5AZ0A

Crystal structure of aldo-keto reductase (akr2e5) of the silkworm, bombyx mori
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
345
structure length
324
Chain Sequence
KVNVPNFKLNNGDEIPALGYGTWLGVSDFDGTDIPKLLDALSYAIDIGYRHIDTAHFYRVEPEIGQVVQEKINEGVVRREDLFITTKVWQHYHRAADVEVSLRASLHRLGLDHVNLVLMHWPMSISQEGVDEKIDYLETWRGFEEVLKKGLTKAIGVSNFNIEQMKRLLTNCNVPPAVNQIEVNLNLSQADLVDYCQANEVVVVAYSPFGTMVPSLNSPEPKLDNPAMLAIGRKYGKTVTQVNLGYLYQRGIVSIPKTVTKSRVLENASIFDFQLDDEDVATLAQFDNGFRTVRPLFWQPYENYPFDVVPGQDIPIAMRKWKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of an aldo-keto reductase (AKR2E5) from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein
total genus 118
structure length 324
sequence length 345
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5az0A00
3UWEA 1MRQA 4GCAA 1Z9AA 1ZGDA 3UZYA 2BGQA 1S2CA 3V0TA 3LQGA 4XZLX 4EXAA 5KETA 3LUTA 1HQTA 2PDJA 1RY8A 3R7MA 5LIXX 4JQ1A 3WBYA 1AH4A 1FRBA 3CV7A 1VP5A 2ACQA 1PYFA 5HNUA 3B3DA 2WZTA 3ONBA 4XVDA 4FA3A 2PDCA 3EAUA 4YS1A 4MHBA 4HMNA 4Q3MA 4GQGA 2PDLA 2FZ9A 2DUZA 2PDHA 4JTDA 3BUVA 1LWIA 2F2KA 4WEVX 4EXBA 3DOPA 4I5XA 1S1RA 4JIIX 1Z8AA 3VXGA 2FZBA 4GIEA 5LIYX 4WDWA 1XGDA 2BGSA 5AZ0A 1IEIA 4LB4A 4YVXA 4R9OA 5HNTA 1ZUAX 2HEJA 3WBWA 4DBUA 2PDPA 4PRTA 2FZDA 2P5NA 5DANA 2PDGA 4WDTA 3BCJA 2HV5A 2I16A 4FALA 4NKCA 3O3RA 4ASTA 4RPQA 2PDFA 5AZ1A 3WBXA 2ACRA 3V36A 3LN3A 4FAMA 4PR4A 3UZZA 4XZHA 3LENA 1Q13A 5LIKX 1X97A 1MZRA 3R94A 4DBSA 3R58A 4QX4A 4XO6A 2HVOA 3BV7A 2DV0A 3C3UA 3KRBA 3NTYA 2IKJA 1Z3NA 3MC5A 5JH2A 2PDXA 4JTAA 3R43A 2PDBA 4LBRA 1YE6A 4WRHA 2A79A 2ALRA 1AZ2A 5LIUX 3D3FA 1S1PA 4XZMX 2ACUA 4JTCA 2PDUA 1X96A 4WDUA 4PRRA 5M2FX 3RX4A 4XAPA 4JQ4A 1OG6A 3RX2A 4PUWA 3FX4A 1A80A 4FZIA 4PUUA 3V35A 1XF0A 1S2AA 1X98A 4IJCA 4H8NA 5C7HA 3M64A 4H7CA 4WDXA 4GABA 1Z89A 3GHSA 2R24A 2R9RA 2PDWA 4LB3A 1EKOA 4G5DA 3UZWA 3R8HA 1EL3A 1GVEA 2PZNA 2IPJA 1PWMA 1RY0A 4ZFCA 2INEA 1QRQA 2BP1A 3LBOA 3CV6A 4F40A 1EXBA 2FVLA 3WCZA 4JIHA 2IKGA 4XK2A 4JQ3A 1PZ0A 2I17A 4JTRA 1EF3A 1AH3A 2PDMA 1J96A 2HDJA 4JQAA 3G1RA 4XVEA 4DZ5A 1AH0A 3LEPA 3O0KA 4ICCX 3LNMA 1QWKA 2IQ0A 4PMJA 2AGTA 2PDQA 3LZ5A 2IPWA 3CAQA 3COTA 3ERPA 1JEZA 2IKIA 4XZNX 2PD5A 3V0UA 1YNPA 3CMFA 2FZ8A 3UFYA 2HE5A 4YVVA 3LZ3A 2PFHA 3UP8A 1T41A 2PDYA 3BURA 2NVDA 4L1WA 3EB3A 1YE4A 4LAUA 4OTKA 3M4HA 2FGBA 3Q67A 1VBJA 4XZIA 1US0A 3EB4A 3MB9A 2VDGA 3T42A 2IPFA 4GA8A 3N2TA 1HW6A 5LIWX 3GHTA 3M0IA 1AFSA 4WGHA 3LD5A 3U2CA 1IHIA 2WZMA 3WG6A 3LQLA 2PD9A 2ACSA 1M9HA 4IGSA 2CLPA 4LBSA 3V0SA 1XJBA 2IQDA 1PZ1A 1ZSXA 2IS7A 3RX3A 1UR3M 1LQAA 3CASA 3S3GA 2DUXA 2J8TA 5HA7A 3GUGA 1ZQ5A 1K8CA 3UG8A 1AZ1A 4QBXA 1C9WA 3N6QA 3UGRA 2PDIA 3G5EA 4L1XA 1Q5MA 1RALA 3H7UA 3DN5A 4JIRA 5JH1A 3F7JA 4YU1A 3CAVA 4XO7A 3R8GA 4AUBA 2PEVA 3UYIA 1YNQA 3FJNA 3UZXA 4QR6A 4GACA 4JTQA 2IKHA 3GHUA 3Q65A 4HBKA 3H7RA 3QKZA 2INZA 2PF8A 1R38A 2C91A 1PWLA 2HVNA 4GQ0A 1T40A 4IJRA 2HE8A 4LAZA 4DBWA 3GHRA 2NVCA 2IPGA 3H4GA 3ONCA 1SM9A 2PDNA 2F38A 4YVPA 2QXWA 4Q7BA 2PDKA 4JQ2A 1ADSA 3P2VA 2ISFA 1MI3A 3R6IA 4QXIA
chains in the Genus database with same CATH superfamily
3CK5A 1OJXA 2WVSA 2YCKX 3TX9A 3MMDA 4I5UA 3PPFA 9RUBA 4B5UA 1I1XA 4A8LA 3NZ1A 3AWNA 3T6CA 2JALA 3CQHA 2NLYA 3BAJA 3RU6A 3CU2A 2P10A 1ZP4A 1R7AA 5G1TA 1QOQA 3T05A 5DY2A 4MPKA 3L4TA 3BZGA 3ARWA 5EMJA 2R1MA 1JG9A 4BQ5A 2VQTA 2REQB 5LSMA 1H7RA 1P6CA 1DE6A 1GVIA 3O6CA 1BPLB 1PX8A 3WENA 1FKWA 4LUJA 3FGCA 2VKZG 1KXHA 1VLIA 3H2EA 3VIPA 4HOZA 1CBGA 2OQLA 3I10A 3V18A 1POJA 4FA3A 1OG0A 2AQWA 1GQKA 1Q4WA 1K6AA 3KWXA 1LWIA 1CGWA 3OVRA 3MSRA 4IUOA 4FOJA 4UQ9A 3N2OA 4Q33A 1S5NA 3MW7A 5H8PA 4CEUC 2QJGA 1VFMA 1DQXA 1SZRA 2G4FA 3UW6A 3VNDA 4ZE5A 3MJMA 4DXKA 3POCA 4FX7A 5LXXA 2A2IA 3EB2A 4MZ8A 1DYSA 3B8UA 5KEZA 2ZKMX 1Q8AA 4C6KA 5H8MA 2PA6A 3C2EA 1E6RA 4PUNA 2RKXA 1E3ZA 4V15A 3MV01 2CLFA 4W7UA 3NZGA 1W1TA 1XBXA 3LHUA 5AHEA 1JCYA 1E40A 4G9PA 2NQ9A 2WVUA 3EOEA 1OABA 5I3HA 1V3LA 1TMHA 1FXPA 1NWRA 4J3VA 3G8EA 2WCGA 1HP4A 4X9YA 1ZJIA 3HF3A 8A3HA 3A3HA 3T40A 5FJPA 1J6OA 3EWUA 1CTNA 3E2RA 4AZHA 3OBAA 1KKRA 4KRTA 5CPQA 1WA3A 4FO4A 2BHZA 1WUFA 4GQBA 5A6KA 2OKOA 4N9CA 5E6ZA 4M82A 3KEHA 1N55A 3ZJ6A 5K9DA 4O8AA 3OLDA 4DUWA 4BWLA 1Z6KA 3V35A 4QCFA 1P5BA 2EPLX 3ICJA 1WBJA 4M6QA 3AUOA 2D20A 1GZJA 3WF2A 4WDXA 1X8FA 1QASA 5LNSA 4K8EA 3HO8A 4WKHA 3BLIA 1JZ5A 3S5NA 3CH9A 3O2LA 1HIZA 2A3LA 3UNDA 5DN1A 2UY5A 3GIYA 2X1RA 4LF2A 2J9YA 1W54A 4JEJA 4S3KA 4RE2A 3SY1A 3RCYA 1LG2A 3BG3A 1ZJHA 2VC7A 3WH7A 4MSSA 3VUPA 2ISSA 4B90A 1EF3A 1R2TA 4MJ2A 3S5SA 4XVEA 2VJXA 1ZTVA 4LCSA 1HJVA 2G8ZA 4MIMA 2FDMA 2Y7FA 3SO7A 3B97A 4JTJA 2O4QA 3LPFA 1JI1A 2PDQA 4WK9A 3C2OA 1EUAA 3E38A 4A22A 3SAZA 4IM4A 1ZNNA 2CZ5A 4GGHA 2QMKA 4H3DA 2WSQA 2V6AA 3VE9A 3AMKA 3SUVA 2X05A 1KRBC 1E6PA 3VCCA 4E4PA 5IFTA 3TJIA 3BURA 4GNJA 1XRSA 4H6EA 3OA3A 1LLZA 5C2GA 1OIMA 2YA0A 4PFHA 1VBJA 3DGRA 4IMEA 2IXUA 2Y5JA 2NT0A 4GA8A 4GH1A 5FEZA 1ZBWA 3AYSA 3ELFA 1AD1A 3NURA 1OFPA 2XVPA 3N13A 4QM1A 3RAOA 3GTXA 4IGSA 3BAXA 3C0JA 3FHQA 4KERA 4C1LA 4HPNA 1HG3A 1PZ1A 3T4CA 1Q45A 4AY7A 3EMCA 4PC8A 2XIOA 1EGVA 1O6IA 2I14A 4G7FA 1ONEA 4O8RA 1XRVA 5CPSA 2CC0A 3G5EA 3N15A 1Q5MA 4H7ZA 4DUOA 1RALA 4LC8A 3MDWA 4IGNA 3TNOA 2XU2A 2JK2A 3BG9A 3PAOA 1YRRA 4XKYB 3DFYA 3UJ2A 4LUSA 4HSOA 3E96A 1P0DA 1OYAA 3GHUA 1QAPA 3AUJA 1PB0A 5MKGB 2DDXA 1FWEC 2INZA 5IBXC 2DU2A 1K3UA 1IWAA 1B31A 2OEKA 3L0GA 3FYPA 4FS9A 4S3GA 1KM3A 2YR1A 5FJRA 2NVCA 2Q02A 2IPGA 3SFWA 2YZRA 5A1AA 1E72M 1XYMA 2DSZA 4Q7BA 1XCWA 3W7RA 4UWMA 2PP3A 1KBBA 2HSAA 1XI3A 2XWDA 1NFPA 1ISWA 1HVXA 1KXTA 5CPTA 1AODA 3GDKA 1WOAA 3PZGA 3GAKA 5AOUA 8XIMA 3W37A 2I5QA 1ZU8A 1W9DM 3VM5A 5H2ZA 2YBVA 3VIKA 1QTWA 3KL0A 1ZGDA 1EO5A 3PPCA 1RK5A 1UZ4A 3KS6A 3PK7A 2WVVA 2YCIX 1K70A 3N18A 1ADOA 4IMFA 5KITA 5D2TA 1W1IE 4O4VA 1E15A 3BLFA 2YBTA 4XWUA 1JVNA 2OLSA 2A5HA 3PBUA 5XIMA 3VKBA 3FDKA 4JQ1A 3WBYA 1D3CA 3N2BA 1FRBA 2FPYA 1CXHA 3UVIA 3LI0A 4FNSA 2VX5A 2VL4A 2YL8A 1FTXA 4X9SA 3S47A 3GD6A 1XLLA 2IMRA 4XD5A 1U1HA 1Q3NA 4C5ZA 1RXOB 4V1XA 3QFWA 1EA0A 4D2JA 1I1WA 2C7FA 3AIVA 3APTA 5I2UA 4NP7A 3W7KA 1FA2A 4HN4A 2B81A 1BSIA 4R7WA 4PMZA 2E5BA 3DG3A 3T1GA 3WBWA 4MY8A 4PRTA 3TR2A 4XAZA 3BCJA 4J40A 1Y5VA 1J0YA 4ASTA 3CYJA 2YW3A 4UFIA 2E9MA 3WBXA 4MWAD 3V36A 3AOFA 3O6AA 2VYOA 3HBLA 4PR4A 4H9YA 1W32A 2WAGA 3EDEA 3KP1A 3N9SA 2AKMA 1JFXA 1F61A 3VYLA 3QOMA 3UR2A 3WFAA 1OY0A 1P48A 3OG3A 2HVOA 4RPPA 2VM8A 3CWNA 4BI7A 2WNWA 5HMFA 5L6UA 3TLQA 4ZQPA 5HNNA 4L56A 1IXQA 1C8VA 3PWIA 4IP7A 2ADAA 4GE8A 3GS6A 1M65A 3ENLA 1EJTC 3L4VA 1B2YA 2PDXA 3BAIA 3GWQA 3AU2A 4FEZA 3R43A 4LUIA 3I68A 1XDLA 4NYUA 1JD9A 3UJEA 1TPFA 2ZE3A 3TE9A 3CB8A 3D3FA 5BRQA 1FWCC 3WD4A 3KOFA 1C7TA 1O66A 2Y61A 1QR7A 1NOUA 2WSRA 4IG2B 1U2YA 3EEZA 4GVGA 3RX4A 3E0VA 1DXFA 3NDYA 3EA2A 2DIKA 3KP0A 1A80A 3DX5A 3AAMA 3ABQA 3Q94A 4XISA 1IEVA 4MJ4A 1QHPA 4QIUA 4UUIA 3AIRA 1TVNA 3M64A 3KHJA 2BB0A 2KX9A 1B3VA 2GSEA 4C6EA 1GQIA 1UZ1A 3VE7A 3WUFA 1I9CB 2R1KA 2E8YA 3BSGA 3P5YA 1LWJA 1MFVA 4K7VA 1E0VA 4CN6A 1VBGA 4MNLA 4X60A 1CGYA 2XZ9A 3QR3A 3RIKA 2D0GA 2DEPA 3SSJA 5HJYA 4HA3A 1JYNA 1I45A 4AZBA 5A3HA 5C9ZA 1XLMA 2ZTJA 1OFBA 4E2OA 2E9LA 2NX1A 3LEPA 2Y8VA 4ZB0A 3TXZA 3FDGA 2J62A 1H51A 3BV4A 5D2XA 4AZ6A 4B4HA 1PSCA 1VIZA 1TCDA 1NF0A 3FAWA 1US2A 1E6XM 1YBQA 2ALDA 5A6BD 4JX5A 1O4UA 1KFCA 3WLLA 3V5FA 3GSMA 3I4EA 4J27A 4ZOBA 3AIQA 4AZGA 4DJED 4IISA 2EF9A 3NL6A 4U4MA 1XW8A 2QVHA 3UP8A 3NPWA 3WLIA 1DTUA 3N2CA 4AD2A 2BLEA 1QW8A 3KBWA 3H4WA 3CC1A 3RJXA 3VNYA 4Q4SA 2PLMA 1KO0A 3GHTA 3QGAC 3UJSA 2ZCGA 4B15A 3E2QA 1O1HA 2GQ9A 1XPGA 4LBSA 3UA4A 3IJLA 2Z1BA 4MB1A 4CGTA 4O14A 3B05A 3C3NA 3WLHA 4D6JA 2JIWA 3GIPA 1SQ7A 2QDDA 2C13A 4W86A 3LTSA 2VRKA 2VURA 1ME7A 3MSDA 3CT7A 3ARYA 3SBFA 4Q4MA 1XIEA 1KKOA 4D6FA 3NSXA 1R3SA 3H7UA 2LLEA 3F7JA 1SZEA 3HB9A 2A7PA 4CLMA 5BZAA 3VMOA 3FJNA 3HURA 4QR6A 3E5BA 5EL1A 1ELSA 1VGAA 4WOZA 2JE8A 5CLWA 3LMZA 4RR4A 4GY0A 3BVJA 4HBKA 2NW0A 1TE6A 4Q22A 4C7FA 1DHPA 4P7OA 1IQ8A 4ERIA 4JL1A 1CXIA 3DGBA 1QK0A 1QNPA 1XD0A 3I3BA 3AZSA 3W85A 4HP5A 1EP1A 2YL5A 4UFMA 2Z2BA 3GHRA 1YW1A 1T0OA 3UY8A 3LYEA 4QG6A 3W2MA 1YMYA 4JBRA 1OK4A 3WDJA 3BICA 3VOFA 2FLIA 5L9FA 4JQ2A 3P2VA 3RRXA 5G4WA 3N34A 3HIJA 3TWBA 4AWTA 3EKGA 3INPA 1PTDA 4PA8A 4B5TA 1J5TA 4GYPA 1K7XA 3GH4A 1DOSA 1OX5A 3L5MA 2OSYA 3ZT7A 1NWTA 4GCAA 2H3BA 1UWUA 2A4AA 5J04A 2BWGA 5ABEA 3TW6A 1W9BM 1CPUA 1YDNA 4UMAA 2Z29A 4NJHA 2PTYA 4CEXC 2AMXA 3BSHA 1V02E 3L67A 2HBXA 2E77A 3U7VA 2WMIB 4IGMA 1V3HA 1BGAA 2ANUA 3TSMA 1PKYA 4X3ZA 2A6NA 1YTDA 2NT1A 3ONBA 1JI2A 3RPDA 1XLHA 3QYQA 3QSRA 1H0GA 2Y89A 3VNIA 2VFFA 4XQ6A 3FKKA 4AISA 3S2NA 3UVAA 4QNEA 5CG0A 3VXGA 2FZBA 1XGDA 2NLIA 1GYLA 3G8RA 1RLDA 1GK8A 2QV5A 3GTFA 1HGWA 2GJNA 3SEPA 4CVWA 1CLVA 4L7ZA 4JKLA 4QROA 3GE7A 1V51A 5BOFA 3BXWA 5AC5A 3TA6A 3MUCA 4FIRA 1RBAA 1Q63A 3ARQA 4NKCA 3O3RA 1TTPA 3W73A 2GJPA 3CHFA 2FDSA 5CBIA 2EXOA 3EMZA 2PGEA 5A8OA 4HU3A 3BAKA 1ODZA 3TLLA 1J5SA 1IEWA 3MVTA 2ZRVA 4K68A 4DBSA 4FK9A 5M1TA 4I5RA 5CAKA 1NOFA 3HV9A 1H7WA 2HXUA 1PZ3A 2VEPA 1WBHA 2R1NA 3LV5A 2QCDA 3EBVA 2PRMA 3MUAA 1JJKA 2DIJA 3LHZA 4QJ1A 3T07A 4KPLA 3KOWA 1EHAA 2TPSA 1E73M 1R7OA 1TFVA 2Z1KA 1GOKA 3ZVHA 3FJLA 1UROA 3S0CA 1SSDA 3ITCA 5F1VA 1JYWA 4PRRA 5M2FX 2BG5A 4N42A 2GJXB 1V7YA 3B8VA 4HSNA 1XG4A 4FXRA 1FWBC 1XR2A 1UWQA 4TU1A 3ZSTA 1O5QA 4AEEA 4G6CA 4NU7A 1X1NA 2B31A 2E4TA 4GUJA 4PMXA 1BRLA 4JHMA 5BCAA 4F79A 4S2BA 1UR2A 1DIOA 1QNVA 2WNQA 1AQFA 5DO8A 4HU8A 3LGGA 5KINA 1JCXA 1SU5A 3Q45A 3GHSA 5EGRA 2R24A 1XBVA 3R1ZA 3TW7A 1WDQA 1GVEA 2OWCA 4US5A 3SB0A 1ONRA 3GH5A 3KCLA 1PWMA 4L5ZA 3EWZA 5E1QA 2OLHA 4LV4A 2XGZA 4UC5A 2ZRYA 3MMUA 4ZSUA 3LHTA 1CZ1A 2TRSA 3NQGA 3OBKA 4TMCA 2I17A 5LZLA 1AH3A 4NHVA 1TVLA 5BWAA 4FOUA 4Q7IA 2POZA 3M0ZA 5A6MA 3UYCA 5D04C 4IFRA 4ORMA 3N14A 4PTMA 4TOQA 2GOKA 2ABAA 3W82A 4QJ4B 2PWVA 2DJXA 1B3ZA 3CPRA 1TCMA 3M5YA 4PEEA 2ZYFA 4YTSA 3SGZA 1JEZA 3MO7A 2X7VA 2GUYA 2RJGA 2VUNA 3QV7A 5I6SA 2R1PA 2R94A 4R5EA 1F2JA 1O5KA 4WF7A 1UPPA 4IIDA 1F6PA 2ZXDA 3N11A 3ZJ8A 3WBAA 4LCQA 3CUFA 1S5MA 2J13A 2C16A 4H9MA 4MADA 1E71M 1PYMA 5CKSA 8RUCA 5FJTA 3ZT6A 2Y62A 1JCNA 2OOFA 2V3EA 3GFXA 1VFSA 1OHLA 5IHRA 1ITCA 3N2TA 1OBAA 4AZ5A 4DUXA 3CUXA 1UKPA 1A3WA 4C7DA 1AFSA 3OBEA 3T09A 1SPQA 3K2GA 4WIWA 3WG6A 2AOSA 1W5QA 5M3WA 4JX4A 3HMJG 1UH3A 4J2MA 2WHLA 3TTYA 2J9ZA 1PKMA 3FW6A 1CYGA 5EA9A 4Y9NA 3H8AA 3FCPA 3VMPA 3A5FA 1SO6A 3NEVA 4M7SA 4W4QA 3TU9A 1LWHA 4IMDA 3ANYA 4ORIA 4HTYA 1F6YA 2B7NA 5JH1A 4GZ7A 1YXYA 3MZ2A 4L6HA 1UJQA 4MKVA 2DIEA 2EJ1A 3AMGA 4W7WA 2G3IA 3IUDA 3JRKA 4O15A 1IIGA 5C9RA 3SCUA 4CU7A 3W71A 2OMAA 2XH7A 3Q65A 3W27A 8CGTA 4Q8NA 3GDRA 4H9UA 5AN7A 4A35A 2BY3A 2BASA 1VKFA 2W79A 2A3BA 3TNBA 3LOTA 5LA0A 3BC9A 4DI9A 1WP6A 4JIPA 4MYXA 1JGMA 4IJBA 1ICQA 4B2DD 5TQLA 4S3DA 4WUIA 3R4IA 1BAGA 2PUZA 4ZSTA 3CT2A 2QXWA 3BSMA 4C6JA 2PDKA 4HKPA 1BD0A 1ADSA 3N1AA 3LG3A 1V0KA 4KS0A 1UMYA 1XLKA 4O12A 4KWWA 3R13A 3S2MA 1NDYA 1T8XA 4KEMA 1GKRA 3DERA 4ZQOA 4KGLA 3XIMA 1H7XA 1TRDA 2OT0A 1NJJA 2G3JA 1GQJA 2JGQA 3IRSA 4AAJA 5ECUA 3KDOA 4RZBA 2BGQA 4RE4A 4TTUA 5AHNA 3VOIA 1S2CA 3C5QA 4M19A 4D8LA 5HJLA 4AQLA 2XUCA 2JEPA 3ITOA 4DNHA 3VOHA 4KCUA 2WCAA 3P81A 3WH6A 2E40A 4EWJA 4ZOAA 1QBBA 3R5EA 3PBYA 2WZTA 4W8AA 1O5RA 1OM0A 1OINA 1Q6LA 3N73A 3FEQA 3GAYA 2V67A 2R6OA 2FYMA 1RQBA 4DZHA 4RV3A 2DP3A 1HJSA 4JTTA 3OVQA 5MHBA 4I5XA 3ZT5A 2B7QA 2VGFA 3M07A 5AECA 2EEXA 3G1AA 2O55A 5LIYX 5K3VA 2QJMA 1EJXC 1NDZA 2PGWA 4DBDA 2GQAA 2ZX9A 1AW1A 1L8PA 3HGSA 1VAHA 2D3LA 4DF1A 3F1QA 2QHAA 1PHQA 3FGCB 3U57A 3TROA 4GY7A 4K7YA 3Q4DA 4C1KA 1DP0A 2DZWA 4RPQA 1D7KA 3WJYA 4H2HA 4JS3A 1RJPA 2BV9A 2ACRA 1A3XA 3IJ8A 1Z69A 1EJRC 2PRHA 1IZKA 3QY8A 5HWMA 1FBAA 3NZRA 1EZWA 3WELA 3TYCA 1V77A 3QZAA 2Q01A 5LKYA 3BE7A 3MP4A 1G4TA 3W87A 4UTMA 3VI2A 1XH1A 3VGGA 4A3UA 1HXJA 2J9XA 3KWSA 2Q8LA 3OU8A 1E0WA 4AIOA 3HPFA 1PS9A 1KM0A 3W1NA 1VS1A 1YDYA 1UQZA 4ZFMA 1GTHA 1TKKA 2O7QA 4QJ5B 1D8CA 2V2HA 1BTMA 3AZTA 1FH9A 4LTSA 4PUMA 1UP3A 4KCTA 4D6IA 4F3HA 3PTKA 4AEFA 4DZAA 1GG1A 4K37A 4O1DA 2BDQA 2PODA 3NR0A 3W75A 2X7WA 4NJJA 3M7SA 4HNVA 5HR7A 1TR9A 4O1AA 1GTEA 4YN5A 1VFHA 4ZOCA 1UW9A 2VGBA 4O0KA 3W38A 3RO6A 1OFEA 4MZ1A 4GXPA 4K6AA 2PU1A 5IOBA 4UTHA 1YHTA 2OQHA 4JYDA 1UD2A 3CQIA 1VFLA 4LVBA 3BOXA 1V3MA 1Q4NX 4PEKA 3IVSA 3WLOA 4NNCA 3OVGA 3USZA 5TBOA 2OGYA 4CD8A 2ZA2A 3SRFA 3MU7A 3OP2A 4NQ1A 5E09A 4WZHA 2W3ZA 4ROPA 1JAKA 3VX1A 3RPMA 3I65A 2NSOA 1JD7A 3KW3A 3OZPA 3LSCA 3GO2A 1JF5A 3K13A 2BP1A 1JUBA 1EDQA 1U5VA 5GNYA 2O4MA 1H7OA 2HNEA 1PZ0A 3IS4A 4JN7A 3THCA 3WUGA 1ICPA 3PG8A 2VX4A 4O1EA 4MZYA 5DQPA 5MF5A 4QAIA 3UWYA 1FWTA 4ES4A 3AXKA 3ANVA 2ZVIA 4ZXLA 3O15A 5CC6A 3PTQA 4PL1A 1ZENA 3V1PA 1T8QA 3S5YA 4F0RA 4F0HA 1Q6OA 2H9AB 5FAGA 2VGGA 3N2XA 3RPTA 5FF3A 2OFJA 4UTFA 2YXGA 3CHVA 2Y0FA 3IUHA 3V75A 3V0UA 3WD2A 5FF0A 5BMXA 5FEPA 1V79A 2A7NA 2EKCA 3B0XA 1E0UA 2UBPC 2G97A 4ZB2A 3H2NA 3PUGA 1WE5A 1XIMA 4N2YA 1K1DA 2FFCA 3K30A 1JYVA 4XZIA 3E6EA 3KRZA 3JR2A 5LNVA 4DWSA 1TPB1 3UCCA 4LU0A 3WQGA 2XZ7A 1K9DA 1HJUA 1EGMA 1S38A 1G4EA 3BLKA 1J2BA 1EX1A 4K39A 1XSJA 1UOKA 1WB0A 1AL7A 3ABOA 1YADA 4GFIA 4JAWA 4LS2A 1FHUA 1LUCA 5K7JA 4M1RA 3W28A 5DF0A 1CB7B 1TTQA 4K38A 1GOXA 2W9MA 5I09A 1EJSC 1IWPA 2G0WA 4QNWA 5FA5A 1WKEA 1G1YA 5EFDA 1PVNA 1BYBA 3BJTA 4DZIA 5BRPA 1XP3A 1KTNA 5FACA 1M7JA 1YEYA 5HR6A 2QGYA 3UG3A 2NZLA 2D73A 2ZVRA 1QI3A 3GG1A 3TIMA 5H1WA 1FOBA 3L2LA 2EPNA 7PTDA 4DUVA 3II1A 1ZPTA 4I7VA 4W85A 1OWQA 5CEWA 4Q4KA 4DJDA 1S46A 3UWVA 1X6LA 3WUBA 2WVTA 3WF4A 1A5BA 3VOJA 4LYQA 1J0ZA 2FJUB 5FSDC 1ZY9A 4XZBA 4B5XA 1QW9A 4TX6A 4XB3A 1UKTA 3LLDA 7TAAA 3TN4A 3H24A 1W1B1 2PWGA 1TIWA 4AC1X 3W23A 3T2OA 1VJSA 4JEQA 1IR2A 1GUVA 3WEOA 2X1TA 3TSBA 4QG9A 1XCXA 1BVZA 4Q4OA 1GG0A 3CZLA 4Q8PA 4AX7A 3UWEA 3T81A 4OZOA 4FXJA 2V69A 4UFKA 3PVFA 3PHAA 2PWDA 4XIAA 4LYKA 1E1FA 2V5KA 3UZYA 4L65A 3TA9A 2NV2A 2YDAA 2VT0A 1AK5A 3OG2A 1OCJA 1IXOA 4XZLX 4RZ5A 3V16A 5K4ZA 4S3EA 4GJJA 1HQTA 4H4IA 1KCLA 2XWEA 3GXDA 1V08A 2ISVA 5E9XA 1AQMA 4HMEA 1H7NA 1N2VA 2J7GA 3PBWA 4X0VA 1PAMA 3DFHA 4DB7A 2VD9A 3KZPA 1Q7ZA 3WMLA 1J8VA 3S6OA 4MWAE 4JTDA 1HL2A 4D1JA 4UR9A 3UETA 4HHPA 3W02A 3PJUA 3PNUA 3K1GA 3DC8A 3W1PA 3G18A 1JDEA 1WDRA 4UQAA 1LJYA 4QS6A 1UUOA 1ZB5A 1UR0A 1TWDA 3SN1A 1H0IA 2GDUA 1XIIA 4XIMA 4HPXA 2WV8A 3HGJA 4U33A 4O1CA 2HV5A 3KTSA 1RBOB 3FY1A 4Z1DA 3TTOA 1QCWA 1QNSA 3BLDA 3W7GA 4GUFA 2DW7A 4AWUA 3QBUA 4NILA 4GUIA 1OFAA 3RUBL 1AMKA 2A6LA 4Q6JA 1OGGA 1ONXA 2DVTA 2WKJA 1UG6A 3GXPA 3W7MA 1UC5A 2EQDA 1MZRA 3RJYA 2R8WA 3CH0A 4X2RA 4E8GA 1ICSA 4IMAA 3GUWA 4YTRA 1EB3A 3EDFA 3C3UA 4IL2A 4F4RA 1XIFA 3RCMA 1FWIC 1SW7A 4XAYA 4PUKA 2Z2AA 3M43A 1UR9A 4G8TA 4FB7A 5AVNA 1EGZA 3QM3A 3V4BA 1B4EA 4JTGA 4GVIA 3DYMA 3HFYA 4HQVA 4PTWA 1GWJA 2FZMA 4M6PA 3WQOA 1A5UA 1JQXA 2C1GA 3D5HA 3L4UA 3A9BA 4PULA 1MEWA 4ZB5A 1REQB 3B04A 1PZ2A 2YLAA 1ZLPA 4WDUA 1DE5A 1RVGA 3LLFA 3AQUA 1UC4A 5D8WA 5LXEA 3WJZA 4LYRA 5G5IA 3LPOA 2ZDRA 5CSUA 1XDMA 1MMFA 2V2DA 3VDCA 4QLKA 2W91A 2DZSA 4FZIA 4LAKA 3LM3A 1R5YA 5F4WA 5KZ6A 2WMFA 4IJCA 2A3EA 1VJZA 2VP8A 5DRIA 4DWSC 1XRFA 4H2CA 2X1SA 4A8IA 1GOWA 3VO0A 3T44A 5JBFA 1TWZA 3T0DA 1MUMA 1CNVA 3OOQA 4B5NA 1UUQA 4MDPA 5IHSA 1QHOA 1RCOB 5K9CA 2AQVA 4XZWA 2C1HA 4JTEA 3HFTA 4LWWA 3W6YA 1AW5A 4P7QA 1QRQA 4WSJA 3CJPA 3SSZA 1E1CB 2Z1VA 2OELA 4QP0A 1E1CA 5D9PA 3I4KA 1WOBA 2INFA 2YA2A 3IIOA 3PJTA 4NY2A 2VUYA 3O9NA 1DQWA 2J79A 3PZMA 1MSSA 5FF2A 1TG7A 3H53A 1W3KA 1J93A 4TXEA 3T0AA 3JVAA 3WSUA 2CXGA 1EQPA 3HJEA 5DXYA 1BEUA 3WD1A 1PV8A 3NG3A 2D2GA 3KXQA 1XUZA 3AXMA 2WM1A 4TX8A 1JPMA 4IWWA 1JZ3A 4JN6A 2IKIA 1LYXA 4CCEA 2QCCA 3M5XA 2HXTA 4BY3A 2D0HA 3S6DA 4IFKB 3DZ1A 3GZAA 3BTNA 4EANA 2Z1WA 3WQVA 1KRMA 3UXKA 4BI5A 3VZZA 3F2CA 1HO4A 2QUMA 4KFOA 5FJJA 3LGDA 1T41A 2RGMA 3RO8A 5EFFA 1B5TA 1Q2SA 4L1WA 4P61A 1DIKA 4GUHA 4UFJA 3M0VA 5HXMA 3W1AA 1H49A 1W8GA 3FYOA 4IMGA 2YL9A 3L2IA 3RILA 5E5CA 1P1MA 2F6UA 2WJFA 1AA1B 1YDOA 3CV1A 3LD5A 3CAWA 1BRLB 1KV5A 2C0AA 4Z2KA 4JFTA 1EQCA 4A3HA 1IF2A 4NSBA 2EO7A 3PBGA 1TJRA 1BXNA 1ZJAA 1V6WA 4YTQA 3UWWA 4P8VA 2ZE0A 1JPIA 3QPEA 2NVAA 5B80A 4AB4A 1QOXA 3P8JA 2DT1A 1VYRA 3SCSA 3GUGA 3STFA 3NEHA 1V4YA 3B03A 3N04A 1C91A 4FLOA 5T9CE 1PPIA 1E5JA 1N7KA 2CLEA 1ALDA 5LHFA 3W6MA 4Q8UA 1J12A 1MQPA 3R8GA 5IDZA 1RPKA 3L9CA 2VNCA 1YNQA 4IIEA 3UZXA 5KZDA 3APGA 3G0SA 5U4NA 4JNZA 5EMYA 3T8QA 1XLAA 4Y9OA 2YKKA 3W0KA 4NXSA 2PF8A 3QN3A 3O06A 4O57A 2Y5SA 4MJZA 4JFVA 4M29A 1J4EA 2Z24A 4UQCA 4UR7A 3B9EA 1SM9A 2ZRUA 1KR1A 4AVNA 1WAWA 5E0CA 1QPNA 1SJAA 3CPGA 5F4SA 5DLCA 3WLTA 3VUSA 1A0CA 4WSKA 4RUBA 1C7SA 3GFZA 1GVQA 1PJ9A 3MDUA 5C70A 3WF1A 8TIMA 1V8EA 3SCRA 4XUGA 2ESCA 4AWSA 3B9OA 4S3FA 1I0BA 2EJAA 3LXBA 4GX8A 3ZS4A 4IT1A 3NQBA 4F0SA 3EWXA 2XFFA 3GYEA 1XWYA 4GBDA 4MAVA 4X2PA 5A94A 4D71A 3SURA 5KETA 1WXYA 4LANA 1R46A 1K02A 4HNUA 5A69A 2P76A 1UJPA 4YIWA 1EJUC 3G77A 4KGJA 3TAKA 1ISZA 4GNVA 2RUSA 2OZ8A 3JU2A 3G3DA 4QDMA 1G4PA 2DZUA 1EPVA 2DORA 4OBTA 3N19B 3WN6A 2FH8A 3WH5A 3QC3A 5DT7A 3HGRA 4YWSA 5AYIA 1MYRA 3MT1A 3MUY1 5EY5A 1G01A 2VD8A 3PZQA 2CU0A 4FNQA 3MUXA 3A23A 2YOCA 1P0NA 3SQMA 3KLKA 1QK2A 1HKKA 3AS2A 3SUTA 4EAMA 2P5NA 1EO7A 1R0MA 2E1WA 3CZGA 2VR5A 2J78A 4PMVA 4GX9A 3SCWA 2QIIA 3V1HA 2YJQA 1JPDX 3LN3A 3T7VA 1G7VA 1FCBA 1GCYA 5C0QA 4XZHA 1H50A 3S2LA 2Y7DA 3BPWA 1ZCCA 3UPMA 2WLYA 5I3IA 3WMSA 4U3AA 5CGQA 4E38A 4H00A 3DH7A 2YDRA 2GVGA 1IEQA 4DNMA 4P7LA 5I02A 3C8FA 5JIWA 3I6TA 3KRBA 5A6SA 1TQXA 3MCNA 4K8HA 2JFEX 1GOOA 3AXXA 1HL8A 2C19A 4FNPA 2WHMA 3HN3A 3BANA 1XGEA 3EOUA 3H12A 4LBRA 3OO2A 3G1XA 3UR7A 4L61A 5FF4A 3CIVA 3NL2A 2ABBA 4YYFA 1ME9A 4ZR8A 1WDPA 4GC3A 5ABTA 4JY9A 3WO8A 5CPMA 2CW6A 2P8BA 1NEYA 2XJ7A 1OGSA 4PUUA 1M68A 1AMYA 1BTCA 1VBUA 3W29A 3L68A 1OC6A 1K8XA 2ZUNA 5BROA 4GWEA 1AL8A 4H9XA 4ZTXA 5D9NA 5F2IA 2NSXA 3IK4A 2VWSA 2SFPA 2XIQA 2A0NA 4AMCA 3FAXA 3ECQA 2I5GA 1LORA 1XLJA 3GW0A 4WSHA 3GIQA 1RZMA 1PKLA 2XIIA 3PM6A 1W91A 3DKJA 3GNRA 3W7EA 1M01A 1IT7A 1Q65A 3VVGA 3WD0A 1XL9A 1J96A 4JQAA 7TIMA 3H26A 1B3XA 2CEQA 2QCEA 3OW1A 2Y7EA 1FP9A 4DYJA 4LUYA 1G69A 2XIMA 4PBGA 2GVJA 1XUUA 3BGJA 3SIZA 5C2CA 4CU8A 2P50A 1QWKA 1I2PA 3MO4A 3PZOA 2AGTA 4AHQA 1A3HA 3IPWA 1QT1A 2IPWA 1DWGM 3K8MA 4GYFA 4DIAA 1XIGA 1YNPA 3CMFA 3PULA 4CD6A 1U1UA 1PHWA 1PUDA 1E51A 4INFA 4AXNA 2FTPA 4YVVA 2VHLA 2VELA 4Q7NA 1OK6A 1ISYA 4IPNB 1RD5A 1W9UA 4LALA 2HROA 1NP2A 2E1DA 2AAMA 2DSUA 2BODX 2XISA 4R53A 3PS7A 5FI8A 3AU6A 4OHQA 1TJ0A 4DXVA 2KZHA 2PZ0A 4O54A 2CITA 4ZENA 1HW6A 1WKDA 2BY0A 5LIWX 3O8AA 1RSCA 1K6WA 3E1F1 3WEMA 4HJWA 2VEGA 4G7EA 4IPJA 3A22A 4CNNA 1H11A 3BARA 3RM9A 1M9HA 2EBNA 4RDZA 4L9XA 1OF6A 1FWWA 1VPYA 3BK0A 2Y70A 1AD4A 4L4PA 3RF9A 3P8IA 4CQCA 4Y9PA 3M1ZA 4GGBA 1PIIA 1LBFA 3S3GA 1Q6DA 1EZ2A 3IK2A 2OSWA 1F5ZA 1SJBA 1MW2A 1BWVA 1V0MA 3P5ZA 4EOUA 4QCEA 4A29A 3F5KA 3U5YA 3AS1A 4PMDA 1HX0A 1PIFA 4N0RA 3ZO9A 4AY8A 1TA3A 1X7FA 2XGBA 3AIWA 1MW0A 3LGEA 2QYGA 1IWBA 5I0DA 3QRHA 1LF1A 4QSFA 3H7RA 3SRHA 4WY0A 4LUTA 2G50A 3I3EA 1P6WA 3VKDA 1ADDA 3C2RA 1DIDA 3NYDA 4ZQMA 1TPWA 2DT0A 1J01A 2V5CA 2E0PA 4MNMA 1UD8A 4C6BA 3O0FA 1OF8A 3OGVA 1R86A 2FZNA 4XAGA 1LBMA 3DBPA 4I6KA 4LAOA 3T08A 1I2OA 3N6HA 3HGOA 5GJNA 2RGLA 4XSLA 3CBWA 4RJEA 3LCGA 2X2GA 2MANA 4H8VA 3R6IA 2GK1B 3ARZA 3HQ1A 1GT8A 2TODA 1WDDA 5AC4A 2FVKA 3RR1A 3MHGA 4PTNA 3CNYA 3PBMA 1KLZA 3EX6A 1EBGA 3UF9A 2O56A 1CI1A 2YA1A 3LQGA 4P5UA 1UYQA 4RZ6A 2QAFA 3TR9A 2EHHA 1JQVA 1JCJA 1VFFA 3W00A 2W61A 2V5DA 1RY8A 1GKQA 4J3XA 2BHUA 4LUSB 4NVTA 5E70A 3N3TA 4GUGA 1UA3A 3UR5A 1M7OA 1NVMA 3CXOA 2F8QA 4NRRA 1Q6QA 3DU0A 2BVTA 3W84A 3WFZA 2PDCA 4E6MA 2R91A 3PB2A 3TYAA 3M41A 5D8ZA 5C55A 4GQGA 1MVYA 4LSBA 4M7TA 1Z41A 1HJWA 1S2UA 4JYFA 1R2SA 3H55A 5LA1A 5EYWA 2DJLA 5AHIA 4LB4A 1JXJA 2GGHA 3DG7A 4QDWA 4OUEA 4HA1A 3WDQA 5DXXA 2WC7A 1K8ZA 5EBUA 4EXQA 5J5DA 2PDPA 4ILSA 3W7JA 2PPGA 2YW4A 4J2PA 4TX9A 4GVHA 1DWAM 3BAYA 3V3WA 2X1IA 2WMKA 3CMGA 3R10A 1HN1A 3WL1A 4OQVA 1YPIA 2GOUA 3TCSA 4NRSA 2YCLB 4IQDA 5LIKX 2QS8A 3NQEA 5CC3A 5CLTA 4BJHA 3VM7A 1EYWA 4DX3A 1CW2A 3EOSA 5BXTA 2ZZ7A 1DJXA 4P7NA 1H5YA 3CZKA 3DUGA 1BWKA 1J11A 5MKGA 3MTWA 1F3TA 3ANUA 3QY6A 1KFBA 4NNBA 1R8LA 3WUEA 5TNVA 3U7BA 3FSUA 2W92A 1PBGA 1IV8A 1GPWA 4O0ZA 3WDPP 1JDCA 4N02A 3EWWA 2E6DA 1UKSA 3GXNA 3PZNA 1EDGA 2J4GA 4ZOEA 5D09A 3HPXA 3W72A 2CBVA 1QXLA 1I0DA 4ZEPA 3NSMA 1S1PA 2CYGA 1SFSA 6ALDA 2V5JA 5LGZA 2XIBA 1W31A 1XFCA 3D3AA 3MCOA 4MUPA 2YFOA 3K5XA 1N8FA 3S5ZA 3LS9A 2P53A 3VGHA 3L5LA 3FX4A 3AHTA 5HUOA 3LA4A 3CUHA 4A05A 1S2AA 3WDRA 1A5CA 4AYGA 2XN2A 4PTXA 3L65A 4HT3A 1H1ZA 1TPEA 1TV8A 1RA0A 3TYUA 3GNNA 3RR4A 1XYBA 2YIHA 1RK6A 2OYMA 4BHYA 1OQFA 3WBEA 2OCZA 4IX2A 2OODA 1JL8A 5I5RA 1C8QA 5AB3A 4QE5A 4MWAC 3D0CA 5CJ5A 1SVDA 1HKVA 3HTWA 2JEQA 3DCPA 4NL1A 1H5VA 1W1A1 3LBOA 5F1UA 1UB3A 1ZAJA 1W1ZA 2OO6A 1SSGA 3KCJA 5G4EA 1LRNA 4R88A 1RUSA 3P62A 1KRCC 3G1RA 1A5SA 3KHDA 1OGBA 3NQAA 4CN1A 5IDIA 4Y96A 3KBSA 3WLRA 2IW0A 3DFSA 4KCWA 3LZ5A 1PIGA 1YKWA 1RAKA 2OEMA 1LRQA 1ML1A 1RD6A 2JF6A 2EG6A 3DECA 3MKCA 2F84A 4XZNX 4NIRA 2Y2WA 2ZUSA 3TOPA 4GO8A 1TPDA 3O16A 3AZRA 4O13A 3QZ6A 2WCSA 4H7VA 5HPOA 3ZWSA 2Z6IA 4S3BA 4NJKA 3ZJKA 1W0MA 2YPIA 2FGBA 2WANA 4BQ2A 4WR3A 3NVDA 4LF1A 1BVWA 4JIEA 1US0A 3SGGA 1GZGA 2XVNA 3B4UA 2QF7A 3JW7A 1W2VA 1W3JA 2J24A 3WYZA 1GEQA 1U83A 1WUEA 2GDVA 4ADSA 3VDAA 3UWQA 1RP9A 2Z27A 4QS5A 3RMEA 4D8ZA 3S1WA 1PCKA 3SQSA 4AD1A 2H8ZA 2TYSA 4RE0A 4AIEA 1G0CA 3D6NA 1MO0A 1HP5A 2V82A 1KBLA 4FP1A 1QI4A 1UWTA 1VENA 1UOZA 2FPTA 2X0SA 3UU0A 3WQ8A 4UZSA 3P60A 2IS7A 3TWAA 1L6FA 3T2QA 2YDQA 1JIBA 4EVZA 4FOKA 1KFKA 3IVUA 4UBPC 4B92A 1SGJA 4QBXA 1C9WA 4S2CA 2HPIA 5I00A 4RNIA 1H3GA 3WQCA 1UBSA 3HQOA 3LSBA 3J7HA 4Z08A 3B0PA 4AUBA 1A4MA 1WX0A 5M17A 1IGWA 3EKLA 3GU1A 1SYTA 5I7GA 2V2CA 3ZIZA 4JTQA 1OFQA 1WQ5A 3E0WA 3R8RA 1VC4A 4H19A 1AG1O 1EA9C 4HZ6A 2AGKA 1DPMA 1XBZA 5G4HC 1XLDA 4QITA 4RKAA 4K36A 4CD5A 3HQPA 2ZRXA 2V0TA 2PGFA 3UZJA 4W7VA 4JN8A 4E0CA 2GSHA 4OU1A 1GVRA 1HGYA 2CKSA 2X41A 2HE8A 1GGOA 3WQEA 4DBWA 4XBKA 3LU2A 3ONCA 3QH2A 2CZFA 3C0LA 2NQ5A 3CIWA 3L0KA 2VC9A 3TQKA 4O18A 2JF7A 3KL3A 4H9TA 4DN1A 3QLLA 4I9AA 2VEIA 2CLMA 3QQ1A 1A50A 5I07A 2QUUA 3WK1A 4UMCA 3W76A 3FFSA 2Z6JA 4HCHA 4E8DA 1W9XA 4FXFA 4Q8WA 1SZFA 3UBPC 1M41A 3B9DA 4LT9A 3MY9A 5JBDA 2NQHA 3LX9A 1W8SA 2XYLA 2HS6A 2BVYA 2OR2A 2V5BA 1K7FA 2QJIA 5LIXX 1FKXA 2V63A 3QY7A 2VFGA 3ORWA 5HULA 2ZX6A 4A2SA 2FB3A 5K2ZA 1FWDC 2QVNA 3EAUA 2XSBA 1OC7A 4C6PA 3CWHA 1RPXA 5G2HA 4WY0B 1Q6RA 2PDLA 2D1ZA 2PDHA 3WNNA 1NOWA 1RJQA 3BJSA 3DOPA 2PCQA 4S3JA 3LDVA 4BWLC 4IHCA 1MW3A 3OLIA 4BCEA 3N2MA 1O5XA 3WMCA 2GVYA 1REQA 4LX4A 4IGHA 1PDYA 4JTIA 4ICMA 4JFUA 4OOZA 1KGUA 1NSJA 3M47A 9XIMA 5EMKA 2V8ZA 1J2WA 3N29A 3VABA 3EWYA 2RDTA 2ZC1A 3W74A 3KS5A 4AD3A 3WD3A 2CBJA 4NZ5A 1HJXA 1X8CA 3GLCA 4J3TA 1FDYA 4K8GA 1XH0A 1B1YA 3W25A 4JD4A 1BHGA 1OYBA 3G6LA 1JAEA 1SR9A 5A8QA 2NX3A 4JIQA 2FH6A 3TUUA 4ECLA 4C6DA 1UA7A 4V27A 1ISVA 1X6UA 4LVDA 2J75A 6XIAA 3O05A 1QMLA 2VO5A 3LRLA 5HANA 3WDHA 4HYVA 1N82A 3WIJA 2ZUWA 3TYZA 4GQRA 3WL0A 3NPUA 2GUBA 4MNKA 1JF6A 4OKDA 4ZCWA 2ICSA 2Z00A 1O7AA 1CXEA 2Y7GA 4HHHA 3L4ZA 3S9ZA 4JTLA 3BW2A 4C60A 4JL2A 2YGYA 5J5RA 3B9NA 4BI6A 3G0UA 1DWHM 4WKAA 2GUUA 2Q6ZA 2VZUA 1XDJA 1EBHA 3ITGA 4QRNA 3PAJA 3P84A 2OX1A 1B9ZA 3ABSA 2YBUA 3CS2A 1CXFA 4HD5A 5A5WA 3QXBA 3VDHA 1X98A 1NFGA 4O0QA 1JDFA 1FWJC 4KESA 5IFPA 1HJQA 1NM9A 2F6XA 4CU6A 4UXDA 3B40A 4CVUA 3BCFA 1NWUA 5U7SA 4PRWA 3IJIA 2BZNA 4CQDA 3DESA 3H54A 1XLGA 2VR4A 4R7JA 1GOIA 4F0LA 3WDIA 2WNZA 1H63A 1I75A 1TWIA 1Z44A 5CAHA 4GIAA 3QGVA 4S38A 4CNSA 3U2OA 1R9YA 4BF9A 2GVEA 4DO6A 3P6LA 4JXCA 1KV8A 3ABRA 6TIMA 3OVPA 2ZXQA 1M5WA 2ZUUA 2QV4A 3U4FA 2BOEX 3DYPA 3PTDA 3GDTA 5D30A 3RMJA 1GW1A 4FIQA 1OD8A 4F2UA 1DL3A 4RX0A 4E3VA 5CJNA 1XH2A 1S2WA 2W27A 1I2RA 2XINA 5TF0A 3MKVA 3ERPA 3EKZA 5XINA 3S9IA 1V0NA 4O19A 2FHBA 1L6WA 1EH9A 1R6WA 3TFXA 3SM0A 2BNJA 3VIFA 3W6LA 1RP8A 2FTWA 2OYKA 3PJWA 2FHCA 2Y5EA 3NDOA 2VFIA 4WXYA 4NI3A 4LVGA 4GOAA 1LQ0A 1KBJA 3MP5A 1UIOA 4GYJA 4MDOA 3AIBA 3M4HA 5DFAA 2EPOA 3MB9A 3SN4A 1YQ2A 2G5WA 1QPQA 2RFGA 3AHZA 3BQ5A 3NO3A 3W2LA 2V3FA 3GXTA 2WBGA 3W7NA 3U9IA 3U0HA 1V0LA 4BF5A 4QTGA 2PD9A 3NCOA 3MYPA 2ZRWA 4AVOA 4KETA 3B8SA 2H3DA 4HNNA 1HTIA 4MWAA 5A2BA 4A3RA 2IQDA 4G2DA 3VNKA 5CBBA 1H2JA 4AMAA 3E49A 4N9BA 2DUXA 1E1EA 4O1FA 3SW6A 5HA7A 3TKFA 3NQ2A 4JFSA 4IQJA 4Z1CA 1BFNA 3WKZA 1KA9F 3R79A 3NL3A 4L1XA 5BOOA 3RLGA 1CXLA 2OLAA 3EA1A 4KH2A 1PDZA 2QUNA 7A3HA 3PWGA 1Z42A 4YU1A 1F73A 2XG9A 3UCDA 1XRTA 3QR1A 4GACA 4MKNA 3ZLFA 1GONA 3CTTA 3EOLA 1DJGA 1TTJA 3ZWTA 2O9OA 3QHNA 4PMQA 4LCRA 4RDYA 3PSWA 4XG1A 3W1TA 2HNHA 2G3FA 2VEMA 4H8UA 2CESA 4GZEA 2ZXAA 4WGXA 5G2IA 3KVLA 4J28A 1YTEA 4ACYA 4PB5A 2PI6A 2VVSA 1H41A 3H4GA 1ISXA 4HGXA 3QVQA 5A6TC 4YYCA 2NQJA 3CZEA 1NQKA 4Y7EA 1P0KA 2P0IA 4HHMA 2ZA3A 4QQ3A 3CTLA 2YLLA 3P0XA 1TJ1A 4JFWA 1JZ4A 2ISFA 2TMDA 2PBOA 3QF0A 2PS2A 4B5WA 1T99A 3MSYA 2J66A 3FA4A 1D2KA 1M6JA 4J7RA 5C71A 2VZSA 3DAQA 1MRQA 4X0NA 2HBVA 4O1BA 4NUWA 4A8RA 3NPXA 3STCA 3V0TA 1LDCA 3L4XA 5HINA 4NJGA 1GKPA 3KTXA 1R3VA 3P61A 5FJUA 1FWNA 3U2ZA 2OPJA 4KBXA 4XKMA 2WMGA 4E3TA 2BVDA 1VP5A 5FL1A 2G3MA 1PYFA 2YB1A 3CWOX 3HG5A 3D46A 5HNUA 1SJCA 1HKJA 1SMDA 3ITXA 1FHLA 4B3ZA 2BXYA 2E6YA 3RRAA 3IGSA 3IGUA 2KAUC 1Q7QA 1W1VA 3GVWA 2FZ9A 1BSLA 4B16A 4U2ZA 1V93A 4EXBA 4L9ZA 1E4NA 4E5TA 3ARVA 1ITXA 1FQ0A 1Z8AA 3NM1A 1M53A 3TW9A 4FR1A 3WLSA 4S3CA 2NUXA 1FVPA 1TPH1 2DVUA 3FXYA 2OVLA 1RR2A 1TMLA 4GH3A 5H6HA 2ZZ1A 3UXIA 2AAAA 4KFPA 2GWGA 3N17A 4W8LA 1E70M 3VCNA 3S83A 1KXVA 1QO2A 1ZBCA 3N3MA 2E6AA 4WJ8A 2QW5A 2OTDA 4O10A 3SDOA 4P8UA 4NYYA 4XX6A 1RBLA 4WXZA 4DF2A 1MQRA 2UY3A 6XIMA 2GWNA 3DDMA 4UFLA 4GCXA 4KWUA 1FDZA 3QMSA 4QX4A 3GQYA 1VIWA 5GQBA 3NVTA 3H21A 1ZAHA 3VINA 3B8WA 4HHLA 3O63A 3L21A 4EKJA 3GC4A 1VD6A 3M0LA 2ATSA 3TEVA 4EIVA 1TV7A 1NWSA 1Z3NA 3QGKC 1FCQA 5C7VA 2P1FA 3S42A 3WNKA 4J3WA 4CN4A 4YCPA 3E0FA 1KXQA 5BW6A 1S5WA 1B4KA 2WW5A 4MM1A 3G1HA 2FTYA 3FYYA 3UCQA 1KQYA 3MUIA 3S1GA 1H1YA 3CUGA 3FJ6A 1FHDA 3AROA 1C92A 1E4MM 2NWRA 3GK0A 1EYEA 4GO9A 4XAPA 3GBEA 1FWSA 1DJWA 1C8YA 3EPMA 2PTZA 4HN8A 1TZZA 3GXIA 5JU6A 2CIPA 2FGLA 4NZCA 3PC0A 1XF0A 4JHOA 1A5OC 4LVFA 4J3UA 3EX4A 1TJPA 2X42A 4H8NA 4IMCA 4AD0A 6CGTA 1AUSL 3EOOA 1HFBA 2I56A 2FIQA 4U3CA 2PTDA 2DZBA 1R9XA 1Z89A 5GVJA 1BF6A 2HVMA 4ZO8A 5HDRA 4LFYA 3UZWA 3MZNA 5K4XA 2BY1A 2J25A 3MHFA 5LNUA 3VGDA 1XLBA 4WQ6A 4TQTA 2J27A 3HG3A 2WNNA 2HPMA 3NGJA 1KFJA 1E9ZB 2A3CA 3TC7A 1EXBA 1W3HA 1IT0A 1F3WA 4L4OA 4JTRA 3ZVHB 4YJ5A 4XKYA 3MP3A 2H8XA 1DBTA 1A47A 3ZJ7A 1UD6A 3STPA 1HL9A 2I7GA 3EDKA 1WPCA 4RDWA 1V02A 2NQLA 3AJ7A 2WBKA 4I9MA 2NUYA 4FXSA 1B30A 3COTA 2EG7A 1MXDA 4DY1A 4GRSA 1GZ1A 1KNWA 3GRIA 3S46A 2HE5A 4A6GA 2PSNA 1VCFA 3TZNA 4UTTC 3LTYA 4WLCA 1TA3B 5BXPA 3REQB 2Z1SA 1A53A 3QYSA 3VNJA 3AXIA 4IX0A 1JFHA 1YE4A 1JCLA 1R3RA 4LAUA 7XIMA 3CV2A 3P0WA 1XIBA 4KWOA 4M0XA 3T2PA 4Z17A 4HSHA 2FVMA 3B8TA 2PF0A 3IARA 1AVAA 2BTMA 4H41A 1LL7A 2WQDA 3W1LA 5PTDA 5DCDA 4HOWA 1OB0A 3G3MA 4M5PA 3GC5A 4UTIA 1GVSA 1NELA 3H4XA 4JTSA 3MV11 3RLUA 3OHMB 1TUFA 2VWTA 4S3AA 5JMUA 3WX7A 4DAFA 2NXHA 2TSYA 2ZZ2A 4IG2A 4AD5A 1TV3A 2RDXA 1ZFJA 3C52A 1JYXA 2WHJA 5CCZA 3ITLA 1X1OA 1SO3A 4M1BA 3T0CA 5CQ1A 1UZHA 2UY4A 4B3LA 1UWRA 3DN5A 3CAVA 1XCFA 1HUVA 3NOEA 2IUZA 4LEFA 1KFLA 3KBNA 1JUEA 3O07A 1QJWA 1R38A 1NAL1 2C91A 1U1JA 1PWLA 2FPVA 4YMZA 3AYTA 4LY4A 4A4AA 1T40A 4HIBA 2W66A 2JKEA 5DX7A 1AQHA 1B0IA 3E3HA 5CH9A 1VEOA 2C0HA 2F38A 3ES8A 3NZPA 1KTBA 3W2KA 2Z4GA 4NASA 4PYSA 3UPBA 7ENLA 2XH2A 1W3LA 4PODA 3GTHA 4K1WA 4QXIA 3RHGA 4MLJA 1OC5A 3UWZA 4DO5A 3PFMA 1TV4A 2VX7A 3P14A 4GNKB 5BXRA 2OXNA 1YXDA 4LW7A 3LTPA 3LUTA 2C79A 4DM1A 1XLCA 4CNUA 5I03A 1OT2A 1VYSX 4XZ9A 5A8MA 1B90A 3AHYA 4J1OA 1PX4A 4ATDA 3EEGA 3UT0A 1J18A 4BQ4A 4MHBA 3THDA 5HUPA 3UGVA 3ZSSA 4DRSA 1C3FA 4PSPA 1J0KA 4AWEA 2QJHA 2PMQA 4I8DA 4JCMA 3QKEA 1S1RA 4LAMA 2DVXA 2D23A 3PANA 1OZQA 4N4PA 1M7PA 3WF3A 4Z42C 2CPUA 2X0YA 3AALA 5I3JA 1EEXA 1OX6A 2BGSA 4GLEA 3WFLA 5A2AA 3IRDA 5HMDA 3VIIA 4ZL1A 5JUVA 1DJIA 2JQXA 2HISA 4NZ1A 2FMNA 4Y8EA 2O92A 2VEFA 2VCCA 1W3NA 4HCLA 3M5VA 1SZNA 3SY5A 2EGZA 3A21A 4ZO6A 3N4AA 4H01A 2E6FA 2PC4A 1XG3A 2W5FA 1GQLA 1T5AA 3WMBA 1A4LA 3G1FA 3BOLA 3M0XA 2GQ8A 5T26A 3TQ0A 2WOQA 4Y9MA 3R58A 1XD1A 3VIHA 3E9AA 4KF1A 1L6GA 1NFBA 3W7QA 2A1YA 2IKJA 1DWJM 4LQ1A 1ZRQA 3CZJA 4TR9A 3UNTA 4LJ3A 4FX8A 1XS2A 5FL0A 5C5YA 2GQ3A 4PN2A 2ISWA 1X7IA 3KFTA 2UV8G 1OADA 4K1GA 1YE6A 3DYOA 3EX3A 3G0XA 3VPLA 2ALRA 4DI8A 5I3KA 3TCEA 3GG0A 3T0TA 1UH4A 4JTCA 3SUWA 2PDUA 2D69A 4NAEA 3C56A 3WF0A 4U10A 1F4AA 3IAQA 3W9ZA 1LROA 2CBUA 3GH7A 4HZ8A 4JTUA 1XM3A 1NF7A 1TWWA 4NZ3A 5FKYA 1H09A 4C5YA 1GQNA 1GW9A 1ZBKA 5F2GA 3WJSA 4GZIA 4JNYA 1KB3A 3H22A 2YXOA 3BG5A 1ITQA 1VH7A 2H90A 3DHDA 5C7HA 1XV8A 5BYWA 3L7RA 3BGAA 1B57A 3CUZA 1LTDA 3B0YA 3FA3A 4BQ3A 3TXVA 3EXSA 3V7PA 2R9RA 1DKWA 1PTGA 2D0FA 4G5DA 1KM6A 2NWSA 4J3SA 3UESA 1XYLA 4IXXA 1DWFM 2HK0A 3NZQA 1RY0A 5GNZA 2HK1A 3NQ6A 2NXGA 2ZBTA 3LRKA 4S39A 4NZ4A 2VMFA 2GGJA 3WEZA 4JPGA 1IE7C 5KZEA 1E43A 5EBAA 2EG8A 4Y8FA 3TQVA 3A4AA 3H6OA 3TTEA 3HPSA 4TVUA 3VK5A 3H2AA 2HDJA 4UNLA 4DZ5A 2DQWA 4Y90A 2XPKA 2GYIA 4O4WA 1Q6GA 4ICCX 3QV6A 2OO0A 3XISA 4IIGA 4XD4A 3TJ4A 3LLXA 3A4WA 3PZTA 2WM0A 3VDGA 1KFWA 4LNCA 2IQ0A 2D22A 1TZ9A 3EYPA 3W07A 1MEHA 4JTKA 1VFOA 1IIHA 2QCFA 5DEZA 1UWSA 2EKGA 1R2RA 2PD5A 3EPOA 3AHXA 4W84A 3M6DA 1P7TA 3P3BA 3AC0A 4D9PA 4OBRA 4LV9A 4ERGA 1WXZA 5JXQA 3BO9A 4I3GA 2VFHA 3MHUA 2PFHA 3VAVA 1A0DA 2QJJA 1YDVA 4MNJA 1W1PA 4DJEC 4AY1A 1FX6A 2P3ZA 3CLMA 2DQXA 4J3ZA 1BYCA 1MNSA 4OV4A 1G4SA 4AZ7A 1VCGA 3W1RA 2W4XA 2IPFA 3WLJA 1QBAA 4HCDA 2WSPA 3P93A 3PPGA 3IJDA 5ABGA 2NV1A 3F5JA 3QV8A 4WGHA 1H7PA 2E7FA 1SFTA 4HZMA 2Q8ZA 4OIFA 2Z7GA 3GR8A 4Q8QA 2CLIA 3M5ZA 1KBKA 2ZZ3A 1OT1A 5C8BB 3H2MA 2DUAA 1Q2RA 4CNOA 4KMQA 3DHFA 2HRWA 1XX1A 3C0QA 4GINA 1JZ6A 1ECQA 5EU9A 4PUDA 2J8TA 3OB8A 2O9RA 2MNRA 3USBA 3TK7A 4AG0A 3UG8A 1K8CA 2BOGX 2WWCA 4UTJA 3VD9A 2ZZ5A 3QR0A 2CERA 3QPYA 3U6WA 4QSHA 2AL2A 1PL9A 4MY9A 2J6XA 3UR8A 2OB3A 1FH7A 4HMDA 2FGZA 3DHUA 1TMQA 1PCWA 5HQEA 1VB9A 4B91A 1UR4A 1XIDA 4D6DA 3QOKA 4R85A 4Z1AA 4NZJA 4DVOA 1PTAA 3WNLA 1UD4A 3KOZA 4NF7A 1DHKA 3NFUA 5A6JA 1ODUA 4HK5A 3FV9A 2QJNA 1M7XA 4DQWA 4YHGA 1CGXA 3PTMA 2XHYA 4BA0A 3MS8A 4X61A 1XQKA 3W2NA 2QPUA 1K8YA 1HNYA 1J0JA 3ALFA 2F7FA 3AHVA 3M44A 5LNWA 3THAA 2VENA 2X0HA 4DJDC 4GXWA 1V3KA 5E93A 1R30A 1OX4A 3VKJA 2Q3RA 1CENA 4AFYA 2J7DA 1RV8A 1W56A 3EMQA 2FKPA 4YTTA 4HB7A 3PZ9A 3ZFHA 3GG7A 1KRAC 6ENLA 1DJHA 2BBFA 1KFEA 5AHLA 3N9KA 4IIHA 3ZVIA 1ZAIA 1BYDA 1J0HA 3TJLA 2ZC8A 4C1NB 3MI3A 1W5OA 3GBDA 2GGGA 4JY8A 4UTKA 2OYLA 4KCVA 1IEXA 3EGJA 3UPWA 2GJXA 3RCNA 4QLJA 1FWAC 3ZLHA 3W7DA 3P82A 4PCPA 3ZXWA 2EPKX 4QFUA 1XYCA 4F0KA 2ZTKA 2OOGA 3BUVA 1O12A 4WKFA 1ECEA 2F2KA 2Z2UA 2Z25A 4OBSA 4PH6A 3NM3A 2PURA 3PSVA 1V6TA 2ZDSA 3LXCA 5H91A 1ENUA 3GR7A 3OA5A 1CGTA 4OJYA 2HZGA 1L6YA 5AZ0A 4KEUA 4YVXA 1B54A 2WB5A 3QPZA 3GTIA 4WJXA 4KQNA 4HYWA 1E6SM 3W3OA 4RNFA 3TV8A 5F2MA 3ZR5A 1BVNP 2G4JA 2I16A 1XYZA 4DJFC 3R0UA 3IIZA 5AZ1A 4KW2A 4OWGA 3C8NA 4HOXA 2XN0A 3U2EA 5CZTA 5HNRA 1QNOA 3L0NA 3VIOA 1UQYA 3IGHX 5CZJA 3RM4A 3CIXA 4V33A 4CNPA 1QI2A 1WKYA 1V6UA 4J5NA 1H4PA 2DV0A 3CEUA 3RN6A 2F2HA 2D2HA 3DEQA 3CGTA 3Q58A 3PZUA 4JYEA 3S1UA 5AHFA 4QQUA 4JICA 3ATZA 3MC5A 4UTWC 1TWSA 3MA8A 1O1ZA 1A5MC 1W3TA 4KFNA 3VOCA 1XLIA 2UZ9A 5D9OA 3TDFA 3CAKA 3P74A 4PUEA 4F0MA 5CSYA 3EXTA 1WDWA 2D24A 4GI9A 3W22A 3C4UA 4M51A 2DW6A 4HPGA 5I77A 3ABXA 1JULA 2VC5A 4JQ4A 4C6NA 2BS9A 4LOCA 4WCJA 4AYSA 4GG9A 3VNZA 5T8GA 3AS0A 1Y5XA 3UY7A 4C6CA 5DELA 2AL2B 2VCBA 1ZBVA 3N4FA 3KX6A 3VZXA 2X2YA 1U5JA 1BQGA 1CLXA 2W6RA 5D2WA 3V5CA 3IANA 5HATA 5M03A 1KGWA 3ALGA 4GABA 3FNDA 3KTCA 3U4AA 3EXRA 1LL4A 5HOSA 4LB3A 1XYAA 3QMRA 5BXSA 1T96A 2A21A 3VD5A 3QEZA 1JXKA 1RA5A 4IPIA 1VJIA 3S8HA 2H9AA 3GVRA 4IUGA 3LI1A 3KOYA 1VZWA 1HF6A 1RJRA 2VCAA 1GORA 3CM4A 4Z1BA 5ABHA 3D47A 2QZRA 3UZ5A 2Q8XA 1AH0A 4RDVA 1YPFA 2YZ5A 4UMBA 4EF8A 1BF2A 3U5UA 3LY0A 4W88A 1KCKA 5AVHA 4JTHA 1QPKA 5I79A 4EPEC 1NDWA 3H7VA 6REQB 4E4FA 2A3AA 4AXKA 3E0LA 4B2DA 3WK2A 4GXMA 4JKMA 4RXGA 3F4VA 4Y9AA 3QSTA 2J7CA 1NY1A 3W7OA 1A5AA 1DXEA 2QMJA 1LQ2A 3RDKA 1SJDA 2HJPA 2WSKA 2PRLA 3L12A 3MVIA 3TAOA 7REQB 3WQWA 4H6QA 3URAA 2NX9A 5GPRA 3WY1A 2OEJA 4W87A 1TQJA 2R1LA 3LZ3A 4OFCA 1R87A 4DF0A 1K03A 3NL5A 3DFPA 2E8ZA 2ZRZA 3UJFA 4UFHA 4POCA 4OTKA 1R9ZA 2ISDA 1XLFA 1YBQB 4BS0A 5DMNA 5D9MA 1CECA 2WZIA 4OE7A 4G1NA 3W83A 5TAOA 2Y85A 1KWGA 1XSKA 3M0IA 2DSKA 4JX6A 2ZOXA 4JHZA 4DM2A 4KIRA 2VRQA 1RLCL 2W67A 4UQBA 2ATMA 2CZVA 1JGIA 3LQLA 2I57A 3I6RA 2Z26A 3VKKA 2ZIDA 1HVQA 3OTRA 5CSRA 4UTUA 9CGTA 4UCGA 3F03K 2CLLA 4BF7A 1WV2A 5BMWA 3ZYZA 2XSXA 1ZSXA 1IGSA 5REQB 4FNUA 4YLWA 1UR3M 3HV8A 3CASA 4KRZA 4EX4A 1XHGA 4AVFA 4WOQA 2C71A 3MUZ1 2GPTA 4V1YA 3MMWA 2PDIA 3C6CA 5I3GA 3OZMA 2XH4A 2J77A 3AI0A 3BH4A 4BK9A 1S2VA 3G2GA 3SY8A 2X09A 4D72A 2D2JA 3SIMA 2HS8A 2XN1A 1VF8A 4QLLA 3TYBA 3QHMA 2J8FA 4XTDA 1XIHA 1EFZA 5T91A 1XSIA 2WC4A 4LYPA 3DC0A 3GYCA 4NAEB 1GVFA 2BX7A 5D4YA 1WDSA 2RJHA 1G9HA 3SR7A 1Q6FA 1H62A 1T7LA 2JBMA 4ZQCA 3GFYA 4AD4A 5LYRA 3F2BA 3N12A 3B4YA 5HJXA 3Q37A 1QI0A 2A7RA 1QUMA 1SFJA 2E5DA 3MWCA 3A4JA 1YX1A 4NNAA 4Q32A 1BXBA 1K77A 2BSLA 3HG2A 3ARUA 1XINA 3O1NA 1E9YB 1CLKA 5DMLA 2C1IA 4MUZA 1FH8A 4C90A 1QFEA 2VGIA 4IP4A 2W0UA 1GEHA 4RE3A 1TB3A 1CDGA 4FF5A 1LL6A 3BGGA 5AYBA 4DELA 3NOYA 1IZJA 5M5DA 1JZ7A 4PMNA 2Q71A 4C6QA 3DIPA 3T9PA 1ZJBA 1KWKA 5BU9A 2VTFA 2C15A 4TO8A 3W86A 4TV5A 3GTNA 2E5CA 4XD6A 3DI0A 1XXXA 4B3KA 1KCZA 4EACA 2VDIA 4WEVX 1NTHA 1I4NA 4JIIX 3IAPA 1DORA 5I24A 3URQA 3L4WA 1S39A 4FF7A 4CNTA 1S5VA 4WD0A 1U30A 5FSEC 3ZR4A 2ON3A 3KL5A 1MDLA 4DBUA 3SGUA 3ARPA 1Y5WA 2PDGA 3NNTA 1W3IA 3POHA 3FKRA 1GVYA 1C90A 2GJRA 4FALA 1TRIA 3VX0A 1GOQA 1ESWA 4L4MA 3RLVA 3LBCA 1WYIA 1KD0A 1TZ7A 2PDFA 2FJKA 5REQA 4GBUA 4FNRA 4OECA 1SFLA 5DMMA 1BKSA 1VRDA 3UZZA 1P0BA 4E2BA 3BWWA 3TP4A 1M03A 3DHPA 2DPEA 3A24A 4LY8A 4W5ZA 5XIAA 1CGUA 5FD0A 2D3NA 4OVXA 2ZZ4A 3KAOA 1V3IA 4NXKA 4KEZA 4UNKA 3GC2A 2VDHA 1MZHA 5RUBA 3W70A 3NTYA 2J8GA 4FR6A 5D2VA 1YNYA 4PB3A 5KZMA 3ITTA 1WZMA 4TV6A 2O9PA 3SADA 4IPPA 2XFYA 4CD7A 4NG3A 2HTMA 2PDBA 4GKTA 5CPLA 5DMYA 1MNZA 3I7RA 2VI0A 3TC6A 3K4WA 1I6NA 3IIVA 3W01A 3ISIX 2UWFA 1J0IA 1VBRA 3BJFA 4LVAA 1U33A 3BLOA 4MJMA 3K4AA 1NP0A 1QPOA 2VEKA 2Z7KA 5CG7A 4CQ8A 3A12A 2ZWYA 3L66A 2VZTA 5LA2A 2BVWA 4MF4A 1BKHA 4ZQRA 1UZDA 3NDZA 4XV0A 5E6YA 2Z1XA 2J47A 1T6MA 3LERA 1MXSA 4PCTA 2REQA 1JPKA 2GVLA 3SQLA 3NQCA 4OV9A 4MKSA 4U28A 3IJ7A 4LRSA 1EJ7L 4N7QA 7CGTA 1I2QA 3IIXA 3FHAA 3FSTA 1E6ZA 3OLEA 2DZVA 1XISA 4MB5A 3QV9A 2DY3A 2F9RA 3B0UX 2JKAA 3V5OA 1F8IA 3GM8A 3UXDA 1Q85A 1W6TA 1BGGA 2ONEA 4M3PA 3UXAA 3MMTA 4U5KA 4F40A 2FVLA 2G41A 4XK2A 1SR0A 3GDBA 1MW1A 2CZEA 4LS1A 4XUYA 3H2OA 1D3GA 4E2VA 1K4GA 3G6MA 2L5HA 2X40A 3TYDA 3E2SA 4HNCA 1LM1A 4AEOA 8XIAA 4Q6XA 3AO0A 2V9DA 5HAOA 3NXLA 4BEQA 3QW3A 2QDEA 3XINA 3GU9A 3QJAA 3SCNA 1F6KA 1F76A 3CZ8A 3A64A 3BMVA 1RH9A 3TN6A 3N4EA 2XIJA 1O60A 2XTKA 4IF2A 4U2YA 4O50A 2GGEA 3MANA 2J7BA 1A5NC 2DZPA 2J6VA 3IVTA 3W7HA 1AJ2A 2V81A 1YPXA 1FWRA 1KC7A 4KT2A 4PTVA 1E0XA 4LC6A 3EB4A 2V30A 4R3UA 3LM7A 4ML9A 2CHOA 3ARXA 4DWSD 4YL2A 1LLOA 3G24A 3UA3A 1S3TC 1UMLA 2YYUA 3JUGA 3EDDA 1IHIA 4JKKA 3TSDA 1BQCA 2E09A 1G5AA 2QGHA 4KWSA 4AZCB 3UQNA 1UR1A 3NIYA 4Q4RA 1THFD 2DSWA 2P0OA 2BFGA 3VKAA 2GDQA 2OU4A 5E0FA 1KM2A 4ZVJA 4X63A 1O95A 2XM1A 3TOYA 1ZQ5A 2OZTA 5GJPA 2ASHA 3N6QA 2PGRA 3GDMA 4FHAA 1W17A 1BXCA 1QI5A 2WMHA 3BW3A 4REQB 1W5MA 3FVDA 4GJ1A 4GY1A 2A3HA 5BRBA 1SO5A 1ONWA 4Q8OA 2QKFA 3KCOA 1YXCA 3NYZA 1KTCA 3AS3A 4D6HA 2YB4A 1EP2A 5KMYA 3WNOA 3A13A 3GXFA 2AKZA 4Z1YA 3LHVA 5CZ0A 1EHNA 1ZCOA 3VNLA 3G1VA 4ALDA 2HVNA 1W9PA 2ZQ0A 3CYVA 1K9EA 1KW1A 4LAZA 4ZXOA 2ZX5A 2WJEA 5C54A 2IQTA 2VC6A 3TN5A 5JIPA 4RK8A 4F9DA 2JGYA 2DT2A 3T8LA 1BG9A 2VOMA 1V6XA 2ZZ6A 5GJMA 5HQLA 3TVAA 4U5IA 1POKA 1EOMA 3LCHA 2YYTA 1H61A 4I9TA 9XIAA 5A8NA 2VFEA 4US6A 4FMVA 3ATYA 1JZ8A 4LH8A 4MGGA 1D8WA 4YHEA 3WJWA 4R27A 3KRUA 1LZOA 1UWIA 1PE1A 2G37A 4CCZA 5D2YA 4AC7C 3ARTA 4RCXA 4O17A 1F8MA 3ME3A 5IXEA 1QO5A 4XTIA 2CZDA 3UJRA 4ATLA 1UWAA 1XICA 3H70A 1K4HA 2ZICA 2P3EA 3SN0A 1Y65A 4W93A 3NQMA 4C6OA 1JRCA 6REQA 3GB6A 5IM51 3NO5A 3GR4A 1WO2A 3R11A 1ZHAA 3HPAA 4WDWA 2ZADA 1BWLA 1N8IA 3DXIA 3TQPA 3TH6A 5CXPA 4XSMA 2Z28A 1R3YA 1Z48A 2FZDA 4EPDC 1VFTA 2QCDB 4QEHA 1D3HA 3S4TA 5A8PA 1EC7A 4HU0A 3OQEA 4L6OA 4O28A 5BNKA 2I9UA 4DWSB 1EP3A 3TC3A 4DJEA 3BW4A 5EPDA 3W1UA 4OOUA 3IWPA 1TVPA 2QDGA 3IIPA 3MKKA 4GFSA 3LENA 1Q13A 2VVNA 3R0KA 3MSGA 3WQDA 4AF0A 3SCQA 2QPXA 4GYPC 1XYFA 3CB3A 1GYMA 3MYOA 2I9EA 1LP6A 5A8GA 3APYA 3W26A 3DFTA 1MXGA 3F2DA 1H1NA 3URNA 1G67A 2V3DA 4HPJA 4N9DA 1GJUA 1QATA 1WKFA 4QJ3B 2WJDA 1Q6EA 3URBA 1J10A 4ZBCA 4I8YA 1MWOA 4JTAA 1FXQA 1UCWA 1GVOA 1KM5A 3SCPA 2YX0A 5HPCA 2PWHA 1V5XA 4ADTA 5LIUX 2FHFA 3GKAA 2ACUA 1DJQA 2WK2A 4A8NA 2PLJA 3RG6A 3DFOA 2CCRA 4ZGYA 5ENLA 1ZALA 3OYZA 4ERAA 3H2CA 4TTGA 3WQ5A 3A3XA 4WX2A 1JUKA 4ZQNA 1UUMA 2WZEA 1J9YA 2X16A 3IV8A 2HWGA 5C6MA 5DBTA 2QEZA 3SCVA 4UOJA 5CGMA 1FWGC 3VFCA 4GIRA 4GC4A 1OCBA 3PZIA 3I3DA 2YFNA 4MB3A 3LPPA 3EX1A 4PMYA 3FK4A 2WWDA 1R85A 1L8NA 1KCXA 1MRAA 2PDWA 1VEPA 4M80A 4D1IA 3F4CA 4B9YA 1MUCA 5A2CA 1EL3A 1OFRA 5I3DA 1Q66A 4FLRA 3KDNA 5TD4A 1E0TA 2RDUA 3NWRA 4YPJA 2OX4A 1IXPA 3E74A 1QNQA 3MWAA 1RQHA 4ZFCA 3LMYA 3RGTA 1XLEA 4F66A 1XQLA 4YXGA 3KVJA 2ODOA 2F61A 4PTDA 4JR5A 3WCZA 4OT7A 1SW0A 1EXPA 4JQ3A 1OIFA 3SRKA 2Y6ZA 2CNCA 2PDMA 3ITYA 3GG8A 5FESA 1AW2A 3BCDA 3IGXA 1XKJA 5A6LA 1EC9A 1QNRA 4C6IA 2J74A 4EE9A 2CHNA 2VRJA 3OIHA 3VDBA 1GJPA 3OYXA 1H60A 1SO4A 1WZAA 3OPSA 3HZ3A 2XFWA 2I5IA 4UB9A 1UASA 3NGFA 1PX3A 2UY2A 4Y2WA 5G2WA 4A3QA 2DH3A 5FCZA 4NAFB 3WLNA 1PO9A 4C6MA 2F6KA 3KBVA 2QIWA 2CBIA 3PUOA 4BEUA 1EUNA 1EPXA 1US3A 1JNDA 1OZMA 3SJNA 4AHOA 3UFYA 2X8RA 3WLQA 3M46A 3B0VC 3JZEA 3AYVA 3MQTA 1A49A 3E02A 4MMWA 4G1KA 4DJFA 4YCOA 1XBYA 4HZ7A 2GZXA 2BY2A 3MI6A 4DPQA 3MBDA 2BXVA 4ICNA 3NQVA 3T42A 3PBVA 3EWCA 3O6DA 1JDDA 1GJWA 2R82A 3S9YA 2WXDM 1E55A 3U48A 1P7TB 2Y8KA 2OGJA 1O94A 3R0DA 1PEZA 1OCQA 1KM1A 5C9WA 5LGXA 4CQ9A 3EWDA 5I23A 2V3GA 3SUUA 3E2VA 4FI4A 4FSAA 4B5VA 2AMGA 4MAZA 3M0JA 3GY1A 3QQWA 4Q8TA 3H23A 4KKXA 2HQAA 3QTGA 4HNOA 6TAAA 1BYAA 3KBJA 4H83A 2O7SA 3NQDA 3PUEA 2G3NA 2BMBA 4I90A 5JBEA 1V7AA 3LPGA 4AW7A 5ECVA 4C91A 1AJ0A 2OJPA 3A47A 1IR1A 3S1XA 1CIUA 1LUCB 1NDVA 1F9CA 1DTNA 4WHBA 1UD3A 1WCGA 5HBFA 3K8LA 1K9FA 2Y4SA 1DEDA 1XKYA 1XC6A 1EF2A 2PBGA 3QKZA 3QLDA 1SW3A 4C6FA 2ZUVA 4GQ0A 1FFQA 3AISA 4H9VA 4IQEA 3NPVA 4F2BA 4Z0SA 1GYNA 5D32A 3KVMA 1DJNA 2WC3A 2AL1A 3MBFA 2CLKA 3QC0A 1UKOA 3R25A 1HO1A 4ADUA 1A0EA 4PUJA 3VU2A 4EP8C 3CQKA 3M16A 3CO8A 4L80A 3M0HA 4DJFD 2EPHA 3FS2A 3W1QA 3ARSA 4GMEA 5EMUA 3VTRA 4Z0JA 2WLZA 2YCLA 4CCCA 4HJFA 3GNDA 2OWXA 5AC6A 1TX2A 3WK3A 4EXAA 1QOPA 3MPGA 1X1ZA 2E68A 1BG4A 4HTBA 1AH4A 5D37A 3CV7A 1F7BA 1FWHC 3NJ3A 2ACQA 2Y8UA 4H9ZA 1S5TA 1GHRA 2FMOA 4EPKA 3GNXA 3WH9A 4GPNA 1QHZA 3FJ4A 4GZJA 3R12A 4PGLA 1QVBA 4NI8A 3RYSA 4CQBA 3ES7A 4W8BA 4RXFA 4ZMGA 3DBNA 4GIEA 4PCFA 1IEIA 4HNLA 4C6LA 1GOMA 3RLHA 2VZVA 5B7YA 3DENA 3JZUA 3WJXA 2DT3A 2EPMX 2ZUMA 4DXXA 1FCVA 5DANA 5AFDA 3NXFA 4DLMA 4I9JA 4FPSA 5DY3A 1VPQA 1CGVA 4KIEA 1AQ0A 1KBIA 3RXZA 2C3ZA 3PFRA 7REQA 3I7SA 1OVDA 1JZ2A 3LCFA 4HNTA 2Y88A 4EAYA 4XAFA 4TVCA 2DSVA 4AZCA 2I1OA 3FLUA 1CT5A 1DWIM 3FN9A 4PFMA 1WZKA 2QNEA 3SECA 2XFRA 5ABFB 1JR1A 1UKQA 4TVDA 2J7EA 1I8JA 3S2JA 3M6YA 4J9JA 3VILA 3PZVA 4R33A 5JH2A 3WZ0E 3B8DA 3VC5A 1QU4A 1TELA 4WRHA 4M56A 2A79A 1V6VA 4E4UA 2ZXBA 3CO4A 3NAVA 4Q4PA 1MDRA 2NXIA 5EMLA 4HVXA 2OSXA 4KRUA 4TUFA 1YLVA 4E2DA 1HT6A 5CJMA 3ARRA 2B0MA 4DJDD 3AMDA 1FFRA 1E6NA 4NAFA 3C2YA 5F2LA 2G95A 2RHGA 3VFLA 4AZIA 1JRBA 1DVJA 5D02A 5C9XA 4L4LA 4GHRA 5I06A 2JKPA 1HZYA 4JGDA 4MFEA 1QDSA 4WVXA 3JS3A 3SUSA 3HU7A 3BZJA 1PKNA 2MUCA 3EZ4A 4KWVA 4O16A 1EKOA 1Y8BA 1B3WA 4HPHA 2XVKA 2PZNA 3VIMA 2OZ3A 3AXHA 1L9WA 3T0BA 3GKFA 2WVVB 4DO7A 1YTKA 3CV6A 3KRSA 1TPUA 3TTSA 1NH6A 4RV8A 2IKGA 2BGNE 3PJXA 3KM8A 3RU8X 2FQIA 2GGIA 1EEPA 1F05A 2GJLA 4W9TA 3TN3A 4UIOA 2XDFA 3O0KA 1IZCA 3W81A 1MUWA 3LNMA 3UERA 5FIPA 2CKRA 5ABFA 2GLKA 2XVLA 4GI8A 4PMJA 4CCDA 4TIMA 3FIGA 3KLLA 2WHKA 1OCNA 3QW4B 1Y0EA 3QHOA 1X38A 1UPMB 1P0EA 3F4WA 3CQ0A 1P4CA 4QEEA 4ZTYA 3VIGA 1TREA 3M9YA 3C86A 5BWFA 1N8WA 3W2JA 4L6DA 3PG9A 3BLPX 4O52A 1FWFC 4EK7A 4R7OA 1G94A 3WLKX 3EB3A 5HK4A 2PTXA 1SUXA 1DXIA 3Q67A 4AU0A 2DZTA 1VR6A 2Z0IA 3LCWA 1VQTA 3VD7A 5KTLA 3WLPA 2VDGA 2WSYA 1LRTA 3W7CA 3QFEA 2PB1A 3BMWA 3HQNA 1J6PA 1P43A 4GYKA 2FFIA 4IIBA 5D38A 3CLWA 4H6RA 2C14A 4L64A 4ML4A 4P8WA 3ZMRA 3C61A 3V0SA 1Z7AA 3L4YA 4ENLA 2PC8A 3NQ7A 2PP0A 4U31A 2CWNA 3LBMA 3GNPA 4QHRA 5D33A 4HU4A 3STEA 3PF3A 3OLGA 5CPOA 4GI6A 4FLSA 3IEBA 2R14A 1TV2A 3L5AA 1QW7A 1R3TA 4IICA 5SWUA 4MB4A 4F8XA 3A3WA 4PL2A 3ABZA 1PXGA 5AYYA 4XO7A 4L9YA 4YTUA 2PEVA 3UYIA 4HK6A 1JCTA 1TX0A 1OX4B 4FLQA 4OGZA 1LOLA 2OZ0A 3VCRA 2IKHA 3LB0A 1DIEA 2WQPA 1F4HA 2QCLA 5HWJA 5F7UA 4JDYA 4LBUA 1GNXA 5LNRA 3AICA 2VXNA 4ROQA 2E28A 2QCHA 1SZGA 4ZE4A 4IIFA 3KZSA 3RITA 3GVQA 5BU6A 4QISA 4S1FA 1O68A 2PDNA 1C9DA 3GVVA 2E9BA 4YVPA 1F74A 1FCUA 4US5D 4GVFA 3VGBA 1NIUA 4Q8VA 3TFCA 1QPRA 4NX0A 3CUJA 5CZKA 5FF7A 1DJZA 2E3ZA 3LRMA 1UBPC 3TMQA 4AIBA 5CC7A 1TIMA 3GVGA 4N4QA 2RDWA 3IJQA 1Z9AA 2QUVA 4DYKA 1VLWA 1LT8A 1W9VA 2BOFX 4BZYA 4XD3A 3R2GA 5C9UA 1FY6A 3PPHA 4R9XA 1CB2A 3W24A 1CEOA 5JQ9A 5HWNA 3C2VA 4HMCA 3A9IA 4A3YA 2PDJA 3R7MA