SW3A 4AD9A 4NQ5A 1YCHA 5HIQA 4TZFA 3KNRA 1KR3A 4TZEA 4FR7A 5EW0A 3I0VA 2HB9A 2Y87A 1KO3A 3A4YA 1JJEA 4UA4A 5LCFA 3R2UA 4FSBA 2NYPA 4EXSA 4RL0A 1ZTCA 5EVBA 1WUPA 3DH8A 2Q0IA 3SD9A 4C1HA 3SFPA 2BG6A 4GYQA 4Z5YA 5FQAA 3SPUA 2A7MA 2M5DA 3IEKA 1KO2A 5LE1A 2GCUA 4UAMA 5HIOA 3X2YA 5LCHA 2ZZIA 2BIBA 3ZWFA 3IELA 5ACWA 2YNTB 2AZ4A 4YSKA 3T9MA 4HKYA 4GCWA 4P62A 4U4LA 3JXPA 4Z7RA 4KEQA 5K4NA 5K4MA 2WRSA 5AEBA 4UBQA 3IOGA 4NQ4A 3ESHA 4PVTA 2M5CA 3DHCA 5A0VA 5HIPA 4JO0A 3KL7A 4UWOB 3Q6VA 5B1UA 2BG8A 3IEMA 2FU7A 1QH5A 3VQZA 3BC2A 3I14A 4TZ9A 3X2ZA 5EWAA 3T3OA 5B15A 3RPCA 5EH9A 2BFKA 1M2XA 2YNWA 1A8TA 3IE0A 3LVZA 2YNUA 1ZKPA 2BFLA 5IQKA 4EYBA 1E5DA 3AF6A 4C1DA 3ADRA 5ACTA 5FQCA 3X2XA 4HL2A 4YSLA 1BVTA 2GMNA 4CHLA 3PG4A 2OHJA
chains in the Genus database with same CATH superfamily
5AXOA 3G1PA 5HH6A 2BTNA 3DHAA 2NXAA 1VJNA 3ZQ4A 2WYMA 4EYFA 3IDZA 5ACVA 4WD6A 5A23A 4XWWA 4Z5ZA 2BFZA 5AHRA 2I7TA 1XTOA 4DIKA 4HL1A 5AHOA 5LCAA 2YNVA 3SBLA 4J5HA 2P18A 5KILA 3I13A 2CFUA 5FQBA 5K4KA 5ACUA 3I11A 1K07A 1X8HA 2AIOA 1BMCA 4F6ZA 4D02A 4NQ2A 5EV6A 1HLKA 5LM6A 2WYMC 1SMLA 4ZO2A 2UYXA 4RAMA 2P97A 1BC2A 2DOOA 4NQ6A 3ZNBA 4C1CA 4C1FA 2R2DA 2FU8A 3BK1A 2FM6A 2GFKA 1DXKA 4H0DA 4D1WA 4C09A 2XF4A 3RKJA 3KNSA 2YHEA 4C1EA 3IOFA 5B3RA 1DD6A 4RM5A 4TZBA 4D1TA 4D1UA 3S0ZA 2FHXB 4F6HA 1P9EA 1YCFA 4AV7A 4AWZA 2FK6A 2H6AA 4O98A 4AWYB 3RKKA 2FU9A 3H3EA 1A7TA 4LE6A 5ACXA 2BC2A 4FEKA 4KEPA 5ACPA 2OHHA 1MQOA 5AYAA 4BP0A 2QINA 1X8GA 2I7XA 5EHTA 5EV8A 1WRAA 2BG7A 5HH5A 3IE1A 5A5ZA 2FHXA 4XUKA 2WHGA 2OHIA 2BMIA 5ACQA 4Z6XA 2ZWRA 3BK2A 3PY6A 5EVDA 3MD7A 2E7YA 4RL2A 2P4ZA 4TYTA 2WYLA 4Z60A 2NZFA 2BR6A 2QDSA 4UWSB 2Y8BA 2Q0JA 1DDKA 4GYUA 4AX1B 3IE2A 2P1EA 4XWTA 5LSCA 3X30A 4C1GA 1WUOA 2BG8B 2QDTA 4AX0B 2VW8A 1JJTA 2YZ3A 3PY5A 4ZO3A 3VPEA 3SRXA 2GFJA 3WXCA 4ZNBA 2FU6A 3FAIA 1VMEA 4UWPB 1X8IA 4ZEJA 5AXRA 4EYLA 1YCGA 4RBSA 2YNVB 2CBNA 2BG2A 2NZEA 5HISA 4B87A 2Q42A 2QJSA 3AF5A 4UWRB 1JT1A 5HH4A 2QEDA 2BFZB 5AIJA 4YSBA 4DILA 1VGNA 2YNTA 5A0TA 4BZ3A 5LMCA 2XR1A 5ACRA 2GKLA 2DKFA 2I7VA 2YCBA 4EFZA 5DPXA 4TYFA 2BGAA 1L9YA 3BV6A 2ZNBA 5LS3A 5A87A 3P2UA 4J5FA 4NURA 4PVOA 5K0WA 2ZO4A 3DHBA 4V0HA 1XM8A 4D1VA 4Z67A 3L6NA 4RAWA 3TP9A 2CG3A 5EVKA 5AJLA 3F9OA 5KIKA 2Y8AA 3I15A 4EXYA 2Q9UA 5ACSA 1WW1A 3QH8A 3T3NA 3ZR9A 5LLDA 3AJ3A 1QH3A 3FCZA 1ZNBA 1Y44A 4EY2A 3SW3A 4AD9A 4NQ5A 1YCHA 5HIQA 4TZFA 3KNRA 1KR3A 4TZEA 4FR7A 5EW0A 3I0VA 2HB9A 2Y87A 1KO3A 3A4YA 1JJEA 4UA4A 5LCFA 3R2UA 4FSBA 2NYPA 4EXSA 4RL0A 1ZTCA 5EVBA 1WUPA 3DH8A 2Q0IA 3SD9A 4C1HA 3SFPA 2BG6A 4GYQA 4Z5YA 5FQAA 3SPUA 2A7MA 2M5DA 3IEKA 1KO2A 5LE1A 2GCUA 4UAMA 5HIOA 3X2YA 5LCHA 2ZZIA 2BIBA 3ZWFA 3IELA 5ACWA 2YNTB 2AZ4A 4YSKA 3T9MA 4HKYA 4GCWA 4P62A 4U4LA 3JXPA 4Z7RA 4KEQA 5K4NA 5K4MA 2WRSA 5AEBA 4UBQA 3IOGA 4NQ4A 3ESHA 4PVTA 2M5CA 3DHCA 4PDXA 5A0VA 5HIPA 4JO0A 3KL7A 4UWOB 3Q6VA 5B1UA 2BG8A 3IEMA 2FU7A 1QH5A 3VQZA 3BC2A 3I14A 4TZ9A 3X2ZA 4AXHA 5EWAA 3T3OA 5B15A 3RPCA 2CG2A 5EH9A 2BFKA 1M2XA 2YNWA 1A8TA 3IE0A 3LVZA 2YNUA 1ZKPA 2BFLA 2CFZA 5IQKA 4EYBA 1E5DA 3AF6A 4C1DA 3ADRA 5ACTA 5FQCA 3X2XA 4HL2A 4YSLA 1BVTA 2GMNA 4CHLA 3PG4A 2OHJA
chains in the Genus database with same CATH topology
5AXOA 3G1PA 5HH6A 2BTNA 3DHAA 2NXAA 1VJNA 3ZQ4A 2WYMA 4EYFA 3IDZA 5ACVA 4WD6A 4XWWA 4Z5ZA 2BFZA 5AHRA 2I7TA 1XTOA 4DIKA 4HL1A 5AHOA 5LCAA 2YNVA 3SBLA 4J5HA 2P18A 5KILA 3I13A 5FQBA 5K4KA 5ACUA 3I11A 1K07A 1X8HA 2AIOA 1BMCA 4F6ZA 4D02A 4NQ2A 5EV6A 1HLKA 5LM6A 2WYMC 1SMLA 4ZO2A 2UYXA 4RAMA 2P97A 1BC2A 2DOOA 4NQ6A 3ZNBA 4C1CA 4C1FA 2R2DA 2FU8A 3BK1A 2GFKA 1DXKA 2FM6A 4H0DA 4D1WA 4C09A 2XF4A 3RKJA 3KNSA 4C1EA 3IOFA 5B3RA 1DD6A 4RM5A 4TZBA 4D1TA 4D1UA 3S0ZA 2FHXB 4F6HA 1P9EA 1YCFA 4AWZA 2FK6A 2H6AA 4O98A 4AWYB 3RKKA 2FU9A 3H3EA 1A7TA 4LE6A 5ACXA 2BC2A 4FEKA 4KEPA 5ACPA 2OHHA 1MQOA 5AYAA 4BP0A 2QINA 1X8GA 2I7XA 5EHTA 5EV8A 1WRAA 2BG7A 5HH5A 3IE1A 5A5ZA 2FHXA 4XUKA 2WHGA 2OHIA 2BMIA 5ACQA 4Z6XA 2ZWRA 3BK2A 3PY6A 5EVDA 3MD7A 2E7YA 4RL2A 2P4ZA 4TYTA 2WYLA 4Z60A 2NZFA 2BR6A 2QDSA 4UWSB 2Y8BA 2Q0JA 1DDKA 4GYUA 4AX1B 3IE2A 2P1EA 4XWTA 5LSCA 3X30A 4C1GA 1WUOA 2BG8B 2QDTA 4AX0B 2VW8A 1JJTA 2YZ3A 3PY5A 4ZO3A 3VPEA 3SRXA 2GFJA 3WXCA 4ZNBA 2FU6A 3FAIA 1VMEA 4UWPB 1X8IA 4ZEJA 5AXRA 4EYLA 1YCGA 4RBSA 2YNVB 2CBNA 2BG2A 2NZEA 5HISA 4B87A 2Q42A 2QJSA 3AF5A 4UWRB 1JT1A 5HH4A 2QEDA 2BFZB 4YSBA 4DILA 1VGNA 2YNTA 5A0TA 4BZ3A 5LMCA 2XR1A 5ACRA 2GKLA 2DKFA 2I7VA 2YCBA 4EFZA 5DPXA 4TYFA 2BGAA 1L9YA 3BV6A 2ZNBA 5LS3A 5A87A 3P2UA 4J5FA 4PVOA 5K0WA 2ZO4A 3DHBA 4V0HA 1XM8A 4Z67A 3L6NA 4RAWA 4D1VA 3TP9A 5EVKA 3F9OA 5KIKA 2Y8AA 3I15A 4EXYA 2Q9UA 5ACSA 1WW1A 3QH8A 3T3NA 3ZR9A 5LLDA 3AJ3A 1QH3A 3FCZA 1ZNBA 1Y44A 4EY2A 3SW3A 4AD9A 4NQ5A 1YCHA 5HIQA 4TZFA 3KNRA 1KR3A 4TZEA 4FR7A 5EW0A 3I0VA 2HB9A 2Y87A 1KO3A 3A4YA 1JJEA 4UA4A 5LCFA 3R2UA 4FSBA 2NYPA 4EXSA 4RL0A 1ZTCA 5EVBA 1WUPA 3DH8A 2Q0IA 3SD9A 4C1HA 3SFPA 2BG6A 4GYQA 4Z5YA 5FQAA 3SPUA 2A7MA 2M5DA 3IEKA 1KO2A 5LE1A 2GCUA 4UAMA 5HIOA 3X2YA 5LCHA 2ZZIA 2BIBA 3ZWFA 3IELA 5ACWA 2YNTB 2AZ4A 4YSKA 3T9MA 4HKYA 4GCWA 4P62A 4U4LA 3JXPA 4Z7RA 4KEQA 5K4NA 5K4MA 2WRSA 5AEBA 4UBQA 3IOGA 4NQ4A 3ESHA 4PVTA 2M5CA 3DHCA 5A0VA 5HIPA 4JO0A 3KL7A 4UWOB 3Q6VA 5B1UA 2BG8A 3IEMA 2FU7A 1QH5A 3VQZA 3BC2A 3I14A 4TZ9A 3X2ZA 5EWAA 3T3OA 5B15A 3RPCA 5EH9A 2BFKA 1M2XA 2YNWA 1A8TA 3IE0A 3LVZA 2YNUA 1ZKPA 2BFLA 5IQKA 4EYBA 1E5DA 3AF6A 4C1DA 3ADRA 5ACTA 5FQCA 3X2XA 4HL2A 4YSLA 1BVTA 2GMNA 4CHLA 3PG4A 2OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AXO A;  3G1P A;  5HH6 A;  2BTN A;  3DHA A;  2NXA A;  1VJN A;  3ZQ4 A;  2WYM A;  4EYF A;  3IDZ A;  5ACV A;  4WD6 A;  4XWW A;  4Z5Z A;  2BFZ A;  5AHR A;  2I7T A;  1XTO A;  4DIK A;  4HL1 A;  5AHO A;  5LCA A;  2YNV A;  3SBL A;  4J5H A;  2P18 A;  5KIL A;  3I13 A;  5FQB A;  5K4K A;  5ACU A;  3I11 A;  1K07 A;  1X8H A;  2AIO A;  1BMC A;  4F6Z A;  4D02 A;  4NQ2 A;  5EV6 A;  1HLK A;  5LM6 A;  2WYM C;  1SML A;  4ZO2 A;  2UYX A;  4RAM A;  2P97 A;  1BC2 A;  2DOO A;  4NQ6 A;  3ZNB A;  4C1C A;  4C1F A;  2R2D A;  2FU8 A;  3BK1 A;  2GFK A;  1DXK A;  2FM6 A;  4H0D A;  4D1W A;  4C09 A;  2XF4 A;  3RKJ A;  3KNS A;  4C1E A;  3IOF A;  5B3R A;  1DD6 A;  4RM5 A;  4TZB A;  4D1T A;  4D1U A;  3S0Z A;  2FHX B;  4F6H A;  1P9E A;  1YCF A;  4AWZ A;  2FK6 A;  2H6A A;  4O98 A;  4AWY B;  3RKK A;  2FU9 A;  3H3E A;  1A7T A;  4LE6 A;  5ACX A;  2BC2 A;  4FEK A;  4KEP A;  5ACP A;  2OHH A;  1MQO A;  5AYA A;  4BP0 A;  2QIN A;  1X8G A;  2I7X A;  5EHT A;  5EV8 A;  1WRA A;  2BG7 A;  5HH5 A;  3IE1 A;  5A5Z A;  2FHX A;  4XUK A;  2WHG A;  2OHI A;  2BMI A;  5ACQ A;  4Z6X A;  2ZWR A;  3BK2 A;  3PY6 A;  5EVD A;  3MD7 A;  2E7Y A;  4RL2 A;  2P4Z A;  4TYT A;  2WYL A;  4Z60 A;  2NZF A;  2BR6 A;  2QDS A;  4UWS B;  2Y8B A;  2Q0J A;  1DDK A;  4GYU A;  4AX1 B;  3IE2 A;  2P1E A;  4XWT A;  5LSC A;  3X30 A;  4C1G A;  1WUO A;  2BG8 B;  2QDT A;  4AX0 B;  2VW8 A;  1JJT A;  2YZ3 A;  3PY5 A;  4ZO3 A;  3VPE A;  3SRX A;  2GFJ A;  3WXC A;  4ZNB A;  2FU6 A;  3FAI A;  1VME A;  4UWP B;  1X8I A;  4ZEJ A;  5AXR A;  4EYL A;  1YCG A;  4RBS A;  2YNV B;  2CBN A;  2BG2 A;  2NZE A;  5HIS A;  4B87 A;  2Q42 A;  2QJS A;  3AF5 A;  4UWR B;  1JT1 A;  5HH4 A;  2QED A;  2BFZ B;  4YSB A;  4DIL A;  1VGN A;  2YNT A;  5A0T A;  4BZ3 A;  5LMC A;  2XR1 A;  5ACR A;  2GKL A;  2DKF A;  2I7V A;  2YCB A;  4EFZ A;  5DPX A;  4TYF A;  2BGA A;  1L9Y A;  3BV6 A;  2ZNB A;  5LS3 A;  5A87 A;  3P2U A;  4J5F A;  4PVO A;  5K0W A;  2ZO4 A;  3DHB A;  4V0H A;  1XM8 A;  4Z67 A;  3L6N A;  4RAW A;  4D1V A;  3TP9 A;  5EVK A;  3F9O A;  5KIK A;  2Y8A A;  3I15 A;  4EXY A;  2Q9U A;  5ACS A;  1WW1 A;  3QH8 A;  3T3N A;  3ZR9 A;  5LLD A;  3AJ3 A;  1QH3 A;  3FCZ A;  1ZNB A;  1Y44 A;  4EY2 A;  3SW3 A;  4AD9 A;  4NQ5 A;  1YCH A;  5HIQ A;  4TZF A;  3KNR A;  1KR3 A;  4TZE A;  4FR7 A;  5EW0 A;  3I0V A;  2HB9 A;  2Y87 A;  1KO3 A;  3A4Y A;  1JJE A;  4UA4 A;  5LCF A;  3R2U A;  4FSB A;  2NYP A;  4EXS A;  4RL0 A;  1ZTC A;  5EVB A;  1WUP A;  3DH8 A;  2Q0I A;  3SD9 A;  4C1H A;  3SFP A;  2BG6 A;  4GYQ A;  4Z5Y A;  5FQA A;  3SPU A;  2A7M A;  2M5D A;  3IEK A;  1KO2 A;  5LE1 A;  2GCU A;  4UAM A;  5HIO A;  3X2Y A;  5LCH A;  2ZZI A;  2BIB A;  3ZWF A;  3IEL A;  5ACW A;  2YNT B;  2AZ4 A;  4YSK A;  3T9M A;  4HKY A;  4GCW A;  4P62 A;  4U4L A;  3JXP A;  4Z7R A;  4KEQ A;  5K4N A;  5K4M A;  2WRS A;  5AEB A;  4UBQ A;  3IOG A;  4NQ4 A;  3ESH A;  4PVT A;  2M5C A;  3DHC A;  5A0V A;  5HIP A;  4JO0 A;  3KL7 A;  4UWO B;  3Q6V A;  5B1U A;  2BG8 A;  3IEM A;  2FU7 A;  1QH5 A;  3VQZ A;  3BC2 A;  3I14 A;  4TZ9 A;  3X2Z A;  5EWA A;  3T3O A;  5B15 A;  3RPC A;  5EH9 A;  2BFK A;  1M2X A;  2YNW A;  1A8T A;  3IE0 A;  3LVZ A;  2YNU A;  1ZKP A;  2BFL A;  5IQK A;  4EYB A;  1E5D A;  3AF6 A;  4C1D A;  3ADR A;  5ACT A;  5FQC A;  3X2X A;  4HL2 A;  4YSL A;  1BVT A;  2GMN A;  4CHL A;  3PG4 A;  2OHJ A; 
#chains in the Genus database with same CATH topology
 5AXO A;  3G1P A;  5HH6 A;  2BTN A;  3DHA A;  2NXA A;  1VJN A;  3ZQ4 A;  2WYM A;  4EYF A;  3IDZ A;  5ACV A;  4WD6 A;  5A23 A;  4XWW A;  4Z5Z A;  2BFZ A;  5AHR A;  2I7T A;  1XTO A;  4DIK A;  4HL1 A;  5AHO A;  5LCA A;  2YNV A;  3SBL A;  4J5H A;  2P18 A;  5KIL A;  3I13 A;  2CFU A;  5FQB A;  5K4K A;  5ACU A;  3I11 A;  1K07 A;  1X8H A;  2AIO A;  1BMC A;  4F6Z A;  4D02 A;  4NQ2 A;  5EV6 A;  1HLK A;  5LM6 A;  2WYM C;  1SML A;  4ZO2 A;  2UYX A;  4RAM A;  2P97 A;  1BC2 A;  2DOO A;  4NQ6 A;  3ZNB A;  4C1C A;  4C1F A;  2R2D A;  2FU8 A;  3BK1 A;  2FM6 A;  2GFK A;  1DXK A;  4H0D A;  4D1W A;  4C09 A;  2XF4 A;  3RKJ A;  3KNS A;  2YHE A;  4C1E A;  3IOF A;  5B3R A;  1DD6 A;  4RM5 A;  4TZB A;  4D1T A;  4D1U A;  3S0Z A;  2FHX B;  4F6H A;  1P9E A;  1YCF A;  4AV7 A;  4AWZ A;  2FK6 A;  2H6A A;  4O98 A;  4AWY B;  3RKK A;  2FU9 A;  3H3E A;  1A7T A;  4LE6 A;  5ACX A;  2BC2 A;  4FEK A;  4KEP A;  5ACP A;  2OHH A;  1MQO A;  5AYA A;  4BP0 A;  2QIN A;  1X8G A;  2I7X A;  5EHT A;  5EV8 A;  1WRA A;  2BG7 A;  5HH5 A;  3IE1 A;  5A5Z A;  2FHX A;  4XUK A;  2WHG A;  2OHI A;  2BMI A;  5ACQ A;  4Z6X A;  2ZWR A;  3BK2 A;  3PY6 A;  5EVD A;  3MD7 A;  2E7Y A;  4RL2 A;  2P4Z A;  4TYT A;  2WYL A;  4Z60 A;  2NZF A;  2BR6 A;  2QDS A;  4UWS B;  2Y8B A;  2Q0J A;  1DDK A;  4GYU A;  4AX1 B;  3IE2 A;  2P1E A;  4XWT A;  5LSC A;  3X30 A;  4C1G A;  1WUO A;  2BG8 B;  2QDT A;  4AX0 B;  2VW8 A;  1JJT A;  2YZ3 A;  3PY5 A;  4ZO3 A;  3VPE A;  3SRX A;  2GFJ A;  3WXC A;  4ZNB A;  2FU6 A;  3FAI A;  1VME A;  4UWP B;  1X8I A;  4ZEJ A;  5AXR A;  4EYL A;  1YCG A;  4RBS A;  2YNV B;  2CBN A;  2BG2 A;  2NZE A;  5HIS A;  4B87 A;  2Q42 A;  2QJS A;  3AF5 A;  4UWR B;  1JT1 A;  5HH4 A;  2QED A;  2BFZ B;  5AIJ A;  4YSB A;  4DIL A;  1VGN A;  2YNT A;  5A0T A;  4BZ3 A;  5LMC A;  2XR1 A;  5ACR A;  2GKL A;  2DKF A;  2I7V A;  2YCB A;  4EFZ A;  5DPX A;  4TYF A;  2BGA A;  1L9Y A;  3BV6 A;  2ZNB A;  5LS3 A;  5A87 A;  3P2U A;  4J5F A;  4NUR A;  4PVO A;  5K0W A;  2ZO4 A;  3DHB A;  4V0H A;  1XM8 A;  4D1V A;  4Z67 A;  3L6N A;  4RAW A;  3TP9 A;  2CG3 A;  5EVK A;  5AJL A;  3F9O A;  5KIK A;  2Y8A A;  3I15 A;  4EXY A;  2Q9U A;  5ACS A;  1WW1 A;  3QH8 A;  3T3N A;  3ZR9 A;  5LLD A;  3AJ3 A;  1QH3 A;  3FCZ A;  1ZNB A;  1Y44 A;  4EY2 A;  3SW3 A;  4AD9 A;  4NQ5 A;  1YCH A;  5HIQ A;  4TZF A;  3KNR A;  1KR3 A;  4TZE A;  4FR7 A;  5EW0 A;  3I0V A;  2HB9 A;  2Y87 A;  1KO3 A;  3A4Y A;  1JJE A;  4UA4 A;  5LCF A;  3R2U A;  4FSB A;  2NYP A;  4EXS A;  4RL0 A;  1ZTC A;  5EVB A;  1WUP A;  3DH8 A;  2Q0I A;  3SD9 A;  4C1H A;  3SFP A;  2BG6 A;  4GYQ A;  4Z5Y A;  5FQA A;  3SPU A;  2A7M A;  2M5D A;  3IEK A;  1KO2 A;  5LE1 A;  2GCU A;  4UAM A;  5HIO A;  3X2Y A;  5LCH A;  2ZZI A;  2BIB A;  3ZWF A;  3IEL A;  5ACW A;  2YNT B;  2AZ4 A;  4YSK A;  3T9M A;  4HKY A;  4GCW A;  4P62 A;  4U4L A;  3JXP A;  4Z7R A;  4KEQ A;  5K4N A;  5K4M A;  2WRS A;  5AEB A;  4UBQ A;  3IOG A;  4NQ4 A;  3ESH A;  4PVT A;  2M5C A;  3DHC A;  4PDX A;  5A0V A;  5HIP A;  4JO0 A;  3KL7 A;  4UWO B;  3Q6V A;  5B1U A;  2BG8 A;  3IEM A;  2FU7 A;  1QH5 A;  3VQZ A;  3BC2 A;  3I14 A;  4TZ9 A;  3X2Z A;  4AXH A;  5EWA A;  3T3O A;  5B15 A;  3RPC A;  2CG2 A;  5EH9 A;  2BFK A;  1M2X A;  2YNW A;  1A8T A;  3IE0 A;  3LVZ A;  2YNU A;  1ZKP A;  2BFL A;  2CFZ A;  5IQK A;  4EYB A;  1E5D A;  3AF6 A;  4C1D A;  3ADR A;  5ACT A;  5FQC A;  3X2X A;  4HL2 A;  4YSL A;  1BVT A;  2GMN A;  4CHL A;  3PG4 A;  2OHJ A; 
#chains in the Genus database with same CATH homology
 5AXO A;  3G1P A;  5HH6 A;  2BTN A;  3DHA A;  2NXA A;  1VJN A;  3ZQ4 A;  2WYM A;  4EYF A;  3IDZ A;  5ACV A;  4WD6 A;  4XWW A;  4Z5Z A;  2BFZ A;  5AHR A;  2I7T A;  1XTO A;  4DIK A;  4HL1 A;  5AHO A;  5LCA A;  2YNV A;  3SBL A;  4J5H A;  2P18 A;  5KIL A;  3I13 A;  5FQB A;  5K4K A;  5ACU A;  3I11 A;  1K07 A;  1X8H A;  2AIO A;  1BMC A;  4F6Z A;  4D02 A;  4NQ2 A;  5EV6 A;  1HLK A;  5LM6 A;  2WYM C;  1SML A;  4ZO2 A;  2UYX A;  4RAM A;  2P97 A;  1BC2 A;  2DOO A;  4NQ6 A;  3ZNB A;  4C1C A;  4C1F A;  2R2D A;  2FU8 A;  3BK1 A;  2GFK A;  1DXK A;  2FM6 A;  4H0D A;  4D1W A;  4C09 A;  2XF4 A;  3RKJ A;  3KNS A;  4C1E A;  3IOF A;  5B3R A;  1DD6 A;  4RM5 A;  4TZB A;  4D1T A;  4D1U A;  3S0Z A;  2FHX B;  4F6H A;  1P9E A;  1YCF A;  4AWZ A;  2FK6 A;  2H6A A;  4O98 A;  4AWY B;  3RKK A;  2FU9 A;  3H3E A;  1A7T A;  4LE6 A;  5ACX A;  2BC2 A;  4FEK A;  4KEP A;  5ACP A;  2OHH A;  1MQO A;  5AYA A;  4BP0 A;  2QIN A;  1X8G A;  2I7X A;  5EHT A;  5EV8 A;  1WRA A;  2BG7 A;  5HH5 A;  3IE1 A;  5A5Z A;  2FHX A;  4XUK A;  2WHG A;  2OHI A;  2BMI A;  5ACQ A;  4Z6X A;  2ZWR A;  3BK2 A;  3PY6 A;  5EVD A;  3MD7 A;  2E7Y A;  4RL2 A;  2P4Z A;  4TYT A;  2WYL A;  4Z60 A;  2NZF A;  2BR6 A;  2QDS A;  4UWS B;  2Y8B A;  2Q0J A;  1DDK A;  4GYU A;  4AX1 B;  3IE2 A;  2P1E A;  4XWT A;  5LSC A;  3X30 A;  4C1G A;  1WUO A;  2BG8 B;  2QDT A;  4AX0 B;  2VW8 A;  1JJT A;  2YZ3 A;  3PY5 A;  4ZO3 A;  3VPE A;  3SRX A;  2GFJ A;  3WXC A;  4ZNB A;  2FU6 A;  3FAI A;  1VME A;  4UWP B;  1X8I A;  4ZEJ A;  5AXR A;  4EYL A;  1YCG A;  4RBS A;  2YNV B;  2CBN A;  2BG2 A;  2NZE A;  5HIS A;  4B87 A;  2Q42 A;  2QJS A;  3AF5 A;  4UWR B;  1JT1 A;  5HH4 A;  2QED A;  2BFZ B;  4YSB A;  4DIL A;  1VGN A;  2YNT A;  5A0T A;  4BZ3 A;  5LMC A;  2XR1 A;  5ACR A;  2GKL A;  2DKF A;  2I7V A;  2YCB A;  4EFZ A;  5DPX A;  4TYF A;  2BGA A;  1L9Y A;  3BV6 A;  2ZNB A;  5LS3 A;  5A87 A;  3P2U A;  4J5F A;  4PVO A;  5K0W A;  2ZO4 A;  3DHB A;  4V0H A;  1XM8 A;  4Z67 A;  3L6N A;  4RAW A;  4D1V A;  3TP9 A;  5EVK A;  3F9O A;  5KIK A;  2Y8A A;  3I15 A;  4EXY A;  2Q9U A;  5ACS A;  1WW1 A;  3QH8 A;  3T3N A;  3ZR9 A;  5LLD A;  3AJ3 A;  1QH3 A;  3FCZ A;  1ZNB A;  1Y44 A;  4EY2 A;  3SW3 A;  4AD9 A;  4NQ5 A;  1YCH A;  5HIQ A;  4TZF A;  3KNR A;  1KR3 A;  4TZE A;  4FR7 A;  5EW0 A;  3I0V A;  2HB9 A;  2Y87 A;  1KO3 A;  3A4Y A;  1JJE A;  4UA4 A;  5LCF A;  3R2U A;  4FSB A;  2NYP A;  4EXS A;  4RL0 A;  1ZTC A;  5EVB A;  1WUP A;  3DH8 A;  2Q0I A;  3SD9 A;  4C1H A;  3SFP A;  2BG6 A;  4GYQ A;  4Z5Y A;  5FQA A;  3SPU A;  2A7M A;  2M5D A;  3IEK A;  1KO2 A;  5LE1 A;  2GCU A;  4UAM A;  5HIO A;  3X2Y A;  5LCH A;  2ZZI A;  2BIB A;  3ZWF A;  3IEL A;  5ACW A;  2YNT B;  2AZ4 A;  4YSK A;  3T9M A;  4HKY A;  4GCW A;  4P62 A;  4U4L A;  3JXP A;  4Z7R A;  4KEQ A;  5K4N A;  5K4M A;  2WRS A;  5AEB A;  4UBQ A;  3IOG A;  4NQ4 A;  3ESH A;  4PVT A;  2M5C A;  3DHC A;  5A0V A;  5HIP A;  4JO0 A;  3KL7 A;  4UWO B;  3Q6V A;  5B1U A;  2BG8 A;  3IEM A;  2FU7 A;  1QH5 A;  3VQZ A;  3BC2 A;  3I14 A;  4TZ9 A;  3X2Z A;  5EWA A;  3T3O A;  5B15 A;  3RPC A;  5EH9 A;  2BFK A;  1M2X A;  2YNW A;  1A8T A;  3IE0 A;  3LVZ A;  2YNU A;  1ZKP A;  2BFL A;  5IQK A;  4EYB A;  1E5D A;  3AF6 A;  4C1D A;  3ADR A;  5ACT A;  5FQC A;  3X2X A;  4HL2 A;  4YSL A;  1BVT A;  2GMN A;  4CHL A;  3PG4 A;  2OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...