5AY8B

Crystal structure of human nucleosome containing h3.y
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8B00
4WNNA 4WU9B 1ID3B 5G49A 5JA4A 3MNNA 1P3MA 5DNNA 3UT9A 3MNND 1P3MD 5DNND 4NFTA 3UT9D 3UTAC 1EQZA 5B1MC 1KX4C 3TU4C 2YFWA 1EQZD 5GT3C 3MGRC 3RELA 1P3KB 4WU9A 1ID3A 2L5AA 4LD9C 3RELD 5B32B 1WWIA 4WU9D 1ID3D 2FJ7C 2RVQD 1TZYD 3C1CB 1M1AC 4CAYB 5BS7C 4J8WB 1S32A 1P3IB 1S32D 5JRGC 3B6FC 4J8UB 3KXBB 1P3KA 1P3GB 1ZLAC 5B32A 1P3KD 4J8UC 3KXBC 5B32D 4X23B 3AZMB 3C1CA 4CAYA 3C1CD 4J8WA 4KGCB 4KUDB 4QLCC 1Q9CA 4J8WD 1F66B 1P3IA 1P3PA 3LELB 3NQJB 5B0ZA 3KUYA 1P3ID 1P3PD 4KUDC 1F66C 3NQUB 4Z2MG 5B0ZD 3KUYD 3AN2B 4J8UA 3KXBA 1P3GA 5E5AB 5B24B 1M19B 3KXBD 1P3GD 3AN2C 2JSSA 5GT0B 4X23A 5E5AC 5B24C 3AZMA 4G91B 5B32G 1M19C 4X23D 4G92C 3LJAB 3AZMD 4KGCA 5GT0C 4KUDA 4G91C 3MVDA 3AZIC 5B1LC 4KGCD 4KUDD 2PYOB 4WU8A 3REHB 3MVDD 3LELA 2AROB 4UUZA 5DNMB 4WU8D 3X1SB 3B0CW 3LELD 3NQUA 5AVBB 3AN2A 3B6GC 2AROC 5E5AA 5B24A 5DNMC 3X1SC 1M19A 5AVBC 5E5AD 5B24D 4H9RB 5GT0A 1M19D 1TAFB 5GT0D 3LJAA 3W96A 3WKJC 5AV8C 3LJAD 3W96D 2CV5B 2PYOA 3REHA 4R8PB 2AROA 3AFAC 4J8VB 2PYOD 2BYKA 5DNMA 3O62A 3REHD 3X1SA 3W97C 2CV5C 2AROD 5AVBA 5B2IB 3O62D 5DNMD 4R8PC 3X1SD 5AVBD 3UTBB 5B2IC 3AZFB 3REJC 4H9RA 3UTBC 1TAFA 5B40C 3MGQB 3AZFC 5AVCB 2CV5A 3MGQC 5AV5B 2CV5D 4J8VA 5CHLB 2NQBC 5B2IA 4J8VD 3W98B 5AV5C 1KX3B 4ZBJB 5B2ID 4NE3A 3WAAC 3UTBA 3B0DB 5AV9C 3AZFA 3C1BC 1HTAA 3UTBD 4J8XC 4ZBJC 1KX3C 3AZFD 3MGQA 1BH9B 5AVCA 5CPIC 5AVCD 3UTAB 5B1MB 5B31C 5AV5A 3REIC 1KX4B 3TU4B 5GT3B 5AV5D 1ULYA 3W98A 4Z5TC 3MGRB 3X1UB 3B0CT 3W98D 2F8NH 1KX5C 3X1UC 1AOIB 4LD9B 3W99C 2FJ7B 2HIOB 1BH9A 1AOIC 1B67A 1P3BC 1M18C 1M1AB 3X1VB 4WZSB 3UTAA 2HIOC 5B1MA 1P3OC 1KX4A 3UTAD 3TU4A 5B1MD 5GT3A 3AZEB 3X1VC 1KX4D 3TU4D 3MGRA 3X1UA 5GT3D 4AWLC 3AZEC 3MGRD 5JRGB 5B0YC 3X1UD 3B6FB 4E45A 1ZLAB 1P3LB 4LD9A 4LD9D 2FJ7A 2HIOA 5BNVB 1P3LC 2FJ7D 1M1AA 2HIOD 5BS7A 3AZNB 1M1AD 1BH8B 4QLCB 4H9SC 3AZEA 3AZNC 3AZED 1U35C 3AYWB 3WA9C 5JRGA 3B6FA 1JFIB 1ZLAA 5JRGD 1P3LA 2F8NK 3B6FD 3AYWC 4YS3B 1ZLAD 1P3LD 5BT1C 3KWQC 5BNVA 4J8UD 4DRAA 4G92B 4YS3C 4H9SA 3AZNA 1BH8A 4QLCA 3AZIB 5B1LB 3VH5W 3AZND 4QLCD 2YFVB 5AV6C 1F66A 3MGPB 3AZLB 1F66D 1JFIA 3B6GB 2HUEC 3NQJA 4XZQB 5AY8B 3AZKB 3WTPE 5GXQC 3MGPC 4YS3A 3AZLC 5BO0B 5AY8C 4XZQC 3AZKC 4YS3D 3AN2D 3WKJB 5AV8B 1P3AB 3AZIA 5B1LA 1HQ3C 5C3IB 3AZID 3V9RB 5B1LD 5CPKC 3AFAB 1P3AC 3W97B 3AV1C 3A6NC 5C3IC 3MGPA 3AZLA 4JJNB 3B6GA 1B6WA 4XZQA 4Z66B 3AZKA 2NZDC 3MGPD 1KU5A 3B6GD 3VH5A 5FUGB 4JJNC 3REJB 5BO0A 4Z66C 3AZGC 5B40B 3WKJA 3KSYA 5AV8A 3WTPC 3VH6A 5CP6C 3X1TB 3WKJD 5AV8D 1N1JB 3V9RA 3MGSC 3AFAA 3X1TC 3W97A 1P34C 2NQBB 4NE6A 2F8NB 5F99B 3AFAD 3W97D 4R8PA 4Z66A 5GSUC 3AZJB 3WAAB 1H3OB 5F99C 4R8PD 5AV9B 4Z66D 1WWSA 1P3FC 5FUGA 3C1BB 3REJA 3AZJC 4J8XB 4XUJC 3REJD 5B40A 5B40D 3X1TA 5CPIB 1N1JA 5B31B 3REIB 3MGQD 3VH5T 3LZ1B 2NQBA 2F8NA 4DRBA 5F99A 2NQBD 4Z5TB 2F8ND 5F99D 3LZ1C 5DNNB 3WAAA 1H3OA 5AV9A 3C1BA 3WAAD 1KX5B 5AV9D 3MNNC 4J8XA 1P3MC 5DNNC 1KX3A 3C1BD 3UT9C 3W99B 4J8XD 1KX3D 1EQZC 5CPIA 1P3BB 1M18B 5CPID 3RELB 5B31A 3REIA 1P3OB 3LZ1A 5B2JB 1TZYB 5B31D 3REID 3RELC 3LZ1D 4Z5TA 4WU9C 1ID3C 5B2JC 4AWLB 2F8NG 4Z5TD 2RVQC 1TZYC 5B0YB 1A7WA 1KX5A 3W99A 3LZ0B 1KX5D 1S32B 3W99D 1AOIA 4YM6B 1P3BA 1M18A 3LZ0C 1S32C 1AOID 1P3BD 1M18D 1P3OA 4YM6C 5B2JA 1TZYA 1P3OD 3X1VA 5B2JD 5B31G 1P3KC 1U35B 3X1VD 3WA9B 5B32C 5B0YA 4HGAB 5B0YD 3C1CC 1F1EA 3LZ0A 4H9QB 4HGAC 1P3PB 4H9PB 3KWQB 4J8WC 3LZ0D 4YM6A 5B0ZB 3KUYB 1P3IC 1P3PC 4YM6D 3B0BA 5B0ZC 3KUYC 5BNXB 5AV6B 3AV2B 4Z2MH 1P3GC 1U35A 5B33B 3WA9A 3REKB 2BYMB 1U35D 3AV2C 2HUEB 3WA9D 4X23C 3AZMC 3AYWA 5GXQB 5B33C 3MVDB 3REKC 4H9QA 4ZUXB 3VH6W 4H9PA 3KWQA 4WU8B 3AYWD 4KGCC 4UUZB 5BT1D 3KWQD 3MVDC 4ZUXC 1R4VA 4WU8C 3LELC 4WV4B 1HQ3B 4H9OB 5BNXA 5AV6A 3AV2A 5CPKB 3AV1B 3A6NB 5B33A 5AV6D 3AV2D 4CSRB 3REKA 2BYMA 3W96B 2YFVA 5B33D 4KHAB 2NZDB 3REKD 5GXQA 4ZUXA 3W96C 3LJAC 5GXQD 5AY8A 2CWEA 3AZLD 4ZUXD 3AZGB 2BYKB 3O62B 3AZKD 5AY8D 4XZQD 3R45B 3WTPB 2PYOC 5KDMB 3REHC 4H9NB 5CP6B 4NE5A 3O62C 3AZHB 1HQ3A 4H9OA 3MGSB 5CPKA 1P3AA 1HQ3D 1P34B 3AV1A 3AZHC 1BFMA 3A6NA 1P3AD 5CPKD 4CSRA 3AV1D 3A6ND 5GSUB 4KHAA 2NZDA 2IO5B 1P3FB 2NZDD 4JJNA 2LY8A 4EO5B 2IO5C 4XUJB 3AZGA 4JJND 3R45A 3WTPA 4EO5C 3AZGD 5KDMA 4H9NA 5CP6A 4J8VC 3WTPD 3AZHA 5CPJB 5CP6D 3MGSA 3AZHD 1P34A 5CPJC 3MGSD 3X1TD 4WNNB 1P34D 5GSUA 4M6BA 5G49B 1P3FA 5GSUD 4E44A 5JA4B 3AZJA 3MNNB 1P3MB 1P3FD 4XUJA 5AVCC 3UT9B 3VH6T 3AZJD 4XUJD 1EQZB 5CPJA 2YFWB 5CPJD 3W98C 3B0DC
chains in the Genus database with same CATH superfamily
4WNNA 4WU9B 1ID3B 5G49A 5JA4A 3IP4C 3MNNA 1P3MA 5DNNA 3UT9A 3MNND 1P3MD 5DNND 2VQRA 3P5JB 4NFTA 3UTAC 3UT9D 5B1MC 1EQZA 1KX4C 3TU4C 2YFWA 1EQZD 5GT3C 3MGRC 3RELA 1P3KB 4WU9A 1ID3A 2L5AA 4LD9C 3RELD 5B32B 1WWIA 4WU9D 1ID3D 2FJ7C 2Y2HA 2RVQD 1TZYD 3EPKA 2Y2JA 3C1CB 1M1AC 4CAYB 5BS7C 4J8WB 1S32A 1P3IB 1S32D 3F6TA 5JRGC 2Y2OA 3B6FC 4J8UB 3KXBB 1P3KA 1P3GB 1ZLAC 5B32A 1P3KD 4J8UC 3KXBC 5B32D 2Y2NA 4X23B 3AZMB 3C1CA 2FFFB 4CAYA 3C1CD 4J8WA 4KGCB 4KUDB 4QLCC 1Q9CA 4J8WD 1F66B 1P3IA 1P3PA 3LELB 3NQJB 5B0ZA 3KUYA 1P3ID 1P3PD 4KUDC 1F66C 3NQUB 4Z2MG 5B0ZD 3KUYD 3AN2B 4J8UA 3KXBA 1PZRA 1P3GA 5E5AB 5B24B 1M19B 3KXBD 1P3GD 3AN2C 2JSSA 5GT0B 4X23A 5E5AC 5B24C 3AZMA 2Y2IA 4G91B 5B32G 1M19C 4X23D 4G92C 3LJAB 3AZMD 4KGCA 5GT0C 2ZM5A 4KUDA 4G91C 3MVDA 3AZIC 5B1LC 4KGCD 4KUDD 2PYOB 2DF4C 4WU8A 3REHB 3MVDD 3LELA 2AROB 4UUZA 5DNMB 4WU8D 3X1SB 3B0CW 3LELD 3NQUA 5AVBB 3AN2A 3KFUG 3B6GC 2AROC 5E5AA 5B24A 5DNMC 3X1SC 1M19A 5AVBC 5E5AD 5B24D 4H9RB 5GT0A 1M19D 1TAFB 5GT0D 2J8PA 3LJAA 3W96A 3WKJC 5AV8C 3LJAD 3W96D 2CV5B 2PYOA 3REHA 4R8PB 2AROA 2Y2PA 3AFAC 2Y2LA 4J8VB 2PYOD 2BYKA 5DNMA 3O62A 3REHD 3X1SA 3W97C 2CV5C 2AROD 5AVBA 5B2IB 3O62D 5DNMD 4R8PC 3X1SD 5AVBD 3UTBB 5B2IC 3AZFB 3REJC 4H9RA 2Y2QA 3UTBC 1TAFA 5B40C 2ZY4A 3H0LC 3MGQB 3AZFC 5AVCB 2CV5A 3MGQC 5AV5B 2CV5D 2F2AC 4J8VA 1T3UA 5CHLB 2NQBC 5B2IA 4J8VD 3W98B 2ZY2A 5AV5C 1KX3B 4ZBJB 5B2ID 4NE3A 3WAAC 3UTBA 3B0DB 5AV9C 2G5IC 3AZFA 3C1BC 1HTAA 3UTBD 4J8XC 4ZBJC 1KX3C 3AZFD 3MGQA 1BH9B 5AVCA 5CPIC 5AVCD 3UTAB 5B1MB 5B31C 5AV5A 3REIC 1KX4B 3TU4B 5GT3B 5AV5D 1ULYA 3W98A 4Z5TC 3MGRB 3X1UB 3B0CT 3W98D 2F8NH 2XD1A 1KX5C 3X1UC 1AOIB 4LD9B 3W99C 2FJ7B 3EG5B 2HIOB 1BH9A 1AOIC 1B67A 1P3BC 1M18C 1M1AB 3X1VB 4WZSB 3UTAA 2HIOC 5B1MA 1P3OC 1KX4A 3UTAD 3TU4A 5B1MD 5GT3A 3AZEB 2W8SA 3X1VC 1KX4D 3TU4D 4WJ3C 3MGRA 3X1UA 5GT3D 4AWLC 3AZEC 3MGRD 5JRGB 5B0YC 3X1UD 3B6FB 4E45A 1ZLAB 1P3LB 4LD9A 4LD9D 2FJ7A 2JE5A 2HIOA 2JCHA 5BNVB 1P3LC 2FJ7D 1M1AA 2HIOD 5BS7A 3AZNB 3H0MC 1M1AD 1BH8B 4QLCB 4H9SC 3AZEA 3AZNC 3AZED 1U35C 3AYWB 3WA9C 5JRGA 3B6FA 1JFIB 1ZLAA 5JRGD 1P3LA 2F8NK 3B6FD 3AYWC 4DQYB 4YS3B 1ZLAD 1P3LD 5BT1C 3KWQC 5BNVA 4J8UD 4DRAA 4G92B 4YS3C 4H9SA 3AZNA 1BH8A 4QLCA 3AZIB 5B1LB 3VH5W 3AZND 4QLCD 2YFVB 5AV6C 1F66A 3MGPB 3AZLB 1F66D 1JFIA 3B6GB 2HUEC 3NQJA 4XZQB 5AY8B 3AZKB 3WTPE 5GXQC 3MGPC 4YS3A 3AZLC 3EPLA 5BO0B 5AY8C 4XZQC 3AZKC 4YS3D 3AN2D 3WKJB 5AV8B 1P3AB 3AZIA 5B1LA 1HQ3C 5C3IB 3AZID 3V9RB 5B1LD 5CPKC 3AFAB 1P3AC 3W97B 3AV1C 3A6NC 5C3IC 3MGPA 3AZLA 4JJNB 3B6GA 1B6WA 4XZQA 2Y2MA 4Z66B 3AZKA 3MGPD 1KU5A 2NZDC 3B6GD 3VH5A 5FUGB 4JJNC 3REJB 5BO0A 4Z66C 3AZGC 5B40B 3WKJA 3KSYA 5AV8A 3WTPC 3VH6A 5CP6C 3X1TB 3WKJD 5AV8D 3H0RC 3EPJA 1N1JB 2Y2KA 3V9RA 3MGSC 3AFAA 3X1TC 3W97A 1P34C 2NQBB 4NE6A 2F8NB 5F99B 3AFAD 3W97D 4R8PA 4Z66A 5GSUC 3AZJB 3WAAB 1H3OB 5F99C 4R8PD 5AV9B 4Z66D 1WWSA 1P3FC 3A1KA 5FUGA 3C1BB 3REJA 3AZJC 4J8XB 4XUJC 3REJD 5B40A 2RIQA 5B40D 3X1TA 5CPIB 3AL0C 1N1JA 5B31B 3REIB 3MGQD 3VH5T 3LZ1B 2NQBA 2F8NA 4DRBA 5F99A 2ZY3A 2NQBD 4Z5TB 2F8ND 5F99D 3LZ1C 5DNNB 3WAAA 1H3OA 5AV9A 3C1BA 3WAAD 1KX5B 5AV9D 3MNNC 4J8XA 1P3MC 5DNNC 1KX3A 3C1BD 3UT9C 3W99B 2DQNC 4J8XD 1KX3D 1EQZC 5CPIA 1P3BB 1M18B 2XD5A 5CPID 3RELB 5B31A 3REIA 1P3OB 3LZ1A 5B2JB 1TZYB 5B31D 3REID 3RELC 3LZ1D 4Z5TA 4WU9C 1ID3C 5B2JC 4AWLB 2F8NG 4Z5TD 2RVQC 1TZYC 5B0YB 1A7WA 1KX5A 3W99A 3LZ0B 1KX5D 1S32B 3W99D 1AOIA 4YM6B 1P3BA 1M18A 3LZ0C 1S32C 1AOID 1P3BD 1M18D 1P3OA 4YM6C 5B2JA 1TZYA 1P3OD 3X1VA 3EPHA 5B2JD 5B31G 1P3KC 1U35B 3X1VD 3WA9B 5B32C 5B0YA 4HGAB 5B0YD 3C1CC 1F1EA 3LZ0A 4H9QB 4HGAC 1P3PB 4H9PB 3KWQB 4J8WC 3LZ0D 4YM6A 5B0ZB 3KUYB 2Y2GA 1P3IC 1P3PC 4YM6D 3B0BA 5B0ZC 3KUYC 3A1IA 5BNXB 5AV6B 3AV2B 4Z2MH 1P3GC 1U35A 5B33B 3WA9A 3REKB 2BYMB 1U35D 3AV2C 2HUEB 3WA9D 4X23C 3AZMC 3AYWA 5GXQB 5B33C 3MVDB 3REKC 4H9QA 4ZUXB 3VH6W 4H9PA 3KWQA 4WU8B 3AYWD 4KGCC 2UWXA 3FDDA 4UUZB 5BT1D 3KWQD 3MVDC 4ZUXC 1R4VA 4WU8C 3LELC 4WV4B 1W2EA 1HQ3B 4H9OB 4UPKA 5BNXA 5AV6A 3AV2A 5CPKB 3AV1B 3A6NB 5B33A 5AV6D 3AV2D 4CSRB 3REKA 2BYMA 3W96B 2YFVA 5B33D 4KHAB 2NZDB 3REKD 5GXQA 4ZUXA 3W96C 3LJAC 5GXQD 5AY8A 2CWEA 3AZLD 4ZUXD 3AZGB 2BYKB 3O62B 3AZKD 5AY8D 4XZQD 3R45B 3WTPB 2PYOC 5KDMB 3REHC 4H9NB 5CP6B 4NE5A 3O62C 3AZHB 1HQ3A 4H9OA 3MGSB 5CPKA 1P3AA 1HQ3D 1P34B 3AV1A 3AZHC 1BFMA 3A6NA 1P3AD 5CPKD 4CSRA 3AV1D 3A6ND 5GSUB 4KHAA 2NZDA 2IO5B 1P3FB 2NZDD 4JJNA 2LY8A 4EO5B 2IO5C 4XUJB 3AZGA 4JJND 3R45A 3WTPA 2G5HC 2ZY5A 4EO5C 5KDMA 3AZGD 4H9NA 5CP6A 4J8VC 3WTPD 3AZHA 5CPJB 5CP6D 3MGSA 3AZHD 1P34A 5CPJC 3MGSD 3X1TD 4WNNB 1P34D 2BG1A 5GSUA 4M6BA 5G49B 1P3FA 5GSUD 4E44A 5JA4B 3AZJA 3MNNB 1P3MB 1P3FD 4XUJA 5AVCC 3UT9B 3VH6T 3AZJD 4XUJD 1EQZB 5CPJA 2YFWB 5CPJD 3W98C 1Z2CB 3B0DC
chains in the Genus database with same CATH topology
4WNNA 4WU9B 1ID3B 5G49A 5JA4A 3IP4C 3MNNA 1P3MA 5DNNA 3UT9A 3MNND 1P3MD 5DNND 2VQRA 3P5JB 4NFTA 3UTAC 3UT9D 5B1MC 1EQZA 1KX4C 3TU4C 2YFWA 1EQZD 5GT3C 3MGRC 3RELA 1P3KB 4WU9A 1ID3A 2L5AA 4LD9C 3RELD 5B32B 1WWIA 4WU9D 1ID3D 2FJ7C 2Y2HA 2RVQD 1TZYD 3EPKA 2Y2JA 3C1CB 1M1AC 4CAYB 5BS7C 4J8WB 1S32A 1P3IB 1S32D 3F6TA 5JRGC 2Y2OA 3B6FC 4J8UB 3KXBB 1P3KA 1P3GB 1ZLAC 5B32A 1P3KD 4J8UC 3KXBC 5B32D 2Y2NA 4X23B 3AZMB 3C1CA 2FFFB 4CAYA 3C1CD 4J8WA 4KGCB 4KUDB 4QLCC 1Q9CA 4J8WD 1F66B 1P3IA 1P3PA 3LELB 3NQJB 5B0ZA 3KUYA 1P3ID 1P3PD 4KUDC 1F66C 3NQUB 4Z2MG 5B0ZD 3KUYD 3AN2B 4J8UA 3KXBA 1PZRA 1P3GA 5E5AB 5B24B 1M19B 3KXBD 1P3GD 3AN2C 2JSSA 5GT0B 4X23A 5E5AC 5B24C 3AZMA 2Y2IA 4G91B 5B32G 1M19C 4X23D 4G92C 3LJAB 3AZMD 4KGCA 5GT0C 2ZM5A 4KUDA 4G91C 3MVDA 3AZIC 5B1LC 4KGCD 4KUDD 2PYOB 2DF4C 4WU8A 3REHB 3MVDD 3LELA 2AROB 4UUZA 5DNMB 4WU8D 3X1SB 3B0CW 3LELD 3NQUA 5AVBB 3AN2A 3KFUG 3B6GC 2AROC 5E5AA 5B24A 5DNMC 3X1SC 1M19A 5AVBC 5E5AD 5B24D 4H9RB 5GT0A 1M19D 1TAFB 5GT0D 2J8PA 3LJAA 3W96A 3WKJC 5AV8C 3LJAD 3W96D 2CV5B 2PYOA 3REHA 4R8PB 2AROA 2Y2PA 3AFAC 2Y2LA 4J8VB 2PYOD 2BYKA 5DNMA 3O62A 3REHD 3X1SA 3W97C 2CV5C 2AROD 5AVBA 5B2IB 3O62D 5DNMD 4R8PC 3X1SD 5AVBD 3UTBB 5B2IC 3AZFB 3REJC 4H9RA 2Y2QA 3UTBC 1TAFA 5B40C 2ZY4A 3H0LC 3MGQB 3AZFC 5AVCB 2CV5A 3MGQC 5AV5B 2CV5D 2F2AC 4J8VA 1T3UA 5CHLB 2NQBC 5B2IA 4J8VD 3W98B 2ZY2A 5AV5C 1KX3B 4ZBJB 5B2ID 4NE3A 3WAAC 3UTBA 3B0DB 5AV9C 2G5IC 3AZFA 3C1BC 1HTAA 3UTBD 4J8XC 4ZBJC 1KX3C 3AZFD 3MGQA 1BH9B 5AVCA 5CPIC 5AVCD 3UTAB 5B1MB 5B31C 5AV5A 3REIC 1KX4B 3TU4B 5GT3B 5AV5D 1ULYA 3W98A 4Z5TC 3MGRB 3X1UB 3B0CT 3W98D 2F8NH 2XD1A 1KX5C 3X1UC 1AOIB 4LD9B 3W99C 2FJ7B 3EG5B 2HIOB 1BH9A 1AOIC 1B67A 1P3BC 1M18C 1M1AB 3X1VB 4WZSB 3UTAA 2HIOC 5B1MA 1P3OC 1KX4A 3UTAD 3TU4A 5B1MD 5GT3A 3AZEB 2W8SA 3X1VC 1KX4D 3TU4D 4WJ3C 3MGRA 3X1UA 5GT3D 4AWLC 3AZEC 3MGRD 5JRGB 5B0YC 3X1UD 3B6FB 4E45A 1ZLAB 1P3LB 4LD9A 4LD9D 2FJ7A 2JE5A 2HIOA 2JCHA 5BNVB 1P3LC 2FJ7D 1M1AA 2HIOD 5BS7A 3AZNB 3H0MC 1M1AD 1BH8B 4QLCB 4H9SC 3AZEA 3AZNC 3AZED 1U35C 3AYWB 3WA9C 5JRGA 3B6FA 1JFIB 1ZLAA 5JRGD 1P3LA 2F8NK 3B6FD 3AYWC 4DQYB 4YS3B 1ZLAD 1P3LD 5BT1C 3KWQC 5BNVA 4J8UD 4DRAA 4G92B 4YS3C 4H9SA 3AZNA 1BH8A 4QLCA 3AZIB 5B1LB 3VH5W 3AZND 4QLCD 2YFVB 5AV6C 1F66A 3MGPB 3AZLB 1F66D 1JFIA 3B6GB 2HUEC 3NQJA 4XZQB 5AY8B 3AZKB 3WTPE 5GXQC 3MGPC 4YS3A 3AZLC 3EPLA 5BO0B 5AY8C 4XZQC 3AZKC 4YS3D 3AN2D 3WKJB 5AV8B 1P3AB 3AZIA 5B1LA 1HQ3C 5C3IB 3AZID 3V9RB 5B1LD 5CPKC 3AFAB 1P3AC 3W97B 3AV1C 3A6NC 5C3IC 3MGPA 3AZLA 4JJNB 3B6GA 1B6WA 4XZQA 2Y2MA 4Z66B 3AZKA 3MGPD 1KU5A 2NZDC 3B6GD 3VH5A 5FUGB 4JJNC 3REJB 5BO0A 4Z66C 3AZGC 5B40B 3WKJA 3KSYA 5AV8A 3WTPC 3VH6A 5CP6C 3X1TB 3WKJD 5AV8D 3H0RC 3EPJA 1N1JB 2Y2KA 3V9RA 3MGSC 3AFAA 3X1TC 3W97A 1P34C 2NQBB 4NE6A 2F8NB 5F99B 3AFAD 3W97D 4R8PA 4Z66A 5GSUC 3AZJB 3WAAB 1H3OB 5F99C 4R8PD 5AV9B 4Z66D 1WWSA 1P3FC 3A1KA 5FUGA 3C1BB 3REJA 3AZJC 4J8XB 4XUJC 3REJD 5B40A 2RIQA 5B40D 3X1TA 5CPIB 3AL0C 1N1JA 5B31B 3REIB 3MGQD 3VH5T 3LZ1B 2NQBA 2F8NA 4DRBA 5F99A 2ZY3A 2NQBD 4Z5TB 2F8ND 5F99D 3LZ1C 5DNNB 3WAAA 1H3OA 5AV9A 3C1BA 3WAAD 1KX5B 5AV9D 3MNNC 4J8XA 1P3MC 5DNNC 1KX3A 3C1BD 3UT9C 3W99B 2DQNC 4J8XD 1KX3D 1EQZC 5CPIA 1P3BB 1M18B 2XD5A 5CPID 3RELB 5B31A 3REIA 1P3OB 3LZ1A 5B2JB 1TZYB 5B31D 3REID 3RELC 3LZ1D 4Z5TA 4WU9C 1ID3C 5B2JC 4AWLB 2F8NG 4Z5TD 2RVQC 1TZYC 5B0YB 1A7WA 1KX5A 3W99A 3LZ0B 1KX5D 1S32B 3W99D 1AOIA 4YM6B 1P3BA 1M18A 3LZ0C 1S32C 1AOID 1P3BD 1M18D 1P3OA 4YM6C 5B2JA 1TZYA 1P3OD 3X1VA 3EPHA 5B2JD 5B31G 1P3KC 1U35B 3X1VD 3WA9B 5B32C 5B0YA 4HGAB 5B0YD 3C1CC 1F1EA 3LZ0A 4H9QB 4HGAC 1P3PB 4H9PB 3KWQB 4J8WC 3LZ0D 4YM6A 5B0ZB 3KUYB 2Y2GA 1P3IC 1P3PC 4YM6D 3B0BA 5B0ZC 3KUYC 3A1IA 5BNXB 5AV6B 3AV2B 4Z2MH 1P3GC 1U35A 5B33B 3WA9A 3REKB 2BYMB 1U35D 3AV2C 2HUEB 3WA9D 4X23C 3AZMC 3AYWA 5GXQB 5B33C 3MVDB 3REKC 4H9QA 4ZUXB 3VH6W 4H9PA 3KWQA 4WU8B 3AYWD 4KGCC 2UWXA 3FDDA 4UUZB 5BT1D 3KWQD 3MVDC 4ZUXC 1R4VA 4WU8C 3LELC 4WV4B 1W2EA 1HQ3B 4H9OB 4UPKA 5BNXA 5AV6A 3AV2A 5CPKB 3AV1B 3A6NB 5B33A 5AV6D 3AV2D 4CSRB 3REKA 2BYMA 3W96B 2YFVA 5B33D 4KHAB 2NZDB 3REKD 5GXQA 4ZUXA 3W96C 3LJAC 5GXQD 5AY8A 2CWEA 3AZLD 4ZUXD 3AZGB 2BYKB 3O62B 3AZKD 5AY8D 4XZQD 3R45B 3WTPB 2PYOC 5KDMB 3REHC 4H9NB 5CP6B 4NE5A 3O62C 3AZHB 1HQ3A 4H9OA 3MGSB 5CPKA 1P3AA 1HQ3D 1P34B 3AV1A 3AZHC 1BFMA 3A6NA 1P3AD 5CPKD 4CSRA 3AV1D 3A6ND 5GSUB 4KHAA 2NZDA 2IO5B 1P3FB 2NZDD 4JJNA 2LY8A 4EO5B 2IO5C 4XUJB 3AZGA 4JJND 3R45A 3WTPA 2G5HC 2ZY5A 4EO5C 5KDMA 3AZGD 4H9NA 5CP6A 4J8VC 3WTPD 3AZHA 5CPJB 5CP6D 3MGSA 3AZHD 1P34A 5CPJC 3MGSD 3X1TD 4WNNB 1P34D 2BG1A 5GSUA 4M6BA 5G49B 1P3FA 5GSUD 4E44A 5JA4B 3AZJA 3MNNB 1P3MB 1P3FD 4XUJA 5AVCC 3UT9B 3VH6T 3AZJD 4XUJD 1EQZB 5CPJA 2YFWB 5CPJD 3W98C 1Z2CB 3B0DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNN A;  4WU9 B;  1ID3 B;  5G49 A;  5JA4 A;  3MNN A;  1P3M A;  5DNN A;  3UT9 A;  3MNN D;  1P3M D;  5DNN D;  4NFT A;  3UT9 D;  3UTA C;  1EQZ A;  5B1M C;  1KX4 C;  3TU4 C;  2YFW A;  1EQZ D;  5GT3 C;  3MGR C;  3REL A;  1P3K B;  4WU9 A;  1ID3 A;  2L5A A;  4LD9 C;  3REL D;  5B32 B;  1WWI A;  4WU9 D;  1ID3 D;  2FJ7 C;  2RVQ D;  1TZY D;  3C1C B;  1M1A C;  4CAY B;  5BS7 C;  4J8W B;  1S32 A;  1P3I B;  1S32 D;  5JRG C;  3B6F C;  4J8U B;  3KXB B;  1P3K A;  1P3G B;  1ZLA C;  5B32 A;  1P3K D;  4J8U C;  3KXB C;  5B32 D;  4X23 B;  3AZM B;  3C1C A;  4CAY A;  3C1C D;  4J8W A;  4KGC B;  4KUD B;  4QLC C;  1Q9C A;  4J8W D;  1F66 B;  1P3I A;  1P3P A;  3LEL B;  3NQJ B;  5B0Z A;  3KUY A;  1P3I D;  1P3P D;  4KUD C;  1F66 C;  3NQU B;  4Z2M G;  5B0Z D;  3KUY D;  3AN2 B;  4J8U A;  3KXB A;  1P3G A;  5E5A B;  5B24 B;  1M19 B;  3KXB D;  1P3G D;  3AN2 C;  2JSS A;  5GT0 B;  4X23 A;  5E5A C;  5B24 C;  3AZM A;  4G91 B;  5B32 G;  1M19 C;  4X23 D;  4G92 C;  3LJA B;  3AZM D;  4KGC A;  5GT0 C;  4KUD A;  4G91 C;  3MVD A;  3AZI C;  5B1L C;  4KGC D;  4KUD D;  2PYO B;  4WU8 A;  3REH B;  3MVD D;  3LEL A;  2ARO B;  4UUZ A;  5DNM B;  4WU8 D;  3X1S B;  3B0C W;  3LEL D;  3NQU A;  5AVB B;  3AN2 A;  3B6G C;  2ARO C;  5E5A A;  5B24 A;  5DNM C;  3X1S C;  1M19 A;  5AVB C;  5E5A D;  5B24 D;  4H9R B;  5GT0 A;  1M19 D;  1TAF B;  5GT0 D;  3LJA A;  3W96 A;  3WKJ C;  5AV8 C;  3LJA D;  3W96 D;  2CV5 B;  2PYO A;  3REH A;  4R8P B;  2ARO A;  3AFA C;  4J8V B;  2PYO D;  2BYK A;  5DNM A;  3O62 A;  3REH D;  3X1S A;  3W97 C;  2CV5 C;  2ARO D;  5AVB A;  5B2I B;  3O62 D;  5DNM D;  4R8P C;  3X1S D;  5AVB D;  3UTB B;  5B2I C;  3AZF B;  3REJ C;  4H9R A;  3UTB C;  1TAF A;  5B40 C;  3MGQ B;  3AZF C;  5AVC B;  2CV5 A;  3MGQ C;  5AV5 B;  2CV5 D;  4J8V A;  5CHL B;  2NQB C;  5B2I A;  4J8V D;  3W98 B;  5AV5 C;  1KX3 B;  4ZBJ B;  5B2I D;  4NE3 A;  3WAA C;  3UTB A;  3B0D B;  5AV9 C;  3AZF A;  3C1B C;  1HTA A;  3UTB D;  4J8X C;  4ZBJ C;  1KX3 C;  3AZF D;  3MGQ A;  1BH9 B;  5AVC A;  5CPI C;  5AVC D;  3UTA B;  5B1M B;  5B31 C;  5AV5 A;  3REI C;  1KX4 B;  3TU4 B;  5GT3 B;  5AV5 D;  1ULY A;  3W98 A;  4Z5T C;  3MGR B;  3X1U B;  3B0C T;  3W98 D;  2F8N H;  1KX5 C;  3X1U C;  1AOI B;  4LD9 B;  3W99 C;  2FJ7 B;  2HIO B;  1BH9 A;  1AOI C;  1B67 A;  1P3B C;  1M18 C;  1M1A B;  3X1V B;  4WZS B;  3UTA A;  2HIO C;  5B1M A;  1P3O C;  1KX4 A;  3UTA D;  3TU4 A;  5B1M D;  5GT3 A;  3AZE B;  3X1V C;  1KX4 D;  3TU4 D;  3MGR A;  3X1U A;  5GT3 D;  4AWL C;  3AZE C;  3MGR D;  5JRG B;  5B0Y C;  3X1U D;  3B6F B;  4E45 A;  1ZLA B;  1P3L B;  4LD9 A;  4LD9 D;  2FJ7 A;  2HIO A;  5BNV B;  1P3L C;  2FJ7 D;  1M1A A;  2HIO D;  5BS7 A;  3AZN B;  1M1A D;  1BH8 B;  4QLC B;  4H9S C;  3AZE A;  3AZN C;  3AZE D;  1U35 C;  3AYW B;  3WA9 C;  5JRG A;  3B6F A;  1JFI B;  1ZLA A;  5JRG D;  1P3L A;  2F8N K;  3B6F D;  3AYW C;  4YS3 B;  1ZLA D;  1P3L D;  5BT1 C;  3KWQ C;  5BNV A;  4J8U D;  4DRA A;  4G92 B;  4YS3 C;  4H9S A;  3AZN A;  1BH8 A;  4QLC A;  3AZI B;  5B1L B;  3VH5 W;  3AZN D;  4QLC D;  2YFV B;  5AV6 C;  1F66 A;  3MGP B;  3AZL B;  1F66 D;  1JFI A;  3B6G B;  2HUE C;  3NQJ A;  4XZQ B;  5AY8 B;  3AZK B;  3WTP E;  5GXQ C;  3MGP C;  4YS3 A;  3AZL C;  5BO0 B;  5AY8 C;  4XZQ C;  3AZK C;  4YS3 D;  3AN2 D;  3WKJ B;  5AV8 B;  1P3A B;  3AZI A;  5B1L A;  1HQ3 C;  5C3I B;  3AZI D;  3V9R B;  5B1L D;  5CPK C;  3AFA B;  1P3A C;  3W97 B;  3AV1 C;  3A6N C;  5C3I C;  3MGP A;  3AZL A;  4JJN B;  3B6G A;  1B6W A;  4XZQ A;  4Z66 B;  3AZK A;  2NZD C;  3MGP D;  1KU5 A;  3B6G D;  3VH5 A;  5FUG B;  4JJN C;  3REJ B;  5BO0 A;  4Z66 C;  3AZG C;  5B40 B;  3WKJ A;  3KSY A;  5AV8 A;  3WTP C;  3VH6 A;  5CP6 C;  3X1T B;  3WKJ D;  5AV8 D;  1N1J B;  3V9R A;  3MGS C;  3AFA A;  3X1T C;  3W97 A;  1P34 C;  2NQB B;  4NE6 A;  2F8N B;  5F99 B;  3AFA D;  3W97 D;  4R8P A;  4Z66 A;  5GSU C;  3AZJ B;  3WAA B;  1H3O B;  5F99 C;  4R8P D;  5AV9 B;  4Z66 D;  1WWS A;  1P3F C;  5FUG A;  3C1B B;  3REJ A;  3AZJ C;  4J8X B;  4XUJ C;  3REJ D;  5B40 A;  5B40 D;  3X1T A;  5CPI B;  1N1J A;  5B31 B;  3REI B;  3MGQ D;  3VH5 T;  3LZ1 B;  2NQB A;  2F8N A;  4DRB A;  5F99 A;  2NQB D;  4Z5T B;  2F8N D;  5F99 D;  3LZ1 C;  5DNN B;  3WAA A;  1H3O A;  5AV9 A;  3C1B A;  3WAA D;  1KX5 B;  5AV9 D;  3MNN C;  4J8X A;  1P3M C;  5DNN C;  1KX3 A;  3C1B D;  3UT9 C;  3W99 B;  4J8X D;  1KX3 D;  1EQZ C;  5CPI A;  1P3B B;  1M18 B;  5CPI D;  3REL B;  5B31 A;  3REI A;  1P3O B;  3LZ1 A;  5B2J B;  1TZY B;  5B31 D;  3REI D;  3REL C;  3LZ1 D;  4Z5T A;  4WU9 C;  1ID3 C;  5B2J C;  4AWL B;  2F8N G;  4Z5T D;  2RVQ C;  1TZY C;  5B0Y B;  1A7W A;  1KX5 A;  3W99 A;  3LZ0 B;  1KX5 D;  1S32 B;  3W99 D;  1AOI A;  4YM6 B;  1P3B A;  1M18 A;  3LZ0 C;  1S32 C;  1AOI D;  1P3B D;  1M18 D;  1P3O A;  4YM6 C;  5B2J A;  1TZY A;  1P3O D;  3X1V A;  5B2J D;  5B31 G;  1P3K C;  1U35 B;  3X1V D;  3WA9 B;  5B32 C;  5B0Y A;  4HGA B;  5B0Y D;  3C1C C;  1F1E A;  3LZ0 A;  4H9Q B;  4HGA C;  1P3P B;  4H9P B;  3KWQ B;  4J8W C;  3LZ0 D;  4YM6 A;  5B0Z B;  3KUY B;  1P3I C;  1P3P C;  4YM6 D;  3B0B A;  5B0Z C;  3KUY C;  5BNX B;  5AV6 B;  3AV2 B;  4Z2M H;  1P3G C;  1U35 A;  5B33 B;  3WA9 A;  3REK B;  2BYM B;  1U35 D;  3AV2 C;  2HUE B;  3WA9 D;  4X23 C;  3AZM C;  3AYW A;  5GXQ B;  5B33 C;  3MVD B;  3REK C;  4H9Q A;  4ZUX B;  3VH6 W;  4H9P A;  3KWQ A;  4WU8 B;  3AYW D;  4KGC C;  4UUZ B;  5BT1 D;  3KWQ D;  3MVD C;  4ZUX C;  1R4V A;  4WU8 C;  3LEL C;  4WV4 B;  1HQ3 B;  4H9O B;  5BNX A;  5AV6 A;  3AV2 A;  5CPK B;  3AV1 B;  3A6N B;  5B33 A;  5AV6 D;  3AV2 D;  4CSR B;  3REK A;  2BYM A;  3W96 B;  2YFV A;  5B33 D;  4KHA B;  2NZD B;  3REK D;  5GXQ A;  4ZUX A;  3W96 C;  3LJA C;  5GXQ D;  5AY8 A;  2CWE A;  3AZL D;  4ZUX D;  3AZG B;  2BYK B;  3O62 B;  3AZK D;  5AY8 D;  4XZQ D;  3R45 B;  3WTP B;  2PYO C;  5KDM B;  3REH C;  4H9N B;  5CP6 B;  4NE5 A;  3O62 C;  3AZH B;  1HQ3 A;  4H9O A;  3MGS B;  5CPK A;  1P3A A;  1HQ3 D;  1P34 B;  3AV1 A;  3AZH C;  1BFM A;  3A6N A;  1P3A D;  5CPK D;  4CSR A;  3AV1 D;  3A6N D;  5GSU B;  4KHA A;  2NZD A;  2IO5 B;  1P3F B;  2NZD D;  4JJN A;  2LY8 A;  4EO5 B;  2IO5 C;  4XUJ B;  3AZG A;  4JJN D;  3R45 A;  3WTP A;  4EO5 C;  3AZG D;  5KDM A;  4H9N A;  5CP6 A;  4J8V C;  3WTP D;  3AZH A;  5CPJ B;  5CP6 D;  3MGS A;  3AZH D;  1P34 A;  5CPJ C;  3MGS D;  3X1T D;  4WNN B;  1P34 D;  5GSU A;  4M6B A;  5G49 B;  1P3F A;  5GSU D;  4E44 A;  5JA4 B;  3AZJ A;  3MNN B;  1P3M B;  1P3F D;  4XUJ A;  5AVC C;  3UT9 B;  3VH6 T;  3AZJ D;  4XUJ D;  1EQZ B;  5CPJ A;  2YFW B;  5CPJ D;  3W98 C;  3B0D C; 
#chains in the Genus database with same CATH topology
 4WNN A;  4WU9 B;  1ID3 B;  5G49 A;  5JA4 A;  3IP4 C;  3MNN A;  1P3M A;  5DNN A;  3UT9 A;  3MNN D;  1P3M D;  5DNN D;  2VQR A;  3P5J B;  4NFT A;  3UTA C;  3UT9 D;  5B1M C;  1EQZ A;  1KX4 C;  3TU4 C;  2YFW A;  1EQZ D;  5GT3 C;  3MGR C;  3REL A;  1P3K B;  4WU9 A;  1ID3 A;  2L5A A;  4LD9 C;  3REL D;  5B32 B;  1WWI A;  4WU9 D;  1ID3 D;  2FJ7 C;  2Y2H A;  2RVQ D;  1TZY D;  3EPK A;  2Y2J A;  3C1C B;  1M1A C;  4CAY B;  5BS7 C;  4J8W B;  1S32 A;  1P3I B;  1S32 D;  3F6T A;  5JRG C;  2Y2O A;  3B6F C;  4J8U B;  3KXB B;  1P3K A;  1P3G B;  1ZLA C;  5B32 A;  1P3K D;  4J8U C;  3KXB C;  5B32 D;  2Y2N A;  4X23 B;  3AZM B;  3C1C A;  2FFF B;  4CAY A;  3C1C D;  4J8W A;  4KGC B;  4KUD B;  4QLC C;  1Q9C A;  4J8W D;  1F66 B;  1P3I A;  1P3P A;  3LEL B;  3NQJ B;  5B0Z A;  3KUY A;  1P3I D;  1P3P D;  4KUD C;  1F66 C;  3NQU B;  4Z2M G;  5B0Z D;  3KUY D;  3AN2 B;  4J8U A;  3KXB A;  1PZR A;  1P3G A;  5E5A B;  5B24 B;  1M19 B;  3KXB D;  1P3G D;  3AN2 C;  2JSS A;  5GT0 B;  4X23 A;  5E5A C;  5B24 C;  3AZM A;  2Y2I A;  4G91 B;  5B32 G;  1M19 C;  4X23 D;  4G92 C;  3LJA B;  3AZM D;  4KGC A;  5GT0 C;  2ZM5 A;  4KUD A;  4G91 C;  3MVD A;  3AZI C;  5B1L C;  4KGC D;  4KUD D;  2PYO B;  2DF4 C;  4WU8 A;  3REH B;  3MVD D;  3LEL A;  2ARO B;  4UUZ A;  5DNM B;  4WU8 D;  3X1S B;  3B0C W;  3LEL D;  3NQU A;  5AVB B;  3AN2 A;  3KFU G;  3B6G C;  2ARO C;  5E5A A;  5B24 A;  5DNM C;  3X1S C;  1M19 A;  5AVB C;  5E5A D;  5B24 D;  4H9R B;  5GT0 A;  1M19 D;  1TAF B;  5GT0 D;  2J8P A;  3LJA A;  3W96 A;  3WKJ C;  5AV8 C;  3LJA D;  3W96 D;  2CV5 B;  2PYO A;  3REH A;  4R8P B;  2ARO A;  2Y2P A;  3AFA C;  2Y2L A;  4J8V B;  2PYO D;  2BYK A;  5DNM A;  3O62 A;  3REH D;  3X1S A;  3W97 C;  2CV5 C;  2ARO D;  5AVB A;  5B2I B;  3O62 D;  5DNM D;  4R8P C;  3X1S D;  5AVB D;  3UTB B;  5B2I C;  3AZF B;  3REJ C;  4H9R A;  2Y2Q A;  3UTB C;  1TAF A;  5B40 C;  2ZY4 A;  3H0L C;  3MGQ B;  3AZF C;  5AVC B;  2CV5 A;  3MGQ C;  5AV5 B;  2CV5 D;  2F2A C;  4J8V A;  1T3U A;  5CHL B;  2NQB C;  5B2I A;  4J8V D;  3W98 B;  2ZY2 A;  5AV5 C;  1KX3 B;  4ZBJ B;  5B2I D;  4NE3 A;  3WAA C;  3UTB A;  3B0D B;  5AV9 C;  2G5I C;  3AZF A;  3C1B C;  1HTA A;  3UTB D;  4J8X C;  4ZBJ C;  1KX3 C;  3AZF D;  3MGQ A;  1BH9 B;  5AVC A;  5CPI C;  5AVC D;  3UTA B;  5B1M B;  5B31 C;  5AV5 A;  3REI C;  1KX4 B;  3TU4 B;  5GT3 B;  5AV5 D;  1ULY A;  3W98 A;  4Z5T C;  3MGR B;  3X1U B;  3B0C T;  3W98 D;  2F8N H;  2XD1 A;  1KX5 C;  3X1U C;  1AOI B;  4LD9 B;  3W99 C;  2FJ7 B;  3EG5 B;  2HIO B;  1BH9 A;  1AOI C;  1B67 A;  1P3B C;  1M18 C;  1M1A B;  3X1V B;  4WZS B;  3UTA A;  2HIO C;  5B1M A;  1P3O C;  1KX4 A;  3UTA D;  3TU4 A;  5B1M D;  5GT3 A;  3AZE B;  2W8S A;  3X1V C;  1KX4 D;  3TU4 D;  4WJ3 C;  3MGR A;  3X1U A;  5GT3 D;  4AWL C;  3AZE C;  3MGR D;  5JRG B;  5B0Y C;  3X1U D;  3B6F B;  4E45 A;  1ZLA B;  1P3L B;  4LD9 A;  4LD9 D;  2FJ7 A;  2JE5 A;  2HIO A;  2JCH A;  5BNV B;  1P3L C;  2FJ7 D;  1M1A A;  2HIO D;  5BS7 A;  3AZN B;  3H0M C;  1M1A D;  1BH8 B;  4QLC B;  4H9S C;  3AZE A;  3AZN C;  3AZE D;  1U35 C;  3AYW B;  3WA9 C;  5JRG A;  3B6F A;  1JFI B;  1ZLA A;  5JRG D;  1P3L A;  2F8N K;  3B6F D;  3AYW C;  4DQY B;  4YS3 B;  1ZLA D;  1P3L D;  5BT1 C;  3KWQ C;  5BNV A;  4J8U D;  4DRA A;  4G92 B;  4YS3 C;  4H9S A;  3AZN A;  1BH8 A;  4QLC A;  3AZI B;  5B1L B;  3VH5 W;  3AZN D;  4QLC D;  2YFV B;  5AV6 C;  1F66 A;  3MGP B;  3AZL B;  1F66 D;  1JFI A;  3B6G B;  2HUE C;  3NQJ A;  4XZQ B;  5AY8 B;  3AZK B;  3WTP E;  5GXQ C;  3MGP C;  4YS3 A;  3AZL C;  3EPL A;  5BO0 B;  5AY8 C;  4XZQ C;  3AZK C;  4YS3 D;  3AN2 D;  3WKJ B;  5AV8 B;  1P3A B;  3AZI A;  5B1L A;  1HQ3 C;  5C3I B;  3AZI D;  3V9R B;  5B1L D;  5CPK C;  3AFA B;  1P3A C;  3W97 B;  3AV1 C;  3A6N C;  5C3I C;  3MGP A;  3AZL A;  4JJN B;  3B6G A;  1B6W A;  4XZQ A;  2Y2M A;  4Z66 B;  3AZK A;  3MGP D;  1KU5 A;  2NZD C;  3B6G D;  3VH5 A;  5FUG B;  4JJN C;  3REJ B;  5BO0 A;  4Z66 C;  3AZG C;  5B40 B;  3WKJ A;  3KSY A;  5AV8 A;  3WTP C;  3VH6 A;  5CP6 C;  3X1T B;  3WKJ D;  5AV8 D;  3H0R C;  3EPJ A;  1N1J B;  2Y2K A;  3V9R A;  3MGS C;  3AFA A;  3X1T C;  3W97 A;  1P34 C;  2NQB B;  4NE6 A;  2F8N B;  5F99 B;  3AFA D;  3W97 D;  4R8P A;  4Z66 A;  5GSU C;  3AZJ B;  3WAA B;  1H3O B;  5F99 C;  4R8P D;  5AV9 B;  4Z66 D;  1WWS A;  1P3F C;  3A1K A;  5FUG A;  3C1B B;  3REJ A;  3AZJ C;  4J8X B;  4XUJ C;  3REJ D;  5B40 A;  2RIQ A;  5B40 D;  3X1T A;  5CPI B;  3AL0 C;  1N1J A;  5B31 B;  3REI B;  3MGQ D;  3VH5 T;  3LZ1 B;  2NQB A;  2F8N A;  4DRB A;  5F99 A;  2ZY3 A;  2NQB D;  4Z5T B;  2F8N D;  5F99 D;  3LZ1 C;  5DNN B;  3WAA A;  1H3O A;  5AV9 A;  3C1B A;  3WAA D;  1KX5 B;  5AV9 D;  3MNN C;  4J8X A;  1P3M C;  5DNN C;  1KX3 A;  3C1B D;  3UT9 C;  3W99 B;  2DQN C;  4J8X D;  1KX3 D;  1EQZ C;  5CPI A;  1P3B B;  1M18 B;  2XD5 A;  5CPI D;  3REL B;  5B31 A;  3REI A;  1P3O B;  3LZ1 A;  5B2J B;  1TZY B;  5B31 D;  3REI D;  3REL C;  3LZ1 D;  4Z5T A;  4WU9 C;  1ID3 C;  5B2J C;  4AWL B;  2F8N G;  4Z5T D;  2RVQ C;  1TZY C;  5B0Y B;  1A7W A;  1KX5 A;  3W99 A;  3LZ0 B;  1KX5 D;  1S32 B;  3W99 D;  1AOI A;  4YM6 B;  1P3B A;  1M18 A;  3LZ0 C;  1S32 C;  1AOI D;  1P3B D;  1M18 D;  1P3O A;  4YM6 C;  5B2J A;  1TZY A;  1P3O D;  3X1V A;  3EPH A;  5B2J D;  5B31 G;  1P3K C;  1U35 B;  3X1V D;  3WA9 B;  5B32 C;  5B0Y A;  4HGA B;  5B0Y D;  3C1C C;  1F1E A;  3LZ0 A;  4H9Q B;  4HGA C;  1P3P B;  4H9P B;  3KWQ B;  4J8W C;  3LZ0 D;  4YM6 A;  5B0Z B;  3KUY B;  2Y2G A;  1P3I C;  1P3P C;  4YM6 D;  3B0B A;  5B0Z C;  3KUY C;  3A1I A;  5BNX B;  5AV6 B;  3AV2 B;  4Z2M H;  1P3G C;  1U35 A;  5B33 B;  3WA9 A;  3REK B;  2BYM B;  1U35 D;  3AV2 C;  2HUE B;  3WA9 D;  4X23 C;  3AZM C;  3AYW A;  5GXQ B;  5B33 C;  3MVD B;  3REK C;  4H9Q A;  4ZUX B;  3VH6 W;  4H9P A;  3KWQ A;  4WU8 B;  3AYW D;  4KGC C;  2UWX A;  3FDD A;  4UUZ B;  5BT1 D;  3KWQ D;  3MVD C;  4ZUX C;  1R4V A;  4WU8 C;  3LEL C;  4WV4 B;  1W2E A;  1HQ3 B;  4H9O B;  4UPK A;  5BNX A;  5AV6 A;  3AV2 A;  5CPK B;  3AV1 B;  3A6N B;  5B33 A;  5AV6 D;  3AV2 D;  4CSR B;  3REK A;  2BYM A;  3W96 B;  2YFV A;  5B33 D;  4KHA B;  2NZD B;  3REK D;  5GXQ A;  4ZUX A;  3W96 C;  3LJA C;  5GXQ D;  5AY8 A;  2CWE A;  3AZL D;  4ZUX D;  3AZG B;  2BYK B;  3O62 B;  3AZK D;  5AY8 D;  4XZQ D;  3R45 B;  3WTP B;  2PYO C;  5KDM B;  3REH C;  4H9N B;  5CP6 B;  4NE5 A;  3O62 C;  3AZH B;  1HQ3 A;  4H9O A;  3MGS B;  5CPK A;  1P3A A;  1HQ3 D;  1P34 B;  3AV1 A;  3AZH C;  1BFM A;  3A6N A;  1P3A D;  5CPK D;  4CSR A;  3AV1 D;  3A6N D;  5GSU B;  4KHA A;  2NZD A;  2IO5 B;  1P3F B;  2NZD D;  4JJN A;  2LY8 A;  4EO5 B;  2IO5 C;  4XUJ B;  3AZG A;  4JJN D;  3R45 A;  3WTP A;  2G5H C;  2ZY5 A;  4EO5 C;  5KDM A;  3AZG D;  4H9N A;  5CP6 A;  4J8V C;  3WTP D;  3AZH A;  5CPJ B;  5CP6 D;  3MGS A;  3AZH D;  1P34 A;  5CPJ C;  3MGS D;  3X1T D;  4WNN B;  1P34 D;  2BG1 A;  5GSU A;  4M6B A;  5G49 B;  1P3F A;  5GSU D;  4E44 A;  5JA4 B;  3AZJ A;  3MNN B;  1P3M B;  1P3F D;  4XUJ A;  5AVC C;  3UT9 B;  3VH6 T;  3AZJ D;  4XUJ D;  1EQZ B;  5CPJ A;  2YFW B;  5CPJ D;  3W98 C;  1Z2C B;  3B0D C; 
#chains in the Genus database with same CATH homology
 4WNN A;  4WU9 B;  1ID3 B;  5G49 A;  5JA4 A;  3IP4 C;  3MNN A;  1P3M A;  5DNN A;  3UT9 A;  3MNN D;  1P3M D;  5DNN D;  2VQR A;  3P5J B;  4NFT A;  3UTA C;  3UT9 D;  5B1M C;  1EQZ A;  1KX4 C;  3TU4 C;  2YFW A;  1EQZ D;  5GT3 C;  3MGR C;  3REL A;  1P3K B;  4WU9 A;  1ID3 A;  2L5A A;  4LD9 C;  3REL D;  5B32 B;  1WWI A;  4WU9 D;  1ID3 D;  2FJ7 C;  2Y2H A;  2RVQ D;  1TZY D;  3EPK A;  2Y2J A;  3C1C B;  1M1A C;  4CAY B;  5BS7 C;  4J8W B;  1S32 A;  1P3I B;  1S32 D;  3F6T A;  5JRG C;  2Y2O A;  3B6F C;  4J8U B;  3KXB B;  1P3K A;  1P3G B;  1ZLA C;  5B32 A;  1P3K D;  4J8U C;  3KXB C;  5B32 D;  2Y2N A;  4X23 B;  3AZM B;  3C1C A;  2FFF B;  4CAY A;  3C1C D;  4J8W A;  4KGC B;  4KUD B;  4QLC C;  1Q9C A;  4J8W D;  1F66 B;  1P3I A;  1P3P A;  3LEL B;  3NQJ B;  5B0Z A;  3KUY A;  1P3I D;  1P3P D;  4KUD C;  1F66 C;  3NQU B;  4Z2M G;  5B0Z D;  3KUY D;  3AN2 B;  4J8U A;  3KXB A;  1PZR A;  1P3G A;  5E5A B;  5B24 B;  1M19 B;  3KXB D;  1P3G D;  3AN2 C;  2JSS A;  5GT0 B;  4X23 A;  5E5A C;  5B24 C;  3AZM A;  2Y2I A;  4G91 B;  5B32 G;  1M19 C;  4X23 D;  4G92 C;  3LJA B;  3AZM D;  4KGC A;  5GT0 C;  2ZM5 A;  4KUD A;  4G91 C;  3MVD A;  3AZI C;  5B1L C;  4KGC D;  4KUD D;  2PYO B;  2DF4 C;  4WU8 A;  3REH B;  3MVD D;  3LEL A;  2ARO B;  4UUZ A;  5DNM B;  4WU8 D;  3X1S B;  3B0C W;  3LEL D;  3NQU A;  5AVB B;  3AN2 A;  3KFU G;  3B6G C;  2ARO C;  5E5A A;  5B24 A;  5DNM C;  3X1S C;  1M19 A;  5AVB C;  5E5A D;  5B24 D;  4H9R B;  5GT0 A;  1M19 D;  1TAF B;  5GT0 D;  2J8P A;  3LJA A;  3W96 A;  3WKJ C;  5AV8 C;  3LJA D;  3W96 D;  2CV5 B;  2PYO A;  3REH A;  4R8P B;  2ARO A;  2Y2P A;  3AFA C;  2Y2L A;  4J8V B;  2PYO D;  2BYK A;  5DNM A;  3O62 A;  3REH D;  3X1S A;  3W97 C;  2CV5 C;  2ARO D;  5AVB A;  5B2I B;  3O62 D;  5DNM D;  4R8P C;  3X1S D;  5AVB D;  3UTB B;  5B2I C;  3AZF B;  3REJ C;  4H9R A;  2Y2Q A;  3UTB C;  1TAF A;  5B40 C;  2ZY4 A;  3H0L C;  3MGQ B;  3AZF C;  5AVC B;  2CV5 A;  3MGQ C;  5AV5 B;  2CV5 D;  2F2A C;  4J8V A;  1T3U A;  5CHL B;  2NQB C;  5B2I A;  4J8V D;  3W98 B;  2ZY2 A;  5AV5 C;  1KX3 B;  4ZBJ B;  5B2I D;  4NE3 A;  3WAA C;  3UTB A;  3B0D B;  5AV9 C;  2G5I C;  3AZF A;  3C1B C;  1HTA A;  3UTB D;  4J8X C;  4ZBJ C;  1KX3 C;  3AZF D;  3MGQ A;  1BH9 B;  5AVC A;  5CPI C;  5AVC D;  3UTA B;  5B1M B;  5B31 C;  5AV5 A;  3REI C;  1KX4 B;  3TU4 B;  5GT3 B;  5AV5 D;  1ULY A;  3W98 A;  4Z5T C;  3MGR B;  3X1U B;  3B0C T;  3W98 D;  2F8N H;  2XD1 A;  1KX5 C;  3X1U C;  1AOI B;  4LD9 B;  3W99 C;  2FJ7 B;  3EG5 B;  2HIO B;  1BH9 A;  1AOI C;  1B67 A;  1P3B C;  1M18 C;  1M1A B;  3X1V B;  4WZS B;  3UTA A;  2HIO C;  5B1M A;  1P3O C;  1KX4 A;  3UTA D;  3TU4 A;  5B1M D;  5GT3 A;  3AZE B;  2W8S A;  3X1V C;  1KX4 D;  3TU4 D;  4WJ3 C;  3MGR A;  3X1U A;  5GT3 D;  4AWL C;  3AZE C;  3MGR D;  5JRG B;  5B0Y C;  3X1U D;  3B6F B;  4E45 A;  1ZLA B;  1P3L B;  4LD9 A;  4LD9 D;  2FJ7 A;  2JE5 A;  2HIO A;  2JCH A;  5BNV B;  1P3L C;  2FJ7 D;  1M1A A;  2HIO D;  5BS7 A;  3AZN B;  3H0M C;  1M1A D;  1BH8 B;  4QLC B;  4H9S C;  3AZE A;  3AZN C;  3AZE D;  1U35 C;  3AYW B;  3WA9 C;  5JRG A;  3B6F A;  1JFI B;  1ZLA A;  5JRG D;  1P3L A;  2F8N K;  3B6F D;  3AYW C;  4DQY B;  4YS3 B;  1ZLA D;  1P3L D;  5BT1 C;  3KWQ C;  5BNV A;  4J8U D;  4DRA A;  4G92 B;  4YS3 C;  4H9S A;  3AZN A;  1BH8 A;  4QLC A;  3AZI B;  5B1L B;  3VH5 W;  3AZN D;  4QLC D;  2YFV B;  5AV6 C;  1F66 A;  3MGP B;  3AZL B;  1F66 D;  1JFI A;  3B6G B;  2HUE C;  3NQJ A;  4XZQ B;  5AY8 B;  3AZK B;  3WTP E;  5GXQ C;  3MGP C;  4YS3 A;  3AZL C;  3EPL A;  5BO0 B;  5AY8 C;  4XZQ C;  3AZK C;  4YS3 D;  3AN2 D;  3WKJ B;  5AV8 B;  1P3A B;  3AZI A;  5B1L A;  1HQ3 C;  5C3I B;  3AZI D;  3V9R B;  5B1L D;  5CPK C;  3AFA B;  1P3A C;  3W97 B;  3AV1 C;  3A6N C;  5C3I C;  3MGP A;  3AZL A;  4JJN B;  3B6G A;  1B6W A;  4XZQ A;  2Y2M A;  4Z66 B;  3AZK A;  3MGP D;  1KU5 A;  2NZD C;  3B6G D;  3VH5 A;  5FUG B;  4JJN C;  3REJ B;  5BO0 A;  4Z66 C;  3AZG C;  5B40 B;  3WKJ A;  3KSY A;  5AV8 A;  3WTP C;  3VH6 A;  5CP6 C;  3X1T B;  3WKJ D;  5AV8 D;  3H0R C;  3EPJ A;  1N1J B;  2Y2K A;  3V9R A;  3MGS C;  3AFA A;  3X1T C;  3W97 A;  1P34 C;  2NQB B;  4NE6 A;  2F8N B;  5F99 B;  3AFA D;  3W97 D;  4R8P A;  4Z66 A;  5GSU C;  3AZJ B;  3WAA B;  1H3O B;  5F99 C;  4R8P D;  5AV9 B;  4Z66 D;  1WWS A;  1P3F C;  3A1K A;  5FUG A;  3C1B B;  3REJ A;  3AZJ C;  4J8X B;  4XUJ C;  3REJ D;  5B40 A;  2RIQ A;  5B40 D;  3X1T A;  5CPI B;  3AL0 C;  1N1J A;  5B31 B;  3REI B;  3MGQ D;  3VH5 T;  3LZ1 B;  2NQB A;  2F8N A;  4DRB A;  5F99 A;  2ZY3 A;  2NQB D;  4Z5T B;  2F8N D;  5F99 D;  3LZ1 C;  5DNN B;  3WAA A;  1H3O A;  5AV9 A;  3C1B A;  3WAA D;  1KX5 B;  5AV9 D;  3MNN C;  4J8X A;  1P3M C;  5DNN C;  1KX3 A;  3C1B D;  3UT9 C;  3W99 B;  2DQN C;  4J8X D;  1KX3 D;  1EQZ C;  5CPI A;  1P3B B;  1M18 B;  2XD5 A;  5CPI D;  3REL B;  5B31 A;  3REI A;  1P3O B;  3LZ1 A;  5B2J B;  1TZY B;  5B31 D;  3REI D;  3REL C;  3LZ1 D;  4Z5T A;  4WU9 C;  1ID3 C;  5B2J C;  4AWL B;  2F8N G;  4Z5T D;  2RVQ C;  1TZY C;  5B0Y B;  1A7W A;  1KX5 A;  3W99 A;  3LZ0 B;  1KX5 D;  1S32 B;  3W99 D;  1AOI A;  4YM6 B;  1P3B A;  1M18 A;  3LZ0 C;  1S32 C;  1AOI D;  1P3B D;  1M18 D;  1P3O A;  4YM6 C;  5B2J A;  1TZY A;  1P3O D;  3X1V A;  3EPH A;  5B2J D;  5B31 G;  1P3K C;  1U35 B;  3X1V D;  3WA9 B;  5B32 C;  5B0Y A;  4HGA B;  5B0Y D;  3C1C C;  1F1E A;  3LZ0 A;  4H9Q B;  4HGA C;  1P3P B;  4H9P B;  3KWQ B;  4J8W C;  3LZ0 D;  4YM6 A;  5B0Z B;  3KUY B;  2Y2G A;  1P3I C;  1P3P C;  4YM6 D;  3B0B A;  5B0Z C;  3KUY C;  3A1I A;  5BNX B;  5AV6 B;  3AV2 B;  4Z2M H;  1P3G C;  1U35 A;  5B33 B;  3WA9 A;  3REK B;  2BYM B;  1U35 D;  3AV2 C;  2HUE B;  3WA9 D;  4X23 C;  3AZM C;  3AYW A;  5GXQ B;  5B33 C;  3MVD B;  3REK C;  4H9Q A;  4ZUX B;  3VH6 W;  4H9P A;  3KWQ A;  4WU8 B;  3AYW D;  4KGC C;  2UWX A;  3FDD A;  4UUZ B;  5BT1 D;  3KWQ D;  3MVD C;  4ZUX C;  1R4V A;  4WU8 C;  3LEL C;  4WV4 B;  1W2E A;  1HQ3 B;  4H9O B;  4UPK A;  5BNX A;  5AV6 A;  3AV2 A;  5CPK B;  3AV1 B;  3A6N B;  5B33 A;  5AV6 D;  3AV2 D;  4CSR B;  3REK A;  2BYM A;  3W96 B;  2YFV A;  5B33 D;  4KHA B;  2NZD B;  3REK D;  5GXQ A;  4ZUX A;  3W96 C;  3LJA C;  5GXQ D;  5AY8 A;  2CWE A;  3AZL D;  4ZUX D;  3AZG B;  2BYK B;  3O62 B;  3AZK D;  5AY8 D;  4XZQ D;  3R45 B;  3WTP B;  2PYO C;  5KDM B;  3REH C;  4H9N B;  5CP6 B;  4NE5 A;  3O62 C;  3AZH B;  1HQ3 A;  4H9O A;  3MGS B;  5CPK A;  1P3A A;  1HQ3 D;  1P34 B;  3AV1 A;  3AZH C;  1BFM A;  3A6N A;  1P3A D;  5CPK D;  4CSR A;  3AV1 D;  3A6N D;  5GSU B;  4KHA A;  2NZD A;  2IO5 B;  1P3F B;  2NZD D;  4JJN A;  2LY8 A;  4EO5 B;  2IO5 C;  4XUJ B;  3AZG A;  4JJN D;  3R45 A;  3WTP A;  2G5H C;  2ZY5 A;  4EO5 C;  5KDM A;  3AZG D;  4H9N A;  5CP6 A;  4J8V C;  3WTP D;  3AZH A;  5CPJ B;  5CP6 D;  3MGS A;  3AZH D;  1P34 A;  5CPJ C;  3MGS D;  3X1T D;  4WNN B;  1P34 D;  2BG1 A;  5GSU A;  4M6B A;  5G49 B;  1P3F A;  5GSU D;  4E44 A;  5JA4 B;  3AZJ A;  3MNN B;  1P3M B;  1P3F D;  4XUJ A;  5AVC C;  3UT9 B;  3VH6 T;  3AZJ D;  4XUJ D;  1EQZ B;  5CPJ A;  2YFW B;  5CPJ D;  3W98 C;  1Z2C B;  3B0D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...