5AZ0A

Crystal structure of aldo-keto reductase (akr2e5) of the silkworm, bombyx mori
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
345
structure length
324
Chain Sequence
KVNVPNFKLNNGDEIPALGYGTWLGVSDFDGTDIPKLLDALSYAIDIGYRHIDTAHFYRVEPEIGQVVQEKINEGVVRREDLFITTKVWQHYHRAADVEVSLRASLHRLGLDHVNLVLMHWPMSISQEGVDEKIDYLETWRGFEEVLKKGLTKAIGVSNFNIEQMKRLLTNCNVPPAVNQIEVNLNLSQADLVDYCQANEVVVVAYSPFGTMVPSLNSPEPKLDNPAMLAIGRKYGKTVTQVNLGYLYQRGIVSIPKTVTKSRVLENASIFDFQLDDEDVATLAQFDNGFRTVRPLFWQPYENYPFDVVPGQDIPIAMRKWKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of an aldo-keto reductase (AKR2E5) from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein
total genus 118
structure length 324
sequence length 345
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5az0A00
1Z8AA 1Z9AA 1PYFA 2ACQA 1PWMA 5DANA 4GIEA 1VBJA 4XAPA 2PDBA 1R38A 1ZSXA 2QXWA 2CLPA 3NTYA 3N2TA 1IHIA 1MRQA 1C9WA 4XO6A 2IPFA 1AZ2A 5KETA 4PRTA 1T40A 3MC5A 2PDNA 2C91A 4XZLX 2FVLA 3EB4A 4Q3MA 1ZUAX 2ACRA 4GABA 4L1WA 3WG6A 4ASTA 4HBKA 3O3RA 1EF3A 1AZ1A 3ONBA 2FZ8A 2WZTA 3CMFA 1PZ1A 4LB3A 1Q5MA 3CAVA 2ACUA 4JQ2A 2R9RA 2IPWA 1AH3A 3S3GA 3O0KA 4G5DA 1EKOA 3M0IA 3ONCA 2HDJA 4JTRA 2PF8A 4YU1A 4GQGA 4JQ1A 1Z89A 3CASA 2F2KA 3N6QA 4R9OA 2PEVA 3U2CA 2BP1A 1PWLA 4JIHA 4EXAA 3LZ3A 4OTKA 4XZNX 4XZIA 1M9HA 4DBUA 3B3DA 2I17A 2IPJA 3MB9A 3LD5A 1PZ0A 1YE4A 4H8NA 1J96A 4RPQA 4PR4A 4JQAA 2R24A 2PZNA 3WBXA 3Q67A 3R8GA 1AH0A 3R58A 1ADSA 1UR3M 2FZBA 1T41A 2HE8A 3RX4A 4GA8A 2PDFA 1IEIA 1QRQA 2HV5A 5JH1A 4Q7BA 4JTCA 2I16A 3FX4A 3GHSA 1AFSA 5LIYX 2F38A 1HQTA 5LIXX 2PDHA 3UGRA 4JTAA 1RY0A 1S1RA 1US0A 3UZZA 2PD5A 3H4GA 3V0UA 1SM9A 4FZIA 3KRBA 4JTDA 4WRHA 1K8CA 1EL3A 5AZ0A 3P2VA 1YNPA 4LB4A 1A80A 4IGSA 4LAUA 3M4HA 3R94A 1EXBA 2PDUA 5LIKX 3H7UA 2PD9A 1MI3A 2PDPA 2BGQA 1AH4A 2NVDA 1XJBA 1S2CA 1RY8A 4DZ5A 3VXGA 1Z3NA 1Q13A 4WDUA 4MHBA 4GCAA 1FRBA 4XZHA 4PMJA 5C7HA 4FA3A 3GHRA 2AGTA 4WEVX 2PDCA 2PDMA 3UZXA 2IKHA 2INEA 2ACSA 3UWEA 5LIUX 3V36A 3DOPA 4QR6A 2PDIA 3CV7A 3T42A 5JH2A 4EXBA 3V0TA 3WBYA 2DV0A 4XVDA 5AZ1A 3EB3A 2IKIA 4JQ3A 4PUUA 1S2AA 3UG8A 4LAZA 3F7JA 3GUGA 4PUWA 1XF0A 2IQDA 4XZMX 1X98A 3LQGA 4JTQA 2PDYA 3M64A 3LEPA 4F40A 3BUVA 3C3UA 3LENA 4LBRA 4HMNA 3Q65A 2HEJA 4ZFCA 1JEZA 1S1PA 2FGBA 2IQ0A 2PDKA 1ZGDA 3CV6A 2HE5A 2PDGA 4I5XA 4QBXA 1ZQ5A 4NKCA 3LNMA 4IJCA 2FZDA 2PDJA 3CAQA 1LWIA 4YVVA 4ICCX 4XK2A 5HA7A 3QKZA 3UZYA 3DN5A 2VDGA 2WZMA 4AUBA 3BV7A 3R6IA 3GHTA 3COTA 4IJRA 2DUXA 3LBOA 4DBWA 1YNQA 4JIIX 4XO7A 3H7RA 1RALA 2IPGA 3D3FA 4WGHA 3WBWA 2BGSA 3LN3A 4WDWA 4FALA 2HVOA 3LZ5A 4WDTA 3V35A 4GQ0A 1OG6A 3WCZA 5LIWX 3UYIA 2J8TA 4QXIA 2HVNA 1HW6A 1X97A 2FZ9A 2PDWA 1QWKA 3V0SA 3LQLA 4JIRA 4JQ4A 4L1XA 4YVPA 4LBSA 2PDQA 3R43A 2IKGA 3UZWA 1MZRA 4XVEA 2IS7A 3G1RA 4YVXA 3GHUA 1GVEA 1VP5A 2P5NA 3LUTA 4YS1A 1XGDA 4GACA 3UFYA 5HNUA 4PRRA 3R8HA 4WDXA 5M2FX 3G5EA 3ERPA 4H7CA 3R7MA 2ISFA 3FJNA 2INZA 2DUZA 3RX3A 2PFHA 2NVCA 1X96A 4FAMA 2A79A 3RX2A 2PDXA 2ALRA 1YE6A 1LQAA 5HNTA 4DBSA 3BCJA 2PDLA 2IKJA 4QX4A 3EAUA 3BURA 3UP8A
chains in the Genus database with same CATH superfamily
1LP6A 3MUCA 4AF0A 1Z8AA 5HWNA 3LBCA 1ODZA 4JTJA 4CN6A 4GZIA 1ZCOA 3LM3A 4LEQA 4HMEA 3I10A 4EPBC 4JNYA 3D47A 5FJIA 3MUZ1 2ATSA 1KB3A 4N9CA 1F73A 1J5SA 5E1QA 1SMAA 1MNSA 2ZX6A 3TYAA 3UVIA 3EB4A 4TOQA 4HN4A 4M80A 3BVJA 3OIHA 4JCLA 5RUBA 1XLEA 5LHEA 1BKHA 3IUHA 1OX6A 3K8LA 3RXZA 3P80A 2ZUTA 3UF9A 1Z41A 3T9PA 4ERGA 4LUIA 2V5LA 3TROA 1JZ8A 3VDCA 4MWAD 2ACUA 3TWAA 1DL3A 1I0DA 5KITA 2PSNA 3TTYA 1GHRA 1EJVC 1EZ2A 4PL2A 5DCEA 3OHIA 4GUIA 2OWXA 2W9MA 3KLKA 4EWND 3KVMA 3GNXA 5ECVA 1XYBA 1Q4NX 1Y0EA 3B40A 3N2CA 4M1BA 2QUNA 2F2KA 3D46A 5HMDA 1TV8A 3L4YA 1R46A 4H00A 4NY2A 3PBUA 5U4NA 1JCYA 1CTNA 3BPWA 4WZHA 3NXFA 3NNTA 5M03A 3L23A 1QNSA 3E2VA 5ABFA 4MNMA 4O13A 3W1PA 1Q2SA 1KFCA 5HMEA 3TC3A 2CLLA 3ARXA 1XD1A 2YYTA 1V8EA 2P0IA 1A4LA 5G4EA 1W91A 2QUTA 5AB3A 2DVXA 4XD4A 2QDGA 2VCCA 4WUIA 3WUEA 3T4WA 2PZNA 2EPOA 4KEMA 4H8UA 4HA4A 1W6TA 3LHWA 1DEDA 3R8GA 2OB3A 4TTUA 3S8HA 2QMJA 1IIGA 1ADSA 1P0EA 2PLJA 4S3FA 2FZBA 2WVSA 2P3EA 2HV5A 2Z26A 4X3ZA 3RM8A 1QNOA 3HF3A 3RLGA 1GKPA 2I16A 3T09A 3ZIZA 2OMAA 1GT8A 2Z1XA 2XG9A 3UA4A 1JPDX 2EPLX 2PTZA 1UJPA 2ISVA 4BI5A 5TQLA 1UD8A 3OTRA 3QQ1A 1ZS2A 3QR3A 3CMGA 2BV9A 3FYOA 1L6GA 3VFLA 1SM9A 1VIWA 4AIOA 2V0TA 2IW0A 3I6RA 4O57A 1VFFA 3EXSA 3GU2A 3P2VA 3FA3A 1YNPA 3FLUA 5HAOA 1GQJA 3R12A 2XIBA 5HWJA 2Z24A 1SW3A 3M6YA 3W2KA 4Z1AA 1ITQA 1DJHA 3H8AA 3C0QA 3TYDA 1LCOA 1E1EA 3HPSA 1DHKA 1TTPA 4XBJA 3USZA 2R1LA 4BY3A 3UJEA 3REQB 3CUZA 4I9JA 1E4IA 4HPGA 3L5LA 3AIQA 3PZ9A 4B5VA 1M68A 4X22A 3UPMA 2FDMA 1O7AA 4JKMA 3IANA 4ZO6A 3ITGA 6REQA 1VEMA 1VFLA 1DV7A 1W31A 2YA2A 2BOFX 3LLFA 2VYOA 1GZ1A 3KHDA 3QF0A 4NJIA 2EJ1A 4E2VA 1K6WA 4QR6A 4V15A 3GG8A 4C7FA 3PJUA 2YBUA 4O50A 2BSLA 4NRSA 4ZBCA 3W7HA 3RILA 1S2AA 5HUOA 3FDKA 3KL0A 1AW5A 1DORA 4TX9A 1ELSA 1Q6EA 3H2CA 3S42A 1UCWA 3ZS4A 4W7WA 1V3MA 1HN1A 5I3DA 2YGYA 4LC8A 4NX0A 3U4AA 3PPGA 4LCSA 1BD0A 4DBEA 3IIPA 3BW3A 1TJ1A 1YLVA 4ZFCA 5H91A 2IQ0A 2DSVA 2J8FA 1D7KA 3II1A 1C8XA 1RJPA 5G2HA 1POJA 3CPUA 1GEQA 2XIJA 3IK2A 4Y2WA 2HBVA 2ZRWA 2W3ZA 5JQ9A 4IJRA 3T0DA 1UC5A 2GQAA 1UD3A 4IF2A 5J5RA 1UMYA 2IPGA 2BVWA 1F6YA 1GW1A 4LT9A 3GIPA 3TMLA 4FALA 1XC4A 3LM7A 4LUSB 1RA0A 1REQB 3ZLHA 4F9DA 3WCZA 3NXLA 3P8IA 5K9CA 3TZFA 4JTSA 2WPBA 3N14A 3U5YA 3W1LA 1LG1A 1HVXA 1WDDA 1O60A 4R53A 4UTWC 4O17A 4BS0A 4F0HA 2ONEA 1D2KA 3T0BA 3KBMA 2PDWA 1NWSA 4GISA 4GXMA 2VX4A 3BLFA 1UIPA 4RDWA 4P2VA 1OYBA 3WQFA 3TVAA 1E4NA 3HGSA 4KRZA 1SFSA 3NPUA 1H2JA 4KFPA 1UUOA 4UR8A 4A3QA 4Z1YA 4NAEA 4F3HA 1UD5A 5AN7A 3F2BA 2QDDA 2NQ9A 2X41A 2DQXA 4JTEA 3JRKA 4R88A 1VJZA 2FTYA 4BHYA 2XSBA 1B3WA 1NDYA 1PO9A 1PB0A 2ODOA 4Y96A 3EDDA 4ERIA 1GOXA 1RVGA 4TR9A 1NDZA 2VP8A 1C3FA 4PODA 1EBHA 2A6LA 5HJXA 4DAIA 1FH8A 4EF8A 1H4PA 2VR2A 2PPGA 2PTYA 1UOZA 4GC4A 2GOUA 2NX3A 1DJIA 3U48A 1O1ZA 5PTDA 1N7KA 4E4FA 4TO8A 1XCWA 4DJEA 1VFSA 1MUMA 2ZXQA 5KZ6A 2VCAA 1WZAA 1J79A 1IEXA 2VFDA 4NYYA 4KPLA 4IWWA 2C0AA 4MWAE 5D33A 2WHJA 1EDTA 3VFCA 4XV0A 3MV01 3W2JA 3NOEA 4GUFA 4CNSA 3CWNA 3WLOA 3BOXA 2QJHA 4G8TA 3AWOA 1VC4A 1GOIA 1GJUA 4XUYA 4JN7A 3KVJA 4LFYA 2H3BA 3ARSA 4CEXC 1GW9A 1XR2A 4ALDA 2DORA 1UR4A 3QFEA 1ME9A 1M7OA 4ASTA 2WK2A 5BXSA 1UKSA 4C6MA 2E09A 4C6NA 2BXYA 3FOKA 3CUXA 3ARVA 1W17A 3GSMA 4Z17A 1PX8A 3ZJ7A 1HIZA 2HMCA 1EH9A 1A47A 3DFNA 3LU2A 3RU6A 3WDHA 2WHLA 2GWNA 5A8GA 3UCCA 3TW6A 1KQYA 2ZIDA 5G4WA 5C9ZA 1AK5A 4A2RA 3W1RA 3VKAA 4WXZA 4GQGA 2VQTA 3TZNA 2DIJA 3NZRA 1GJWA 1W5PA 5FEXA 1W54A 2XN2A 3EB2A 2XTKA 3WLTA 1E43A 1ALDA 2YLLA 1U5JA 5M17A 4C1NA 1P5BA 4IT1A 4LGXA 2P53A 3WDQA 3MVIA 5I2UA 3RM4A 3Q94A 2CHOA 3QGKC 1XH1A 4AEEA 3FYYA 1GTHA 1QI2A 3IJ9A 5JU6A 2GSHA 4H19A 1L0PA 5AYZA 4H2HA 1T6MA 4GUHA 4JIQA 3VE9A 3G1YA 4WKAA 1IEIA 1DJZA 4MG4A 1HT6A 1MZHA 2TPSA 3CT2A 3TN3A 4BQ3A 3H2EA 2YCJA 4LYPA 2OLHA 2I9EA 2YL5A 5DBUA 4JTAA 2QJNA 3W7NA 5A8OA 5FAGA 1QW7A 1X1ZA 4AWTA 1BYCA 2OGJA 3VX0A 2E1WA 2UY4A 1RZMA 4QFUA 5FJUA 1K8CA 4NXKA 4ZA0A 5H8MA 2QAFA 1VR6A 1HKMA 1IE7C 5AC4A 1FDZA 2VEKA 1OC6A 4ATWA 3L7RA 3MUXA 3TEVA 3TYUA 2PD9A 4DZIA 1FWJC 3WLHA 4MZ8A 3NSNA 4DUWA 3N3MA 4ZQMA 2YCLA 3W23A 4FMVA 5L9FA 4RV3A 7A3HA 1TSIA 3JR2A 4BQ4A 1Z3NA 3R89A 4Q32A 5GJNA 1B0IA 3NVDA 1MW0A 2VTFA 4RPPA 5C70A 2WZIA 4HHPA 3WEZA 1BQCA 3T08A 3UEQA 3NCOA 4YWIA 5A3HA 3S2JA 1XRSA 2PDCA 3W07A 3FJ4A 3H21A 1TPVA 3GO2A 3LHYA 1UKTA 5G5IA 1Y65A 1DXFA 3UT0A 1DWFM 4H6KA 3QFWA 4XWUA 2Y85A 5AZ1A 3GNNA 2VUYA 4ZB0A 4O1FA 5CGQA 2Z0IA 5T9BG 3NUKA 1R86A 3CV1A 3T05A 1Q7MA 1WOAA 2X7WA 1FDYA 3DH7A 1KM3A 4GBDA 1OYCA 4HU8A 5K3VA 5C9UA 3GUGA 4JD4A 3S46A 4LBUA 4BEUA 3KX6A 1UC4A 1R6WA 2QPXA 1JVNA 1X98A 5REQB 4NZJA 3W27A 1JZ5A 1PKYA 2DFAA 1VLIA 2ABAA 1S3HA 2XWDA 2QIWA 3FJ6A 3URQA 5LYRA 1JEZA 3ATZA 1AJZA 2X05A 2GGIA 3K4AA 1OFDA 4GO9A 2CYGA 5FL1A 4OWGA 2VZOA 1HZYA 4UTTC 3HGRA 5A6TC 4YVVA 4ICCX 3SEPA 1P0BA 3WLRA 1BRLB 3BV7A 4MFEA 1DQUA 3ARRA 3WQ8A 2XSXA 3SGUA 1LL4A 4K7VA 4ECLA 1YNQA 4AW7A 1R0MA 1GK8A 2DQWA 4E6MA 1TYGA 3U2OA 4AD4A 4X9SA 1ZPTA 3BCDA 4GX9A 4MKVA 2HVOA 4O4VA 1V3HA 3T44A 1N8WA 3R1ZA 4IH3A 1OG6A 4HTYA 1IT8A 5FD0A 3OVGA 4AVOA 5BCAA 1B5TA 4LANA 3IVSA 4CU7A 1SU5A 1HNYA 4LYKA 2WZEA 2I5GA 4AXKA 3N2MA 4QXIA 5EMKA 1QPKA 3QR1A 2DDXA 4REQA 3LB0A 4QM1A 1P4CA 5EGRA 1PDZA 1M03A 2OZ3A 4I7UA 4EE9A 1I2PA 3H70A 3NA8A 1HF6A 4KCUA 3UZWA 3GG0A 1KXHA 5A6LA 3HFTA 3PZIA 1RXOB 3WZ0E 2V8ZA 1GPFA 3R8HA 4HHHA 2EF9A 1LOLA 1PTDA 4WSKA 2A7RA 1B1YA 3R7MA 5CC3A 1VYPX 2YXXA 1AD4A 4N02A 4PTWA 4FF7A 4EVZA 1CXKA 3M0XA 4ICNA 4FAMA 3VNMA 2MNRA 3LCWA 1SJCA 1SO5A 1I1WA 4GWEA 3GNPA 1YE6A 3IUDA 4Y7EA 3VZYA 4O14A 4WK9A 4FP1A 2NX9A 3SJ3A 3WN6A 5LXEA 3C2RA 2QV5A 3CZKA 3E0LA 3CLMA 2BDQA 5CGMA 1TRIA 1CT5A 5BRQA 3W71A 2YOCA 2VEIA 3VVGA 3LK6A 3PF3A 4LNCA 4DQWA 1IZJA 3DBNA 3DFSA 2WHKA 3G1DA 4FHAA 1J6OA 4U2YA 4Z08A 2FKPA 2P8BA 1BWKA 2PWUA 3DKLA 4XO6A 4HK7A 3WEMA 2HJPA 1O12A 3M5XA 4Y9NA 4CD4A 3EGJA 2AAAA 6ENLA 2V3EA 1XYLA 3GG1A 3PG8A 1VCVA 2RHGA 4F8XA 4PB5A 4L1WA 1VRDA 3EXTA 3MYPA 3M44A 1CXHA 3TR9A 3GRIA 3M46A 1VRXA 1K4HA 4KWSA 3AIUA 4QEEA 1E6PA 1FWRA 1AA1B 4ONVA 1W2PA 1JYXA 4I8YA 3WLJA 4GFSA 4JQ2A 3ITOA 4CU6A 1M01A 1UHVA 3DCPA 2OO6A 2ZE0A 3GB6A 2V69A 3FAXA 4UOQA 4A05A 4MKNA 6REQB 5FF2A 4PUDA 4LAMA 4WY0B 1R3SA 1VQTA 4K37A 3NEHA 3IIXA 3CASA 3HG2A 3A24A 3B97A 4K8HA 3V16A 1PWLA 3ZO9A 1JYVA 2X2YA 1RSCA 3FXYA 4DX3A 3MKCA 3SUSA 4ZEPA 3W1MA 3FAWA 2FGLA 2FB2A 1UUMA 3BMXA 4B92A 1SMDA 5F2LA 2WXDM 4H04A 1V77A 1UBSA 3WX7A 3W24A 4QAWA 4DO4A 3BANA 3R11A 3AZTA 4MGGA 1WZMA 3UWQA 1GCYA 2I57A 3CXOA 4MB5A 4AD1A 4CNPA 1EYWA 2NXHA 4CCEA 4GA8A 4LS2A 1TB3A 4FX6M 3U6WA 4AHPA 3GHSA 4FNSA 2YLAA 1QVBA 1XICA 5LIXX 3ITTA 4J3TA 1SSDA 3AYRA 1UW9A 2WQDA 3LG3A 3QY8A 1KBIA 2J7FA 2RH9A 1U5VA 1V3JA 3NR0A 3FW6A 2FH8A 1JNDA 3DDMA 1JD9A 4WIWA 2G97A 3AXIA 4AD2A 3TYCA 2CLHA 1W5MA 2WCAA 1VBUA 1C93A 4H6QA 1KQZA 3W82A 1ZALA 3NPWA 4ZO7A 3WQOA 2V3FA 4HT3A 3GBEA 4BJHA 2UBPC 1FQ0A 1EQPA 3WD2A 2RFGA 3AXMA 3KBJA 1AH4A 2XZ9A 4TX8A 2QMKA 3VKBA 3W1NA 3OQ8A 3VXGA 2JIEA 1WAWA 5FF7A 4WDUA 4GCAA 5FSEC 2XVKA 3OVPA 1BTMA 1E3XA 3NYDA 3CQ0A 1BFNA 1POKA 3ZT5A 3MBDA 2J7GA 1QWGA 3ARYA 1EJXC 3EWWA 4NUWA 4FLSA 1B3YA 1E0WA 4FPSA 3DOPA 3VKCA 2PDIA 5ABTA 3NL2A 2OSYA 2WCGA 4M51A 4L65A 4K1WA 4GINA 4LCRA 4J35A 3IV8A 4IIBA 2VR5A 5DT5A 4ROQA 1NARA 5HANA 3SR7A 4NZFA 4GHRA 1QUMA 3K2GA 1ZAJA 3ZFHA 4MLJA 3BLOA 4IPJA 2CBJA 2IQDA 1KRCC 3QEZA 1R9XA 2A5HA 3M5YA 4N4QA 5CKSA 4UZSA 2XINA 3GFZA 3ORWA 3BJSA 4ADTA 3LXBA 2D2GA 5BROA 7XIMA 1K8ZA 5HUPA 4HMNA 1OJXA 1QBBA 1KCZA 2P3ZA 2PGEA 3U8GA 3AZRA 3A3XA 3I7SA 2PDKA 3CMJA 3MJYA 4UFLA 2WVVA 5D32A 2LLEA 4M81A 1DPMA 1UWRA 4C91A 1DWGM 5DBTA 4GY7A 1Q8AA 3TSDA 2NV2A 2V6AA 3GDBA 3QKZA 3ANUA 1WDSA 3WQ4A 2X16A 3BLIA 3PWAA 5KSWA 2H90A 1V7AA 1QU4A 4B15A 1W1YA 1QNVA 3V18A 3WMBA 6TIMA 1XIJA 4EF9A 4RJEA 4MMWA 1ZLPA 3U7VA 1K7EA 4GQ0A 3THAA 3B9DA 3N15A 3SCWA 3T8LA 4LWWA 3NJ3A 1L2QA 3AXHA 3W86A 2GYIA 3R0UA 1E0XA 1IYXA 3SY1A 1P1MA 3V1PA 2QULA 1FWBC 3N29A 3QQ0A 3E1F1 2FFCA 2GOKA 3E12A 4JTIA 1R47A 1NOWA 2CKSA 4MTVA 4YVPA 1U5HA 2WHMA 4JIEA 1PX4A 3R43A 5G2WA 2W5FA 1BVWA 1EHNA 3D0CA 1H50A 4LRTA 4LPCA 1PL9A 3WQVA 5F1UA 5BWAA 4E4UA 4Z2LA 5HNUA 4UTMA 1P6CA 3OIXA 1D3HA 4M1RA 1YPXA 2ZUWA 4QNEA 1ZL1A 2Y7DA 2VX5A 1XUZA 1HJSA 3BLLA 3RX3A 3RN6A 3WFLA 3MCMA 4UTKA 2JIWA 4JZ5A 4H41A 5BRBA 5C8BB 3HG4A 2OR2A 3CIWA 1V0LA 2PGWA 3RX2A 1NY1A 1EDQA 3POCA 3HTWA 1UWQA 3THQA 2AMGA 2G95A 4EIVA 3K4DA 3VI2A 4YCOA 3POHA 3P0XA 3GZAA 3VNYA 4QIUA 4D1IA 3F4NA 1ESWA 4BQ2A 3N9SA 1Q7QA 2XN0A 3U2EA 3THUA 3KRUA 3FK4A 2GDVA 4GE8A 1ZSXA 4Y6GA 4QS5A 3W26A 5CEWA 4PYSA 3WH9A 1MRQA 4PB4A 2IPFA 4DJED 1AZ2A 1ZJBA 2ABBA 1QW9A 1Q85A 2HVMA 4UTIA 4XZLX 1UG6A 1Z7AA 2CZFA 2PRLA 2ACRA 1QR7A 1UP3A 2PU1A 4NP7A 3VGFA 3LGGA 2YCLB 1E9LA 4MIMA 3QJAA 4Q4OA 3VIKA 4IUOA 1KTCA 4G7EA 4YL2A 4KMQA 4FNQA 2VEMA 4XKMA 1WDRA 1VFMA 3CYVA 4QQUA 2VGFA 1QAPA 1YEYA 4OOZA 4G7FA 5EYWA 4RNJA 4OOUA 3ONCA 5ENLA 3TC6A 3LBMA 1CWYA 4YU1A 4DY1A 1CGYA 5DMYA 3PZGA 1KRMA 1HKVA 3DFYA 3NZ1A 4JPGA 3UXAA 5C55A 1H49A 3GKAA 1A5NC 4BWLA 1AUSL 3L2IA 4NZ3A 2WNZA 3WH8A 1SR9A 3O16A 4H2CA 1X1NA 3NPXA 2QCMA 1GG0A 3UR2A 9RUBA 1OFBA 1G1YA 4BZYA 1C92A 2IPJA 4QG8A 3LV5A 4H8NA 1B3VA 1G6CA 5HQEA 2WNNA 1KFBA 3EKZA 3JS3A 1L8NA 1E6NA 1R3RA 2QDEA 1QDSA 1T0OA 4FS9A 4GX8A 4DF0A 2JEQA 3D6NA 3P81A 1JUKA 8A3HA 3LTYA 1MW1A 3ID7A 1F9CA 5JH1A 3CZGA 2OG9A 3DBPA 3AS2A 4MAVA 1SZNA 1KGUA 2PCEA 2XJ7A 4M7TA 2R8WA 4N9EA 2CHNA 4HNCA 1RY0A 5BMWA 1WDWA 1KTNA 4CVUA 3UZZA 3AU6A 4HPNA 1TKKA 4WHBA 3AISA 2A4AA 1D8CA 1UWIA 4J2MA 1ZJAA 3GR4A 1XKYA 4C6DA 2OLAA 3MCNA 1WXZA 4FOKA 5CSRA 4Y9AA 3A9IA 1K7FA 3PTDA 3W2UA 3MTWA 1H5VA 1WBHA 2JKPA 2A3HA 3EA2A 2GFTA 4E3TA 1ADDA 3BDKA 1DP0A 4YYCA 5GNXA 4GIYA 3DG6A 3LRLA 3MZNA 1K4GA 1X8FA 4PCFA 2JEPA 4PMJA 5C7HA 4MB3A 2AL2A 4L9XA 5GVJA 2ZQ0A 3KBWA 2DH3A 3TCEA 5MHBA 2J8GA 1S3TC 3EPOA 4D6CA 3L21A 1KBLA 2J7DA 4IX2A 2PGFA 1OK6A 4TMCA 4DPQA 3WQGA 4O16A 4GUGA 5EL1A 1AQHA 3I6TA 3WBYA 2V5DA 3BGAA 1FWCC 3GXTA 2QGHA 1T8QA 4OHQA 2FQIA 3L4TA 5HDRA 4F0RA 3RJXA 3OYXA 5CLTA 2CWXA 4GZ7A 3AYVA 4NZ1A 2QCHA 4AEOA 3W1TA 3B8DA 6XIAA 1MMFA 2JQXA 4MJ4A 3KCJA 1GKRA 3M64A 5HJYA 4JNMA 4DJFD 3N4EA 3W87A 4JY9A 3BG9A 3VC6A 5KTLA 3G1HA 3TXVA 2AL2B 2QVHA 5DLCA 3UERA 4R85A 5A5WA 5CLWA 4Q8WA 3PUGA 4IJCA 4KT2A 4JEQA 4PBGA 3CAQA 1JCLA 1OINA 1KKOA 1IIHA 1KTBA 1X6NA 1DQWA 3VZXA 3TC7A 4HU3A 3C2OA 4OKDA 1TVPA 1FCUA 3GVGA 3D3FA 1ZAIA 1GVOA 4WGHA 3MA8A 4CQCA 1CLVA 5MF5A 2VRKA 2VHLA 3L12A 5KEZA 2BS9A 4KIRA 3D3AA 1SFJA 1JI1A 3H2OA 4S1FA 5LHFA 4Y9OA 3G1VA 3HU7A 1KR0A 3HMCA 4HPHA 4KWUA 1E1CB 1NF7A 4QITA 3CZLA 3L68A 5A6MA 4CCDA 1C8QA 2FYMA 1MRAA 3WNMA 3G24A 3V75A 4W7VA 3GKFA 2CZVA 1OY0A 4HPJA 2X8RA 3C2VA 2V38A 4PCTA 1LQ2A 2VD9A 5AHMA 1ML1A 2X1TA 3DESA 4L61A 3WDRA 4Z2HA 4XVEA 1UKQA 1HL9A 1NIUA 4PRWA 1DQXA 3G1RA 4H7VA 3GHUA 4XUGA 2W92A 2VWSA 1JCNA 1QNRA 2A3LA 2QT3A 2J75A 4GACA 2DZVA 1EX1A 3ABQA 5M2FX 2OQLA 1WKYA 2C3ZA 4IPNB 1MDLA 3JU2A 3QY7A 3EKLA 4IMAA 1RLDA 1ZHAA 3A4WA 3PC0A 2G50A 3KW3A 5KZDA 4DXKA 5BXTA 3C61A 1LQAA 1IR2A 2KAUC 1TV4A 1AQFA 1FWSA 4FOJA 1MWOA 2DW6A 4XBSA 3RYSA 4LAOA 4S3BA 3C56A 1LLZA 3UU0A 2C16A 2NX1A 3AO0A 3UWUA 4AWEA 3WKZA 3FXGA 1HJUA 4H9VA 2E6DA 3FVDA 5I3GA 4CKQA 5AHNA 3AFBA 3PFMA 3NTYA 1BRLA 1DJYA 1B54A 3N2TA 4R5EA 5ABFB 1EC7A 2QVNA 5J04A 1OK4A 3NZGA 3TK7A 4EWJA 3ME3A 3V1HA 7REQB 4UXDA 1KD0A 1W1TA 1O6IA 5E0KA 4YTSA 1JDDA 3QVQA 3GG7A 4Q3MA 3NDYA 2V5KA 2BHUA 1B30A 5CZKA 1XLHA 1OC7A 4GYPC 2Q6ZA 2W61A 2C19A 3OZYA 3GDMA 1OB0A 3O0FA 3SZ8A 1L9WA 3URAA 3VIMA 4BR1A 5K2ZA 1CB2A 4V27A 1H60A 1FP9A 3QXBA 4E2BA 1PZ1A 3KS5A 4S38A 2QPSA 5C6MA 1FCVA 3W53A 1EBGA 4Z2GA 1JAEA 2G5WA 3LCFA 2B7QA 3M0IA 1ME8A 2ZA3A 2ZZ6A 3TCSA 3W84A 5D09A 2BXZA 3AHVA 3HPFA 3KTSA 3MP5A 2PEVA 4RXFA 1WXJA 2Y88A 2EEXA 4A8LA 1H7OA 4OTKA 2XWEA 4XAFA 3GFXA 1KA9F 4US5A 4OECA 4JBRA 5D2WA 1AW2A 3B3DA 7REQA 1V93A 3JVAA 3QRHA 1A5KC 1E6SM 2X7VA 4DWDA 4AAJA 1TV2A 2VVNA 1V0KA 3Q45A 2WBKA 3WQ5A 2OYLA 1M6JA 3GUWA 4S2CA 4JQAA 2J47A 1YQ2A 3W01A 3VA8A 1GTEA 3QC3A 5JXQA 1MSSA 4B5NA 3TAOA 1UR3M 4IQDA 3EOOA 3LCLA 4X2RA 3L4XA 3E96A 5C2XA 1SR0A 2WSRA 3WFAA 1GOQA 1M65A 3N2BA 4QCEA 1WA3A 1XIMA 3L0GA 4ATLA 3LHVA 2Y4SA 4S39A 1DIEA 4PSRA 1QO5A 3W38A 4X9YA 2P76A 2HZGA 3O1NA 4H4IA 3KVLA 3V0UA 3NL3A 1Q6OA 4MZ1A 2DZBA 2I14A 3EDKA 3WLMA 2VR4A 3H2MA 1V0MA 1F05A 1JPIA 3IUIA 1BVZA 1P48A 1SPQA 1YADA 1XC6A 1UIOA 1VEOA 4UTLA 2VRJA 3M47A 1TJ0A 1EOKA 4JDYA 2BMBA 3SGGA 4DWSA 2YX0A 2ZADA 4WGXA 5JBEA 2W91A 1CYGA 2A21A 4LUYA 4Q8UA 4PMRA 5TF0A 1OX5A 3O2LA 4A6GA 3DHFA 4MY1A 2AMXA 2NSXA 2A1YA 2E6FA 3H22A 4MYXA 4NIRA 2HRWA 3AYTA 2O4QA 5FL0A 1E0TA 1G4SA 5E70A 4M6VA 4B5WA 4MWAA 3RPMA 3SFWA 2X0HA 3NQEA 3KAOA 1IEWA 2INEA 5AYIA 3V36A 5C0QA 4X0VA 4R9XA 3L66A 2D0HA 4QNWA 3IIOA 1I2RA 3R13A 1ECQA 1B9ZA 4FB7A 4QS6A 2WKGA 3HQNA 1IEVA 1MYRA 4LSBA 3SCOA 4F2UA 3KP1A 1JF6A 1D8WA 3VIFA 2POTA 5A6SA 1KFLA 1F8IA 4J3SA 3L5AA 3SRKA 3O7UA 2WCSA 1A0CA 4O8RA 3VMOA 2QLYA 1UPPA 5I78A 1WDQA 3IV3A 4FXFA 4IG2A 3UR8A 4EXQA 3HG3A 4F40A 4ZZ9A 1H7NA 2BY2A 4LBRA 3F03K 3WBEA 2ZWYA 4FR6A 1OT1A 4I5XA 3WLKX 3NVTA 3EEZA 1W3TA 1RD5A 4U33A 4JKKA 4JGDA 1QI0A 4Q8TA 1J93A 3J7HA 5CSUA 4DO7A 1SW7A 4ZMGA 2NWRA 1CBGA 3COTA 4TIMA 1BPLB 3VDAA 1MXSA 8XIMA 2Z1VA 1RALA 5CC7A 1EP2A 4L4PA 4AZ5A 2PP1A 4Q33A 4I9AA 2OX4A 3ZMRA 1F6PA 3QV6A 3WD4A 3IPWA 3CIVA 5BU6A 3B9OA 2J6VA 3U4FA 5LNSA 4F79A 4IG2B 4G7EB 2OZTA 4HCDA 1UZHA 3V3WA 3UZJA 1GYMA 1LG2A 3DEQA 3O15A 2XH7A 4RDYA 3CUIA 3TQKA 3VAVA 3LI0A 1UH2A 4RE2A 3KOWA 4NQ1A 1DWAM 4LRSA 2ZUNA 3N2XA 5C2CA 2NSOA 4L1XA 3EWXA 3RCYA 1CLKA 3K1DA 4UWMA 4HB7A 2QCFA 2FGZA 3CEUA 5T9CE 3MHGA 4ZOBA 3XINA 2ZX9A 2F9RA 4IPIA 2E25A 5JMUA 4C6QA 2ZX5A 3QHMA 1JF5A 2Q8XA 1AD1A 1E6QM 5FJTA 2Q8LA 5C9XA 1UBPC 2E9BA 4D6FA 2ZUUA 1P7TB 3LERA 2D3LA 3TDFA 3FJNA 3BTNA 3HQPA 2J27A 3B4UA 3MKKA 1LLWA 3PK7A 3TOPA 2Y8VA 1QI3A 1MW3A 3OBAA 4C90A 3CUJA 3BV4A 2ALRA 4D8AA 4CLMA 4FNUA 4JDBA 2NLYA 7ENLA 3EA1A 4L5ZA 1XBYA 3FFSA 4XAGA 3NM3A 3UCQA 1EGVA 3V5CA 5TNVA 1XG3A 2B31A 3E02A 1SSGA 3WJXA 1R30A 4WJEA 2Y63A 4E38A 4PBFA 1DJQA 5I00A 2PA6A 1A5AA 4XAPA 3Q4DA 2QXWA 5EMLA 1DXIA 4EACA 3W37A 5DRCA 5GNZA 3R8RA 1LL6A 3IACA 1SZEA 4KEUA 4RE4A 4AQLA 1AQMA 3CIXA 1C9WA 2CCRA 3GVQA 3SCTA 3MHFA 4DAFA 2OKTA 1OIMA 2C91A 3P8JA 4L9ZA 3WF2A 3OZOA 4LW7A 5DN1A 1MUCA 1GGOA 3QSTA 1OFPA 2PURA 3N2OA 3SJNA 4AIEA 4RXGA 3RCNA 2WZTA 4XAZA 2D23A 3ZWTA 3N73A 4M6UA 1OGGA 1Q5MA 3W6LA 4RDZA 2DUAA 1AH3A 1XUUA 4MB4A 4YTUA 4ZB2A 4P8UA 5IDIA 1SZRA 4O54A 3W85A 1K9TA 3CM4A 2PAJA 3U0HA 4Y9PA 3SIZA 3OZPA 4KRTA 3EMZA 3O06A 3WLNA 1R2TA 4CQAA 5HK4A 2XFYA 4I9MA 3LRMA 5LNVA 3UVAA 1V5XA 1FDJA 2WBGA 3IJQA 3TN6A 2GUUA 5CPLA 4R7JA 4A35A 4PMYA 2W62A 4IQLA 3SW6A 4H9XA 1S2UA 4H8VA 3U5UA 1ISWA 1Z44A 2ZBTA 1MEWA 3WMLA 3THCA 2XGZA 2PUZA 3R58A 4DNMA 3S2NA 2ZRXA 1V6UA 4C6LA 3F1QA 5I09A 1WKFA 4FLRA 5D4YA 3A64A 1H7PA 3KTCA 1AQ0A 2CLEA 1EP1A 5A2CA 4U10A 3SRDA 1MFVA 3VCNA 1TJPA 3CUGA 3PP7A 2D22A 2BBFA 1XFCA 1NM9A 3K1GA 2ISDA 1BF6A 1R7AA 4TV5A 3GLCA 1A5UA 1B3XA 1BF2A 1EWDA 4I5RA 1EF2A 3W73A 4B91A 1XRTA 5D2VA 3WK1A 3P67A 2J9YA 1JCTA 1MUWA 3HMJG 1TQJA 4Q4QA 4K8EA 1F3XA 4LUJA 4MUZA 5XIMA 3PWGA 3SGZA 2DSUA 5FCZA 1Q6GA 4ZE4A 3FEMA 3V5OA 2CFFA 4X60A 1EGZA 4Q4RA 2VRQA 3VU2A 3AI0A 1F76A 1A5SA 4GBUA 3VD3A 2PGRA 1HXJA 4IHCA 5LIUX 4M6PA 1G4PA 1XGEA 3L0NA 2G96A 2VL4A 4NL1A 4UFHA 4LUSA 1O66A 1SUXA 3KOZA 3DAQA 1EJUC 3PUEA 2FPYA 2Z2UA 3RMEA 3IGUA 2CWNA 5JIWA 2G8ZA 3BLKA 3NAVA 3PWIA 1JL8A 3E0IA 3C5QA 3N6JA 1AL7A 2PCQA 2Z1BA 1OG0A 3VIPA 3LQGA 5BMXA 1IGSA 4IIDA 3LY0A 2W4XA 1I9CB 1G7UA 1XFBA 3NPVA 5A69A 3S2LA 3VD9A 2Q01A 3IGHX 3W28A 5LA1A 1YW1A 2HEJA 4I7VA 5KINA 3GR8A 3L2LA 1B4KA 1KCLA 5HQMA 1W8GA 4N4PA 3IVTA 1VEPA 1X6UA 2OT1A 3HV9A 5A94A 1LWIA 5BZAA 3RDKA 2V2HA 3UA3A 4CQ8A 2CW6A 1PYMA 1C90A 4K39A 4RE3A 4JL2A 4AUBA 4RZBA 4QE4A 2WVTA 4LNYA 4KKXA 1G4EA 1H0IA 4M56A 5IFPA 1ITXA 3CB8A 2OKOA 4AYSA 1A3XA 3BE7A 3V35A 1JUEA 3AMDA 4LF1A 4P5UA 3BCFA 4EANA 5LIWX 4PEEA 1MNZA 4DO5A 1O1HA 4GYJA 1ZFJA 2ZZ7A 4YHEA 3PM6A 4C6PA 2HVNA 2ZTKA 2Z4GA 1V03A 3AJ7A 3DU0A 4C1KA 1OZMA 4TV6A 4LEFA 2PC4A 3W7EA 2WZHA 3EX3A 4LAKA 3M0HA 2QJGA 3W1AA 2XIMA 5HOSA 1GVEA 2EKCA 2V5BA 5F1VA 2ZUMA 2ZICA 3NZQA 1HJVA 5D37A 1WUEA 1Z32X 3OLGA 2ZZ5A 2GJRA 2J79A 3WF0A 4YTRA 3TV8A 1B3OA 2INZA 2WAGA 1X96A 3N34A 2C79A 3WJYA 4C5YA 2PDXA 1OSEA 3LS9A 3SCRA 4JYFA 4LV4A 4QSFA 3T0TA 1XCXA 4KWOA 5D03A 1UKPA 2BHYA 1KLZA 2CIPA 4LVBA 4ZCWA 1XPGA 1K70A 2PDLA 3P84A 4A29A 4L4OA 2P10A 3ZR5A 3WDIA 4ZTYA 1EO5A 1J0YA 2J77A 4B5XA 3IJ6A 2TODA 1H7RA 1RHCA 1VCFA 2PF0A 1DIKA 1GWJA 1OIFA 3P14A 1V6XA 2HCVA 3P5YA 5TAOA 3TR2A 4D6EA 4W84A 1WNOA 1V3IA 2V9DA 5GQBA 3HURA 1F4AA 4PUNA 1FWHC 5DXYA 2WNWA 2Y0FA 3I4EA 4UNKA 1QO2A 2X09A 1WB0A 3MUY1 3WENA 2WO5A 3WYZA 3A47A 1VB9A 4DELA 4WSHA 3N13A 1UWAA 1V51A 5G1MA 1H0GA 3H4WA 2BVDA 3T4CA 2WMJA 4AD0A 3S9YA 2HXTA 3HJZA 1J4EA 2CC0A 3L4VA 3N11A 2R14A 1QFEA 4NI3A 3CL7A 1EX5A 2A3EA 1ITCA 3MV11 5CAHA 3VNKA 4F9JA 1BSIA 2VGBA 2X2GA 4KEVA 4BI7A 1FX6A 4DJDC 2BB0A 1XV8A 4IGMA 2JBMA 2QDHA 2YR1A 3U2CA 4ZOAA 2DVUA 1YDYA 2VC5A 4E5TA 1M5WA 4HN8A 3ZSSA 4L6OA 1JQVA 4IISA 3T2PA 1BGAA 1C91A 1YE4A 1UR2A 5IDZA 4G9PA 2AKMA 3TFCA 1D3CA 2VDIA 3SCNA 1SJBA 4RPQA 1TIWA 5IBXA 1TWDA 1HJXA 4L56A 4BK9A 2XGBA 1VS1A 3KOYA 3EBVA 3TXZA 4C6FA 1GQLA 1KCKA 4CD7A 2XM1A 1BG9A 2NQLA 2FPTA 5A2BA 1GZJA 1W5NA 1P0NA 4W87A 1CI1A 1NELA 4HK6A 3WNKA 2XGIA 3M0YA 1MXGA 1F4HA 3URBA 4W88A 1A50A 2QGYA 4JCMA 4NJHA 1HQTA 1H7XA 2XIQA 4EX4A 5I02A 2VC7A 4XQ6A 3ZQ9A 3VGGA 1EJTC 4AY1A 1RQEA 4Q8VA 3KRBA 3MUIA 1HJQA 5CH9A 1VGAA 3H23A 1YPIA 3RMJA 3RNDA 3WD3A 4LVFA 1TWSA 4IIFA 1E9YB 3QYSA 4OJYA 3GIQA 1XIHA 2VGIA 3MDWA 1PAMA 4HOZA 1YTKA 1M53A 2VZSA 4KF1A 2WNQA 4ORMA 2UV8G 2DT3A 3C6CA 1WYIA 5C7VA 1XP3A 5HMSA 3SM0A 1LM1A 5U7SA 1TVLA 3TLLA 2ZZ2A 5EBUA 1RR2A 3MP4A 1OCNA 3B4YA 3QMTA 4NAFA 2UZ9A 1R3YA 2OJPA 1VFOA 1KFEA 1V3LA 2FB3A 4NRRA 4RL3A 1P0DA 1BWLA 4FR1A 4P7LA 2PDMA 2E8ZA 3L0KA 5I3KA 1N8IA 3AUJA 2BHZA 4ZSTA 3PANA 4LUTA 3CV7A 5CPMA 5JH2A 4XD3A 4EXBA 3N3TA 4QQ3A 2DV0A 4NSBA 4GVFA 3LMYA 2ZWZA 4PTNA 1JCMP 3VOFA 2IKIA 2I1OA 3PTMA 1UD4A 4WOQA 3NO5A 4GQQA 4LAZA 1VJIA 4J40A 4ZQOA 1LDCA 3TYZA 4R3UA 4XZMX 2JKEA 1A3WA 5C9RA 2FZMA 2CXGA 2Q02A 1TPC1 3AHZA 4EPDC 1AL8A 4W5ZA 5DFAA 2H8ZA 3HQ1A 3M5VA 3SSJA 1S1PA 1D7FA 1J0JA 3GU9A 2I7GA 2ZZ1A 2BNJA 3PHAA 4B5SA 1LTDA 1EZWA 1BEUA 2J7BA 4AIBA 4YPJA 4JTTA 2CZDA 3HO8A 1LQ0A 1HG3A 3VYLA 1ISZA 1JR1A 4AY8A 2FMNA 3NFUA 4JIIX 5F7UA 1HKKA 5XINA 4IJBA 1TO3A 3E3HA 4ZR8A 3DG3A 4O19A 3VKDA 3M0JA 3AS1A 4UMAA 3YPIA 2G4JA 1PSCA 1K02A 2J7EA 3WQCA 4R27A 4HZ6A 1OCQA 1LF1A 3PZNA 1R2SA 1PKMA 1O95A 4R33A 3R25A 4ZENA 4ZQNA 4P7NA 1Y8BA 2ZA1A 3SN4A 1VFUA 4JQ4A 3B0PA 3E74A 4MWAB 3W7CA 5BU9A 2VENA 1E15A 2UY3A 2GUYA 3AHYA 3UG4A 5D9NA 4ZOEA 1JG9A 3LPOA 1Q6RA 3B04A 1I2OA 5D2YA 4DF1A 3P74A 3LGDA 2UWFA 4CCZA 3EDEA 4E8DA 1TPWA 3A5FA 3NOYA 5HXMA 4Q4KA 2Q71A 4QJ4B 3SECA 2C7FA 2O9OA 3KS6A 1M04A 2YXGA 3UG5A 4JFWA 4UQDA 3T07A 1GNXA 4P8WA 3B9AA 2WMFA 5HNTA 4YWSA 1JIBA 4F0KA 1WZLA 3FHAA 5BOEA 1S5VA 1UQZA 4ADSA 1M7JA 3PB2A 1RBLA 2YZRA 4Q7IA 3DHDA 1IZKA 3O6CA 3ARWA 3KBVA 1H41A 1KFKA 3M16A 4O28A 2XVGA 3LV6A 5CSYA 3DKJA 1DVJA 2DZXA 4KGJA 5IHRA 2D1ZA 1IXOA 1IHIA 4LF2A 1GOMA 5KZEA 4O1DA 1REQA 1ODUA 5HJLA 4INFA 3KVKA 2PI6A 2ZZ3A 2RAGA 3KDOA 1E5NA 2DW7A 4GABA 1LL7A 4JEJA 3VNDA 5F4XA 3VNJA 1ONRA 1FY6A 1XQKA 3G8EA 1LYXA 1WUFA 3B8VA 1XDJA 2H9AB 2QCCA 4IGNA 1GORA 3VD5A 2CETA 1EC9A 3S3GA 1E0UA 2QV4A 4G5DA 3DZ1A 4RX0A 1RAKA 2VQUA 4P7RA 1LUCB 5EMUA 4N7QA 3BAXA 4Q4MA 2POZA 5BNKA 3ZVIA 4C6IA 3WQDA 5F2IA 1OX4A 1M9HA 3AHXA 4NU7A 1RQBA 4QSHA 2EPHA 4QG9A 4PE8A 2BLEA 5DEZA 3MB9A 4XD5A 3CHVA 5E6ZA 3GTXA 3W2NA 1JPHA 3E9AA 2NW0A 4CN4A 2ISWA 4CQDA 3OGSA 3GW3A 1E1FA 2PWDA 3ALFA 3W7OA 1PKLA 2HE8A 4GVIA 5EFDA 2PDFA 3RCMA 1CXEA 3GYCA 4S23A 1E72M 3M0VA 4QROA 3BGJA 1DBTA 1J0IA 3KCLA 3P60A 2J9XA 1XLJA 3LXAA 1E0VA 4Z1DA 4E2DA 4LY8A 2CXEA 4MADA 4BWLC 4KIEA 4X61A 4GIAA 4PEKA 2A7NA 1LROA 4GH1A 1NF0A 1V6YA 1AMKA 1I60A 3SY5A 3UR5A 3SCUA 3UNTA 5EMYA 3WNNA 1A80A 2EXOA 3CK5A 4H6EA 4IGSA 4MOZA 1DJXA 4OBTA 1O5RA 2VX6A 3O6DA 2NUXA 1DWJM 3S5YA 1MI3A 1ZJHA 2C8NA 3DECA 4GXWA 5E9XA 2D0FA 1JZ4A 3NSMA 1A49A 1GVQA 3S83A 4FNTA 3E2SA 5IBXC 5K4XA 2NV1A 3CQJA 4MHBA 1V6WA 4FXSA 3TW9A 2VD8A 4I8DA 1DJWA 1IF2A 4TXEA 3C2EA 2NQZA 2AGTA 3QGVA 2JF6A 1QBAA 1B2YA 3GY1A 2GSEA 4LVGA 1MEHA 3BZJA 4PFHA 2IKHA 1C7SA 2XVNA 3PSWA 1BGGA 1XLBA 5CJ5A 4M19A 2VJXA 4JTLA 2BTMA 2V2CA 4GYKA 4A22A 1L6SA 3AROA 4P8XA 4JQ3A 3NDOA 1QASA 5T26A 3TP4A 3C2FA 3NQBA 3PZQA 4NX5A 3F7JA 4HPXA 1BWVA 4URIA 4IP5A 1TG7A 4OBRA 4JTQA 4CNTA 1TPH1 1X7IA 3A12A 4LQ1A 3PFRA 3GXIA 3JZUA 5TD4A 3DYPA 1OFQA 1KC7A 3LENA 2X40A 1OFAA 3BMVA 4WXYA 1JCJA 4Q4SA 3BSHA 5BWFA 5LGZA 1GVYA 5FEZA 2Y61A 3N12A 3CV6A 3RK8A 3SUTA 1ZQ5A 1KFWA 3LPFA 2HROA 5K9DA 4HU4A 1N8FA 2QR6A 1EPXA 1VYRA 3KE0A 3H7VA 3FKKA 4RE0A 2XYLA 3W1UA 3NQGA 1Z48A 3VDGA 3MVTA 1ZBVA 4PMUA 3WLPA 3B05A 4RR4A 4AISA 1CB7B 1QMLA 2QJJA 3E5PA 4GXPA 1LBMA 3QQWA 2GSJA 4NASA 4B3KA 1I2NA 3WBWA 3ZR6A 3VIIA 3SDOA 1HP5A 1R3QA 3CHDA 4H9MA 3GDRA 3VNLA 1QOXA 2DGAA 4FNRA 2GGEA 5DQPA 3NO1A 3B03A 4Q8OA 4B5TA 3STGA 2VMFA 4KETA 2QCDB 2WMGA 4IMDA 4IL2A 5J8LA 3SURA 3U9IA 2FJKA 1W3JA 3AMLA 3GC2A 3MI3A 2Z1KA 2PBOA 3TLQA 2AQOA 3EXRA 4W7UA 1XKJA 3PPFA 1TV3A 4WLCA 4DNHA 2J7CA 2WANA 2O9PA 2EO7A 3TQVA 1UWTA 3W25A 3LGEA 1A4MA 1L6WA 4GNKB 1GJPA 3DUGA 5I23A 2DSWA 1XBVA 3QPZA 3HPZA 3M0ZA 5AC8A 3LUTA 2ZX7A 3UFYA 2FMOA 4NG3A 3ERPA 3I68A 4OV4A 2G3JA 3PZVA 3BK0A 3P62A 3DXIA 3MMTA 2PTWA 1TPUA 1UYQA 1UZ1A 2C71A 1BXBA 3DFPA 2ZRUA 4TX6A 4YXGA 1GKQA 4S3AA 5BRPA 2QS8A 3HJEA 8RUCA 1TWIA 4WVXA 3GU1A 1RCOB 3T8QA 2XHYA 3RG6A 4UBPC 5A8PA 4J3VA 4P7QA 5I6SA 4D9PA 4RNFA 1J0ZA 1I75A 1GEHA 2IKJA 1IQ8A 3UQNA 1HKIA 5DXXA 1OX4B 4CNNA 3OG3A 4K38A 1Y5XA 4CCCA 5XIAA 2F6UA 2WJFA 5DANA 4UTWA 3IAPA 1R38A 3GDKA 4GOAA 4MAZA 1S5WA 4W8LA 4LS0A 3WK0A 2VFFA 3EWUA 2O9TA 4AMCA 1XW8A 1ZRQA 3TOYA 4IZGA 3ABXA 1N82A 2NXIA 2J66A 1PHWA 5D30A 3K8KA 4REQB 1NH6A 4H9TA 1EJRC 1B3ZA 2QPUA 1LZOA 2R1MA 2DZTA 5DELA 1AZ1A 4B5UA 3WK3A 1E5JA 3KOXA 3RITA 3CMFA 3W70A 3WK2A 3LLXA 1CXLA 4PFMA 4ZO8A 4D8LA 3MU7A 4N0RA 4CVWA 3GH7A 2WSYA 3G2GA 1JQXA 1I2QA 2FLIA 4H9YA 3ITYA 3BSGA 5FKYA 1J5TA 1ICSA 4P8VA 4PMXA 3LHZA 4GGBA 2BP1A 3CTTA 1BTCA 3NDZA 4JIHA 2VFGA 1ZCCA 2QF8A 5AYXA 4IX0A 5FESA 1IXPA 5CPSA 2OQHA 3AS3A 3QV7A 1IZCA 1DJGA 3BJTA 3LD5A 3TJIA 1K9EA 1IWPA 4B2DD 1W32A 4PR4A 3IRSA 1VBRA 2CZ5A 1IXNA 2D69A 3QLLA 4JX6A 2PZ0A 1XDMA 2WPGA 2DSKA 1FWDC 4O1EA 4FF5A 3BQ6A 3VABA 1LRQA 1T41A 3GD6A 1J10A 2G3MA 1RH9A 3CPRA 3ZXWA 3W6MA 4GRSA 1YMYA 1UH4A 4KFNA 1K03A 2J13A 3HB9A 1FOBA 1TIMA 2B7NA 3MWCA 3VMPA 1UD6A 4O52A 1XXXA 3BAJA 5HULA 3RM9A 3F5KA 3L65A 3ICJA 3MYOA 4ZGYA 4WRHA 3DHUA 5AZ0A 2FZNA 1LWHA 3TJXA 3CUHA 1LT8A 3E2QA 4YJ5A 3MT1A 4MM1A 3MMWA 3UXIA 3SY8A 4E0CA 2YL9A 3R94A 1DIOA 4FX8A 1GOKA 1EO7A 3NL6A 2BGQA 4MY9A 3AAMA 3CJPA 4A21A 3KZSA 4NXSA 1RY8A 3UESA 3KZPA 2O56A 5SWUA 3P6LA 4S3EA 3VTRA 1WQ5A 4UB9A 1F07A 4PCPA 2DJLA 4MNKA 4OE7A 4FA3A 3GHRA 4DN1A 2BOEX 4XBKA 1LRTA 1SZFA 2XH0A 1QATA 2BVTA 2Q8ZA 3SQSA 1WXYA 1UR1A 3BAIA 3BLPX 4KRUA 2PTXA 4AZGA 1U1UA 2ZX8A 3A9BA 1KM1A 1OEPA 3B9NA 3V5FA 1LLOA 1XS2A 2EQDA 1WKEA 2CHRA 1OWQA 1KBBA 4FI4A 5A8MA 2WOQA 1E71M 3P3BA 2ZRYA 1I45A 3CH0A 4K36A 1H51A 4QJ5B 2ZC1A 2H3DA 4HMCA 1BSLA 3G0SA 2RUSA 1JD7A 4PSPA 1H62A 4CQBA 5KMYA 4G56A 5GJPA 3EOEA 2QIIA 3WLSA 1E56A 4NNCA 3KDNA 3S1WA 4UTUA 2IUZA 4KCVA 2GJXA 2BG5A 2VC9A 9XIMA 3CAWA 4YLWA 1ZBCA 1MQPA 1MO0A 1XYCA 3WNPA 3VO0A 4IMGA 3TIMA 1Y5VA 5BOOA 2FHCA 3TTEA 3KM8A 4O11A 2VEGA 3LPPA 4AY7A 3W2LA 3VDHA 1O5XA 1V6TA 3S5NA 2PDGA 3UXDA 4WJXA 3R0DA 4OVXA 1JZ6A 4XX6A 3MZ2A 2XU2A 3S5OA 1Q4WA 4XAYA 2P88A 3URNA 2JGQA 3LPGA 4CUCA 5BOFA 1UWUA 4YN5A 3SN0A 3KFTA 5CZTA 4UTJA 4YNGA 3EDJA 3R10A 3IARA 1GVRA 3DI0A 4H01A 3T40A 3QBUA 2QUUA 1XH2A 1CNVA 1F3EA 1FXPA 4CNUA 1W5QA 3M0KA 3LN3A 3L5MA 1FHVA 4O0ZA 1EJ7L 3VZZA 3W7GA 3W7MA 3N9KA 3DGRA 1E6XM 1V0NA 2C1GA 1FH7A 4QEHA 2Z2BA 3RJYA 3IAQA 1R2RA 3ARQA 5A6BD 3C8FA 1HW6A 3ZJ8A 4J28A 1X97A 3FVMA 3TJ4A 1W9PA 3RAOA 1TELA 3NIYA 1FWGC 8XIAA 4GI9A 3OP2A 4JN8A 4TQTA 5J5DA 4D6DA 4ACYA 3VNZA 3BH4A 2G4FA 2GQ3A 4PGLA 5T91A 2IKGA 4IPPA 2HSAA 4DBDA 4GQRA 3SADA 2ZVRA 1GOOA 4HCHA 1W2VA 2YBTA 1DHPA 4M6QA 2VM8A 4ERAA 2ALDA 4WOZA 4H7CA 4ENLA 4C6EA 3EKGA 1M1BA 4XD6A 3NWRA 3TONA 1NQ6A 1J2WA 2IXVA 3TYEA 3LCXA 3U57A 3F2CA 2B81A 3QH2A 5E93A 4I9TA 5DY3A 1RVKA 4WKHA 2XIOA 3W7IA 4XSMA 2WVVB 3S6DA 4HZMA 3BMWA 5AC5A 5JUVA 3RFAA 4GGHA 3B0VC 4C65A 5HR6A 2YDAA 2ZTJA 3BCJA 1DYSA 2PU0A 2E5BA 3CV2A 4HGXA 1VPQA 4LYQA 4WSJA 2GVYA 3CPGA 4DVOA 5DO8A 1D9EA 1PWMA 5JBDA 3W22A 2Y5EA 3GXDA 1KO0A 1B57A 4YIWA 1UZ4A 4LCQA 4IIHA 2WJZA 3BOLA 4GQBA 5G4HC 2YKKA 3ALGA 1UZDA 3EX1A 4Q22A 4CGTA 1R3WA 4CNOA 3PBVA 2YW3A 4AG0A 3BJFA 2XSAA 2Q3OA 1GZGA 3MJMA 3PB0A 4XG1A 3OLDA 3VIJA 2Z1WA 2JK2A 3SRFA 1KM2A 2E28A 3PTKA 2DP3A 3BGGA 4HBKA 2VELA 1XSIA 5FJPA 3TX9A 3QN3A 2PWVA 3O6YX 2XM2A 4JTUA 1Q6LA 3W83A 2BFGA 4Z2IA 2J78A 1KCXA 3QZAA 1XLKA 4QRNA 3A4AA 3GTFA 2IPWA 1XDLA 3AIEA 4ZTXA 3OZMA 2CU0A 3O0KA 1FHDA 3BG5A 4JR5A 1TTJA 1K7XA 2VZVA 2D2HA 5F2MA 5A8NA 1EWEA 3PVFA 1XD0A 3I3EA 3N6QA 2CLMA 2FHFA 3PR2A 1S2TA 2C6QA 5LA0A 5I3JA 1E4MM 3PZTA 4BF5A 4DBUA 4ATDA 4IICA 4DWSB 3W02A 2R91A 4JTHA 2DZWA 1DTUA 4MJMA 3FDGA 3I4KA 1JDCA 4HSOA 3UWZA 4O15A 1VIZA 2Z6IA 3CHEA 3L4ZA 3QHOA 4JL1A 4US6A 1B90A 2R24A 2Y62A 3RO6A 4NNBA 4DB7A 4EK7A 4MF4A 4LJ3A 5CQ1A 2VZUA 3NZPA 4XZBA 3W2MA 3VGEA 1TJ2A 3THDA 3T0AA 1XLMA 3DFTA 4R34A 3CC1A 1B4EA 4UQCA 1EDGA 4MLRA 2BZNA 3ZOAA 4JTCA 1S46A 1KFJA 2PWEA 1MQQA 4J4KA 2IMRA 3OG2A 1AFSA 3ATYA 4PUJA 3W81A 4TMBA 3UGRA 3N1AA 3NURA 4Z2JA 4C7DA 1S39A 5CBJA 4MPKA 2PD5A 5DMLA 1W3LA 1J01A 3MO7A 4JNZA 4J3XA 4ZQCA 4F48A 4DJEC 2Y8UA 1G9HA 4Z42C 2ZKMX 4DLMA 2GJXB 4DWSC 3CTLA 4B2DA 1X6LA 2H9AA 4D6JA 2YCIX 3N19B 4IMFA 2YCKX 2GQ8A 4KFOA 1FKWA 1RBAA 2J4GA 1XJBA 4DZ5A 3PN8A 4YCPA 1E70M 3PZMA 3FA5A 5A95A 5FF0A 1XYAA 1OGSA 2E9LA 3T2OA 2AQWA 3MY9A 4DO6A 3LHTA 2E77A 1JDEA 3W7RA 5A2AA 2D24A 2QEZA 3C8NA 3SO7A 1AVAA 1OCBA 2V3DA 4GCXA 4LH8A 2OOGA 4HHLA 4O0QA 1LOQA 1XQLA 4DI9A 2EJAA 3OU8A 1OADA 3CNYA 2YA0A 2NT0A 2X1UA 4IFOA 1BKSA 4BCEA 3QMSA 4JFUA 4UR7A 4JY8A 3IVUA 4L4LA 2FVMA 4H3DA 3VC5A 3L4UA 3FKRA 4ZB5A 1EPVA 3W00A 1BXNA 1YHTA 3TH6A 4YYFA 4UQBA 3S6TA 4GJIA 1OVDA 2WMIB 4YMZA 2C15A 3BW4A 3HM7A 4JHMA 4JAWA 4DLFA 3TAKA 5C54A 1Z69A 4A2SA 3AICA 1QXLA 3UWVA 4E3VA 2EKGA 4W5UA 2BODX 1RK5A 5IRPA 1GONA 2QYGA 2J74A 4GJ1A 3WQEA 5DX7A 2F8QA 1YXCA 1ZGDA 2XVPA 1W56A 2X1IA 2J6XA 2X42A 4QP0A 2HE5A 1EGMA 4QBXA 4LC6A 4IQJA 1Y7VA 1R7OA 4JN6A 1TV5A 3VUPA 4MSSA 1VH7A 3DN5A 1JYWA 2WZMA 3STCA 4C6CA 1EB3A 2E4TA 3U2ZA 2TSYA 4EOUA 2NXGA 1EA9C 4XO7A 5K7JA 3VDBA 2NQJA 1C8YA 2EPKX 3QC0A 2Z6JA 1AJ2A 4HYWA 1VKFA 1ISYA 2R94A 1S5NA 1KKRA 2Y1HA 4D6GA 1FH9A 5BYWA 1HFBA 3FSTA 1XRFA 4KS0A 2PS2A 4F66A 4A3UA 3CAKA 3I7RA 4QISA 4XZ9A 1H11A 1NDVA 4QE1A 1ITUA 4F4RA 3ZZ1A 3SUWA 2TYSA 3CS2A 5FF3A 1KV5A 4W93A 3S1UA 1TCDA 3C4UA 5ABHA 4GNJA 1WP6A 4D1JA 4LBSA 5B80A 4MNJA 2PDQA 4BEQA 3LOTA 4C7GA 1MZRA 3MUAA 1CEOA 3DYMA 1VAHA 3CO4A 4XISA 1GQNA 3QV9A 3ANYA 3EOLA 3KLLA 3AIWA 4MFDA 1VP5A 3W76A 1GVFA 2P5NA 4JYEA 3K13A 1FWWA 3C86A 3H2AA 1LOSA 3AMKA 1FWEC 1YNYA 2TRSA 5DRIA 4M8UA 3NQ6A 1G4TA 3M41A 3QZ6A 1M3UA 1XWYA 4HKPA 3S47A 4EAMA 2WLZA 3SCVA 2OX1A 4M24A 1KWKA 2PTDA 5C71A 1QK0A 4UOZA 5CAKA 1HGYA 1L6FA 1HUVA 4JOMA 5LA2A 2EG8A 1EUNA 2Y6ZA 3AC0A 4NILA 3AMCA 4N9BA 3W7LA 4C6BA 1Z9AA 4M0XA 1XIIA 4DYKA 6ALDA 1VF8A 3MKVA 2BWGA 1VBJA 3ZWSA 4U2ZA 3WUFA 2WSKA 2NUWA 2GPTA 3IWPA 1KRAC 4WCJA 5G1TA 3W74A 3ISIX 1RP8A 1OFEA 3G0XA 1U83A 1T40A 4PRTA 3BICA 1L2UA 2HS6A 2V3GA 2JALA 3H54A 3KBNA 4Y8FA 3ZM8A 4X63A 3NYZA 2X30A 3HBLA 3M7WA 1PKNA 3QLDA 4BFAA 1VYSX 3GVRA 2YZ5A 4DJDD 7TIMA 1GQKA 1K9DA 2QCDA 1VHNA 2VUNA 3CWHA 4RZ5A 1A5CA 4UFJA 1XIFA 2R9RA 3C3NA 3FSUA 4GI4A 4K1GA 1EKOA 1UUQA 2D2OA 2QQ6A 4QDWA 3RGTA 5TBOA 1RJRA 1ZP4A 2PF8A 3G6MA 4JQ1A 1Z89A 4PTMA 3PUDA 3APGA 3CGTA 1BXCA 3G0UA 2PC8A 1HKJA 3GXMA 2YYUA 1NOFA 4QDMA 2X1RA 2PLCA 2A0NA 4JIPA 4RUBA 1VFTA 3M7SA 4GIRA 1JJKA 1XLGA 3UG3A 2I17A 4DF2A 4GFIA 3ABRA 1W5OA 1J96A 5HNNA 1WOBA 1MXDA 3TQPA 1CGVA 9XIAA 4DM1A 4WKFA 1FKXA 1TZ7A 3D5HA 3KP0A 2UY5A 2X0SA 1P1XA 1X1OA 3QYQA 1TVNA 4HMDA 4LTSA 4D8ZA 3SUVA 5HMFA 1E3ZA 3A22A 3DFHA 3STFA 3BXWA 5G1YA 4MJ2A 4HNNA 1V7YA 1FHUA 1X8CA 4NAFB 3KCOA 4XTIA 7CGTA 3SSZA 3U3HA 3SB0A 3RRXA 2VDHA 3PNZA 4HNUA 2YFNA 1G01A 1XSJA 5AHLA 4O53A 2OSXA 4IPLA 4FEZA 3ITXA 4GUJA 3FJLA 3NQ7A 1E40A 1UD2A 3TW7A 5EKYA 4Y9MA 2XIIA 4UUIA 2Y7GA 4Z1BA 4HU0A 2TMDA 2E9MA 2WLYA 1KXVA 4EP8C 2NVDA 1VPYA 3HQOA 1A3HA 4JX4A 1UR0A 4IFRA 5LKYA 2E67A 5LNUA 2DIEA 1UOKA 2QAPA 5A6JA 1GHSA 3LCIA 4AEFA 4YHGA 5H8PA 1FRBA 2INFA 1W1ZA 1TZ9A 1A5LC 2OCZA 3WQ6A 1ZBWA 5HWMA 1KBKA 3LSBA 4OIFA 4G6CA 3TNBA 3NSXA 4OV9A 5FF4A 3RU8X 1QT1A 2ACSA 3UWEA 4EPKA 1C9DA 2GZXA 5LNRA 1K1DA 3F2DA 4K68A 3W1QA 4ADUA 4UTHA 5TIMA 3NGFA 1J0HA 1R9ZA 3MS8A 1E73M 1EJWC 1THFD 1Y5WA 3EWDA 3EB3A 1MFUA 3VX1A 1AMYA 5CGTA 3ZYZA 1FXQA 4IMEA 1P43A 1XIEA 1O5KA 3ZJKA 2WM1A 2WW5A 3RPTA 4AMAA 1UASA 1R3TA 3PBYA 3VINA 2O4MA 1IGWA 1TUXA 2GL5A 4FK9A 4OBSA 3I3DA 2PP3A 4FXJA 4N6EA 3DIPA 1IT0A 3STEA 3DC0A 3PG9A 1W0MA 5D2TA 1HP4A 3C52A 4PZVA 3HPXA 2ZC8A 4IP4A 4GO8A 3K30A 1FWFC 3M5ZA 2DT0A 2VCBA 3LNMA 1KGWA 1J0KA 3MI6A 1TUFA 3GK0A 3MCOA 1SFLA 3TTSA 1JZ2A 4XK2A 1GPWA 2OZ0A 3W7DA 2HNHA 3PAOA 1LT7A 3R6IA 3GM8A 3WL1A 4FIQA 1ZB5A 4D2JA 1PZ2A 3MMDA 3S5SA 2OWCA 1SYTA 3HA1A 1S5MA 3UD6A 1XX1A 3RUBL 1MVYA 3AS0A 5AC7A 1BAGA 2RGMA 3UXLA 1CLXA 3GFYA 5I24A 3JUGA 4GKTA 1H1NA 3E0FA 3GAKA 4XIAA 2O7SA 5JIPA 4UTFA 4K2SA 2VZTA 4I90A 3OGRA 3WUBA 2GVLA 4D6HA 3G1AA 4AZBA 5FJJA 1XH0A 1QWKA 3DG7A 4PL1A 2G0WA 1X7FA 3UR7A 1E55A 1GYLA 4PMDA 2YDSA 9CGTA 3GNRA 4Z1CA 1U30A 4PTVA 1JPKA 3T1GA 4GH3A 2B7OA 5I3FA 2FVKA 1PX3A 2CPUA 2IS7A 4YVXA 5DCDA 1QHOA 1YYAA 4UTTA 1WAUA 2YL6A 1XYZA 4IXHA 1H7WA 2ZOXA 2Y2WA 3QHNA 4WDXA 3O6AA 1LJYA 3BW2A 4B90A 3AQUA 1UWSA 2PFHA 2R82A 3VOGA 4ZXOA 4OQVA 2R1PA 2Z7GA 2ZE3A 1ZP3A 4S3KA 3C0LA 3OLIA 3M0MA 2OQYA 2RGLA 3TU9A 1OYAA 3B0XA 1CCWB 3O63A 3AALA 3PJTA 3PULA 2WM0A 3T55A 1JI2A 2J62A 5C5YA 5C9WA 1NEYA 4QJ3B 2DSZA 1U1JA 2E5DA 3UNDA 2IXUA 2J88A 1LUCA 2QCNA 3DX5A 2HWGA 3SN1A 1PYFA 2OYMA 2PDBA 3DGBA 1YTEA 4MVAA 1O94A 1F6KA 4D71A 1RCQA 4AZ6A 4DZHA 5EA9A 4ZVJA 4J27A 4G2DA 1M7PA 2HK0A 3GDTA 2REQB 1UA3A 4Q6XA 2V2DA 5M3WA 3MDUA 3EYPA 1E6ZA 4BA0A 4MPQA 4P7OA 2W6RA 3LTSA 4QLJA 4HCLA 4I6VA 4BQ5A 4ZO9A 4N6FA 1ZNNA 4S3DA 5CC5A 2ZFAA 4MUPA 4B3LA 2FPVA 5HQLA 3VUSA 1NVMA 2DZUA 1AG1O 4Q7NA 4UCFA 4AFYA 2B4GA 4HNVA 1HL8A 1DWIM 4KCTA 1EOMA 3ELFA 3HV8A 3VD4A 3GBDA 4JTGA 1VBHA 3TWBA 1PDYA 2GUBA 1CDGA 4MB1A 3T6CA 4U3CA 4TVCA 1BLIA 1VENA 2HDJA 2O92A 2WVUA 3O07A 5A6BA 2C18A 3MBFA 3B0UX 5ABGA 3CQKA 1P7TA 4Y90A 2RJHA 4PUKA 4H83A 4NJJA 4J3ZA 2ZCGA 1ONXA 4FXRA 1E4LA 3I6EA 1XCFA 1NQKA 4KERA 4N2YA 2REQA 5I5RA 3W6YA 1H1ZA 3QM3A 5EY5A 3WELA 3OW1A 3VGDA 3HIJA 2G41A 1X38A 3CB3A 3G22A 1ICPA 3A21A 3G8RA 4WJ8A 1AH0A 3ZJ6A 1OF8A 4M5PA 1F7BA 4E8GA 4K7YA 5AECA 3WH6A 3ANVA 2F61A 3H4XA 2XPKA 1GQIA 1QRQA 2CEQA 1Z6KA 3WJSA 3FX4A 2YCEA 3T78A 1J9YA 5LIYX 4MYAA 1E51A 2A3AA 1US3A 1TTIA 2RKXA 2PDHA 1UR9A 2EHHA 4HD5A 1QNQA 4HZ8A 3C0SA 1W9BM 4ES4A 1FHLA 5D9PA 3KHJA 3H4GA 4UOJA 3VCCA 3I7QA 2CBUA 4GYPA 4JTDA 2QZRA 4FLOA 5IFTA 4S3JA 5IXEA 3O05A 4AU0A 1W8SA 4NYUA 3SQLA 4PC8A 4LB4A 3QV8A 1PTGA 3FEQA 4W9TA 2O7QA 2X0YA 1PIFA 3AIBA 2PDUA 5LIKX 4DJFC 3Q37A 3H7UA 1ENUA 1A0EA 2KZHA 2C0HA 1NWUA 3F4DA 1CW2A 1ICQA 5DMMA 3GH5A 1MEIA 4HA1A 1KBJA 2WQPA 3SUUA 4KEZA 4CEUC 4ZOCA 4I3GA 3S1GA 1QI4A 3WLIA 3LCHA 1HX0A 1R3VA 5CPTA 4TVDA 2D2JA 3GC4A 3LLDA 4JXCA 4JFVA 4H1ZA 4L4MA 3ARZA 3EX6A 3OBEA 2HXUA 2WC4A 4L64A 3UZXA 3IK4A 3LMZA 5F4SA 1OBAA 5CXPA 3B8TA 3B8IA 3TTQA 3T42A 3UZ5A 1S5TA 3BQ5A 3K8MA 5E0CA 4PMOA 4AWSA 3WY1A 1Q45A 3SQMA 2QF7A 4HJWA 4PUWA 3KWXA 1VJSA 4NVTA 3NQMA 3AU2A 3UGVA 3GYEA 4DHGA 4W4QA 4HOXA 3GNDA 3IGXA 3WF4A 2E6AA 1TFVA 4IIEA 5CG0A 1R8LA 4Q4PA 1KLYA 3Q65A 3S2MA 5HBFA 4NHVA 4GMEA 4GI6A 4LVDA 1XINA 3N4FA 3R4IA 4N9DA 2WSPA 4W8BA 2OELA 1O68A 2WMKA 1W3NA 1Q7ZA 3IS4A 1T99A 3AUOA 3AJXA 4HQVA 3AZSA 3B06A 1QNPA 4B3ZA 2MUCA 2VGGA 3ZSTA 3ABOA 5C2GA 4MNLA 3N18A 2YL8A 2RDTA 1IWBA 5I07A 1XYMA 5BW6A 4HNTA 2E40A 3H2FA 3H7RA 2PODA 2GLKA 2B0MA 5D2XA 3TSBA 3PSVA 1OCJA 3N04A 3LZ5A 4AHOA 3NM1A 2WV8A 3K46A 4AZCA 3MSGA 3GR7A 2HBXA 3A6OA 5AVHA 4TVUA 3VGBA 2KX9A 1KRBC 2A3CA 3E5BA 2RDUA 1UH3A 1TV7A 4R7WA 1OF6A 2P0OA 1XLAA 1QPQA 3AIVA 4LV9A 2QNEA 1FWNA 2OEMA 3A5VA 3A23A 3E38A 2GDQA 4JIRA 5AVNA 2GJLA 5G2IA 3FYPA 2Y5SA 4ZQRA 1HO1A 3WO8A 2AOSA 3SCPA 1HVQA 4DYEA 4H9ZA 3TA9A 3KBSA 2V30A 2J24A 3PAJA 4ACZA 2GK1A 4HK5A 4TTGA 1XBXA 2E8YA 3E49A 3NGJA 2YBVA 5EB8A 3U7BA 7PTDA 4UC5A 1JULA 4NZ5A 3QR0A 4GK8A 4HIBA 3C0JA 3QPEA 4WY0A 4MKSA 3G5EA 1ME7A 2EBNA 2HPIA 2Q3RA 4F2TA 4GNVA 3CL6A 1K77A 2NVCA 4DEFA 1UKOA 3RIKA 4AZCB 4AX7A 3W1XA 1XISA 3QOMA 1LBLA 4WD0A 1QJWA 2OU4A 3KL3A 2V63A 1JRBA 5H1WA 4HNOA 1G7VA 3IJ7A 3LNPA 3UJFA 4QGCA 4S2BA 3LXCA 3EWYA 2EG7A 4DBSA 2ZDRA 1JUBA 1IXQA 5EBAA 1G5AA 1YTDA 1EQCA 1CGUA 2FTPA 4AZHA 4WQ6A 1G67A 2WKJA 1ZENA 3NQAA 4J2PA 2Z28A 2AQVA 2FFIA 2CLPA 3DC8A 4LY4A 4O8AA 2DZAA 5I79A 3XISA 3EOUA 1YDOA 1ZJIA 3MC5A 3GIYA 4A3HA 1TA3A 1MDRA 4XIMA 1TTQA 5DT7A 5EMMA 5IM51 4L6HA 3BWWA 3WNLA 3NO3A 4WX2A 5CZ0A 4FOUA 1TQXA 4PBEA 3AXXA 3G1SA 3VCRA 4QLKA 4AB4A 1PJ9A 4J5NA 1NFBA 2OGYA 2QKFA 2ZDSA 1FA2A 5I3IA 2DJXA 2OPJA 5JVLA 4Q8MA 4S3GA 2O0TA 3ZT6A 4H8HA 1SJDA 3TUUA 4RKAA 4QDPA 2VKZG 5CSSA 1R87A 2BY1A 2VOTA 2VURA 3DI1A 4ZFMA 5E6YA 3SIMA 4JTRA 4CQ9A 2E7FA 1JDFA 3H53A 3AMGA 4DUXA 4QTGA 3VKKA 1CX9A 4Z0JA 5IHSA 3SCSA 4EXAA 3LZ3A 2DT2A 4ILSA 3USBA 1P6WA 1BQGA 2OEJA 2E3ZA 3BO9A 4FLQA 2XVLA 1SW0A 2CBIA 2R1NA 3EX2A 3VOHA 2OLSA 2HISA 1QTWA 1UP0A 2NT1A 6A3HA 1A53A 1TA3B 4OUEA 1ONWA 1PCKA 4HNLA 3UJSA 2W79A 4ORIA 1UB3A 3MWAA 3S5ZA 3VM5A 1T96A 4HA3A 1A5MC 1N55A 3WD0A 3R5EA 3CUFA 4DUOA 1UPMB 3ECQA 5CBBA 2TAAA 1B9BA 3RX4A 1EJSC 5AYYA 4U5KA 1RPKA 4Q7BA 3I65A 4AD5A 4DYJA 2VO5A 2F38A 3LHUA 4PMVA 3KL5A 3HOJA 4PMZA 2BGNE 1US0A 4LYRA 2GGJA 3EDFA 5HNRA 3BAWA 2NVAA 1OHLA 4JTFA 2GDUA 1BVNP 3CQIA 4E4PA 2YB1A 3WDJA 4LAUA 5F4WA 1RD6A 1E9IA 4FX7A 1W1IE 3I3BA 4CD5A 4JICA 4GKLA 2JFEX 4V33A 4C1NB 3SI9A 1R9YA 2QCGA 4WR3A 4J3UA 2A85A 1B31A 5H6HA 4L80A 1S2VA 3GTHA 5L6UA 2BASA 2F6KA 2WC3A 3PNUA 5M5DA 1Q6FA 1OQFA 3FGCB 3TSMA 4GLEA 1S38A 1DOSA 1LORA 4OFCA 1XYFA 1BYDA 4NF7A 3PBMA 4OU1A 2CLKA 4UQEA 5CZJA 3IJIA 4LU0A 3OPSA 1Q65A 1PBGA 1I6NA 1YDNA 3CL8A 4HZ7A 3E0WA 1RCXB 2WSQA 3PS7A 3MI2A 4ZSUA 2NUYA 4DXXA 4UFKA 3EMQA 4J9JA 4DJDA 1TJRA 3WD1A 4KWWA 3ITLA 4DUVA 1ZU8A 1XF0A 1EUAA 3ES8A 4DJFA 1HO4A 4V1XA 2PDYA 1ISXA 3SRHA 2WJDA 2E6YA 1XIDA 1CGWA 5I03A 4GI8A 1G0CA 4Q8NA 5CBIA 2C13A 2F7FA 1SVDA 1UQYA 1OABA 2D73A 4IGHA 3HZ3A 3M6DA 3OGVA 4GVHA 1TR9A 4NKCA 1YXYA 3N6HA 1PIGA 4GJJA 4UIOA 3H2NA 1KR1A 3S0CA 2PDJA 4F0MA 3TTOA 3P0WA 4M3PA 3BAKA 5A8QA 1OD0A 2EAWA 5D05A 4KCWA 1FCBA 2F2HA 4RZ6A 2Y89A 2AL1A 3WSUA 3GHTA 1YBQA 4DPPA 1GOWA 2OZ8A 5LXXA 2OT0A 4PUMA 3G3DA 3LRKA 3LBOA 3N17A 1VZWA 3OVQA 3ARTA 4X0NA 2W67A 3QSRA 4WDWA 4G1KA 4IXXA 1EEPA 2J25A 4NT0A 1HKWA 3EPNA 3UYIA 4KBXA 4AD3A 2YDQA 3UPWA 3E2RA 1J8VA 2E68A 2ZUVA 4RW3A 1KXTA 2QJMA 3KEHA 3PPCA 3TN5A 1XL9A 1SFTA 4LUTB 2CLIA 4OZOA 5I3HA 2HK1A 1IT7A 1DE6A 3G77A 1T5AA 4V28A 1TPFA 5D38A 4D72A 4RNHA 1W9VA 4P61A 4E8CA 2CESA 4HA0A 4QLLA 3VM7A 2XISA 4DZAA 3DFQA 3B8UA 1FP8A 2Y5JA 1O5QA 3ENLA 4A3YA 4GY0A 4RV8A 1N2VA 5FJOA 3VIOA 3BSMA 1KNWA 3IIZA 3EMCA 1XLCA 1CGXA 2YA1A 1RLCL 2Y24A 4AX6A 1FVPA 1UJQA 3EWCA 3OA3A 4FSAA 1TWZA 6TAAA 4H6RA 1RP9A 3VMNA 3WIJA 4GZJA 2H6RA 4MWAC 3M43A 3GXNA 4QG6A 4PCNA 2D0GA 1SZGA 1JXKA 4DIAA 4UFMA 1HJWA 2PB1A 2ZXBA 3TKFA 3L4WA 2I56A 3O8AA 2ACQA 3BARA 4CD6A 1W1B1 5I7GA 5D8WA 3NQDA 3JW7A 2ZRVA 4HJFA 4F2BA 3EA3A 1DXEA 1W9XA 3MP3A 3KOFA 2BXVA 2Y70A 4AYGA 5KETA 5AYBA 2PRHA 3N9RA 5HPCA 5D9OA 4QE5A 1IR1A 1DE5A 2FVLA 4HYVA 1ZUAX 3MSRA 3IJLA 3SBFA 4F0LA 4GD0A 3GWQA 4RCXA 1XSKA 3DFOA 1UROA 2O55A 1NU5A 3CQHA 8CGTA 3FIGA 3WMSA 4OUIA 2ZZ4A 3W72A 2G37A 3V7PA 2DZPA 4GPNA 1TCMA 1YRRA 2OEKA 1SJAA 4A3RA 1NJJA 2AAMA 2DIKA 2ON3A 2NV9A 3M0LA 4QJ1A 4B9YA 4AZIA 4ML4A 1CXFA 3UWYA 3ITCA 1J11A 1X39A 4XZNX 2V68A 4JHOA 3VILA 2ZUSA 1TMLA 2ZA2A 3CHFA 6PTDA 2YB4A 1QK2A 3UW6A 3STPA 3OB8A 1W1VA 2ISSA 2WYSA 2WB5A 1W9UA 3BG3A 3H55A 1WZKA 1WCGA 2V5JA 1G94A 1QHPA 1W37A 4QCFA 4FIRA 4UNIA 2Q09A 3CZJA 1W1A1 2PRMA 1QPOA 4KWVA 2VNCA 5AHIA 5EPDA 2ANUA 4PUEA 1WDPA 3SCQA 1NAL1 1KM0A 1K8XA 1ONEA 2O9RA 5AOUA 2Z00A 5FEPA 5JBFA 1Q8JA 3XIMA 5CC6A 3RR1A 4RNIA 3ES7A 1FWIC 4IMCA 4K8GA 1XLDA 1JFXA 2YIHA 2GJNA 3KUMA 4EPEC 5A1AA 4FZIA 1T8XA 3MO4A 3WF1A 4L1GA 5BXRA 3A3HA 4ZXLA 3GE7A 3ZR4A 4BKNA 1BYBA 4GY1A 4Z0SA 3RR4A 3CT7A 1AJ0A 1VPXA 3WQPA 3MQTA 4RK8A 6CGTA 2PDPA 4UMBA 2WJEA 1OT2A 1VHCA 1EYEA 1OGBA 4ROPA 5HINA 1M7XA 1LWJA 1LRNA 4O10A 1ZAHA 2A6NA 1KM4A 2C1IA 1TPEA 3G18A 4XZHA 3QGAC 2R1KA 3GVVA 4AZ7A 1W3KA 3CWOX 4W85A 5KZMA 2PLKA 1V02A 1VLWA 3EZ4A 3BLDA 1XIBA 5DY2A 3BOFA 5I06A 3H6OA 3DYOA 4O0KA 4ACZB 2D20A 3VOJA 1OM0A 3N25A 4A8RA 2RJGA 2DH2A 2W27A 4UCGA 2OTDA 2PLMA 4U31A 1I4NA 5FI8A 2E5CA 4XB3A 4IM4A 4ZQPA 1KW1A 1YXDA 3NQVA 3OJGA 2WMHA 5FOOA 1QOQA 3TE9A 4XTDA 3AOFA 4I7WA 2NLIA 5M1TA 4GZEA 3VOIA 1P6BA 4W89A 1PXGA 4B16A 5AHFA 1TE1A 2BY3A 3OYZA 4M82A 3NQCA 3GW0A 4L6DA 1VCGA 3C3UA 4XKYB 3AIRA 2Y7FA 3PZUA 3UXKA 3WL0A 2GVJA 2HPMA 3RHGA 5LGXA 2FGBA 3NL5A 1VBGA 3WMCA 3VGHA 3EEGA 1PTAA 1DWHM 2FZDA 3RRAA 2OXNA 1YDVA 3M9YA 3UZYA 2GGHA 2VDGA 2OVLA 3M1ZA 4PCSA 3VOCA 1XLLA 1QHZA 4AXNA 3F5LA 2NZLA 2PE4A 4PB3A 4NI8A 4OT7A 4ZODA 2AKZA 4A8NA 1QW8A 5EU9A 4WDTA 2X1SA 1J6PA 5REQA 1BG4A 3KWSA 1PHQA 4LXFA 1QCWA 4RZ4A 5CZSA 3F4CA 4UQAA 4YTTA 5MKGA 1BYAA 1W9DM 1WV2A 2FZ9A 4XKYA 4DRSA 4AIUA 4UR9A 4U4MA 3OODA 3V0SA 3LQLA 2XZ7A 1PUDA 1GG1A 1SGJA 3GH4A 3ZVHB 3W3OA 3IEBA 1QI5A 4B9ZA 1RBOB 5CJMA 2B7PA 1GVSA 3S6OA 4IFKA 3VIHA 3T81A 2DT1A 3QW3A 4AHQA 2HS8A 1Q63A 2CLFA 2Z25A 3GZ3A 1JYNA 1Z42A 4YS1A 1XGDA 5FAJA 3PTQA 4LVAA 4BF9A 2QUVA 2ASHA 2QW5A 3LX9A 2ICSA 5BXPA 3LCGA 2BY0A 1DTNA 4EAYA 6XIMA 1FTXA 1PVNA 2FH6A 3VPLA 2CKRA 3MPGA 2A79A 2CERA 4H9UA 1I1XA 1JDAA 1EA0A 2Y8KA 3P82A 4HYRA 4JYDA 3TMQA 5H2ZA 2Z27A 3WH7A