5AY8A

Crystal structure of human nucleosome containing h3.y
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8A00
3KUYA 1P34A 5GSUA 3W99C 3LZ0C 3AN2D 3WA9B 3WA9A 3AYWA 5AY8B 4YS3A 5AY8A 3AFAC 5GXQC 5CPIC 3AZID 4Z5TD 5B24C 4WNNA 2FJ7A 3R45B 5AV6C 2F8NH 3AV1C 5BS7A 3AZMC 3REKD 5GT0C 3KSYA 3UT9A 5E5AC 3WAAD 3X1VC 1A7WA 5B0YB 4H9RB 2JSSA 4H9RA 1P3PB 3V9RA 1P3PA 3WTPB 3MGQD 3WTPA 5KDMB 1Q9CA 5KDMA 1M1AB 4WU8A 3B0DC 1B67A 1P3KA 1P3FA 1EQZC 1F1EA 3X1TC 3B6FB 2HUEC 4Z2MG 3W98B 1F66D 3VH6T 3B6FA 3W96D 3W98A 4H9QB 4G91C 4H9QA 3X1SD 5F99B 4H9SC 1KU5A 3W97C 3AZEB 5B2ID 3AZEA 3B6GB 2F8NA 5B0YD 5B1MA 3KWQC 3C1CC 1R4VA 3AZJB 4H9PA 5C3IB 3VH6A 1TZYC 1WWSA 3W99A 3LZ0A 1N1JB 1P3IB 4ZBJC 1WWIA 1N1JA 1P3LC 1M1AD 3MGRC 4XUJB 5B0ZC 5DNMA 3AZKC 4XZQB 3AZLC 3AFAB 5GXQB 3AFAA 5GXQA 5CPIB 4QLCD 1P34C 2RVQC 5CPIA 5F99D 5B33B 5B24B 3RELB 2PYOD 3MVDC 3REHC 3MGPD 5AV6B 3AYWC 5AV6A 3B6GD 4YS3C 3AZMB 3AV1A 5GT0B 4ZUXC 5E5AB 3AZMA 5GT0A 3AZJD 3X1VB 5E5AA 5B40B 4DRAA 3X1VA 5AVCD 3B0BA 3C1BC 1P3ID 3NQUB 1ULYA 2FJ7C 3NQUA 4XUJD 5BS7C 1BFMA 5AVBD 4XZQD 3B0DB 3UT9C 1AOIA 1M19D 2HIOC 4H9OA 1EQZA 1ZLAC 2HUEB 3X1TA 5BNVB 3AZHC 5BNVA 5B33D 1P3AD 4G91B 4J8UD 1M18B 5B24D 5CP6D 3RELD 4R8PC 4J8XA 3WKJC 2YFWA 3W97B 4EO5C 3W97A 3VH5T 5BO0B 3TU4C 3X1UD 1P3KC 5B32G 4H9NB 5B31A 5B40D 3KWQB 3C1CB 3REJD 4H9NA 3KWQA 3C1CA 1KX4D 1TZYB 4HGAB 1TZYA 4ZBJB 4KHAA 1P3LB 1P3LA 3MGRA 5B0ZB 3AZKB 3AZLB 3VH5A 5B1MC 3AZKA 2CWEA 4CSRB 3B0CT 4DRBA 3AZGC 3A6ND 4CSRA 3O62C 5AV8C 4Z66D 3KUYB 1P34B 1M18D 3KXBD 3MGSC 1P3GD 4KGCD 1P3BC 3NQJB 4LD9C 3REHB 3NQJA 3MVDA 3REHA 3MNND 3AYWB 4J8WD 4YS3B 5DNNA 5DNMC 4KUDD 4ZUXB 4X23A 1P3MD 4ZUXA 1P3OA 5AV9D 1U35C 4E44A 3C1BB 3UTAC 3LZ1C 3C1BA 5B32D 1HQ3D 4WNNB 5B1LC 2FJ7B 5B2JD 1S32D 5B0ZD 1KX3C 5GT3C 3AZLD 2AROD 4J8VC 3REIA 5G49B 3UT9B 3AZFD 2HIOB 5G49A 5JRGC 1ZLAB 3KUYD 2HIOA 2RVQD 4AWLC 1P34D 5GSUD 3AZHB 1ZLAA 3V9RB 3AZHA 5CPJC 3WA9D 3WKJB 3AYWD 4R8PA 1TAFB 3WKJA 4YS3D 1TAFA 4EO5B 5AY8D 4WU8B 3TU4B 1AOIC 1P3KB 3TU4A 1P3FB 5CPKC 2F8NG 2FJ7D 4YM6C 4J8XC 2BYKB 2NQBC 2BYKA 5CHLB 4JJNC 1H3OA 3UT9D 2NZDA 2F8NB 3UTBC 5B1MB 5B31C 1ID3C 4H9PB 3O62B 1P3PD 3AZGA 2CV5C 3O62A 3MGSB 5AV8A 3WTPD 3MGSA 3LJAC 3LELC 3LZ0B 3W99B 1P3BB 3AZNC 4LD9B 5AV5C 1P3BA 5FUGA 4LD9A 4WU8D 1P3KD 1P3FD 5DNMB 4UUZB 3B6FD 4UUZA 3W98D 1U35B 1KX5A 1U35A 3AN2C 4NE6A 4WU9A 3UTAB 3LZ1B 3UTAA 3LZ1A 5B1LB 5B1LA 4NFTA 1KX3B 3AZED 5GT3B 3AV2A 2F8ND 5DNNC 3AV1B 1KX3A 5B1MD 5GT3A 4X23C 4J8VB 3AZIC 4J8VA 1P3OC 4Z5TC 4AWLB 5JRGA 5CPJB 3W99D 3LZ0D 5CPJA 3REKC 3WAAC 5DNMD 5BNXA 3REIC 1AOIB 3AFAD 5GXQD 4H9OB 1EQZB 3X1TB 5CPID 3MGQC 5CPKB 3B0CW 5CPKA 4YM6B 4J8XB 2YFWB 4YM6A 5AV6D 3AV1D 2NQBA 4JJNB 3AZMD 5GT0D 4JJNA 1F66C 5E5AD 3W96C 1ID3B 5B31B 3X1VD 3UTBA 1ID3A 3X1SC 2CV5B 2CV5A 2L5AA 3LJAB 3LELB 3LELA 3LJAA 4KHAB 3AZNB 5AV5B 3AZNA 5B2IC 5AV5A 3MGRB 5B0YC 2YFVB 1AOID 2NZDC 2YFVA 1EQZD 3X1TD 3AN2B 2LY8A 3AN2A 1M1AC 4J8XD 1B6WA 3MVDB 3W97D 5DNNB 5B31D 4X23B 4QLCC 3KWQD 3C1CD 1P3OB 3AZIA 5F99C 1KX5C 4Z5TA 1TZYD 4WU9C 2PYOC 3VH6W 3MGPC 1P3LD 3B6GC 3MGRD 3REKA 3AV2C 3WAAA 4NE3A 3REIB 3AZKD 2IO5C 5AVCC 1P3IC 3MGQB 2F8NK 5BT1C 3MGQA 4XUJC 4WZSB 3MVDD 4R8PB 3REHD 5AVBC 4XZQC 5DNND 1M19C 4X23D 4ZUXD 1F66B 1P3OD 3W96B 1F66A 5B33C 4G92C 3W96A 1P3AC 4J8UC 3X1SB 5CP6C 4Z2MH 3RELC 3X1SA 3C1BD 3R45A 3X1UC 5B2IB 5B2IA 5B40C 4E45A 1H3OB 3REID 2NZDB 5B0YA 3REJC 1KX4C 2HIOD 1ZLAD 5JA4B 5JA4A 3AZHD 3AZGB 5AV8B 2BYMB 1M1AA 4R8PD 2BYMA 3WKJD 5FUGB 3TU4D 3A6NC 4Z66C 4QLCB 1M18C 3KXBC 4KGCC 4QLCA 1P3GC 1KX5B 5F99A 4WU9B 2PYOB 2PYOA 3MGPB 3MNNC 3MGPA 4J8WC 4KUDC 3B6GA 1P3MC 2NZDD 3AV2B 3AZJA 5AV9C 2IO5B 3VH5W 4HGAC 5AVCB 3AZGD 5JRGB 3O62D 5AVCA 5AV8D 1P3IA 5B32C 1HQ3C 4CAYB 3MGSD 4CAYA 4XUJA 5B2JC 1S32C 1P3BD 4LD9D 2AROC 5AVBB 4XZQA 5AVBA 3AZFC 1M19B 5BNXB 1M19A 3KUYC 5GSUC 1P3AB 4G92B 1KX5D 1U35D 5B33A 4J8UB 1P3AA 5CP6B 4WU9D 4J8UA 3WA9C 5B24A 5CP6A 3RELA 3UTAD 3LZ1D 5B31G 4NE5A 5B1LD 5AY8C 4M6BA 3X1UB 3AV2D 1KX3D 3X1UA 5GT3D 2NQBB 5B40A 3REJB 4J8VD 3REJA 1KX4B 5JRGD 3UTBB 1KX4A 5BT1D 3WTPE 5CPJD 1BH9B 1BH9A 3A6NB 1P3PC 4Z66B 3A6NA 4KGCB 1BH8B 3KXBB 4Z66A 1P3GB 3WTPC 1M18A 1BH8A 3KXBA 5CPKD 1P3GA 4KGCA 1HTAA 4WV4B 4H9SA 4WU8C 4YM6D 3MNNB 1JFIB 4J8WB 3MNNA 5BO0A 1P3FC 1JFIA 2NQBD 4KUDB 4J8WA 1P3MB 4KUDA 4JJND 1P3MA 3B6FC 3W98C 5AV9B 3UTBD 1ID3D 5AV9A 3AZIB 4Z5TB 2CV5D 5B32B 1HQ3B 5B32A 1HQ3A 3LJAD 3LELD 5B2JB 1S32B 3AZND 3AZEC 5B2JA 5AV5D 5B0ZA 1S32A 2AROB 3AZLA 2AROA 3AZFB 3REKB 3AZFA 3AZJC 3WAAB 5C3IC 5GSUB
chains in the Genus database with same CATH superfamily
3KUYA 1P34A 5GSUA 3W99C 3LZ0C 3AN2D 3WA9B 3WA9A 2XD5A 3AYWA 2Y2PA 2G5HC 5AY8B 4YS3A 5AY8A 3AFAC 5GXQC 5CPIC 3AZID 4Z5TD 2Y2NA 5B24C 4WNNA 2FJ7A 3R45B 5AV6C 2F8NH 3AV1C 5BS7A 3AZMC 3REKD 5GT0C 3KSYA 3UT9A 5E5AC 3WAAD 3X1VC 1A7WA 5B0YB 4H9RB 2JSSA 4H9RA 1P3PB 3V9RA 1P3PA 3WTPB 3MGQD 3WTPA 5KDMB 1Q9CA 5KDMA 1M1AB 4WU8A 3B0DC 1B67A 1P3KA 1P3FA 1EQZC 1F1EA 3X1TC 3B6FB 2HUEC 4Z2MG 3W98B 1F66D 3VH6T 3B6FA 3W96D 3W98A 4H9QB 4G91C 4H9QA 3X1SD 5F99B 4H9SC 1KU5A 3W97C 3AZEB 5B2ID 3AZEA 3B6GB 2RIQA 2F8NA 5B0YD 5B1MA 3KWQC 3C1CC 1R4VA 3AZJB 4H9PA 5C3IB 1PZRA 3VH6A 1TZYC 3EPKA 1WWSA 3W99A 3LZ0A 1N1JB 1P3IB 4ZBJC 1WWIA 1N1JA 1P3LC 1M1AD 3MGRC 4XUJB 5B0ZC 4DQYB 5DNMA 3AZKC 4XZQB 3AZLC 3AFAB 5GXQB 3AFAA 5GXQA 5CPIB 4QLCD 1P34C 2RVQC 5CPIA 5F99D 5B33B 2JE5A 5B24B 3RELB 2PYOD 3MVDC 3REHC 3MGPD 5AV6B 3AYWC 5AV6A 3B6GD 4YS3C 3AZMB 3AV1A 5GT0B 4ZUXC 5E5AB 3AZMA 5GT0A 3AZJD 1W2EA 3X1VB 5E5AA 5B40B 4DRAA 3X1VA 5AVCD 3B0BA 3C1BC 1P3ID 3NQUB 1ULYA 2FJ7C 3NQUA 4XUJD 5BS7C 1BFMA 5AVBD 4XZQD 3B0DB 3UT9C 1AOIA 1M19D 2HIOC 4H9OA 1EQZA 1ZLAC 2HUEB 3X1TA 5BNVB 3AZHC 5BNVA 5B33D 1P3AD 4G91B 4J8UD 1M18B 5B24D 5CP6D 3RELD 4R8PC 4J8XA 3WKJC 2YFWA 3W97B 4EO5C 3W97A 3VH5T 5BO0B 3TU4C 3X1UD 3EPLA 1P3KC 5B32G 4H9NB 5B31A 5B40D 3KWQB 3C1CB 3REJD 4H9NA 3KWQA 3C1CA 1KX4D 1TZYB 4HGAB 1TZYA 4ZBJB 4KHAA 1P3LB 1P3LA 3MGRA 3FDDA 5B0ZB 3AZKB 3AZLB 3VH5A 5B1MC 3AZKA 2CWEA 4CSRB 3B0CT 4DRBA 3AZGC 3A6ND 4CSRA 2Y2IA 3O62C 5AV8C 4Z66D 3KUYB 1P34B 1M18D 3KXBD 3MGSC 1P3GD 4KGCD 1P3BC 2F2AC 3NQJB 4LD9C 3REHB 3NQJA 3MVDA 3REHA 3MNND 3AYWB 4J8WD 4YS3B 5DNNA 5DNMC 4KUDD 4ZUXB 4X23A 1P3MD 3KFUG 4ZUXA 1P3OA 5AV9D 1U35C 2ZY2A 4E44A 3C1BB 3UTAC 3LZ1C 3C1BA 5B32D 1HQ3D 4WNNB 5B1LC 2FJ7B 5B2JD 1S32D 5B0ZD 1KX3C 5GT3C 3AZLD 2AROD 4J8VC 3REIA 5G49B 3UT9B 3AZFD 2HIOB 5G49A 5JRGC 1ZLAB 3KUYD 2HIOA 2RVQD 4AWLC 1P34D 5GSUD 2W8SA 3AZHB 1ZLAA 3V9RB 3AZHA 5CPJC 3WA9D 3WKJB 3AYWD 4R8PA 1TAFB 3WKJA 4YS3D 1TAFA 4EO5B 5AY8D 4WU8B 3TU4B 1AOIC 1P3KB 3TU4A 1P3FB 3EG5B 5CPKC 2F8NG 2FJ7D 4YM6C 4J8XC 2BYKB 2NQBC 2BYKA 5CHLB 3P5JB 4JJNC 1H3OA 3UT9D 2NZDA 2F8NB 3UTBC 5B1MB 5B31C 1ID3C 4H9PB 3O62B 1P3PD 3AZGA 2CV5C 2Y2JA 3O62A 3MGSB 5AV8A 3WTPD 2Y2HA 3MGSA 3LJAC 3LELC 3LZ0B 3W99B 1P3BB 3AZNC 4LD9B 5AV5C 1P3BA 5FUGA 4LD9A 4WU8D 2VQRA 1P3KD 1P3FD 5DNMB 4UUZB 3B6FD 4UUZA 3W98D 1U35B 1KX5A 1U35A 3AN2C 4NE6A 4WU9A 3UTAB 3LZ1B 3UTAA 3LZ1A 5B1LB 3EPHA 2BG1A 5B1LA 4NFTA 1KX3B 3AZED 5GT3B 3AV2A 2Y2KA 5DNNC 3AV1B 1KX3A 5B1MD 5GT3A 4X23C 4J8VB 2F8ND 3AZIC 4J8VA 1P3OC 4Z5TC 4AWLB 5JRGA 5CPJB 3W99D 3LZ0D 5CPJA 2Y2QA 3REKC 3IP4C 3WAAC 5DNMD 5BNXA 3REIC 1AOIB 3AFAD 5GXQD 4H9OB 1T3UA 1EQZB 3X1TB 5CPID 3MGQC 5CPKB 3B0CW 5CPKA 4YM6B 4J8XB 2YFWB 4YM6A 5AV6D 2ZY4A 3AV1D 2NQBA 4JJNB 3AZMD 5GT0D 4JJNA 1F66C 5E5AD 3W96C 1ID3B 5B31B 3X1VD 3UTBA 1ID3A 3X1SC 2CV5B 2CV5A 2L5AA 3LJAB 3LELB 3LELA 3LJAA 4KHAB 3AZNB 5AV5B 2J8PA 3AZNA 5B2IC 5AV5A 3MGRB 5B0YC 3A1KA 2YFVB 1AOID 2NZDC 2JCHA 2YFVA 1EQZD 3X1TD 3AN2B 2LY8A 3AN2A 1M1AC 4J8XD 1B6WA 3MVDB 3W97D 5DNNB 5B31D 4X23B 4QLCC 3KWQD 3C1CD 1P3OB 3AZIA 5F99C 1KX5C 4Z5TA 1TZYD 4WU9C 2PYOC 3VH6W 3MGPC 1P3LD 3B6GC 3MGRD 3REKA 3AV2C 3WAAA 4NE3A 3REIB 3AZKD 2IO5C 5AVCC 1Z2CB 1P3IC 3MGQB 2F8NK 5BT1C 3MGQA 4XUJC 4WZSB 3MVDD 4R8PB 3REHD 5AVBC 4XZQC 5DNND 1M19C 4X23D 4ZUXD 1F66B 1P3OD 3W96B 1F66A 5B33C 4G92C 3W96A 1P3AC 4J8UC 3X1SB 5CP6C 4Z2MH 3RELC 3X1SA 3C1BD 3R45A 3H0MC 3X1UC 5B2IB 5B2IA 2DF4C 5B40C 4E45A 1H3OB 3REID 2NZDB 5B0YA 3REJC 1KX4C 2HIOD 1ZLAD 5JA4B 2Y2GA 5JA4A 3AZHD 3AZGB 5AV8B 2BYMB 1M1AA 4R8PD 2BYMA 3WKJD 5FUGB 2Y2LA 2UWXA 3TU4D 3A6NC 4Z66C 4QLCB 1M18C 3KXBC 4KGCC 4QLCA 1P3GC 1KX5B 5F99A 3A1IA 4WU9B 2PYOB 3AL0C 2PYOA 3MGPB 3MNNC 3MGPA 4J8WC 4KUDC 3B6GA 1P3MC 2NZDD 2DQNC 3AV2B 3AZJA 5AV9C 2IO5B 3VH5W 4HGAC 5AVCB 3AZGD 5JRGB 3O62D 5AVCA 5AV8D 1P3IA 5B32C 1HQ3C 4CAYB 3MGSD 4CAYA 2XD1A 4XUJA 5B2JC 1S32C 1P3BD 4LD9D 2AROC 3H0RC 5AVBB 4XZQA 5AVBA 3AZFC 1M19B 5BNXB 1M19A 3KUYC 5GSUC 2Y2MA 1P3AB 4G92B 1KX5D 1U35D 5B33A 4J8UB 1P3AA 5CP6B 4WU9D 4J8UA 3WA9C 5B24A 5CP6A 3RELA 3UTAD 3LZ1D 5B31G 4NE5A 5B1LD 5AY8C 4M6BA 3X1UB 3AV2D 1KX3D 3X1UA 3F6TA 5GT3D 2NQBB 5B40A 3REJB 4J8VD 3REJA 1KX4B 5JRGD 3UTBB 1KX4A 2G5IC 5BT1D 3WTPE 5CPJD 1BH9B 1BH9A 2Y2OA 2ZM5A 3A6NB 2FFFB 1P3PC 4Z66B 3A6NA 4KGCB 1BH8B 3KXBB 4Z66A 1P3GB 3WTPC 3H0LC 1M18A 1BH8A 3KXBA 5CPKD 1P3GA 4KGCA 1HTAA 4WV4B 4WJ3C 4H9SA 4WU8C 4YM6D 3MNNB 1JFIB 4J8WB 3MNNA 5BO0A 1P3FC 1JFIA 2NQBD 4KUDB 4J8WA 1P3MB 4KUDA 4JJND 1P3MA 3EPJA 3B6FC 3W98C 5AV9B 3UTBD 1ID3D 5AV9A 3AZIB 4Z5TB 2CV5D 5B32B 1HQ3B 2ZY3A 5B32A 1HQ3A 3LJAD 3LELD 5B2JB 1S32B 3AZND 3AZEC 5B2JA 5AV5D 5B0ZA 1S32A 2AROB 2ZY5A 3AZLA 2AROA 3AZFB 3REKB 3AZFA 3AZJC 3WAAB 4UPKA 5C3IC 5GSUB
chains in the Genus database with same CATH topology
3KUYA 1P34A 5GSUA 3W99C 3LZ0C 3AN2D 3WA9B 3WA9A 2XD5A 3AYWA 2Y2PA 2G5HC 5AY8B 4YS3A 5AY8A 3AFAC 5GXQC 5CPIC 3AZID 4Z5TD 2Y2NA 5B24C 4WNNA 2FJ7A 3R45B 5AV6C 2F8NH 3AV1C 5BS7A 3AZMC 3REKD 5GT0C 3KSYA 3UT9A 5E5AC 3WAAD 3X1VC 1A7WA 5B0YB 4H9RB 2JSSA 4H9RA 1P3PB 3V9RA 1P3PA 3WTPB 3MGQD 3WTPA 5KDMB 1Q9CA 5KDMA 1M1AB 4WU8A 3B0DC 1B67A 1P3KA 1P3FA 1EQZC 1F1EA 3X1TC 3B6FB 2HUEC 4Z2MG 3W98B 1F66D 3VH6T 3B6FA 3W96D 3W98A 4H9QB 4G91C 4H9QA 3X1SD 5F99B 4H9SC 1KU5A 3W97C 3AZEB 5B2ID 3AZEA 3B6GB 2RIQA 2F8NA 5B0YD 5B1MA 3KWQC 3C1CC 1R4VA 3AZJB 4H9PA 5C3IB 1PZRA 3VH6A 1TZYC 3EPKA 1WWSA 3W99A 3LZ0A 1N1JB 1P3IB 4ZBJC 1WWIA 1N1JA 1P3LC 1M1AD 3MGRC 4XUJB 5B0ZC 4DQYB 5DNMA 3AZKC 4XZQB 3AZLC 3AFAB 5GXQB 3AFAA 5GXQA 5CPIB 4QLCD 1P34C 2RVQC 5CPIA 5F99D 5B33B 2JE5A 5B24B 3RELB 2PYOD 3MVDC 3REHC 3MGPD 5AV6B 3AYWC 5AV6A 3B6GD 4YS3C 3AZMB 3AV1A 5GT0B 4ZUXC 5E5AB 3AZMA 5GT0A 3AZJD 1W2EA 3X1VB 5E5AA 5B40B 4DRAA 3X1VA 5AVCD 3B0BA 3C1BC 1P3ID 3NQUB 1ULYA 2FJ7C 3NQUA 4XUJD 5BS7C 1BFMA 5AVBD 4XZQD 3B0DB 3UT9C 1AOIA 1M19D 2HIOC 4H9OA 1EQZA 1ZLAC 2HUEB 3X1TA 5BNVB 3AZHC 5BNVA 5B33D 1P3AD 4G91B 4J8UD 1M18B 5B24D 5CP6D 3RELD 4R8PC 4J8XA 3WKJC 2YFWA 3W97B 4EO5C 3W97A 3VH5T 5BO0B 3TU4C 3X1UD 3EPLA 1P3KC 5B32G 4H9NB 5B31A 5B40D 3KWQB 3C1CB 3REJD 4H9NA 3KWQA 3C1CA 1KX4D 1TZYB 4HGAB 1TZYA 4ZBJB 4KHAA 1P3LB 1P3LA 3MGRA 3FDDA 5B0ZB 3AZKB 3AZLB 3VH5A 5B1MC 3AZKA 2CWEA 4CSRB 3B0CT 4DRBA 3AZGC 3A6ND 4CSRA 2Y2IA 3O62C 5AV8C 4Z66D 3KUYB 1P34B 1M18D 3KXBD 3MGSC 1P3GD 4KGCD 1P3BC 2F2AC 3NQJB 4LD9C 3REHB 3NQJA 3MVDA 3REHA 3MNND 3AYWB 4J8WD 4YS3B 5DNNA 5DNMC 4KUDD 4ZUXB 4X23A 1P3MD 3KFUG 4ZUXA 1P3OA 5AV9D 1U35C 2ZY2A 4E44A 3C1BB 3UTAC 3LZ1C 3C1BA 5B32D 1HQ3D 4WNNB 5B1LC 2FJ7B 5B2JD 1S32D 5B0ZD 1KX3C 5GT3C 3AZLD 2AROD 4J8VC 3REIA 5G49B 3UT9B 3AZFD 2HIOB 5G49A 5JRGC 1ZLAB 3KUYD 2HIOA 2RVQD 4AWLC 1P34D 5GSUD 2W8SA 3AZHB 1ZLAA 3V9RB 3AZHA 5CPJC 3WA9D 3WKJB 3AYWD 4R8PA 1TAFB 3WKJA 4YS3D 1TAFA 4EO5B 5AY8D 4WU8B 3TU4B 1AOIC 1P3KB 3TU4A 1P3FB 3EG5B 5CPKC 2F8NG 2FJ7D 4YM6C 4J8XC 2BYKB 2NQBC 2BYKA 5CHLB 3P5JB 4JJNC 1H3OA 3UT9D 2NZDA 2F8NB 3UTBC 5B1MB 5B31C 1ID3C 4H9PB 3O62B 1P3PD 3AZGA 2CV5C 2Y2JA 3O62A 3MGSB 5AV8A 3WTPD 2Y2HA 3MGSA 3LJAC 3LELC 3LZ0B 3W99B 1P3BB 3AZNC 4LD9B 5AV5C 1P3BA 5FUGA 4LD9A 4WU8D 2VQRA 1P3KD 1P3FD 5DNMB 4UUZB 3B6FD 4UUZA 3W98D 1U35B 1KX5A 1U35A 3AN2C 4NE6A 4WU9A 3UTAB 3LZ1B 3UTAA 3LZ1A 5B1LB 3EPHA 2BG1A 5B1LA 4NFTA 1KX3B 3AZED 5GT3B 3AV2A 2Y2KA 5DNNC 3AV1B 1KX3A 5B1MD 5GT3A 4X23C 4J8VB 2F8ND 3AZIC 4J8VA 1P3OC 4Z5TC 4AWLB 5JRGA 5CPJB 3W99D 3LZ0D 5CPJA 2Y2QA 3REKC 3IP4C 3WAAC 5DNMD 5BNXA 3REIC 1AOIB 3AFAD 5GXQD 4H9OB 1T3UA 1EQZB 3X1TB 5CPID 3MGQC 5CPKB 3B0CW 5CPKA 4YM6B 4J8XB 2YFWB 4YM6A 5AV6D 2ZY4A 3AV1D 2NQBA 4JJNB 3AZMD 5GT0D 4JJNA 1F66C 5E5AD 3W96C 1ID3B 5B31B 3X1VD 3UTBA 1ID3A 3X1SC 2CV5B 2CV5A 2L5AA 3LJAB 3LELB 3LELA 3LJAA 4KHAB 3AZNB 5AV5B 2J8PA 3AZNA 5B2IC 5AV5A 3MGRB 5B0YC 3A1KA 2YFVB 1AOID 2NZDC 2JCHA 2YFVA 1EQZD 3X1TD 3AN2B 2LY8A 3AN2A 1M1AC 4J8XD 1B6WA 3MVDB 3W97D 5DNNB 5B31D 4X23B 4QLCC 3KWQD 3C1CD 1P3OB 3AZIA 5F99C 1KX5C 4Z5TA 1TZYD 4WU9C 2PYOC 3VH6W 3MGPC 1P3LD 3B6GC 3MGRD 3REKA 3AV2C 3WAAA 4NE3A 3REIB 3AZKD 2IO5C 5AVCC 1Z2CB 1P3IC 3MGQB 2F8NK 5BT1C 3MGQA 4XUJC 4WZSB 3MVDD 4R8PB 3REHD 5AVBC 4XZQC 5DNND 1M19C 4X23D 4ZUXD 1F66B 1P3OD 3W96B 1F66A 5B33C 4G92C 3W96A 1P3AC 4J8UC 3X1SB 5CP6C 4Z2MH 3RELC 3X1SA 3C1BD 3R45A 3H0MC 3X1UC 5B2IB 5B2IA 2DF4C 5B40C 4E45A 1H3OB 3REID 2NZDB 5B0YA 3REJC 1KX4C 2HIOD 1ZLAD 5JA4B 2Y2GA 5JA4A 3AZHD 3AZGB 5AV8B 2BYMB 1M1AA 4R8PD 2BYMA 3WKJD 5FUGB 2Y2LA 2UWXA 3TU4D 3A6NC 4Z66C 4QLCB 1M18C 3KXBC 4KGCC 4QLCA 1P3GC 1KX5B 5F99A 3A1IA 4WU9B 2PYOB 3AL0C 2PYOA 3MGPB 3MNNC 3MGPA 4J8WC 4KUDC 3B6GA 1P3MC 2NZDD 2DQNC 3AV2B 3AZJA 5AV9C 2IO5B 3VH5W 4HGAC 5AVCB 3AZGD 5JRGB 3O62D 5AVCA 5AV8D 1P3IA 5B32C 1HQ3C 4CAYB 3MGSD 4CAYA 2XD1A 4XUJA 5B2JC 1S32C 1P3BD 4LD9D 2AROC 3H0RC 5AVBB 4XZQA 5AVBA 3AZFC 1M19B 5BNXB 1M19A 3KUYC 5GSUC 2Y2MA 1P3AB 4G92B 1KX5D 1U35D 5B33A 4J8UB 1P3AA 5CP6B 4WU9D 4J8UA 3WA9C 5B24A 5CP6A 3RELA 3UTAD 3LZ1D 5B31G 4NE5A 5B1LD 5AY8C 4M6BA 3X1UB 3AV2D 1KX3D 3X1UA 3F6TA 5GT3D 2NQBB 5B40A 3REJB 4J8VD 3REJA 1KX4B 5JRGD 3UTBB 1KX4A 2G5IC 5BT1D 3WTPE 5CPJD 1BH9B 1BH9A 2Y2OA 2ZM5A 3A6NB 2FFFB 1P3PC 4Z66B 3A6NA 4KGCB 1BH8B 3KXBB 4Z66A 1P3GB 3WTPC 3H0LC 1M18A 1BH8A 3KXBA 5CPKD 1P3GA 4KGCA 1HTAA 4WV4B 4WJ3C 4H9SA 4WU8C 4YM6D 3MNNB 1JFIB 4J8WB 3MNNA 5BO0A 1P3FC 1JFIA 2NQBD 4KUDB 4J8WA 1P3MB 4KUDA 4JJND 1P3MA 3EPJA 3B6FC 3W98C 5AV9B 3UTBD 1ID3D 5AV9A 3AZIB 4Z5TB 2CV5D 5B32B 1HQ3B 2ZY3A 5B32A 1HQ3A 3LJAD 3LELD 5B2JB 1S32B 3AZND 3AZEC 5B2JA 5AV5D 5B0ZA 1S32A 2AROB 2ZY5A 3AZLA 2AROA 3AZFB 3REKB 3AZFA 3AZJC 3WAAB 4UPKA 5C3IC 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY A;  1P34 A;  5GSU A;  3W99 C;  3LZ0 C;  3AN2 D;  3WA9 B;  3WA9 A;  3AYW A;  5AY8 B;  4YS3 A;  5AY8 A;  3AFA C;  5GXQ C;  5CPI C;  3AZI D;  4Z5T D;  5B24 C;  4WNN A;  2FJ7 A;  3R45 B;  5AV6 C;  2F8N H;  3AV1 C;  5BS7 A;  3AZM C;  3REK D;  5GT0 C;  3KSY A;  3UT9 A;  5E5A C;  3WAA D;  3X1V C;  1A7W A;  5B0Y B;  4H9R B;  2JSS A;  4H9R A;  1P3P B;  3V9R A;  1P3P A;  3WTP B;  3MGQ D;  3WTP A;  5KDM B;  1Q9C A;  5KDM A;  1M1A B;  4WU8 A;  3B0D C;  1B67 A;  1P3K A;  1P3F A;  1EQZ C;  1F1E A;  3X1T C;  3B6F B;  2HUE C;  4Z2M G;  3W98 B;  1F66 D;  3VH6 T;  3B6F A;  3W96 D;  3W98 A;  4H9Q B;  4G91 C;  4H9Q A;  3X1S D;  5F99 B;  4H9S C;  1KU5 A;  3W97 C;  3AZE B;  5B2I D;  3AZE A;  3B6G B;  2F8N A;  5B0Y D;  5B1M A;  3KWQ C;  3C1C C;  1R4V A;  3AZJ B;  4H9P A;  5C3I B;  3VH6 A;  1TZY C;  1WWS A;  3W99 A;  3LZ0 A;  1N1J B;  1P3I B;  4ZBJ C;  1WWI A;  1N1J A;  1P3L C;  1M1A D;  3MGR C;  4XUJ B;  5B0Z C;  5DNM A;  3AZK C;  4XZQ B;  3AZL C;  3AFA B;  5GXQ B;  3AFA A;  5GXQ A;  5CPI B;  4QLC D;  1P34 C;  2RVQ C;  5CPI A;  5F99 D;  5B33 B;  5B24 B;  3REL B;  2PYO D;  3MVD C;  3REH C;  3MGP D;  5AV6 B;  3AYW C;  5AV6 A;  3B6G D;  4YS3 C;  3AZM B;  3AV1 A;  5GT0 B;  4ZUX C;  5E5A B;  3AZM A;  5GT0 A;  3AZJ D;  3X1V B;  5E5A A;  5B40 B;  4DRA A;  3X1V A;  5AVC D;  3B0B A;  3C1B C;  1P3I D;  3NQU B;  1ULY A;  2FJ7 C;  3NQU A;  4XUJ D;  5BS7 C;  1BFM A;  5AVB D;  4XZQ D;  3B0D B;  3UT9 C;  1AOI A;  1M19 D;  2HIO C;  4H9O A;  1EQZ A;  1ZLA C;  2HUE B;  3X1T A;  5BNV B;  3AZH C;  5BNV A;  5B33 D;  1P3A D;  4G91 B;  4J8U D;  1M18 B;  5B24 D;  5CP6 D;  3REL D;  4R8P C;  4J8X A;  3WKJ C;  2YFW A;  3W97 B;  4EO5 C;  3W97 A;  3VH5 T;  5BO0 B;  3TU4 C;  3X1U D;  1P3K C;  5B32 G;  4H9N B;  5B31 A;  5B40 D;  3KWQ B;  3C1C B;  3REJ D;  4H9N A;  3KWQ A;  3C1C A;  1KX4 D;  1TZY B;  4HGA B;  1TZY A;  4ZBJ B;  4KHA A;  1P3L B;  1P3L A;  3MGR A;  5B0Z B;  3AZK B;  3AZL B;  3VH5 A;  5B1M C;  3AZK A;  2CWE A;  4CSR B;  3B0C T;  4DRB A;  3AZG C;  3A6N D;  4CSR A;  3O62 C;  5AV8 C;  4Z66 D;  3KUY B;  1P34 B;  1M18 D;  3KXB D;  3MGS C;  1P3G D;  4KGC D;  1P3B C;  3NQJ B;  4LD9 C;  3REH B;  3NQJ A;  3MVD A;  3REH A;  3MNN D;  3AYW B;  4J8W D;  4YS3 B;  5DNN A;  5DNM C;  4KUD D;  4ZUX B;  4X23 A;  1P3M D;  4ZUX A;  1P3O A;  5AV9 D;  1U35 C;  4E44 A;  3C1B B;  3UTA C;  3LZ1 C;  3C1B A;  5B32 D;  1HQ3 D;  4WNN B;  5B1L C;  2FJ7 B;  5B2J D;  1S32 D;  5B0Z D;  1KX3 C;  5GT3 C;  3AZL D;  2ARO D;  4J8V C;  3REI A;  5G49 B;  3UT9 B;  3AZF D;  2HIO B;  5G49 A;  5JRG C;  1ZLA B;  3KUY D;  2HIO A;  2RVQ D;  4AWL C;  1P34 D;  5GSU D;  3AZH B;  1ZLA A;  3V9R B;  3AZH A;  5CPJ C;  3WA9 D;  3WKJ B;  3AYW D;  4R8P A;  1TAF B;  3WKJ A;  4YS3 D;  1TAF A;  4EO5 B;  5AY8 D;  4WU8 B;  3TU4 B;  1AOI C;  1P3K B;  3TU4 A;  1P3F B;  5CPK C;  2F8N G;  2FJ7 D;  4YM6 C;  4J8X C;  2BYK B;  2NQB C;  2BYK A;  5CHL B;  4JJN C;  1H3O A;  3UT9 D;  2NZD A;  2F8N B;  3UTB C;  5B1M B;  5B31 C;  1ID3 C;  4H9P B;  3O62 B;  1P3P D;  3AZG A;  2CV5 C;  3O62 A;  3MGS B;  5AV8 A;  3WTP D;  3MGS A;  3LJA C;  3LEL C;  3LZ0 B;  3W99 B;  1P3B B;  3AZN C;  4LD9 B;  5AV5 C;  1P3B A;  5FUG A;  4LD9 A;  4WU8 D;  1P3K D;  1P3F D;  5DNM B;  4UUZ B;  3B6F D;  4UUZ A;  3W98 D;  1U35 B;  1KX5 A;  1U35 A;  3AN2 C;  4NE6 A;  4WU9 A;  3UTA B;  3LZ1 B;  3UTA A;  3LZ1 A;  5B1L B;  5B1L A;  4NFT A;  1KX3 B;  3AZE D;  5GT3 B;  3AV2 A;  2F8N D;  5DNN C;  3AV1 B;  1KX3 A;  5B1M D;  5GT3 A;  4X23 C;  4J8V B;  3AZI C;  4J8V A;  1P3O C;  4Z5T C;  4AWL B;  5JRG A;  5CPJ B;  3W99 D;  3LZ0 D;  5CPJ A;  3REK C;  3WAA C;  5DNM D;  5BNX A;  3REI C;  1AOI B;  3AFA D;  5GXQ D;  4H9O B;  1EQZ B;  3X1T B;  5CPI D;  3MGQ C;  5CPK B;  3B0C W;  5CPK A;  4YM6 B;  4J8X B;  2YFW B;  4YM6 A;  5AV6 D;  3AV1 D;  2NQB A;  4JJN B;  3AZM D;  5GT0 D;  4JJN A;  1F66 C;  5E5A D;  3W96 C;  1ID3 B;  5B31 B;  3X1V D;  3UTB A;  1ID3 A;  3X1S C;  2CV5 B;  2CV5 A;  2L5A A;  3LJA B;  3LEL B;  3LEL A;  3LJA A;  4KHA B;  3AZN B;  5AV5 B;  3AZN A;  5B2I C;  5AV5 A;  3MGR B;  5B0Y C;  2YFV B;  1AOI D;  2NZD C;  2YFV A;  1EQZ D;  3X1T D;  3AN2 B;  2LY8 A;  3AN2 A;  1M1A C;  4J8X D;  1B6W A;  3MVD B;  3W97 D;  5DNN B;  5B31 D;  4X23 B;  4QLC C;  3KWQ D;  3C1C D;  1P3O B;  3AZI A;  5F99 C;  1KX5 C;  4Z5T A;  1TZY D;  4WU9 C;  2PYO C;  3VH6 W;  3MGP C;  1P3L D;  3B6G C;  3MGR D;  3REK A;  3AV2 C;  3WAA A;  4NE3 A;  3REI B;  3AZK D;  2IO5 C;  5AVC C;  1P3I C;  3MGQ B;  2F8N K;  5BT1 C;  3MGQ A;  4XUJ C;  4WZS B;  3MVD D;  4R8P B;  3REH D;  5AVB C;  4XZQ C;  5DNN D;  1M19 C;  4X23 D;  4ZUX D;  1F66 B;  1P3O D;  3W96 B;  1F66 A;  5B33 C;  4G92 C;  3W96 A;  1P3A C;  4J8U C;  3X1S B;  5CP6 C;  4Z2M H;  3REL C;  3X1S A;  3C1B D;  3R45 A;  3X1U C;  5B2I B;  5B2I A;  5B40 C;  4E45 A;  1H3O B;  3REI D;  2NZD B;  5B0Y A;  3REJ C;  1KX4 C;  2HIO D;  1ZLA D;  5JA4 B;  5JA4 A;  3AZH D;  3AZG B;  5AV8 B;  2BYM B;  1M1A A;  4R8P D;  2BYM A;  3WKJ D;  5FUG B;  3TU4 D;  3A6N C;  4Z66 C;  4QLC B;  1M18 C;  3KXB C;  4KGC C;  4QLC A;  1P3G C;  1KX5 B;  5F99 A;  4WU9 B;  2PYO B;  2PYO A;  3MGP B;  3MNN C;  3MGP A;  4J8W C;  4KUD C;  3B6G A;  1P3M C;  2NZD D;  3AV2 B;  3AZJ A;  5AV9 C;  2IO5 B;  3VH5 W;  4HGA C;  5AVC B;  3AZG D;  5JRG B;  3O62 D;  5AVC A;  5AV8 D;  1P3I A;  5B32 C;  1HQ3 C;  4CAY B;  3MGS D;  4CAY A;  4XUJ A;  5B2J C;  1S32 C;  1P3B D;  4LD9 D;  2ARO C;  5AVB B;  4XZQ A;  5AVB A;  3AZF C;  1M19 B;  5BNX B;  1M19 A;  3KUY C;  5GSU C;  1P3A B;  4G92 B;  1KX5 D;  1U35 D;  5B33 A;  4J8U B;  1P3A A;  5CP6 B;  4WU9 D;  4J8U A;  3WA9 C;  5B24 A;  5CP6 A;  3REL A;  3UTA D;  3LZ1 D;  5B31 G;  4NE5 A;  5B1L D;  5AY8 C;  4M6B A;  3X1U B;  3AV2 D;  1KX3 D;  3X1U A;  5GT3 D;  2NQB B;  5B40 A;  3REJ B;  4J8V D;  3REJ A;  1KX4 B;  5JRG D;  3UTB B;  1KX4 A;  5BT1 D;  3WTP E;  5CPJ D;  1BH9 B;  1BH9 A;  3A6N B;  1P3P C;  4Z66 B;  3A6N A;  4KGC B;  1BH8 B;  3KXB B;  4Z66 A;  1P3G B;  3WTP C;  1M18 A;  1BH8 A;  3KXB A;  5CPK D;  1P3G A;  4KGC A;  1HTA A;  4WV4 B;  4H9S A;  4WU8 C;  4YM6 D;  3MNN B;  1JFI B;  4J8W B;  3MNN A;  5BO0 A;  1P3F C;  1JFI A;  2NQB D;  4KUD B;  4J8W A;  1P3M B;  4KUD A;  4JJN D;  1P3M A;  3B6F C;  3W98 C;  5AV9 B;  3UTB D;  1ID3 D;  5AV9 A;  3AZI B;  4Z5T B;  2CV5 D;  5B32 B;  1HQ3 B;  5B32 A;  1HQ3 A;  3LJA D;  3LEL D;  5B2J B;  1S32 B;  3AZN D;  3AZE C;  5B2J A;  5AV5 D;  5B0Z A;  1S32 A;  2ARO B;  3AZL A;  2ARO A;  3AZF B;  3REK B;  3AZF A;  3AZJ C;  3WAA B;  5C3I C;  5GSU B; 
#chains in the Genus database with same CATH topology
 3KUY A;  1P34 A;  5GSU A;  3W99 C;  3LZ0 C;  3AN2 D;  3WA9 B;  3WA9 A;  2XD5 A;  3AYW A;  2Y2P A;  2G5H C;  5AY8 B;  4YS3 A;  5AY8 A;  3AFA C;  5GXQ C;  5CPI C;  3AZI D;  4Z5T D;  2Y2N A;  5B24 C;  4WNN A;  2FJ7 A;  3R45 B;  5AV6 C;  2F8N H;  3AV1 C;  5BS7 A;  3AZM C;  3REK D;  5GT0 C;  3KSY A;  3UT9 A;  5E5A C;  3WAA D;  3X1V C;  1A7W A;  5B0Y B;  4H9R B;  2JSS A;  4H9R A;  1P3P B;  3V9R A;  1P3P A;  3WTP B;  3MGQ D;  3WTP A;  5KDM B;  1Q9C A;  5KDM A;  1M1A B;  4WU8 A;  3B0D C;  1B67 A;  1P3K A;  1P3F A;  1EQZ C;  1F1E A;  3X1T C;  3B6F B;  2HUE C;  4Z2M G;  3W98 B;  1F66 D;  3VH6 T;  3B6F A;  3W96 D;  3W98 A;  4H9Q B;  4G91 C;  4H9Q A;  3X1S D;  5F99 B;  4H9S C;  1KU5 A;  3W97 C;  3AZE B;  5B2I D;  3AZE A;  3B6G B;  2RIQ A;  2F8N A;  5B0Y D;  5B1M A;  3KWQ C;  3C1C C;  1R4V A;  3AZJ B;  4H9P A;  5C3I B;  1PZR A;  3VH6 A;  1TZY C;  3EPK A;  1WWS A;  3W99 A;  3LZ0 A;  1N1J B;  1P3I B;  4ZBJ C;  1WWI A;  1N1J A;  1P3L C;  1M1A D;  3MGR C;  4XUJ B;  5B0Z C;  4DQY B;  5DNM A;  3AZK C;  4XZQ B;  3AZL C;  3AFA B;  5GXQ B;  3AFA A;  5GXQ A;  5CPI B;  4QLC D;  1P34 C;  2RVQ C;  5CPI A;  5F99 D;  5B33 B;  2JE5 A;  5B24 B;  3REL B;  2PYO D;  3MVD C;  3REH C;  3MGP D;  5AV6 B;  3AYW C;  5AV6 A;  3B6G D;  4YS3 C;  3AZM B;  3AV1 A;  5GT0 B;  4ZUX C;  5E5A B;  3AZM A;  5GT0 A;  3AZJ D;  1W2E A;  3X1V B;  5E5A A;  5B40 B;  4DRA A;  3X1V A;  5AVC D;  3B0B A;  3C1B C;  1P3I D;  3NQU B;  1ULY A;  2FJ7 C;  3NQU A;  4XUJ D;  5BS7 C;  1BFM A;  5AVB D;  4XZQ D;  3B0D B;  3UT9 C;  1AOI A;  1M19 D;  2HIO C;  4H9O A;  1EQZ A;  1ZLA C;  2HUE B;  3X1T A;  5BNV B;  3AZH C;  5BNV A;  5B33 D;  1P3A D;  4G91 B;  4J8U D;  1M18 B;  5B24 D;  5CP6 D;  3REL D;  4R8P C;  4J8X A;  3WKJ C;  2YFW A;  3W97 B;  4EO5 C;  3W97 A;  3VH5 T;  5BO0 B;  3TU4 C;  3X1U D;  3EPL A;  1P3K C;  5B32 G;  4H9N B;  5B31 A;  5B40 D;  3KWQ B;  3C1C B;  3REJ D;  4H9N A;  3KWQ A;  3C1C A;  1KX4 D;  1TZY B;  4HGA B;  1TZY A;  4ZBJ B;  4KHA A;  1P3L B;  1P3L A;  3MGR A;  3FDD A;  5B0Z B;  3AZK B;  3AZL B;  3VH5 A;  5B1M C;  3AZK A;  2CWE A;  4CSR B;  3B0C T;  4DRB A;  3AZG C;  3A6N D;  4CSR A;  2Y2I A;  3O62 C;  5AV8 C;  4Z66 D;  3KUY B;  1P34 B;  1M18 D;  3KXB D;  3MGS C;  1P3G D;  4KGC D;  1P3B C;  2F2A C;  3NQJ B;  4LD9 C;  3REH B;  3NQJ A;  3MVD A;  3REH A;  3MNN D;  3AYW B;  4J8W D;  4YS3 B;  5DNN A;  5DNM C;  4KUD D;  4ZUX B;  4X23 A;  1P3M D;  3KFU G;  4ZUX A;  1P3O A;  5AV9 D;  1U35 C;  2ZY2 A;  4E44 A;  3C1B B;  3UTA C;  3LZ1 C;  3C1B A;  5B32 D;  1HQ3 D;  4WNN B;  5B1L C;  2FJ7 B;  5B2J D;  1S32 D;  5B0Z D;  1KX3 C;  5GT3 C;  3AZL D;  2ARO D;  4J8V C;  3REI A;  5G49 B;  3UT9 B;  3AZF D;  2HIO B;  5G49 A;  5JRG C;  1ZLA B;  3KUY D;  2HIO A;  2RVQ D;  4AWL C;  1P34 D;  5GSU D;  2W8S A;  3AZH B;  1ZLA A;  3V9R B;  3AZH A;  5CPJ C;  3WA9 D;  3WKJ B;  3AYW D;  4R8P A;  1TAF B;  3WKJ A;  4YS3 D;  1TAF A;  4EO5 B;  5AY8 D;  4WU8 B;  3TU4 B;  1AOI C;  1P3K B;  3TU4 A;  1P3F B;  3EG5 B;  5CPK C;  2F8N G;  2FJ7 D;  4YM6 C;  4J8X C;  2BYK B;  2NQB C;  2BYK A;  5CHL B;  3P5J B;  4JJN C;  1H3O A;  3UT9 D;  2NZD A;  2F8N B;  3UTB C;  5B1M B;  5B31 C;  1ID3 C;  4H9P B;  3O62 B;  1P3P D;  3AZG A;  2CV5 C;  2Y2J A;  3O62 A;  3MGS B;  5AV8 A;  3WTP D;  2Y2H A;  3MGS A;  3LJA C;  3LEL C;  3LZ0 B;  3W99 B;  1P3B B;  3AZN C;  4LD9 B;  5AV5 C;  1P3B A;  5FUG A;  4LD9 A;  4WU8 D;  2VQR A;  1P3K D;  1P3F D;  5DNM B;  4UUZ B;  3B6F D;  4UUZ A;  3W98 D;  1U35 B;  1KX5 A;  1U35 A;  3AN2 C;  4NE6 A;  4WU9 A;  3UTA B;  3LZ1 B;  3UTA A;  3LZ1 A;  5B1L B;  3EPH A;  2BG1 A;  5B1L A;  4NFT A;  1KX3 B;  3AZE D;  5GT3 B;  3AV2 A;  2Y2K A;  5DNN C;  3AV1 B;  1KX3 A;  5B1M D;  5GT3 A;  4X23 C;  4J8V B;  2F8N D;  3AZI C;  4J8V A;  1P3O C;  4Z5T C;  4AWL B;  5JRG A;  5CPJ B;  3W99 D;  3LZ0 D;  5CPJ A;  2Y2Q A;  3REK C;  3IP4 C;  3WAA C;  5DNM D;  5BNX A;  3REI C;  1AOI B;  3AFA D;  5GXQ D;  4H9O B;  1T3U A;  1EQZ B;  3X1T B;  5CPI D;  3MGQ C;  5CPK B;  3B0C W;  5CPK A;  4YM6 B;  4J8X B;  2YFW B;  4YM6 A;  5AV6 D;  2ZY4 A;  3AV1 D;  2NQB A;  4JJN B;  3AZM D;  5GT0 D;  4JJN A;  1F66 C;  5E5A D;  3W96 C;  1ID3 B;  5B31 B;  3X1V D;  3UTB A;  1ID3 A;  3X1S C;  2CV5 B;  2CV5 A;  2L5A A;  3LJA B;  3LEL B;  3LEL A;  3LJA A;  4KHA B;  3AZN B;  5AV5 B;  2J8P A;  3AZN A;  5B2I C;  5AV5 A;  3MGR B;  5B0Y C;  3A1K A;  2YFV B;  1AOI D;  2NZD C;  2JCH A;  2YFV A;  1EQZ D;  3X1T D;  3AN2 B;  2LY8 A;  3AN2 A;  1M1A C;  4J8X D;  1B6W A;  3MVD B;  3W97 D;  5DNN B;  5B31 D;  4X23 B;  4QLC C;  3KWQ D;  3C1C D;  1P3O B;  3AZI A;  5F99 C;  1KX5 C;  4Z5T A;  1TZY D;  4WU9 C;  2PYO C;  3VH6 W;  3MGP C;  1P3L D;  3B6G C;  3MGR D;  3REK A;  3AV2 C;  3WAA A;  4NE3 A;  3REI B;  3AZK D;  2IO5 C;  5AVC C;  1Z2C B;  1P3I C;  3MGQ B;  2F8N K;  5BT1 C;  3MGQ A;  4XUJ C;  4WZS B;  3MVD D;  4R8P B;  3REH D;  5AVB C;  4XZQ C;  5DNN D;  1M19 C;  4X23 D;  4ZUX D;  1F66 B;  1P3O D;  3W96 B;  1F66 A;  5B33 C;  4G92 C;  3W96 A;  1P3A C;  4J8U C;  3X1S B;  5CP6 C;  4Z2M H;  3REL C;  3X1S A;  3C1B D;  3R45 A;  3H0M C;  3X1U C;  5B2I B;  5B2I A;  2DF4 C;  5B40 C;  4E45 A;  1H3O B;  3REI D;  2NZD B;  5B0Y A;  3REJ C;  1KX4 C;  2HIO D;  1ZLA D;  5JA4 B;  2Y2G A;  5JA4 A;  3AZH D;  3AZG B;  5AV8 B;  2BYM B;  1M1A A;  4R8P D;  2BYM A;  3WKJ D;  5FUG B;  2Y2L A;  2UWX A;  3TU4 D;  3A6N C;  4Z66 C;  4QLC B;  1M18 C;  3KXB C;  4KGC C;  4QLC A;  1P3G C;  1KX5 B;  5F99 A;  3A1I A;  4WU9 B;  2PYO B;  3AL0 C;  2PYO A;  3MGP B;  3MNN C;  3MGP A;  4J8W C;  4KUD C;  3B6G A;  1P3M C;  2NZD D;  2DQN C;  3AV2 B;  3AZJ A;  5AV9 C;  2IO5 B;  3VH5 W;  4HGA C;  5AVC B;  3AZG D;  5JRG B;  3O62 D;  5AVC A;  5AV8 D;  1P3I A;  5B32 C;  1HQ3 C;  4CAY B;  3MGS D;  4CAY A;  2XD1 A;  4XUJ A;  5B2J C;  1S32 C;  1P3B D;  4LD9 D;  2ARO C;  3H0R C;  5AVB B;  4XZQ A;  5AVB A;  3AZF C;  1M19 B;  5BNX B;  1M19 A;  3KUY C;  5GSU C;  2Y2M A;  1P3A B;  4G92 B;  1KX5 D;  1U35 D;  5B33 A;  4J8U B;  1P3A A;  5CP6 B;  4WU9 D;  4J8U A;  3WA9 C;  5B24 A;  5CP6 A;  3REL A;  3UTA D;  3LZ1 D;  5B31 G;  4NE5 A;  5B1L D;  5AY8 C;  4M6B A;  3X1U B;  3AV2 D;  1KX3 D;  3X1U A;  3F6T A;  5GT3 D;  2NQB B;  5B40 A;  3REJ B;  4J8V D;  3REJ A;  1KX4 B;  5JRG D;  3UTB B;  1KX4 A;  2G5I C;  5BT1 D;  3WTP E;  5CPJ D;  1BH9 B;  1BH9 A;  2Y2O A;  2ZM5 A;  3A6N B;  2FFF B;  1P3P C;  4Z66 B;  3A6N A;  4KGC B;  1BH8 B;  3KXB B;  4Z66 A;  1P3G B;  3WTP C;  3H0L C;  1M18 A;  1BH8 A;  3KXB A;  5CPK D;  1P3G A;  4KGC A;  1HTA A;  4WV4 B;  4WJ3 C;  4H9S A;  4WU8 C;  4YM6 D;  3MNN B;  1JFI B;  4J8W B;  3MNN A;  5BO0 A;  1P3F C;  1JFI A;  2NQB D;  4KUD B;  4J8W A;  1P3M B;  4KUD A;  4JJN D;  1P3M A;  3EPJ A;  3B6F C;  3W98 C;  5AV9 B;  3UTB D;  1ID3 D;  5AV9 A;  3AZI B;  4Z5T B;  2CV5 D;  5B32 B;  1HQ3 B;  2ZY3 A;  5B32 A;  1HQ3 A;  3LJA D;  3LEL D;  5B2J B;  1S32 B;  3AZN D;  3AZE C;  5B2J A;  5AV5 D;  5B0Z A;  1S32 A;  2ARO B;  2ZY5 A;  3AZL A;  2ARO A;  3AZF B;  3REK B;  3AZF A;  3AZJ C;  3WAA B;  4UPK A;  5C3I C;  5GSU B; 
#chains in the Genus database with same CATH homology
 3KUY A;  1P34 A;  5GSU A;  3W99 C;  3LZ0 C;  3AN2 D;  3WA9 B;  3WA9 A;  2XD5 A;  3AYW A;  2Y2P A;  2G5H C;  5AY8 B;  4YS3 A;  5AY8 A;  3AFA C;  5GXQ C;  5CPI C;  3AZI D;  4Z5T D;  2Y2N A;  5B24 C;  4WNN A;  2FJ7 A;  3R45 B;  5AV6 C;  2F8N H;  3AV1 C;  5BS7 A;  3AZM C;  3REK D;  5GT0 C;  3KSY A;  3UT9 A;  5E5A C;  3WAA D;  3X1V C;  1A7W A;  5B0Y B;  4H9R B;  2JSS A;  4H9R A;  1P3P B;  3V9R A;  1P3P A;  3WTP B;  3MGQ D;  3WTP A;  5KDM B;  1Q9C A;  5KDM A;  1M1A B;  4WU8 A;  3B0D C;  1B67 A;  1P3K A;  1P3F A;  1EQZ C;  1F1E A;  3X1T C;  3B6F B;  2HUE C;  4Z2M G;  3W98 B;  1F66 D;  3VH6 T;  3B6F A;  3W96 D;  3W98 A;  4H9Q B;  4G91 C;  4H9Q A;  3X1S D;  5F99 B;  4H9S C;  1KU5 A;  3W97 C;  3AZE B;  5B2I D;  3AZE A;  3B6G B;  2RIQ A;  2F8N A;  5B0Y D;  5B1M A;  3KWQ C;  3C1C C;  1R4V A;  3AZJ B;  4H9P A;  5C3I B;  1PZR A;  3VH6 A;  1TZY C;  3EPK A;  1WWS A;  3W99 A;  3LZ0 A;  1N1J B;  1P3I B;  4ZBJ C;  1WWI A;  1N1J A;  1P3L C;  1M1A D;  3MGR C;  4XUJ B;  5B0Z C;  4DQY B;  5DNM A;  3AZK C;  4XZQ B;  3AZL C;  3AFA B;  5GXQ B;  3AFA A;  5GXQ A;  5CPI B;  4QLC D;  1P34 C;  2RVQ C;  5CPI A;  5F99 D;  5B33 B;  2JE5 A;  5B24 B;  3REL B;  2PYO D;  3MVD C;  3REH C;  3MGP D;  5AV6 B;  3AYW C;  5AV6 A;  3B6G D;  4YS3 C;  3AZM B;  3AV1 A;  5GT0 B;  4ZUX C;  5E5A B;  3AZM A;  5GT0 A;  3AZJ D;  1W2E A;  3X1V B;  5E5A A;  5B40 B;  4DRA A;  3X1V A;  5AVC D;  3B0B A;  3C1B C;  1P3I D;  3NQU B;  1ULY A;  2FJ7 C;  3NQU A;  4XUJ D;  5BS7 C;  1BFM A;  5AVB D;  4XZQ D;  3B0D B;  3UT9 C;  1AOI A;  1M19 D;  2HIO C;  4H9O A;  1EQZ A;  1ZLA C;  2HUE B;  3X1T A;  5BNV B;  3AZH C;  5BNV A;  5B33 D;  1P3A D;  4G91 B;  4J8U D;  1M18 B;  5B24 D;  5CP6 D;  3REL D;  4R8P C;  4J8X A;  3WKJ C;  2YFW A;  3W97 B;  4EO5 C;  3W97 A;  3VH5 T;  5BO0 B;  3TU4 C;  3X1U D;  3EPL A;  1P3K C;  5B32 G;  4H9N B;  5B31 A;  5B40 D;  3KWQ B;  3C1C B;  3REJ D;  4H9N A;  3KWQ A;  3C1C A;  1KX4 D;  1TZY B;  4HGA B;  1TZY A;  4ZBJ B;  4KHA A;  1P3L B;  1P3L A;  3MGR A;  3FDD A;  5B0Z B;  3AZK B;  3AZL B;  3VH5 A;  5B1M C;  3AZK A;  2CWE A;  4CSR B;  3B0C T;  4DRB A;  3AZG C;  3A6N D;  4CSR A;  2Y2I A;  3O62 C;  5AV8 C;  4Z66 D;  3KUY B;  1P34 B;  1M18 D;  3KXB D;  3MGS C;  1P3G D;  4KGC D;  1P3B C;  2F2A C;  3NQJ B;  4LD9 C;  3REH B;  3NQJ A;  3MVD A;  3REH A;  3MNN D;  3AYW B;  4J8W D;  4YS3 B;  5DNN A;  5DNM C;  4KUD D;  4ZUX B;  4X23 A;  1P3M D;  3KFU G;  4ZUX A;  1P3O A;  5AV9 D;  1U35 C;  2ZY2 A;  4E44 A;  3C1B B;  3UTA C;  3LZ1 C;  3C1B A;  5B32 D;  1HQ3 D;  4WNN B;  5B1L C;  2FJ7 B;  5B2J D;  1S32 D;  5B0Z D;  1KX3 C;  5GT3 C;  3AZL D;  2ARO D;  4J8V C;  3REI A;  5G49 B;  3UT9 B;  3AZF D;  2HIO B;  5G49 A;  5JRG C;  1ZLA B;  3KUY D;  2HIO A;  2RVQ D;  4AWL C;  1P34 D;  5GSU D;  2W8S A;  3AZH B;  1ZLA A;  3V9R B;  3AZH A;  5CPJ C;  3WA9 D;  3WKJ B;  3AYW D;  4R8P A;  1TAF B;  3WKJ A;  4YS3 D;  1TAF A;  4EO5 B;  5AY8 D;  4WU8 B;  3TU4 B;  1AOI C;  1P3K B;  3TU4 A;  1P3F B;  3EG5 B;  5CPK C;  2F8N G;  2FJ7 D;  4YM6 C;  4J8X C;  2BYK B;  2NQB C;  2BYK A;  5CHL B;  3P5J B;  4JJN C;  1H3O A;  3UT9 D;  2NZD A;  2F8N B;  3UTB C;  5B1M B;  5B31 C;  1ID3 C;  4H9P B;  3O62 B;  1P3P D;  3AZG A;  2CV5 C;  2Y2J A;  3O62 A;  3MGS B;  5AV8 A;  3WTP D;  2Y2H A;  3MGS A;  3LJA C;  3LEL C;  3LZ0 B;  3W99 B;  1P3B B;  3AZN C;  4LD9 B;  5AV5 C;  1P3B A;  5FUG A;  4LD9 A;  4WU8 D;  2VQR A;  1P3K D;  1P3F D;  5DNM B;  4UUZ B;  3B6F D;  4UUZ A;  3W98 D;  1U35 B;  1KX5 A;  1U35 A;  3AN2 C;  4NE6 A;  4WU9 A;  3UTA B;  3LZ1 B;  3UTA A;  3LZ1 A;  5B1L B;  3EPH A;  2BG1 A;  5B1L A;  4NFT A;  1KX3 B;  3AZE D;  5GT3 B;  3AV2 A;  2Y2K A;  5DNN C;  3AV1 B;  1KX3 A;  5B1M D;  5GT3 A;  4X23 C;  4J8V B;  2F8N D;  3AZI C;  4J8V A;  1P3O C;  4Z5T C;  4AWL B;  5JRG A;  5CPJ B;  3W99 D;  3LZ0 D;  5CPJ A;  2Y2Q A;  3REK C;  3IP4 C;  3WAA C;  5DNM D;  5BNX A;  3REI C;  1AOI B;  3AFA D;  5GXQ D;  4H9O B;  1T3U A;  1EQZ B;  3X1T B;  5CPI D;  3MGQ C;  5CPK B;  3B0C W;  5CPK A;  4YM6 B;  4J8X B;  2YFW B;  4YM6 A;  5AV6 D;  2ZY4 A;  3AV1 D;  2NQB A;  4JJN B;  3AZM D;  5GT0 D;  4JJN A;  1F66 C;  5E5A D;  3W96 C;  1ID3 B;  5B31 B;  3X1V D;  3UTB A;  1ID3 A;  3X1S C;  2CV5 B;  2CV5 A;  2L5A A;  3LJA B;  3LEL B;  3LEL A;  3LJA A;  4KHA B;  3AZN B;  5AV5 B;  2J8P A;  3AZN A;  5B2I C;  5AV5 A;  3MGR B;  5B0Y C;  3A1K A;  2YFV B;  1AOI D;  2NZD C;  2JCH A;  2YFV A;  1EQZ D;  3X1T D;  3AN2 B;  2LY8 A;  3AN2 A;  1M1A C;  4J8X D;  1B6W A;  3MVD B;  3W97 D;  5DNN B;  5B31 D;  4X23 B;  4QLC C;  3KWQ D;  3C1C D;  1P3O B;  3AZI A;  5F99 C;  1KX5 C;  4Z5T A;  1TZY D;  4WU9 C;  2PYO C;  3VH6 W;  3MGP C;  1P3L D;  3B6G C;  3MGR D;  3REK A;  3AV2 C;  3WAA A;  4NE3 A;  3REI B;  3AZK D;  2IO5 C;  5AVC C;  1Z2C B;  1P3I C;  3MGQ B;  2F8N K;  5BT1 C;  3MGQ A;  4XUJ C;  4WZS B;  3MVD D;  4R8P B;  3REH D;  5AVB C;  4XZQ C;  5DNN D;  1M19 C;  4X23 D;  4ZUX D;  1F66 B;  1P3O D;  3W96 B;  1F66 A;  5B33 C;  4G92 C;  3W96 A;  1P3A C;  4J8U C;  3X1S B;  5CP6 C;  4Z2M H;  3REL C;  3X1S A;  3C1B D;  3R45 A;  3H0M C;  3X1U C;  5B2I B;  5B2I A;  2DF4 C;  5B40 C;  4E45 A;  1H3O B;  3REI D;  2NZD B;  5B0Y A;  3REJ C;  1KX4 C;  2HIO D;  1ZLA D;  5JA4 B;  2Y2G A;  5JA4 A;  3AZH D;  3AZG B;  5AV8 B;  2BYM B;  1M1A A;  4R8P D;  2BYM A;  3WKJ D;  5FUG B;  2Y2L A;  2UWX A;  3TU4 D;  3A6N C;  4Z66 C;  4QLC B;  1M18 C;  3KXB C;  4KGC C;  4QLC A;  1P3G C;  1KX5 B;  5F99 A;  3A1I A;  4WU9 B;  2PYO B;  3AL0 C;  2PYO A;  3MGP B;  3MNN C;  3MGP A;  4J8W C;  4KUD C;  3B6G A;  1P3M C;  2NZD D;  2DQN C;  3AV2 B;  3AZJ A;  5AV9 C;  2IO5 B;  3VH5 W;  4HGA C;  5AVC B;  3AZG D;  5JRG B;  3O62 D;  5AVC A;  5AV8 D;  1P3I A;  5B32 C;  1HQ3 C;  4CAY B;  3MGS D;  4CAY A;  2XD1 A;  4XUJ A;  5B2J C;  1S32 C;  1P3B D;  4LD9 D;  2ARO C;  3H0R C;  5AVB B;  4XZQ A;  5AVB A;  3AZF C;  1M19 B;  5BNX B;  1M19 A;  3KUY C;  5GSU C;  2Y2M A;  1P3A B;  4G92 B;  1KX5 D;  1U35 D;  5B33 A;  4J8U B;  1P3A A;  5CP6 B;  4WU9 D;  4J8U A;  3WA9 C;  5B24 A;  5CP6 A;  3REL A;  3UTA D;  3LZ1 D;  5B31 G;  4NE5 A;  5B1L D;  5AY8 C;  4M6B A;  3X1U B;  3AV2 D;  1KX3 D;  3X1U A;  3F6T A;  5GT3 D;  2NQB B;  5B40 A;  3REJ B;  4J8V D;  3REJ A;  1KX4 B;  5JRG D;  3UTB B;  1KX4 A;  2G5I C;  5BT1 D;  3WTP E;  5CPJ D;  1BH9 B;  1BH9 A;  2Y2O A;  2ZM5 A;  3A6N B;  2FFF B;  1P3P C;  4Z66 B;  3A6N A;  4KGC B;  1BH8 B;  3KXB B;  4Z66 A;  1P3G B;  3WTP C;  3H0L C;  1M18 A;  1BH8 A;  3KXB A;  5CPK D;  1P3G A;  4KGC A;  1HTA A;  4WV4 B;  4WJ3 C;  4H9S A;  4WU8 C;  4YM6 D;  3MNN B;  1JFI B;  4J8W B;  3MNN A;  5BO0 A;  1P3F C;  1JFI A;  2NQB D;  4KUD B;  4J8W A;  1P3M B;  4KUD A;  4JJN D;  1P3M A;  3EPJ A;  3B6F C;  3W98 C;  5AV9 B;  3UTB D;  1ID3 D;  5AV9 A;  3AZI B;  4Z5T B;  2CV5 D;  5B32 B;  1HQ3 B;  2ZY3 A;  5B32 A;  1HQ3 A;  3LJA D;  3LEL D;  5B2J B;  1S32 B;  3AZN D;  3AZE C;  5B2J A;  5AV5 D;  5B0Z A;  1S32 A;  2ARO B;  2ZY5 A;  3AZL A;  2ARO A;  3AZF B;  3REK B;  3AZF A;  3AZJ C;  3WAA B;  4UPK A;  5C3I C;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...