5AZ0A

Crystal structure of aldo-keto reductase (akr2e5) of the silkworm, bombyx mori
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
345
structure length
324
Chain Sequence
KVNVPNFKLNNGDEIPALGYGTWLGVSDFDGTDIPKLLDALSYAIDIGYRHIDTAHFYRVEPEIGQVVQEKINEGVVRREDLFITTKVWQHYHRAADVEVSLRASLHRLGLDHVNLVLMHWPMSISQEGVDEKIDYLETWRGFEEVLKKGLTKAIGVSNFNIEQMKRLLTNCNVPPAVNQIEVNLNLSQADLVDYCQANEVVVVAYSPFGTMVPSLNSPEPKLDNPAMLAIGRKYGKTVTQVNLGYLYQRGIVSIPKTVTKSRVLENASIFDFQLDDEDVATLAQFDNGFRTVRPLFWQPYENYPFDVVPGQDIPIAMRKWKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural characterization of an aldo-keto reductase (AKR2E5) from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
total genus 118
structure length 324
sequence length 345
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5az0A00
1AZ2A 4WDXA 2HVNA 1Z89A 1HQTA 3LNMA 3EB3A 2IPGA 1XJBA 3R8HA 1RY8A 3CMFA 2ACUA 1C9WA 1S2CA 2C91A 3GHTA 4EXAA 1EKOA 2WZMA 4EXBA 1S1RA 3Q67A 5LIYX 1SM9A 1YE6A 5M2FX 1US0A 1Z9AA 3V35A 2BGQA 3LENA 4YVXA 2ACSA 2IPJA 1EXBA 3LZ5A 1Q5MA 1S1PA 1T41A 3UG8A 1XF0A 4GCAA 3FJNA 5LIKX 1AH0A 5LIXX 2PDXA 4LAUA 3LQGA 4Q3MA 3UGRA 3R43A 4GQGA 2ACRA 2PDLA 2BGSA 4RPQA 4QX4A 5LIWX 2DUXA 3H4GA 3WBXA 2FZ8A 1PZ0A 2DUZA 1EF3A 4XZIA 5DANA 3LUTA 4Q7BA 3B3DA 4JQAA 2IQDA 3LQLA 4IJRA 4MHBA 3O0KA 3GHUA 4L1WA 1UR3M 1EL3A 3LEPA 3FX4A 3GHSA 2I16A 2I17A 4FA3A 3LN3A 3G5EA 4YVPA 3BV7A 1Z3NA 1MI3A 3UWEA 2FZ9A 1YNPA 3R94A 2ACQA 4XO6A 3DOPA 5HA7A 3CAQA 4LBRA 4LAZA 1LQAA 4AUBA 2R24A 2PDJA 4XZNX 4GACA 2BP1A 3UZWA 2NVCA 1LWIA 4ASTA 3ONCA 4QXIA 3ERPA 4WDUA 4FALA 2PDKA 1R38A 2A79A 4WDTA 1K8CA 3CASA 3R58A 4GQ0A 1OG6A 1PYFA 3V0SA 4NKCA 4IGSA 4WRHA 1ZGDA 1ZUAX 3P2VA 4XZLX 4YS1A 1PWLA 4FZIA 3V36A 1AFSA 4DBWA 2IKHA 3UYIA 3GHRA 4JQ3A 4DZ5A 2PEVA 4JQ4A 5HNUA 2PDUA 1XGDA 4XK2A 4WEVX 4GIEA 3UP8A 4OTKA 4GA8A 4JQ1A 2FVLA 2IQ0A 3VXGA 3N6QA 1A80A 4XO7A 3C3UA 2PDWA 4HMNA 2IKIA 3N2TA 4GABA 2PDBA 2FZBA 4G5DA 3S3GA 3V0TA 3UFYA 5HNTA 4ZFCA 2HEJA 2PDFA 3R8GA 3M4HA 4JTCA 4PR4A 3UZXA 1RALA 3ONBA 5JH1A 3BURA 2FGBA 5JH2A 2PDYA 3LD5A 1HW6A 2DV0A 2P5NA 3WCZA 1FRBA 1VP5A 4H8NA 4JTQA 2HV5A 1Q13A 2HDJA 2ISFA 1AZ1A 3BCJA 4PUUA 1QWKA 2PDGA 2ALRA 4XAPA 4LB3A 1J96A 4JTRA 3QKZA 3Q65A 3CV7A 4I5XA 2FZDA 4IJCA 1IHIA 1PWMA 3EAUA 2HE5A 3O3RA 1X96A 3UZZA 4ICCX 3G1RA 4YVVA 2PDHA 1GVEA 2IKGA 4JQ2A 4PRTA 1RY0A 4JTAA 4QBXA 2PDNA 4XVDA 3GUGA 3LBOA 4H7CA 3EB4A 1MRQA 2PDQA 3M0IA 1ZSXA 5KETA 3H7UA 4HBKA 2PDIA 4R9OA 3H7RA 4PUWA 4JTDA 2INEA 3D3FA 1QRQA 5LIUX 3F7JA 4PMJA 4PRRA 1VBJA 3WBWA 1AH3A 1PZ1A 4LBSA 4XZHA 3WG6A 1X98A 1MZRA 4L1XA 2J8TA 4XZMX 4F40A 4DBUA 1ZQ5A 4JIIX 1YNQA 2WZTA 3U2CA 2PD5A 2INZA 3T42A 2F38A 1JEZA 5AZ0A 3CAVA 2F2KA 3KRBA 4FAMA 4QR6A 2QXWA 3UZYA 5AZ1A 5C7HA 3M64A 3NTYA 4WDWA 2HE8A 2VDGA 2R9RA 4LB4A 3MC5A 4JIHA 1IEIA 2HVOA 4DBSA 3COTA 3RX3A 3V0UA 2CLPA 2PF8A 3MB9A 1AH4A 1Z8AA 2PZNA 3R7MA 3WBYA 3RX4A 4WGHA 4YU1A 4XVEA 2IPWA 2IKJA 3LZ3A 2PD9A 1T40A 2PFHA 1M9HA 1X97A 2NVDA 2PDPA 2IS7A 2PDCA 2PDMA 1YE4A 2IPFA 3DN5A 3BUVA 4JIRA 3RX2A 3CV6A 1ADSA 2AGTA 3R6IA 1S2AA
chains in the Genus database with same CATH superfamily
4YHGA 3W24A 4WDXA 2HVNA 3B8TA 4RUBA 3AYSA 4JTSA 4UTWA 1LRNA 3GD6A 1I2QA 1U1UA 3RLHA 3EMQA 2WB5A 1XKYA 3EMZA 2QAPA 5A6TC 7PTDA 3CO4A 5TF0A 3HTWA 4JTTA 2X0SA 1MQPA 5F2IA 4DX3A 2CKRA 2D1ZA 2WOQA 2H9AA 4LCRA 2WNWA 3M0ZA 3PFRA 1SZNA 3THAA 1KV8A 3SRFA 1MNSA 1S1PA 2Z28A 4WVXA 1OQFA 3N1AA 3VYLA 3G6MA 2PDXA 5LHFA 3B8SA 2POTA 1H7NA 1GYMA 3MUXA 2A3EA 3E2SA 3VI2A 3GNPA 4EPBC 1E15A 3QFWA 1X1ZA 4L4OA 1CTNA 3W2NA 5C2XA 1PZ2A 3CLWA 3W81A 2F6KA 3UY8A 3P84A 4AF0B 3VNMA 4I9AA 4INFA 4NJJA 1XSJA 5LIWX 4G2DA 4GUGA 2VZTA 4MY9A 3NSNA 5CXPA 4N42A 5A2AA 4KWWA 3MKCA 4I90A 3DYOA 2V82A 3PN8A 5K3VA 5CGTA 3L21A 2W61A 1QU4A 4DJDA 3S1VA 3GS6A 3ITTA 4ZTXA 4C65A 4AHOA 3SRDA 3EX4A 5G2WA 4D6JA 3C2FA 2E1WA 3CT7A 2BGNE 1UWUA 2OYMA 4EIVA 1PEZA 1YNPA 3NDYA 1GEQA 1PV8A 3HJEA 3GXNA 2VEKA 3FSUA 1BF6A 3CZKA 2DORA 1MO0A 4FXRA 3CL6A 3ANUA 1YYAA 3W9ZA 1WOAA 1TZ9A 4LY4A 3UZWA 2VP8A 3NPXA 1SZGA 4OKDA 2D23A 3ZT5A 1B30A 1VBUA 3HMCA 2WPBA 2X0HA 3P61A 1K8CA 3HM7A 3UXLA 3KLLA 4BWLA 1FWWA 5HATA 3UCQA 1ZFJA 3TMLA 4IGSA 2NV1A 3P2VA 3A4JA 3IACA 3LCIA 2H3DA 3UYIA 4MYXA 1G0CA 5I3DA 2PEVA 3OQ8A 3XIMA 4ML9A 2FMNA 1YKWA 1NP0A 1XRVA 3Q37A 3T09A 2HNHA 1JYVA 4XO7A 3IAQA 3KS6A 4EPKA 1LOQA 3V0TA 2ZUTA 3H2FA 2VZOA 3WX7A 3AWOA 3N4FA 4DM1A 1J18A 4FEZA 3SUTA 2VHLA 4DB7A 4QFUA 3PBWA 3VNYA 1XC4A 2DV0A 1YTEA 1LYXA 2X42A 3IK4A 3MANA 2HV5A 3IVTA 5U7SA 3CAKA 4PCTA 2PWEA 2QCGA 2PLKA 2WJZA 3CHFA 3T0BA 2BB0A 2PU1A 1CXEA 1J96A 4U5IA 1WUFA 1HJWA 3TQKA 2GOUA 2BXZA 5FF3A 2PAJA 3KEHA 4EP8C 1PBGA 4RE4A 4C6OA 2G3IA 4AIBA 2FDSA 2FB2A 1QI4A 1IEWA 1W3LA 4HHHA 1E9ZB 3O2LA 3TFCA 4ZFMA 4P7LA 4J3UA 1ALDA 2QZRA 4DAIA 3GVWA 3CO8A 1RY0A 2EBNA 2GSHA 3LX9A 4XWUA 3BW4A 5AC7A 5IM51 5F1VA 4C6NA 3SGGA 3WDQA 8TIMA 1UWQA 1E6SM 3ORWA 3AYVA 4DXVA 2FTYA 1FOBA 1NWRA 1SO4A 4PCFA 2B4GA 1HIZA 3VOJA 1BF2A 4JTDA 4S38A 4XZBA 1E1CB 5C0QA 3LRLA 4D71A 1O66A 2G4FA 3OVPA 3NIYA 4BA0A 4KH2A 3GDTA 4O1BA 1MNZA 3APTA 2J77A 1J11A 3GXTA 4MZ1A 3VFLA 4K1WA 3FGCB 3H2CA 3L68A 1HP4A 1GCYA 4ERGA 3LHUA 3DHPA 4XTIA 3WJSA 3CXOA 4JY8A 2JEPA 3A13A 3VDCA 1D7FA 4KW2A 3E12A 1W3JA 1R8LA 2Y62A 4UOJA 3BQ5A 3WJXA 5FIPA 1SZFA 3AUJA 1Z6KA 2XSBA 1B9ZA 4B5VA 2E5BA 1DHKA 2QS8A 3LA4A 2VCAA 5KEZA 3P62A 5DCBA 2ZTJA 2ON3A 2ADAA 3ITXA 2BNJA 2WVTA 5D02A 3SURA 3TSBA 1HO4A 2Z1VA 3K8KA 1ZP4A 5G4WA 5H8UA 3VNIA 3WQ4A 1HX0A 2WVVA 2D0FA 1Q45A 1KM6A 3GXIA 1SSGA 1UH2A 3DFPA 3VNJA 4V2XA 2WV8A 4PTXA 1V3LA 3GFZA 5G2HA 1RVGA 3HPFA 4XD4A 4LYQA 3LK6A 5T91A 3OGVA 1PXGA 1TMQA 2DW6A 1X97A 4WOQA 2E68A 4NXKA 2DUAA 1UOKA 3P60A 2YL6A 1UC4A 4LY8A 1PJ9A 4L4LA 3UZ5A 4DUVA 3LS9A 4CCZA 2P1FA 2Z7GA 2C79A 1O60A 1N55A 4EAYA 4MKNA 3EB3A 4XAFA 1XJBA 5I7GA 1BGGA 1KD0A 3IJIA 1C91A 4HU4A 3UESA 5KZDA 3CZEA 3GIYA 3TZFA 1W9BM 1K9TA 4TVDA 1UR8A 1DOSA 2O92A 2XH0A 4EXBA 4I3GA 3S6TA 5CSYA 3W1UA 4PUMA 1U33A 6ENLA 4N9DA 3TOPA 1US3A 1XLCA 4QS5A 3TKFA 2NQHA 1EZ2A 3T1GA 2QULA 4XD5A 1VEPA 2OKTA 3QGVA 4H00A 2W63A 3FNDA 3G77A 4WLCA 5C9WA 2Y4SA 3VIGA 4MAVA 4EACA 4LNCA 3LQGA 3VZYA 5HQLA 2QHAA 1F3EA 1VD6A 3QY8A 4MNKA 4UNLA 3CH0A 3SUWA 2PDLA 5FEZA 1DWAM 3L0GA 3SGZA 3NQMA 3GU2A 1EDTA 3CWHA 1Y0EA 4W88A 5HOSA 3BLIA 2AQVA 1EGVA 1TJPA 4MNJA 1FCQA 1JDAA 3PANA 2JKPA 3FK4A 2XIMA 4XISA 4O57A 4D8ZA 4JQAA 3N19B 1E1EA 2AOSA 4IJRA 2ZRWA 2C16A 2NV2A 2HXTA 4AHQA 4AZ7A 3NQ2A 3UPBA 3FX4A 4QEEA 3A5FA 3MBDA 4YYFA 5I07A 3BWWA 1DXFA 4TR9A 4HNLA 3R94A 4Z1BA 3WLHA 3VM5A 3B8DA 1TE6A 2X1RA 5HA7A 1AW5A 1PYMA 3GYEA 3I65A 4A8RA 2BHYA 4DYEA 1WDDA 3OQEA 5G1MA 1SZRA 1H1NA 3CUFA 2FZMA 2QCNA 2BP1A 5IBXC 3MV01 3T2QA 2CXGA 2YA2A 1DV7A 2DZXA 2WCGA 4L4PA 1LWIA 3R0DA 4K68A 4WDUA 1R86A 1BPLB 2P76A 1R38A 1IYXA 2WKJA 2XDFA 2A79A 1TWWA 3C0SA 3MPGA 3P0WA 4FXSA 1L6SA 3CIWA 3S5SA 4NKCA 4MWAC 5EBUA 4S2CA 1E73M 3VCCA 3WNLA 4JQ3A 4C6PA 4DZ5A 5CC5A 3NXLA 5A1AA 4HPHA 3TMQA 1VH7A 1PKNA 4L80A 1Q6EA 1PX4A 3LTPA 3TC6A 1FP8A 4WY0F 4A3UA 1KM2A 1YTDA 2QPUA 3L5AA 1KM3A 2EPOA 3V1HA 2QJIA 2CBUA 4U5KA 1J2WA 3W73A 1R2TA 4QTGA 4Q8OA 3T08A 2QIIA 4GOAA 4KETA 1VLIA 3CTLA 4NZJA 1KM0A 3LG3A 5CC7A 3PS7A 4MM1A 3QR3A 2YCKX 1PTDA 2GFTA 3EXRA 3PZ9A 4AZCA 4Q8VA 1B3ZA 1UZHA 4GYFA 3V7PA 4N7QA 4KS0A 4UNKA 2CZFA 4Z2KA 1OFOA 3PTKA 2D22A 1VFLA 1R85A 4REQB 1Q13A 2OOFA 4UTLA 1IWBA 3VUSA 2A3LA 2NXIA 3QY7A 3KHJA 1RCQA 1WKDA 2D2JA 3QXBA 3HGRA 3BJFA 2V30A 3L7RA 4LB3A 1NH6A 1IT0A 3W4RA 4I5XA 4IJCA 1JXKA 5JIWA 4JKLA 1AMYA 3E5BA 2WMJA 3RLGA 1JRBA 2D69A 2OZTA 2QW5A 1GQJA 5FA5A 2WSYA 3O63A 3BQ6A 3IVUA 1GHRA 3B9AA 4O14A 1B3XA 4HMEA 3K5XA 3G1AA 1B3YA 3ZMRA 2WLZA 2VFIA 3GNOA 3LLFA 4TV6A 1LQ0A 5FF2A 1ZBKA 1K77A 1EEXA 1NQKA 3DHDA 1P6CA 3GE7A 4MJ4A 2FGZA 1GQKA 2A3BA 1KCLA 4FNRA 3QYQA 1IQ8A 4YLWA 1HP5A 4W5UA 1JIBA 1VENA 4X22A 3B0VC 4S3FA 4W87A 5CKSA 1J0JA 4N9BA 4HNOA 3WNPA 1K9FA 4G7EB 2CNCA 3SCNA 4GK8A 3U5YA 3G8EA 1EJSC 4ACYA 3EA1A 4D1IA 5A2CA 1VQTA 4E6MA 5LNVA 4YPJA 4P8VA 3P3BA 2GJXB 5BROA 1WXYA 2FJKA 2Y5SA 5D37A 3M43A 1H60A 4RZBA 3NUKA 1MW2A 4C90A 4K37A 3TSDA 2OGYA 3G1VA 4AW7A 5DY3A 1GQNA 3OP2A 1I4NA 4PYSA 3AMGA 3M64A 1SO6A 4NJGA 5K2ZA 1W1PA 4BCEA 4E8CA 4ZXOA 4MNMA 1VFOA 1GONA 3JW7A 4Q7IA 4EWND 4CQ8A 2CHNA 4LS0A 3KP1A 1RP9A 3CAWA 5D38A 2PWDA 3NJ3A 3H12A 3GXFA 4K8GA 2OODA 4NAFB 4UTWC 2Y5EA 1FCUA 4GD0A 1G67A 3IARA 1M03A 1NTHA 3B8UA 1X6LA 3B8VA 1G94A 5I0DA 2CZDA 1TJ1A 2QCFA 3E0FA 3MVTA 3MT1A 3TOYA 1B3WA 1ISWA 5AYIA 2PDPA 4JYFA 1TO3A 3OGSA 1PO9A 3WNOA 3LB0A 1FH8A 5K9CA 4PTWA 5REQB 1TV5A 3LI0A 1EC7A 1FWHC 3CZJA 3N2CA 4IMCA 3CV2A 3GQYA 3G8RA 1O4UA 1NARA 4AXKA 2J6VA 2E7FA 1UIOA 3TYCA 1TPEA 1M1BA 2NQLA 4B3LA 4L1GA 3WH7A 1HKWA 3BLKA 4ZQCA 1QNRA 2WZMA 3GR8A 1IF2A 2VEPA 3AHZA 1TV8A 2E28A 3C2VA 2VFEA 4YVXA 2ACSA 3AIEA 3ARPA 3JZEA 1JNDA 4Y90A 3GSMA 3QZAA 3ZSSA 2HJPA 3QPZA 2BOFX 1CZ1A 1I75A 4GIYA 3B0PA 2XVPA 4K1GA 1T6MA 1H5YA 5CJMA 2HVMA 3H2OA 4Z1AA 1RCOB 5EBAA 3V5OA 1WV2A 4KIRA 3TFXA 5CLWA 2W3ZA 2GPTA 4R33A 3N3TA 4GBUA 5A6KA 2QAFA 2O9TA 4IL2A 4DBDA 1ZP3A 4HPJA 2TODA 2VKZG 4DQWA 1F3WA 1K8YA 4NSBA 5MKGB 1XFCA 4LUIA 1YXDA 3EDEA 4MF4A 4CEUC 4DJED 2ZRVA 4H6EA 2EPLX 2WQPA 4PSPA 1XDMA 4J3TA 5C2GA 4ONVA 3WH6A 4O53A 2XIOA 4L9XA 1CLXA 4LV9A 1TPH1 4GYKA 2V5KA 4LT9A 4BWLC 4K2SA 4L1WA 1UP2A 3G5EA 2DT2A 2ZRZA 3VD4A 5FEWA 1YEYA 2RJGA 2A7RA 4QDWA 4ZZ9A 3DC8A 1UMYA 3H4WA 1DIEA 3MY9A 4GC4A 3CAQA 2C8NA 2PS2A 4CEXC 2GJLA 4HMCA 3TCSA 4WD0A 1WB0A 4WKFA 4G6CA 3DAQA 2P8BA 3GM8A 3H22A 1QUMA 2VFDA 3TW9A 1PAMA 1UYQA 3R58A 3BPWA 1J12A 3MUCA 1PYFA 1KXQA 3PTDA 1F8IA 3E0VA 3BLLA 5EMUA 1OIFA 1UWSA 3SCSA 3KVJA 4JQ4A 3W1QA 1VCVA 2OELA 1W37A 1UROA 4XAGA 5C55A 4F4RA 2VC6A 4JL1A 4GUIA 4D6HA 4JTEA 1E0WA 2HROA 5ENLA 1SJDA 5DMMA 5H6HA 1XIFA 4HOWA 1NF0A 1W31A 3EX1A 2DVUA 3WF0A 5HMDA 3V4BA 3FVDA 3MJYA 2CLLA 3KCLA 4JNMA 4U28A 4H6RA 3WQVA 3CH9A 5BW6A 3AU6A 1PIFA 1CGWA 1AL8A 3T4WA 2C6QA 3AIVA 3WCZA 3W72A 2GSEA 5CAHA 4JDYA 4H8NA 2UY3A 4NI3A 3WKZA 3NEVA 4C6CA 4RNIA 4PMVA 5KZMA 1CECA 4P8WA 4Y8FA 4DF0A 4TTUA 2MUCA 4N6FA 5E6ZA 3DCPA 1KFKA 4LANA 1NVMA 4MDPA 3PWGA 2AAMA 5AC8A 3A4AA 4TV5A 3N2MA 3HGOA 1A5BA 1D7KA 2WXDM 1PIGA 4JIEA 3RYSA 1ZBVA 4QCFA 3H2AA 1OSEA 3WL1A 4HSNA 1XGEA 1VLWA 3TLQA 3AROA 1UD3A 2CLEA 3H7UA 1JPDX 2GQ8A 1RP8A 2WMHA 2XH7A 2PWUA 3LV5A 5AYBA 3RAOA 2ZXDA 3OVRA 4NJIA 4HA1A 4R9XA 1POKA 1UKSA 2VYOA 1XV8A 1UR4A 2UZ9A 3CC1A 3USBA 3GG0A 4P7RA 4V1XA 4E4UA 4J35A 3W6YA 1HVXA 3W7EA 1ME8A 4GGHA 2YFOA 5DRCA 3NQGA 1JGMA 5E5CA 3C3NA 1KRAC 2NX3A 1Z69A 3A12A 3W0KA 3KVLA 4QE1A 1JEZA 4P8XA 1KRCC 4XUYA 3KRBA 3BLPX 5BXSA 3MV11 3AHYA 1LLWA 3VCRA 4MZ8A 6XIMA 2WM0A 1NWSA 4QCEA 4QR6A 4FP1A 2R1LA 2G0WA 2J78A 4GCXA 3FGCA 4Q6JA 1G6CA 1OX4B 2I9UA 3IIVA 1VFFA 1QBAA 1P4CA 2D0HA 4PMZA 3U48A 4ICMA 2ESCA 2ZDRA 3AYTA 3VIMA 2PF0A 2V3DA 2EG6A 3COTA 4FF7A 4YTUA 5JUVA 4NNAA 1PS9A 2ZX5A 1BYAA 1HF6A 3ZQ9A 1ECQA 3L65A 4GO8A 3L4UA 1JZ8A 1DJXA 3NL6A 4HD5A 4JTGA 4GNVA 4L61A 1V6VA 3LI1A 3GDBA 1V02A 4NQ1A 2NQJA 2E0PA 4ZVJA 4YWSA 2WVSA 2FFCA 2PFHA 2ZYFA 1TE1A 1LLOA 3BL3A 3HGJA 4I7VA 4M82A 3S2JA 1TJRA 3TTEA 1XD1A 4MY8A 5A8OA 5BRPA 2NQZA 1RJQA 1BYDA 2E40A 3PPHA 3WQPA 3M41A 2WNNA 2WMIB 4FNQA 4UQ9A 3NPVA 5FEXA 3IUHA 1Q6CA 3Q45A 3LNMA 5A8GA 4HOZA 4UMCA 4H9MA 3CUZA 4V1YA 1OFBA 1UWTA 2XYLA 3A22A 1LUCA 3LNPA 3NA8A 1H61A 4GBDA 1VFUA 1BFNA 2QCHA 1LRQA 1R7OA 3P8IA 4EK7A 1GORA 3GDRA 5BU6A 4MPQA 1Y8BA 4QAWA 2ISDA 5KINA 3UF9A 1WKEA 3RIKA 1EUAA 2J47A 3YPIA 1Z9AA 3QZEA 1GKRA 3FA5A 1W1B1 4AHPA 3IJDA 1PKYA 9RUBA 1HJSA 4UQAA 5CZ0A 1QPQA 4UMBA 4QGCA 1KM4A 4R27A 4IX0A 4Q7NA 5F4XA 4OGZA 1W8GA 1GOIA 2YA0A 4H6KA 3MCMA 2VC5A 2QJJA 3ZLFA 4NZCA 2PZ0A 1MVYA 3URNA 3GNRA 4RNHA 5J04A 1GZJA 3CQHA 5HJXA 1PZ0A 3EWXA 4ZQOA 3PG8A 3H26A 4LYPA 4QAIA 1YPXA 3BLOA 4XAZA 4MGGA 3S4TA 2IQDA 5DLCA 2OWXA 2G8ZA 2FFIA 3T6CA 2WJDA 5E70A 5FD0A 3HG2A 1EL3A 1D3HA 3PB0A 3QQ1A 3E1F1 1XPGA 4CNSA 1H7RA 1RPXA 1Z3NA 5CQ1A 5LA0A 1L9WA 3RCYA 2NVAA 5E9XA 4FB7A 1Q8JA 4GZIA 2GOKA 4PB4A 3F4WA 4HZ7A 4LAZA 4TX9A 1BYBA 4W9TA 1S2UA 2D0GA 1UP3A 3HJZA 3U2EA 4YTQA 1RAKA 2D24A 2ZE3A 3D0CA 3QSRA 3MKVA 5I3FA 2CLKA 2NVCA 3F5JA 5D2VA 2YLAA 1F2JA 1R3RA 1UB3A 4JTFA 3W86A 7TIMA 2EPNA 3TYDA 5HUOA 2CFFA 1ZZMA 7XIMA 4P5UA 3WQGA 4WDTA 3PZMA 3NO3A 1LL4A 1F6KA 2WWCA 2O0TA 2PC8A 3NAVA 2BXVA 1OEPA 3WH9A 1SW7A 2UBPC 1MUWA 1VHNA 4YS1A 4IFKB 2YBTA 4U10A 4K8HA 1UJQA 4RDYA 1XGDA 3VTRA 2OU4A 4AIEA 3NQEA 1A80A 2QJGA 5CH9A 4M6UA 5DX7A 3A3WA 4B2DD 3UXDA 4HMNA 4AD5A 4LYRA 3W1TA 2ONEA 3A64A 1QOQA 4LAMA 3N4EA 3RLVA 1B4EA 5M3WA 4O1FA 4BQ4A 1HGWA 4QG9A 1ODUA 2P53A 1QW8A 3BH4A 4KFNA 4F2TA 3SW6A 1S39A 1JZ7A 4D6EA 3NZQA 2ZCGA 4X0VA 4WSJA 3KE0A 3SIMA 2DSUA 1FFQA 5EMKA 2VO5A 4B5NA 4AX7A 4O16A 3BCJA 2BOEX 1SW3A 4CNOA 1ZJHA 4PUUA 3VZZA 4IXXA 2XN0A 4H01A 3TNOA 3FSTA 4DWSA 5F2MA 5FKYA 2RDXA 5H91A 1IZJA 3RXZA 2GVEA 3W25A 2J7CA 2PB1A 3OTRA 3W22A 2V69A 4DLFA 4NVTA 3RPDA 4REQA 3EEGA 4ICCX 1DYSA 1Q3NA 2VZSA 4FIQA 4B92A 3L12A 4JNZA 2QUUA 4N2YA 4JN8A 1L2UA 5JBDA 4XVDA 3GUGA 3WFZA 4U3CA 2J8FA 2GK1B 3MUAA 2NUWA 2R91A 5EL1A 4NZ4A 4LF2A 3WMLA 4KWOA 1VFHA 4KERA 1SFTA 2Z00A 4R3UA 5JIPA 1KCXA 2WC4A 4NRSA 3M47A 1B1YA 4QEHA 4AD3A 4HA0A 3UR2A 2OX1A 1VBJA 4EANA 1E6QM 1B5TA 3S9ZA 1E5NA 4HNUA 3OG2A 4IMFA 5AHEA 1PKLA 2QDDA 1EXPA 5CAKA 3ZLGA 1UBPC 2XGZA 3UXKA 4JS3A 4XZMX 1ZJBA 1K3UA 1QJWA 1ZQ5A 1RSCA 1KFWA 3GO2A 3OLIA 3AO0A 4L7ZA 4DZIA 3W29A 3UNTA 4G7EA 1JD7A 3OZOA 2DSKA 1XGZA 3W88A 2PGFA 1TPVA 5GJPA 4AY1A 2XFRA 4ZR8A 5A6AA 4LW7A 2GJXA 2A6LA 4MY1A 3T0TA 2ZRUA 3LGDA 2WSQA 3EOSA 4K36A 5CPSA 1LP6A 5A6MA 3TNBA 3PBVA 2Z2UA 2Y7GA 3V5CA 1HVQA 1Z7AA 5TNVA 1A5NC 4AZIA 3FYPA 1AODA 3W37A 5FESA 4PMNA 2CW6A 1WPCA 1W32A 4OWGA 3DKLA 4ZB5A 2PWGA 4GIRA 1AH4A 4UNIA 1Z8AA 2PZNA 1H5VA 2ZBTA 3IGHX 1J79A 3DH7A 4DO6A 5AFDA 3R10A 1XLGA 5F7UA 3T44A 5A8MA 3ZM8A 1AQMA 2NVDA 5A5WA 4IUOA 4ZBCA 2J62A 3F5KA 5HJYA 2Y70A 1LBLA 4RDVA 5I02A 3RF9A 1WXJA 1M01A 1Z89A 4Z2LA 5HNNA 1XQKA 3EKZA 4M8UA 4Q4KA 1CENA 3SY8A 3QM3A 4B16A 3GTNA 2YCEA 3LXBA 4IT1A 3BOXA 4GXWA 4IP5A 4F9DA 4D6CA 5CCZA 2CLMA 4L65A 2HS8A 1T5AA 3UG3A 1YXCA 2UY5A 5XIAA 4UXDA 1Z42A 4W7WA 3W7DA 5K9XA 4J4KA 1YE6A 1F3TA 1KCKA 2EXOA 3VAVA 5D9OA 1IWAA 1I6NA 3KAOA 4UOQA 1LWJA 5CEWA 2XGBA 4B5UA 5HWJA 4N0RA 1ZALA 1LDCA 4HNVA 3OEXA 4XD3A 2QJNA 1VZWA 3UGRA 2XIJA 2VEFA 2PGWA 3USZA 3BOFA 2BY1A 2J7FA 4G7FA 4JCLA 1BWVA 4MVAA 3G1DA 1I2NA 4UTTA 1DL3A 2C18A 4C6FA 1V77A 3HBLA 4E4FA 1H0GA 1XIBA 2JGQA 5GVJA 2FYMA 2EAWA 4PL1A 3O0KA 3VKBA 4CCCA 1UR2A 3WF3A 3H53A 2I17A 1AVAA 4C1NB 3MQTA 4E2BA 2YX0A 1E4NA 1XQLA 2GVLA 2DZUA 4FLQA 3WDRA 3BSGA 1P48A 1AG1O 4DI9A 2Z27A 4LBRA 4US5D 1JL8A 3AMDA 3ES7A 5AYXA 4FNTA 4AUBA 4CD5A 4OUEA 2HS6A 1S38A 1SGJA 2OKOA 3KOFA 1A5CA 1UASA 2OJPA 1AQHA 1XLHA 1JF6A 2GJNA 4XD6A 1JFHA 1BVWA 3DYPA 4HU3A 2TMDA 1GVYA 1GJWA 4DUOA 4O8RA 3V36A 3GHRA 2VI0A 2R1PA 1XIHA 1GZGA 2ODOA 3FXYA 4XKMA 1ZNNA 3URQA 4IFOA 4Q8MA 1IE7C 1XYAA 3B8WA 1VEOA 3GXDA 4AX6A 3G6LA 2CLHA 1EA9C 4A8LA 1DJYA 2FVLA 4UBPC 3N6QA 2VDIA 1XLLA 4M29A 2XH4A 2JKEA 5D04C 4LXFA 1HNYA 2HK1A 2QYGA 1CBGA 1DHPA 3R11A 3S3GA 1TPFA 5G1YA 4Z1YA 4LAKA 3S1GA 2CHRA 4HT3A 3THDA 4GY0A 4GFIA 3UZXA 2ZE0A 1E4MM 1DVJA 1R6WA 3IJQA 3PZTA 2ZUNA 2HZGA 3S6DA 5JH1A 5RUBA 4AMCA 3PBMA 4H2HA 1YMYA 4O4WA 3HPZA 2ISFA 3U57A 2ZZ1A 3UWVA 2O7QA 2FPVA 1JCYA 1BEUA 3L67A 1E70M 4PTNA 3FAWA 3QYSA 1Q6FA 2FZDA 4KGLA 4AU0A 3AS0A 4L9YA 4ZMGA 1PWMA 3LCXA 3M9YA 3BGAA 1V7AA 1FH7A 3HQNA 2JIEA 1B31A 3A3XA 1UUOA 3P74A 5CZSA 1VIWA 3I6RA 1JUBA 3I6TA 1ISXA 2HNEA 1GOQA 1V51A 5JVLA 1CXIA 1W3KA 1MEWA 2RDTA 1QWGA 2VT0A 3CZ8A 4UQBA 1BXBA 1OX5A 4QQ3A 4C6MA 1IIHA 3N12A 3P80A 5ABFB 1KKOA 1NDZA 4A2RA 1VBGA 4M7TA 1ZSXA 2XSXA 4UZUA 3UXIA 1FA2A 5FF0A 1WYIA 1YNYA 2WWDA 2IMRA 1YBQB 3T8QA 2WMKA 3GZ3A 4N9EA 4J40A 4FSAA 2OG9A 1D3CA 1KXHA 1XLEA 3OBKA 5IRPA 4O54A 4DUWA 2XVLA 1JRCA 4OQVA 2ZZ5A 1I45A 3T0CA 1F3XA 3K8LA 3RILA 4R34A 3BE7A 1P0BA 1G5AA 1GPFA 3LHWA 3O6CA 3CPGA 3DENA 1AA1B 4WIWA 3QV8A 1AQ0A 1DE6A 3GU9A 3RPMA 4J3ZA 3SJNA 2ZXBA 3ITLA 4WF7A 4OBTA 3A4WA 4MIMA 1SPQA 2YL5A 3RNDA 3VNDA 5I3IA 2VEMA 4ZB2A 5JBEA 4P7QA 1W5OA 4CU7A 4Q6XA 4PC8A 1KM1A 4KMQA 4XAYA 2VNCA 4MMWA 3M46A 2R9RA 4MADA 3EWBX 3ZYZA 1TIWA 4AZBA 4I7UA 4CUCA 3UT0A 2UY4A 5BNKA 2VD9A 3WQ8A 1KKRA 2C19A 4DNMA 2A5HA 3L4ZA 4FOKA 3SM0A 3VOGA 4HPNA 3JVAA 3WK1A 2YCIX 4AMAA 2DSWA 4A21A 3OIXA 3LBCA 2DZTA 3PZQA 3GIQA 2CU0A 5HXMA 1W1ZA 5AC6A 3UW6A 5HWMA 3TP4A 3GVQA 1LQ2A 5I3GA 1CXKA 4XIAA 3W76A 1HL2A 1DQUA 2OTDA 1E72M 3EDKA 4MAZA 1DJGA 4C6KA 1S2AA 1JDDA 4W8LA 1SFJA 3BZJA 5FJJA 3S2NA 1O95A 1HTIA 4MWAE 4QSFA 1HQTA 4IH3A 5HAOA 3WQFA 3W02A 2NQ5A 3UG4A 2OYLA 5TBOA 3BLEA 2YW3A 3PWIA 1TV7A 1R3YA 2D2HA 2A1YA 4GFSA 1IZKA 3MA8A 3NQVA 1QOXA 3NQ8A 4EXAA 1AW2A 1F4AA 1HG3A 2C0HA 4G8TA 5A94A 4JX5A 4ZOBA 1RHCA 1ZTVA 1SW0A 1ZLPA 4WX2A 1MUMA 2G41A 1H09A 2VFGA 4ACZB 3O6YX 1FTXA 1WX0A 2DIJA 3LZ5A 3T2PA 1U5HA 4KFOA 2QJMA 2Z1KA 1T8QA 3ABOA 4G1KA 3THUA 1MDLA 5I09A 1AH0A 4JAWA 5AKQA 4A05A 3AIQA 1DORA 4WZHA 2F6XA 4ZQMA 2JBMA 2PGRA 3WH5A 3B0UX 1GZ1A 1OHLA 1XP3A 3MZNA 3H8AA 3L66A 4NG3A 5I24A 1H41A 7ODCA 1JYXA 4RPQA 1LRTA 1W1YA 4XZ9A 3CLMA 4QNEA 4F66A 4M1RA 4I5RA 4F48A 2V2HA 4L6DA 2DU2A 2V3FA 5LGZA 4Q7BA 5G5IA 1QASA 1LL6A 3W01A 2JEQA 4J3SA 4W89A 3GRIA 5GNYA 5BCAA 2W0UA 2QVNA 2J4GA 2PRMA 4Q4SA 3LN3A 4GJJA 2J7BA 4YVPA 4XKYB 5DQPA 1EHNA 1WZLA 3TW7A 2ABAA 2Y24A 2V6AA 1I2PA 3BDKA 2FH8A 6XIAA 1KB3A 4K38A 4MFEA 4G1NA 4BF7A 3MSYA 1WKYA 2E6DA 2PDJA 2YJQA 1S2VA 2XM1A 4J2PA 2DVXA 4CD8A 4NJKA 5E09A 1B57A 4ASTA 4IF2A 3ONCA 1THFD 4K8EA 3PPGA 5EMLA 5E93A 3SDOA 3PZNA 1UBSA 3CBWA 3DESA 1VYSX 4GQ0A 3O16A 1P0EA 4RR4A 2W92A 2ZICA 3CHCA 3ZR5A 1MW3A 1TMLA 1EFZA 3LCWA 1C8QA 1DWIM 8RUCA 3S9YA 2VGBA 3LRKA 3VE7A 3MUY1 5HNUA 2GZXA 4NZ3A 2XN1A 2HWGA 4R88A 2XVKA 2WSKA 1FXPA 2VX4A 1X8CA 3RM9A 2I7GA 1KFJA 4AISA 4U4MA 2YXGA 4GHRA 4DWSC 1E71M 1RXOB 1QNSA 4JFUA 3MP4A 1XXXA 1H51A 1JPMA 1TV2A 2E6FA 4IFKA 3G1SA 4HTYA 4GABA 3BJSA 4PMYA 4PULA 2PP3A 5HNTA 5DCDA 3SBFA 3TN6A 3G3DA 2XVGA 3NSXA 1W2PA 2YCLA 3IUDA 3QOMA 4MYAA 2XFYA 3BURA 4Q22A 3NQ7A 1JZ2A 1GVQA 2QF7A 3VOIA 5JH2A 2V8ZA 3PM6A 3UJRA 2P5NA 1CIUA 4H7VA 2EGZA 1X39A 1NDYA 1OD8A 5FI8A 4AEFA 1FX6A 2DEPA 4HGXA 3KBSA 3FV9A 1NIUA 3OA3A 1KCZA 3AXKA 1F76A 2JF7A 3WN6A 2GJRA 4HKPA 2BMBA 3CV7A 2H90A 2JALA 4ATLA 3RPTA 4QJ4B 2HE5A 2VFFA 2GL5A 4IQEA 2J88A 3UZZA 1CGVA 1TQJA 4GX8A 2PDHA 2SFPA 3C4UA 5T26A 1HXJA 3JR2A 3EB4A 4XB3A 3KZPA 3CT2A 2VZUA 3H54A 3GNNA 3DERA 4O8AA 1XS2A 3TJLA 4ZSUA 4BR1A 1ZB5A 1EJRC 2PDIA 3VD5A 1K4HA 2Z2BA 3W1XA 4NNBA 3SRKA 1IGSA 5DMLA 1XYMA 4AYGA 4CN4A 1M3UA 2GK1A 5EFFA 1K03A 4I5UA 4PRRA 3WBWA 1AH3A 2OCZA 1P43A 3FY1A 2VENA 3ARZA 4XQ6A 3SUVA 1JFXA 1I8JA 4BQ3A 4AAJA 1OK6A 1XIIA 1XG3A 4J28A 3WF4A 1CT5A 3W85A 3U2CA 5CZKA 4ZE4A 3IJ6A 4Q8UA 1E6XM 4S3EA 5AZ0A 4NL1A 2F2KA 1XM3A 4JOMA 1QCWA 4FAMA 4ERIA 4C6IA 2PMQA 3WD4A 1AJ0A 2PP1A 3BSMA 3GC4A 1OM0A 5I06A 1JCTA 4PBGA 1BLIA 4KRTA 4YN5A 3MMDA 1S5NA 2R1NA 3CS2A 1J10A 1YDOA 4GUFA 1A50A 2JKAA 5AYZA 1F9CA 1IEIA 1BSIA 1OINA 4UFJA 3KP0A 4TVCA 4M51A 1CGYA 4C60A 3E0WA 1JCJA 3GC2A 3TN3A 1GG1A 3N3MA 2VUNA 3NZRA 1IT7A 3HB9A 2CLOA 1V3MA 1YDVA 2WHKA 5H1WA 4GX9A 3U2OA 1OZQA 4HA4A 2AL2B 1ZY9A 3WJWA 4WGHA 4CQCA 4XVEA 5HR6A 2DIKA 3AZTA 1Q85A 4GUJA 3C2EA 1M9HA 1KFBA 5D9MA 5I5RA 3GFXA 3VC6A 1FQ0A 2OPJA 2D73A 2JQXA 3CUIA 4O19A 3RDKA 3LERA 3W7MA 3VKKA 4K7YA 1YDYA 5CSSA 3TC7A 4DM2A 1HJQA 2NW0A 1J2BA 1RK6A 3R89A 4CN6A 3WFAA 4V33A 4W84A 1OB0A 3EWUA 1EJXC 3S46A 3DHUA 1XD0A 2OT1A 3RG6A 1DJQA 1TRIA 4Z0JA 1MDRA 1LL7A 3WLKX 3MUIA 3CUJA 2ANUA 5TAOA 4MLRA 4Q4RA 4UTTC 1V03A 2GWNA 4IMEA 3SCOA 4D1JA 1XYLA 3WF1A 4WK9A 2Y8VA 4E4PA 1G4TA 4PTMA 3UCDA 4CQDA 2DY3A 3OIHA 1Q5MA 1B3VA 2MANA 5LA2A 3N4AA 3ABQA 4HSOA 4A3YA 3S83A 2EKCA 3A4XA 1P0KA 4JR5A 5I2UA 4FR1A 4I6KA 3TV8A 1IGWA 1RCXB 2RDUA 1XPYA 3H55A 1EUNA 1ME9A 5JXQA 1R2SA 1V0KA 2GLKA 2VL4A 1FWNA 2DUXA 3ISIX 1JD9A 1U2YA 5C9ZA 1DWHM 2NX1A 3W7NA 4CKQA 4C7GA 3WBXA 1QTWA 2PCQA 3MKKA 4OECA 4XZIA 4QROA 3STCA 4C6EA 2W9MA 4PBEA 1UKTA 1IEXA 1TRDA 1TR9A 2CKSA 3KS5A 1C90A 3VGGA 4FLRA 1U5VA 2V9DA 2X1SA 3O9NA 4AH7A 1R3TA 1DXIA 4HNCA 5C7VA 2XTKA 2W4XA 4UQDA 3WLMA 3M7WA 1W9VA 1OFPA 2XWDA 1UR1A 1F61A 2EPKX 2F9RA 1HGYA 8A3HA 1BG9A 2PBGA 3DYMA 4DO7A 1Y5XA 3BXWA 3B9OA 1H50A 1W5PA 1Z48A 1OYBA 2ZA3A 1LQAA 1A53A 1AD4A 5I3HA 3E3HA 2B7NA 3TN4A 4C1NA 3ME3A 3VMNA 1TJ0A 3ANYA 2V5BA 3BGJA 3B03A 5AB3A 4KGJA 2X1UA 4EPDC 3F1QA 2J66A 3N9SA 1QR7A 4WRHA 3H23A 1ZGDA 3W2UA 2J7GA 1AFSA 5A6BD 2J7HA 2Z1WA 4D2JA 4WHBA 5I6SA 2NX9A 2WLYA 2OT0A 3WQDA 1EDGA 2PDUA 1P7TB 3NR0A 1F07A 3CHEA 3BAYA 1W1IE 2GUUA 3A9BA 1K7EA 4RLIA 1RV8A 1JPHA 4H1ZA 2A4AA 1XYBA 5LSMA 2QMJA 5G4HC 5K4ZA 1P5BA 3RM8A 2ZIDA 2PDFA 5JBFA 3M4HA 3NYDA 1NAL1 2B0MA 4JL2A 4P7OA 3TYUA 2DIEA 3G0SA 1QNVA 3UCCA 2PDYA 3MYPA 3LD5A 3OBEA 4O50A 2QV4A 5AOUA 4ZEPA 2Y8KA 5U4NA 4DZHA 4M0XA 5A3HA 2HDJA 1RPKA 4U31A 4XBKA 3S5YA 1EJVC 1FY6A 3FW6A 1Q6LA 2ALRA 3FCPA 4W86A 3SO7A 2EO7A 3WH8A 3STEA 4GVGA 3THCA 5ABHA 3QQWA 1JCXA 2CESA 4MSSA 4DIAA 3EAUA 2OEKA 1XCFA 4UFLA 5A69A 3WLNA 3LXAA 3W00A 3SSJA 2CC0A 5DXXA 3KUMA 4POCA 3QVQA 1A3HA 4GI9A 2Z26A 3Q94A 3ARYA 1GVEA 2X0YA 5D4YA 2OYKA 4OV9A 1ONXA 2WKGA 4JTAA 4UIOA 1W9UA 4FOUA 1WA3A 1EHAA 1CXFA 3AISA 1SUXA 4IIEA 1NEYA 1KTCA 3MSRA 1J6OA 2FTPA 3PZGA 3DXIA 1G7UA 1GQIA 1IXPA 4IZGA 9XIAA 2OLAA 2A3CA 4MB4A 3VZXA 1DTUA 5LXXA 3HG5A 3FA4A 3TJXA 3D3FA 4TXEA 1TTIA 3K1GA 5ABFA 4AQLA 2OR2A 2CPUA 1TPUA 3CL7A 4E2OA 1O5QA 3W2KA 5I79A 3WG6A 1CI1A 1YBQA 1X98A 1MZRA 4H6QA 4MWAB 4PFMA 2FHCA 3IIXA 3KXQA 2D20A 3S2CA 3WNKA 2DW7A 2D3NA 4DNHA 4ML4A 4ADTA 4B4FA 2Z25A 3N73A 3WQ5A 4ORIA 2J8GA 3HU7A 1V93A 3PWAA 1K4GA 3ARQA 1VAHA 1EQPA 4S3DA 3T78A 1KW1A 1M7XA 1Q6OA 3QTGA 1JNEA 3NQFA 2AMGA 3GVVA 3GY1A 5CPTA 2HVOA 3WUFA 4PEKA 3WDHA 3IJ9A 2NUXA 1A5AA 3TTQA 2CCRA 2QUNA 3NURA 4WY0B 2PP0A 7A3HA 2OQYA 1EJ7L 3E2VA 3RMJA 3L2IA 2VX7A 4QG8A 4HCLA 3AZRA 4C7DA 5FJTA 3I10A 4CD7A 5LZLA 2IPWA 2Y6ZA 4B90A 1KFEA 4B91A 4JN7A 4HB7A 2Z1XA 3W71A 5C54A 3HQPA 2Y1HA 3MW7A 1I9CB 3AXHA 3MSDA 3N13A 4R53A 1E0XA 5B80A 3F4NA 5IOBA 1ADSA 2QCDB 2AGTA 4ZQRA 3R6IA 3VNKA 4U3AA 1TA3A 2X7VA 1LF1A 3MO4A 5M1TA 4WXYA 3P81A 2XZ9A 5BZAA 3O15A 1YPFA 4HHMA 1A0DA 2WHMA 3VDGA 5D32A 4ZCWA 4EAMA 1EOMA 3ZFHA 3CQ0A 3O05A 2V2DA 2EEXA 3P0XA 1L6WA 1FP9A 4JIPA 4LRTA 3KTXA 1W2VA 1V08A 2GGHA 4I6VA 4GYPA 4MWAD 1GKQA 1IXOA 4GVIA 4MKVA 3OVQA 5CC3A 2VR2A 1XKJA 4YTTA 3PK7A 1QI5A 1FHVA 4J9JA 1EEPA 2ASHA 1WE5A 2PWFA 1D8CA 3SQLA 3BV4A 3WK2A 3H7VA 3BW2A 1X38A 1J5TA 1DEDA 1R47A 4M80A 1NJJA 4ACZA 1RVKA 1UOZA 3TC3A 1W9PA 4OFCA 3F4DA 1KBIA 1DPMA 1OFRA 1KBKA 3ECQA 4JXCA 3G24A 4JHOA 1OFEA 1B0IA 2QKFA 2DUZA 3BARA 4Q4MA 4KIEA 3C56A 5F2GA 3BAIA 3UA4A 1XWYA 3BOLA 1F7BA 1L8PA 1FHLA 3PPFA 3S6OA 5C9UA 4FA3A 3PUGA 1YADA 4C91A 1BQGA 1UKPA 1EQCA 2YZRA 2RGMA 1SYTA 4HPXA 7REQA 3AMLA 4YTSA 4JX6A 1Q8AA 2GQ3A 3C61A 2O9PA 1F4HA 1GVFA 3RO8A 3QPYA 1LTDA 4IGMA 4J2MA 2I9EA 4XKYA 2H9AB 4PL2A 3T7VA 3NL2A 2BHUA 2OXNA 4TOQA 1A3XA 1UIPA 1ONRA 3ITGA 3NOEA 4HZ8A 1I1WA 2ZVRA 1R0MA 3W28A 4RE0A 3C8FA 4HPGA 4RX0A 4HP5A 5L6UA 3WJYA 4Y9MA 3KOWA 2QCLA 4WKAA 3QMSA 2ZC8A 4AZHA 2J7DA 1V6TA 2CLIA 2RFGA 3L2LA 5JU6A 5FF7A 4XK2A 1LOLA 1UMLA 3S5NA 3PY2A 4H8HA 3TH6A 1TWSA 3W7QA 2ZUWA 3M5ZA 2GQ9A 4UMAA 4UC5A 3WELA 2FZNA 3G1HA 2XG9A 3BO9A 4FX6M 3UFYA 5E0FA 3VOCA 3GTHA 5A8PA 1O94A 4DJFA 4MZYA 5FL1A 3FXGA 4PUEA 3UU0A 4B3KA 1SJBA 1M41A 3KLKA 3HPXA 2DZVA 3OW1A 4QHRA 4V27A 3U8GA 1V5XA 3RUBL 2NLYA 1GG0A 3DIPA 1HW6A 3N17A 1S3TC 2Y2WA 4HU0A 4A35A 2YBUA 1C3FA 3NO5A 2GGEA 4I9MA 3CIVA 3N14A 4IG2A 4G56A 1OVDA 5T8GA 2TPSA 1E4IA 3W53A 1ADOA 4LQ1A 3DEQA 4AXNA 2FIQA 3P6LA 3GLCA 5BU9A 4TU1A 1PB0A 1OFDA 3O3RA 5CJ5A 3QMRA 2VFHA 3A21A 1Q2SA 3KBMA 2YPIA 3QQ0A 3M07A 5AHMA 1U30A 3M7SA 4ZQPA 3M0VA 2BVTA 3A23A 5HWNA 3PTQA 4RXGA 4DVOA 2QDGA 1ZENA 4X2RA 3VFCA 3IRDA 2V5CA 3VO0A 1KWGA 2P0OA 3S8HA 1Q4WA 4CQBA 3RHGA 2BY0A 3PBUA 1J9YA 5AVNA 4Z08A 4PUWA 3UWWA 1Q4NX 2VXNA 5CZTA 2G97A 5CSRA 4F2UA 4RZ5A 2Z6JA 4AEOA 1ZL1A 3I7SA 5FCZA 1AMKA 3KCOA 1XYCA 2G4JA 2VRQA 4Z2IA 3U7BA 3P8JA 3B8IA 4R7OA 4TO8A 4L1XA 3URBA 4IMAA 2WNQA 2DZPA 1E40A 1OBAA 3EA2A 4R7JA 2GYIA 1PPIA 4MKSA 3W38A 3EX6A 2ZC1A 3NQDA 3T07A 1DWFM 1UPMB 3APYA 5FJRA 4PB5A 2QIWA 4OOUA 4IPJA 4K7VA 3UNDA 5HK4A 3UZYA 3L4WA 1NFPA 4KCUA 4JFSA 3QV9A 4EXQA 3ZLHA 3MO7A 3R2GA 4GISA 3LDVA 3OG3A 1NOWA 2DZSA 3UZJA 4LB4A 4R5EA 2WZEA 3EWWA 4JIHA 4O11A 4GXPA 4DBSA 4KEZA 4LUYA 4L6OA 3APGA 1OCQA 5BXRA 1SU5A 1OFAA 3GG7A 3NZGA 3CYJA 3SRHA 4OHQA 1V4YA 3O1NA 1YX1A 2DT3A 4KRUA 2EQDA 1VCFA 3V0UA 1BTCA 1NM9A 3S9IA 4BS0A 4RL3A 3GBEA 3EXTA 2HBXA 1S5TA 2WMFA 1JJKA 2J25A 2ICSA 3VUPA 4EVZA 5I77A 4A3QA 1WDRA 3E74A 5FJOA 2G37A 3TROA 5ABTA 1EIXA 1MYRA 4UTHA 4AWTA 2PDMA 5HINA 1YW1A 4ROQA 1AL7A 3NM3A 2BG5A 4HN8A 1R3VA 2AL2A 4MUPA 2FGLA 3FJ6A 3C8NA 1LT7A 3PUEA 1VCGA 3PULA 1EO7A 2WJFA 1PHWA 3RO6A 3MVIA 3AS1A 3SCPA 4KEUA 1OZMA 4V15A 4NRRA 1NDWA 4Y9AA 4GJ1A 5I23A 9CGTA 4PTDA 1TMHA 1RY8A 1H7XA 3REQB 2C91A 2ZDSA 5EMYA 3GHTA 1Q7ZA 4JPGA 3M16A 1WDWA 5MF5A 1EDQA 3AIBA 2DDXA 3NQCA 5M2FX 3V16A 3O7UA 4PZVA 4MB1A 3VC5A 4JN6A 3GW0A 1HKJA 2EJAA 3W74A 3PFMA 2BY3A 3WUBA 1BXCA 3WK0A 1TTJA 2R8WA 4JTIA 1HT6A 2WVVB 4S3BA 5KSWA 2PRLA 1HN1A 3CMJA 4C6LA 1GVRA 1ONEA 4ADSA 1KBJA 1VYPX 3BCFA 3HF3A 1SMDA 3MJMA 4HN4A 1W1A1 3RJYA 4IIBA 3S0CA 3TAKA 3MUZ1 3GX9A 3TQ0A 1XIMA 2X09A 1EF3A 1EIBA 4JKMA 4O0ZA 4FMVA 1SJCA 4IOTA 1Q6RA 2ZX6A 1AD1A 5A6LA 1W3NA 4MHBA 4C5YA 1GOKA 3IAPA 1M6JA 1LG1A 3G2GA 2O4MA 1GUVA 3VILA 2WNZA 4US6A 3W3OA 5HPCA 1F6PA 3W7IA 4LUTA 3TU9A 2X2GA 2QDHA 1R7AA 1RJRA 2X7WA 1O12A 1JPIA 4H3DA 1XBXA 1F05A 3TTSA 2WVUA 3EOLA 4XIMA 1TVLA 3QW4B 2R24A 1XDLA 2TSYA 1X7IA 1NQ6A 2PLCA 3SN0A 4A3RA 8XIAA 5I00A 3QBUA 4LGXA 4CCDA 4Y6GA 1B9BA 4PEEA 5A95A 4LCSA 2Q02A 2ZZ3A 3VKCA 2E9MA 1LBMA 4LNYA 2F84A 1E6NA 1ELSA 2FB3A 1US2A 4DHGA 4EOUA 4UCGA 5E1QA 2WHLA 3B9DA 4LH8A 1K6AA 1N7KA 2DP3A 3EEZA 3L4YA 4PMDA 1JZ3A 4C6DA 1A3WA 3DDMA 5BRBA 2Q3RA 3B0XA 2VR5A 4GA8A 4JQ1A 3WLLA 3Q58A 5FACA 2V81A 1NSJA 3M6YA 4MLJA 3EDJA 1P7TA 4X2PA 2QQ6A 4JHMA 3C2RA 2G5WA 3H21A 1RQHA 1E6ZA 2NWRA 4Z1CA 1WQ5A 4I9TA 5DN1A 3WEOA 4U33A 2WBGA 4X9YA 1FBAA 2ISVA 2QGHA 1IIGA 2RJHA 1K8XA 3T0AA 6REQA 4LVDA 2ZUVA 5HANA 4AWUA 1SQ7A 3B4UA 2W66A 3ZJ7A 2YA1A 2RUSA 1UD5A 4LFYA 4N6EA 3QKZA 3VD9A 2NV9A 3CZLA 4UTKA 5J5RA 3POCA 3TONA 3S1UA 1BSLA 1N8IA 1FWSA 5HR7A 1EPVA 4C1LA 1W6TA 2WYSA 1J01A 1P1MA 3M6DA 2GDUA 1C29A 4X63A 4LJ3A 1PDYA 3MI6A 2WC7A 3RU8X 3UJSA 1DQXA 4YL2A 1J8VA 1SJAA 3EPMA 3R1ZA 1CGXA 3GKAA 4LC6A 4DN1A 3EKGA 3OLDA 2GDVA 2ZXQA 1EP1A 1MRQA 3NNTA 4YHEA 3OO2A 3IPWA 1FWBC 4ADUA 2DJLA 4P7NA 1NFBA 1IR2A 4O52A 1XI3A 3JRKA 2RGLA 3U5UA 1WBHA 2EG7A 3F7JA 3B04A 2PGEA 3W7JA 3FS2A 1Z41A 3KX6A 1U5JA 4MDOA 3PUDA 2WZIA 1K02A 3MSGA 4M3PA 3LPPA 4AZCB 1DE5A 3D3AA 3LXCA 4ILSA 4CVWA 2J8TA 4IHCA 3NPWA 1VB9A 4DBUA 4GXMA 3W87A 3EB2A 2INZA 4L56A 4NI8A 1HZYA 3Q4DA 2Y85A 3ATYA 4IMDA 4DJDC 3WBAA 5AVHA 4BFAA 3ICJA 4O15A 4MWAA 4JBRA 4LV4A 4LVGA 1RLCL 1YDNA 1NWTA 3MC5A 3UJEA 1E55A 1IXQA 2XN2A 2JE8A 4YCPA 1ESWA 4PMOA 3OYZA 1S5WA 3W1MA 3GH4A 2YGYA 1CW2A 3RX3A 5K9DA 4F0MA 3LCLA 2QT3A 2YW4A 3VIHA 3HGSA 4D6GA 1H7OA 2PF8A 3LCFA 4KEMA 5D2XA 4AF0A 3CM4A 3WBYA 4JGDA 3BCDA 1SO3A 3BG3A 1B3OA 2ZUSA 5CPMA 5CG0A 2XISA 3TWBA 3MHUA 4WR3A 3AHXA 4GYPC 3OLGA 3W7PA 4AD2A 3VDAA 2C1GA 4CGTA 3MMTA 5AECA 2P3EA 1G1YA 4YJ5A 3N15A 3SAZA 4HNTA 1O5RA 2IPFA 1EP3A 2VURA 3W7OA 4U2ZA 5G1TA 4NJHA 4NU7A 3WEMA 2VX6A 4D9PA 2AKZA 3U4AA 1CPUA 3VM7A 1Q63A 2P3ZA 1DJHA 1MMFA 2BHZA 3L5LA 4JKKA 1JUEA 3QHOA 2YL9A 1PL9A 1EO5A 3IGXA 4FS9A 2MNRA 1BHGA 1ZAHA 2OOGA 4MJ2A 4RPPA 3N25A 4TX8A 2YOCA 2QCDA 3ZR6A 4GWEA 1KQYA 2PLMA 1ZBCA 3M0MA 4S2BA 3BG5A 4BQ2A 2XINA 2ZZ4A 3GW3A 4O12A 4JD4A 3PSWA 3Q67A 2XIQA 5ABGA 3SUUA 3S1WA 3FYYA 2XIBA 1HJUA 5GJNA 1QW7A 3QGKC 4O0QA 3TR2A 3KBVA 1OY0A 5ECUA 1XLDA 3PR2A 3EOUA 3IRSA 5MHBA 3ALFA 1OGBA 2X41A 3HG3A 2I56A 1OC7A 2E25A 5AHLA 4AG0A 2NUYA 3MYOA 3ELFA 3PPCA 4WXZA 3VK5A 2F7FA 3MMUA 5M5DA 4ZO6A 4AIOA 2BGSA 1P0DA 2WK2A 1GOMA 5AHIA 5CG7A 3UYCA 3PNUA 4OUIA 3GNXA 5BOOA 4AEEA 1XHGA 1KO0A 1ZU8A 1UD8A 5HBFA 1M53A 4MB5A 3SI9A 1TWZA 2G3FA 1UZDA 1LT8A 2NWSA 2IXVA 3ZVHB 4BF5A 1E4LA 5HMSA 3TW6A 7TAAA 4UFHA 4F3HA 1UA3A 4QLJA 2JGYA 4P2VA 2BTMA 3GHUA 3AS3A 2QJHA 1GOOA 2WKLA 3IANA 2CZ5A 1MI3A 4MOZA 4LUJA 1GVOA 3VD3A 1F5ZA 1N82A 3L4XA 3MS8A 1CEOA 4AYSA 2OQLA 3U0HA 2JIWA 2YB4A 2ZZ7A 4RE2A 2WSRA 4Q4QA 7CGTA 3WDIA 1NFGA 1WDQA 3ITYA 4I9JA 3FEMA 1JZ4A 1Q65A 2C7FA 3EXSA 3LY0A 4C6JA 3RLUA 3WDPP 4E0CA 1X7FA 4QE5A 1WNOA 4DJFC 3WLIA 1KTNA 1UKQA 1TTPA 2IUZA 2C14A 3DKJA 3WY1A 2GGIA 3JU2A 2WHJA 5IDZA 1FWAC 3RITA 1IXNA 4QM1A 3W26A 3WNNA 1Z44A 1ICQA 4IL0A 1M68A 4WEVX 4WUIA 1CB7B 1FHUA 2C3ZA 1ZCOA 4Z0SA 3UETA 1E1CA 3ZVIA 1S5VA 1W5MA 1FCVA 2ABBA 3VIKA 3IWPA 1MUCA 1OF6A 1EYWA 2FPTA 3AJ7A 1H4PA 1GNXA 2ISWA 3OBAA 3N2BA 1KRMA 2E77A 5XINA 3FA3A 1RALA 3KRSA 2Q6ZA 3ABSA 3TJIA 3IJ8A 1W54A 1SVDA 5D9PA 3R79A 2CHOA 1OABA 4PODA 1XRSA 3FKRA 3HV8A 1GW9A 1ICPA 3KVKA 3DG3A 1W17A 1UUMA 4Q33A 4O1AA 4W4QA 3O6DA 4HYRA 3UWYA 1E6PA 4X3ZA 3SCRA 4XAPA 4WJ8A 2QCEA 4GNJA 1RR2A 4JTRA 1OF8A 1E0VA 3DZ1A 6CGTA 1HKMA 4ZE5A 1IHIA 1TKKA 3LCHA 3OZMA 4BI5A 3GB6A 4UFKA 3NL3A 2FTWA 1ENUA 1IR1A 2WJEA 4HZ6A 2QUVA 2VVSA 3WQWA 2PI6A 1CLKA 4F2BA 3N6HA 3IIZA 4LWWA 4QBXA 1JG9A 1FWJC 1ITUA 2V63A 1TZ7A 2O7SA 3KDNA 1WDSA 4BHYA 3GBDA 4LYKA 1ZJIA 4K39A 4CQ9A 2HBVA 2XFFA 1SR9A 3CHVA 5EB8A 3AMCA 3HQOA 3QN3A 3WBEA 4HJWA 5AHNA 4Y9OA 3N2XA 1EPXA 4GJIA 4MJMA 4DUXA 1RK5A 3HURA 1EBHA 1P6BA 8CGTA 4DELA 2INEA 4J3WA 1W56A 4DF2A 5CPOA 1G4EA 1TWIA 4UR8A 3PAJA 4KCTA 3AJXA 1POJA 1BWLA 1PCWA 4QE4A 4PTVA 3QC3A 1YNQA 4QS6A 3WLPA 2R1MA 3TUUA 4GIAA 4GLEA 3G1FA 4O13A 1EF2A 4QJ5B 1ZS2A 1CNVA 4P8UA 1QO2A 4QISA 5HQEA 4NASA 3WJZA 1TB3A 1VJZA 4RNJA 5AZ1A 2BFGA 3HMJG 4Q8QA 4ZB0A 3PVFA 1T99A 3RCNA 4C6BA 2NSOA 4KKXA 3OA5A 4QLLA 4O1EA 4UTFA 4JTHA 1OC5A 1UD4A 1KLZA 2TRSA 1XRTA 3EGJA 5F4WA 4UTJA 3NZ1A 4PCNA 3AIUA 2NXGA 4ATWA 1UUQA 3ZJ6A 1DWGM 5FF4A 5J5DA 1QFEA 1UCWA 3WNMA 1EJTC 3RX4A 2A2IA 5FJUA 4EPEC 1V6YA 1DIKA 2V5JA 4KQNA 2R6OA 3U9IA 2CETA 3VKDA 3IJ7A 1TUFA 2NT0A 3E49A 3I3EA 5CBJA 2J9XA 3SADA 2QEZA 2PTXA 4KT2A 3NQBA 1B54A 3OPSA 3LHZA 3QGAC 1XFBA 3HPAA 1BQCA 3FN9A 2OWCA 4QRNA 2IPGA 1OADA 4JEQA 3DI1A 3B9EA 3LGGA 5DBTA 4GZEA 4MTVA 2E6YA 4GO9A 3AZSA 1OC6A 2V5DA 4L64A 3II1A 1SM9A 4CU6A 1E51A 3DGBA 3WYZA 3LTYA 1US0A 5F4SA 4K3ZA 3UJFA 1OCBA 3L23A 4LPCA 3V35A 3QV6A 1I2RA 1EXBA 4XV0A 1GWJA 2WZHA 4AD0A 1MRAA 1T41A 4PUNA 3REQA 4CQAA 4JCMA 3OU8A 2F8QA 3KL0A 4S1FA 1YPIA 1XCXA 3VCNA 3GFYA 4PN2A 2A7NA 2IXUA 1KGXA 4NIRA 1Q7MA 4GQGA 2ACRA 2VVNA 4URIA 3T0DA 1F6YA 3TR9A 1XIEA 3ABXA 3PF3A 4PSRA 4ZGYA 4W93A 1E0UA 3QLLA 2YYUA 5GNZA 1J0KA 3S47A 1AK5A 1ZJAA 2H6RA 2ZRXA 3T8LA 5EA9A 1EP2A 3A9IA 3QR1A 5K7JA 3D46A 3LCGA 3LQLA 4YMZA 4MPKA 1A47A 1TPC1 4HHLA 2CITA 2I16A 2Q8LA 4B3ZA 4A29A 3GUWA 1M5WA 3BV7A 1UC5A 1GKPA 2VUYA 1G9HA 2DQXA 4MG4A 1EB3A 1UPPA 4LVFA 4Y96A 1MXSA 1DIDA 1D9EA 3LHYA 1LUCB 4AWEA 5IHRA 3CWNA 4NX5A 1UJPA 3NFUA 4AY7A 3U4FA 2ZWYA 4O4VA 2J74A 3DFHA 3WMSA 4XZNX 1J0ZA 5T9BG 3P14A 3NPUA 3IJLA 1X6UA 1CCWB 3BVJA 3W6LA 1VIZA 5CPQA 3UVAA 4DPPA 3AU2A 1GOWA 1HUVA 2GQAA 1H0IA 2Y61A 3MWAA 2GWGA 1JI2A 3FVMA 4UWMA 1M7OA 2OB3A 4PFHA 3VXGA 4IGNA 1H7PA 1RUSA 5BOFA 2PDWA 2Z7KA 4Z2HA 4Q8NA 2Z24A 2J6XA 3KDOA 4LF1A 5G2IA 3O06A 3L4TA 4QITA 2Y5JA 4ZFCA 2HEJA 3WQCA 3WQ6A 3ONBA 5DFAA 3AXXA 3OGRA 4RW5A 3PJXA 5C70A 3CNYA 5L9FA 3QJAA 4XTDA 2ZX7A 4IWWA 4J5NA 3FEQA 2J75A 3WF2A 4DF1A 4EF8A 1H3GA 3WQEA 3MWCA 4PE8A 1FRBA 4HK7A 4UQEA 4NZ1A 5FAGA 3KHDA 3O07A 4G9PA 2PDGA 3NDZA 4A3HA 3NVDA 2B7QA 5A6SA 3BLDA 1OWQA 2Z2AA 3VGFA 3NZPA 4AY8A 1FKWA 4IQDA 4M56A 1FHDA 4ZOCA 2CERA 4N02A 1Q6QA 3WD2A 5CBBA 4PMQA 2J7EA 4LALA 1TSIA 3G1RA 1SMAA 4Z2JA 3VPLA 4J1OA 5EPDA 4IP4A 2R1KA 3CB8A 3ES8A 2QCMA 3DI0A 3UERA 1XH1A 4DRSA 4NAFA 1XICA 1H11A 1OD0A 2BSLA 5M03A 4DJEA 1QHPA 1GHSA 1IEVA 3J7HA 3MP3A 4GMEA 2OZ8A 1A0EA 2WM1A 3BICA 3LLDA 5LKYA 1PCKA 1VRDA 2ZKMX 1EGMA 3G3MA 2V0TA 1NF7A 3UA3A 4LX4A 2DSVA 4GKLA 2X16A 3GDKA 1U83A 3Q2DA 2OO0A 3WK3A 3INPA 4NX0A 1VJSA 3ID7A 5REQA 3V75A 4DYKA 4N9CA 5H8PA 1PZ1A 2H8XA 3UWUA 2Q8ZA 1C7SA 3CQKA 3U3HA 1KBLA 4PB3A 2KAUC 4JIIX 1GEHA 3GTXA 1TREA 2PODA 3MI2A 4X61A 1YQ2A 1A5SA 1TQXA 2UV8G 3MDWA 5EGRA 3QZ6A 1LBFA 2C1HA 4A22A 2ZX9A 3LYEA 3OHMB 4MB3A 1UZ4A 4DWSB 2QXWA 3MU7A 4UFIA 3PB2A 4S39A 5C7HA 2XJ7A 2VELA 1WZAA 5T9CE 4D72A 5BXTA 3PBYA 1FWIC 3VD7A 4HVXA 1ODZA 3KZSA 4HNNA 2YDQA 1H7WA 3QV7A 1P0NA 2X40A 3CEPA 4H9YA 3M0XA 3EA3A 5GQBA 3TXVA 4PH6A 4HTBA 3GK0A 3NGJA 3GR4A 3MB9A 5D2WA 4LEFA 2HCVA 3KL5A 2PRHA 3R4IA 1KWKA 3SFKA 1KRBC 5MKGA 1QPKA 4GH1A 3CUHA 3OVGA 2IS7A 1CYGA 1SZEA 1R46A 1VRXA 3L0KA 1ZBWA 3U7VA 4QJ1A 2E5CA 2HK0A 3PP7A 2O9OA 3KBWA 1QO5A 1YTKA 3CV6A 2BVDA 2ZFAA 5HJLA 4HQVA 3IIOA 4OBSA 5FL0A 4TIMA 1W0MA 1YRRA 2HQAA 2Z6IA 4GVHA 2YSWA 3LMYA 2J27A 5EU9A 4ZENA 2XUCA 2VR4A 5C8BB 5FOOA 3CMFA 1ML1A 3AQUA 2Y7DA 1C9WA 1S2CA 1O6IA 1R3QA 4WGXA 1VFSA 3KBJA 3AYRA 1OCNA 5D9NA 2QGYA 3T55A 2XVNA 1T7LA 1EWEA 1RLDA 4AC1X 3D6NA 2ATSA 2BGQA 1PZ3A 4Z2GA 1QHZA 4AD1A 1G69A 4H04A 4JZ5A 3VIFA 3UG8A 2YXOA 1GTEA 1REQB 2ZOXA 4DWSD 3TSMA 4S3AA 3RR4A 2OLHA 5C9XA 1LZOA 2PPGA 5E0KA 1BKSA 3WFLA 3QF0A 4NF7A 4Q3MA 2P88A 2DH3A 4NZFA 3QW3A 3B40A 2P8CA 4WJXA 1VJIA 4IUGA 1EYEA 3SY5A 1A5OC 2PA6A 4QX4A 1R3SA 3EWZA 4H4IA 5CJNA 1V8EA 2A3HA 3H2NA 1UWIA 3VMPA 1PKMA 5AC5A 4WCJA 4UR7A 1QPOA 1QI3A 2RDWA 3EKLA 3P93A 4AIUA 3N04A 3HN3A 4Q4PA 4DO5A 2G3NA 5D8ZA 3HPSA 1CXHA 4QIUA 4CCEA 4KCWA 3GHSA 1FWEC 1D8WA 3VKAA 3W7CA 1I1XA 4XO6A 3CB3A 3ZVHA 1FCBA 4O18A 2QR6A 4P61A 3ZT7A 1RH9A 2VX5A 4O28A 3W2MA 4XBJA 3STPA 5BWFA 1P1XA 4Z17A 4R85A 4NT0A 1U1JA 2V2CA 4JY9A 1TIMA 4EWJA 4O10A 1LM1A 3BMVA 4KFPA 1K7FA 1EBGA 2XWEA 4QXIA 3FIGA 3E02A 2D3LA 5KTLA 3I4KA 1M7JA 4MFDA 1XLJA 1KBBA 4AVOA 3WDJA 5DO8A 5KZ6A 3ZIZA 4DO4A 4J3XA 1PWLA 2FH6A 3GZAA 1KNWA 2ISSA 4ROPA 1TCDA 2KZHA 1TV4A 1ZHAA 3VIOA 2J9YA 4LTSA 2HRWA 3CEUA 2Y89A 1V3HA 4FF5A 2DPEA 4NYUA 1JZ5A 3E0IA 1XLIA 4W8BA 1OGGA 5FJPA 4PUJA 3LM3A 2VEGA 4FI4A 2QVHA 3ZXWA 1UD6A 4YWIA 2DH2A 4PCPA 2VOTA 3TJ4A 1E1FA 3WLTA 4GQRA 2QPXA 4GQBA 4ECLA 4IIGA 2W5FA 3U6WA 3OZYA 3SCQA 4UTMA 1XBZA 3M0HA 3TE9A 1JAKA 4M81A 1V0LA 4LRSA 3VMOA 3SCTA 2R82A 3H4XA 1GJPA 1PUDA 3ABRA 1XCWA 1UW9A 2CBIA 2OZ0A 1OX4A 1XBVA 5EMJA 4DYJA 1KGUA 4H9ZA 1YIXA 1H49A 1A5MC 4OBRA 1XLMA 3LHTA 2YZ5A 4YVVA 1K8ZA 1XSIA 3KVMA 1KQZA 4FNPA 3CUGA 3W2LA 2VRKA 3I6EA 4PRTA 2CIPA 5LHEA 3VKJA 4WKHA 3W82A 1L2QA 3NL5A 2A85A 2NQ9A 1ITXA 3WUEA 3NWRA 4TMBA 3AHVA 2DJXA 2RAGA 3M0LA 4NILA 3VE9A 5KETA 4DBEA 1AJ2A 1UQZA 1J6PA 1BKHA 4BZYA 2CZEA 3C52A 5DXYA 2OFJA 1FWDC 3KRUA 4HYVA 3V3WA 4HHPA 3WLOA 3OZPA 4PBFA 4QQUA 1QRQA 1MXGA 2E9BA 5LIUX 1BVNP 3BG9A 1C92A 3ATZA 1OYAA 4UZSA 3PZOA 5DBUA 3DC0A 1J0HA 3LPOA 4FLOA 3DFQA 1GGOA 1KV5A 2WMIA 2BV9A 2NLIA 5KITA 4ZOAA 1Q6GA 3GDLA 3DGRA 4FR6A 2WO5A 1GK8A 1TZZA 4F40A 2WZTA 3A3HA 4C5ZA 3PNZA 1XX1A 2CXEA 3CV1A 2VGFA 3TN5A 2Y88A 3CAVA 1EX1A 4ZSTA 3TVAA 3NXFA 3ZWSA 4DPQA 2A6NA 1YLVA 4AZ6A 4RXFA 3A24A 4Y9NA 2HE8A 3DFTA 5XIMA 1UD2A 1FDZA 2G3MA 3SEPA 1L6GA 1QOPA 2AQWA 1NY1A 1IV8A 1Q7QA 4KF1A 3SCUA 5CPLA 3LGEA 1C8XA 4Y8EA 3W6MA 4B2DA 1Q2RA 3LSBA 4HOXA 1GQLA 4FXJA 1O7AA 1AUSL 2CBJA 2FDMA 3TX9A 1R3WA 3ZS4A 5JQ9A 2A7PA 4IJBA 4WQ6A 4CNUA 2DGAA 3VDHA 2VJXA 1W3IA 2PD9A 3SECA 3C0QA 2E5DA 4B4HA 1G7VA 1X1NA 4UQCA 3BK0A 4IPNB 5IFPA 1JQVA 4JIRA 1V3IA 1OX6A 1TJ2A 4WOZA 3STGA 4IMGA 2CEQA 4FIRA 3W1RA 4RDWA 4CD4A 1AZ2A 1L6YA 5FSEC 4TTGA 1JCNA 4A8IA 3FDKA 1A5LC 4DI8A 3ZSTA 1WO2A 1W5NA 1FWGC 1XSKA 2VC7A 2TAAA 3UEQA 2V67A 1W1VA 5D30A 4D6IA 2F61A 1A49A 1FUYA 1W1TA 2OVLA 3BC9A 4RZ4A 2I5GA 4OE7A 1CDGA 4O17A 3WD3A 5LIYX 1XYZA 3CQJA 3CYVA 3M1ZA 3LENA 3PHAA 1IWPA 1WOBA 4ORMA 1V6WA 3C0JA 2Z29A 3B9NA 4D8AA 5ECVA 4OVXA 3VGHA 4LAUA 3VA8A 1UQYA 2AL1A 4DLMA 2XIIA 1SFSA 2BASA 1TPDA 4LVBA 4YIWA 3NO1A 3SR7A 3HA1A 3O8AA 2A21A 1QK0A 1L6FA 4KWUA 1WKFA 1WP6A 3PAOA 3R25A 3LM7A 3B97A 4GYJA 4O1DA 1V0MA 4EF9A 4FLSA 1E3ZA 1M7PA 4U2YA 4F8XA 3DFOA 1BTMA 4O0KA 5I3KA 2BS9A 3QH2A 3THQA 1TWDA 1SSDA 4M1BA 4ZO7A 5DEZA 3P5ZA 1WCGA 4IGHA 1L8NA 4NUWA 2IQTA 2FZ9A 1YXYA 3T81A 4UR9A 1ME7A 4KEVA 3QMTA 3DFYA 3PC0A 4H2CA 2YDRA 4JFWA 2OWWA 3N18A 1VKFA 4S3JA 1DWJM 2VEIA 3QSTA 2UY2A 1CB2A 4ES4A 3TCEA 1KC7A 5HULA 5I78A 3NDOA 3W1LA 4OZOA 4WSHA 2Q09A 3PTMA 4W8AA 1HKVA 1N8WA 3DUGA 2PDKA 3F2BA 4Y7EA 1IT8A 4JX4A 1C93A 2W62A 2RH9A 2OMAA 3UQNA 2KX9A 3QFEA 4JTKA 4IX2A 3DG6A 4M6QA 4ZODA 1FWCC 4FZIA 4M6VA 4DBWA 4LU0A 1E9IA 3VNLA 1V6XA 3RM4A 4QLKA 4C7FA 6PTDA 1K70A 3OOQA 5HDRA 2AKMA 6A3HA 4KESA 3HOJA 1JAEA 1DJZA 3S1XA 4E2VA 4GGBA 4IM4A 4E5TA 1ICSA 2C0AA 4DZAA 1ITQA 3BAWA 2REQB 1DP0A 1RA0A 3TEVA 2PLJA 4W7UA 1QATA 4CU8A 2PDBA 3SCWA 5F2LA 1CLVA 3DFNA 2FHBA 1LJYA 1VEMA 4JTCA 2E8ZA 1CWYA 1NOFA 1C8YA 2TYSA 4MUZA 2QLYA 3ITCA 3EBVA 1UR0A 3KOXA 2FGBA 1W3TA 3C5QA 4JFVA 4AZGA 3O6AA 4JTQA 3QHMA 4DJEC 3GAKA 3BZGA 4WSKA 3F4CA 3W75A 3OLEA 5CLTA 4PUKA 4CNTA 4RK8A 3UD6A 3H70A 1GYNA 3KRZA 3LBMA 1R9ZA 2V5LA 3N9KA 5AN7A 5E9AA 5A2BA 2QUTA 3VOFA 1O5XA 1BRLB 1QNOA 1G4PA 1OYCA 2Y63A 4OV4A 2W79A 1VFTA 2L5HA 1TV3A 3DU0A 3R5EA 3RFAA 3WUGA 3ZOAA 3GAYA 4LVAA 1Y5VA 1X8FA 4BQ5A 3K8MA 3O0FA 3P5YA 1PHQA 2X8RA 1FWFC 5FEPA 4UUIA 4LEQA 3BW3A 1C7TA 1TPB1 2YL8A 4AVNA 2PDNA 1Y7VA 4H7CA 2IW0A 2G96A 5H2ZA 2PDQA 3M44A 1WXZA 1K6WA 1X1OA 4F79A 1FVPA 4FX7A 3K46A 3CPRA 3S5OA 3QOKA 4MNLA 4HMDA 1S2TA 4KWVA 2VCCA 2PURA 4IISA 3UWQA 1LCOA 2J79A 3KM8A 4F0LA 5IXEA 3VOHA 4US5A 5EMMA 4LBSA 4XZHA 2FQIA 3UJ2A 2YCLB 1CGTA 1FDJA 4AWSA 1FWRA 3T40A 3L9CA 4BK9A 1LOSA 3TYBA 5BYWA 1WZMA 2O55A 1JF5A 2PD5A 2W91A 2PTZA 4HIBA 1ISYA 4RV3A 4NY2A 2OGJA 4M7SA 3E38A 4CN1A 3GC5A 1EGZA 2AMXA 4J27A 4J3VA 3SUSA 3F03K 3NTYA 5HMFA 3G0UA 1RBOB 1KFLA 3LU2A 1OT2A 2YCJA 3EX2A 3FLUA 3PG9A 3P82A 4ZXLA 1K1DA 4TUFA 3E2QA 4KBXA 2FPYA 3ZWTA 4H41A 4M24A 2DT1A 1NELA 3MDUA 1JQXA 1J0YA 1I0BA 2AGKA 1O5KA 2CWXA 3WMBA 3JZUA 1MEIA 5B7ZA 4N4QA 4NZ5A 3LZ3A 4UTIA 3PBGA 2XPKA 1X6NA 2OEMA 3QY6A 3AC0A 4RV8A 1ZPTA 3FHAA 1TUXA 3ZJKA 1DBTA 3ITVA 1R30A 1DKWA 4GRSA 2EHHA 2DT0A 3WLQA 3RX2A 3VU2A 5M17A 1ISZA 3RCMA 2FKPA 1UA7A 2XM2A 3WIJA 4JDBA 4TVUA 4H8VA 4E8DA 3WMCA 4E2DA 1XUUA 5DRIA 3PZUA 2FJUB 2OEJA 4IPIA 5JMUA 5C6MA 3W2JA 2PC4A 3FAXA 4HZMA 1LG2A 4GINA 4RJEA 4JHZA 2JFEX 2OX4A 3R0UA 2WC3A 2BODX 5DY2A 1WUEA 2HXUA 3R0KA 5EY5A 3H2EA 1DJNA 5D2YA 2WMGA 2HMCA 2XFWA 2P50A 4XUGA 3NSMA 3K1DA 3AWNA 1OCJA 4IQLA 4AZ5A 4GY7A 4GCAA 2E09A 3K4WA 3QR0A 2G50A 2BOGX 5D33A 4H9VA 1TELA 1VC4A 3UR8A 1VR6A 1MXDA 1DXEA 3L5MA 1N2VA 2VQUA 2XSAA 4RDZA 3QPEA 3BMXA 1AJZA 3AIRA 1QW9A 3GIPA 5BRQA 4BY3A 1REQA 3AXIA 1EJUC 4B5WA 5C5YA 1CX9A 4UTUA 1QHOA 4HYWA 2ZUUA 2VCBA 2C71A 3ARVA 5IHSA 2XHYA 1BXNA 4GI6A 4CVUA 2FZ8A 1PSCA 3NEHA 1XW8A 2YB1A 1QMLA 3LUTA 1SO5A 5AC4A 1C9DA 2VMFA 4EE9A 1JPKA 3GH5A 3MHGA 3FDGA 2FMOA 4PA8A 4RNFA 3GKFA 1S46A 3S2MA 2HTMA 4M19A 3UG5A 3DBNA 3RK8A 2ZWZA 4B5TA 1EC8A 4A8NA 2VWTA 3G18A 2ACQA 1UKOA 3EWDA 3C0LA 3VABA 5FJIA 3STFA 4OOZA 1WBJA 3H6OA 3MP5A 1UR9A 2BVWA 3C6CA 3CZGA 1EOKA 1PIIA 3MCOA 2HISA 1W91A 2Q01A 5CSUA 1XL9A 2W27A 3S5ZA 1E56A 4XBSA 2DZAA 3BAJA 2F2HA 2HPMA 2DVTA 4NAEB 1XYFA 3PJTA 3EOOA 1BWKA 4IQJA 2H3BA 4RZ6A 3CASA 4YNGA 4DAFA 3V0SA 2OSWA 1UZ1A 4XZLX 1OT1A 1K9EA 2X1IA 4FNSA 4HU8A 1UH4A 4A2SA 3B06A 4FPSA 4GIEA 3UP8A 3ALGA 3GR7A 3F2DA 1HJXA 3GXPA 3ABZA 3IIPA 3VGBA 1RD5A 3T4CA 3HFYA 2IKIA 2FZBA 4QSHA 1XIGA 4G5DA 1VF8A 2ZA2A 4H9UA 1MQQA 3SSZA 1XH0A 2WCAA 2YDSA 1QBBA 4N4PA 1W9DM 3TTYA 3DHFA 1DJWA 4GE8A 1MQRA 2H8ZA 3K13A 1VP5A 1Z32X 2YR1A 3ENLA 3BSHA 2C1IA 4RW3A 3L0NA 5BWAA 1AZ1A 2QF8A 2BY2A 1QWKA 4TQTA 3I4EA 3WQOA 3EZ4A 3OHIA 1QVBA 3XISA 2G95A 1QDSA 4X9SA 3MTWA 3QLDA 2OSXA 1OG0A 2FHFA 3AS2A 5DMYA 1B4KA 5IFTA 3CWOX 5E0CA 2BXYA 4IXHA 3GU1A 1X96A 1VPQA 3B05A 5KZEA 4JTJA 3SQSA 1VPYA 4QDMA 2G3JA 4KRZA 5SWUA 2BZNA 1RJPA 3UY7A 4ALDA 1EH9A 1PX3A 2Z1BA 5CBIA 2P0IA 4ENLA 3LBOA 4H9XA 2BBFA 3WLJA 3FOKA 3DX5A 2BVYA 3ZZ1A 4QP0A 1BVZA 5D8WA 5I3JA 2I5IA 1WDPA 5K4XA 2R14A 4S3KA 1MW1A 1JGIA 1DTNA 3NGFA 5EYWA 2I57A 1XIDA 4IICA 1EC9A 1JI1A 3ANVA 3CQIA 3WL0A 4F9JA 3EWCA 4D8LA 3AAMA 3SJ3A 4CLMA 2QCCA 1BD0A 4PMJA 5BOEA 4W85A 1XIJA 4LS2A 3AOFA 2WBKA 4BI6A 2XGIA 2JF6A 4ZQNA 1UWRA 3WD1A 1TYGA 4IIFA 3W1AA 5CZJA 3K4DA 4RCXA 3WO8A 1QPRA 4F0RA 5KMYA 1E43A 1BYCA 1KXVA 3FJ4A 2VGGA 3WLRA 5C9RA 3M5VA 4H19A 2ZUMA 1MFVA 1O1ZA 3EX3A 5C71A 2R94A 4WDWA 4LUSB 1PVNA 4L6HA 1KFCA 3TYEA 4B9YA 2VDGA 2DSZA 3TA9A 4FNUA 1BAGA 4GQQA 3W7GA 3P7YA 1S2WA 4GZJA 5F1UA 2CZVA 1NDVA 4M6PA 1H2JA 3GVGA 5CPNA 2V68A 2C15A 4Q8PA 3IGUA 3HQ1A 3V18A 3ARWA 2QPSA 1R9YA 1SFLA 1VHCA 3EMCA 3F5LA 4LAOA 2J9ZA 3IEBA 3S2LA 1XDJA 1LROA 3RGTA 1LWHA 3BANA 4PMUA 1XUZA 2PDCA 3TYAA 1W8SA 4O1CA 2Q71A 3BUVA 2J13A 2POZA 3QRHA 1HKKA 3W83A 1M04A 2VM8A 3H24A 3RJXA 4L9ZA 3MMWA 2RHGA 3SY1A 4Y9PA 2RKXA 3E9AA 4V28A 1JULA 5LGXA 4A4AA 3LMZA 4CNNA 2ACUA 4Z42C 2EPMX 3ARSA 2X1TA 3VIIA 2F6UA 6TIMA 4ZOEA 1WAWA 4W5ZA 5CC6A 1S1RA 1XR2A 2OZ3A 4LOCA 1B90A 2O4QA 2O9RA 4XG1A 3KOYA 1XBYA 3OJGA 1M65A 3NQAA 1GTHA 3NOYA 5PTDA 1G01A 4PCSA 2C13A 2IPJA 4ZO8A 1HFBA 3WENA 1I2OA 2DZBA 3HFTA 1QK2A 3WLSA 5B7YA 3I3BA 1XF0A 3KWSA 3FJNA 3T9PA 1H63A 4UFMA 4GH3A 3K2GA 1NWUA 4YCOA 4L4MA 4Q32A 2W67A 1KLYA 3R43A 3HO8A 3WEZA 3C86A 4XX6A 2Q8XA 3SB0A 3GYCA 1H62A 3VIJA 3E2RA 2E8YA 1XLAA 2Y8UA 3TYZA 3E5PA 1KR0A 3BGGA 4ATDA