5AZ0A

Crystal structure of aldo-keto reductase (akr2e5) of the silkworm, bombyx mori
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
345
structure length
324
Chain Sequence
b'KVNVPNFKLNNGDEIPALGYGTWLGVSDFDGTDIPKLLDALSYAIDIGYRHIDTAHFYRVEPEIGQVVQEKINEGVVRREDLFITTKVWQHYHRAADVEVSLRASLHRLGLDHVNLVLMHWPMSISQEGVDEKIDYLETWRGFEEVLKKGLTKAIGVSNFNIEQMKRLLTNCNVPPAVNQIEVNLNLSQADLVDYCQANEVVVVAYSPFGTMVPSLNSPEPKLDNPAMLAIGRKYGKTVTQVNLGYLYQRGIVSIPKTVTKSRVLENASIFDFQLDDEDVATLAQFDNGFRTVRPLFWQPYENYPFDVVPGQDIPIAMRKWKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Oxidoreductase
source organism Bombyx mori
publication title Structural characterization of an aldo-keto reductase (AKR2E5) from the silkworm Bombyx mori
pubmed doi rcsb
total genus 118
structure length 324
sequence length 345
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5az0A00
5HNUA 1J96A 2HVNA 1GVEA 1UR3M 3MB9A 3V0UA 2PDNA 1EF3A 2F2KA 4YVXA 1A80A 1AH3A 3BCJA 4WEVX 4LAUA 4JTDA 1EXBA 2INZA 2PDLA 1PZ0A 4NKCA 1ZSXA 2J8TA 2PZNA 3R94A 5KETA 4ICCX 1Z89A 4LB3A 1US0A 2BP1A 5LIUX 2IPJA 2IPWA 4JIRA 1AH0A 3H7RA 2ACSA 3R7MA 1YE6A 3UWEA 3VXGA 1S2AA 1Z9AA 3MC5A 3GHUA 1YE4A 4LAZA 4H7CA 2FZDA 1PZ1A 4GACA 3U2CA 3R8HA 4RPQA 3LQGA 2A79A 3RX3A 3G5EA 3D3FA 3LD5A 3N2TA 2INEA 2FVLA 4GIEA 4QR6A 1X96A 1S1PA 4OTKA 4HMNA 4GCAA 5LIKX 2PDKA 3ONBA 3T42A 4WDXA 1M9HA 3O3RA 3UYIA 3O0KA 4PUWA 2PDWA 4XO7A 3RX4A 3RX2A 3CMFA 1AZ1A 2PDYA 2ACQA 3V0SA 1HQTA 2I17A 2PDHA 1Z3NA 4LBSA 3BV7A 2PDUA 1T41A 4Q3MA 1IEIA 5M2FX 2DV0A 1Q5MA 2PDCA 4ZFCA 3LBOA 2QXWA 1MZRA 3LN3A 3R58A 4IJRA 1ZQ5A 1RY8A 4DBWA 4XK2A 3Q65A 2FZ8A 1JEZA 2PDBA 4QXIA 2IQDA 3KRBA 4QBXA 2IKJA 1QWKA 4PRTA 3UG8A 3CASA 2PEVA 1MRQA 3BURA 1ADSA 1PWLA 1T40A 3LZ3A 2IS7A 1XF0A 3R8GA 4PMJA 1K8CA 2WZTA 3DOPA 4JQ3A 4L1XA 1VBJA 2IPFA 1MI3A 3UZXA 4WDWA 3GHTA 3LZ5A 2NVDA 1LWIA 4L1WA 3LUTA 3V36A 3WCZA 2PFHA 4WGHA 2PDXA 4WDTA 1SM9A 2PDJA 1XJBA 3UZYA 2ACRA 2P5NA 2R9RA 1VP5A 3GUGA 4XZLX 4JQ1A 4Q7BA 3Q67A 1RALA 5AZ1A 3N6QA 2DUZA 3QKZA 5DANA 2DUXA 1AFSA 4WDUA 4YU1A 4DBUA 4PR4A 3GHSA 2HVOA 4AUBA 4G5DA 1EL3A 4JTAA 5LIWX 3WBYA 2PD5A 1IHIA 2PDQA 4YVPA 3EB4A 1EKOA 2PDPA 1RY0A 2C91A 4GA8A 3LQLA 1AZ2A 3B3DA 2ISFA 2PD9A 4WRHA 1X97A 5HA7A 2PF8A 4XZMX 2FZBA 1ZUAX 4PUUA 5HNTA 3UFYA 3UP8A 4DZ5A 4JQ2A 4XVEA 4GABA 3R6IA 5AZ0A 1AH4A 4IGSA 3UGRA 4MHBA 3GHRA 1S2CA 4FA3A 3V35A 3EB3A 4GQ0A 1OG6A 3M4HA 3M64A 4XAPA 4LBRA 3WG6A 1FRBA 1Z8AA 4FAMA 1YNQA 4IJCA 2ALRA 4JIIX 1YNPA 3FJNA 2HE5A 4LB4A 1ZGDA 2BGQA 4JTCA 3DN5A 3CAVA 5C7HA 2R24A 4R9OA 3WBXA 4HBKA 4YS1A 1PWMA 2PDMA 3ONCA 3LEPA 2HDJA 4EXAA 4XZNX 2IKGA 4ASTA 3BUVA 2PDIA 3H7UA 3V0TA 2HV5A 5LIYX 1PYFA 4EXBA 2IQ0A 3NTYA 1Q13A 5JH1A 2HEJA 3UZWA 1HW6A 3F7JA 4XZIA 4XVDA 3G1RA 2I16A 4XZHA 3WBWA 4H8NA 4F40A 3LENA 3ERPA 1R38A 4FZIA 3S3GA 4JQ4A 4QX4A 3C3UA 4XO6A 3LNMA 3EAUA 3P2VA 2AGTA 4I5XA 1X98A 1QRQA 3R43A 2WZMA 3CAQA 3CV7A 2IKHA 4FALA 3UZZA 3H4GA 4YVVA 4JIHA 2BGSA 3M0IA 2HE8A 2PDFA 2NVCA 2F38A 4PRRA 2ACUA 2FGBA 2PDGA 2IPGA 4JTRA 1S1RA 3COTA 1C9WA 2IKIA 4JTQA 2CLPA 1XGDA 3FX4A 2FZ9A 2VDGA 4DBSA 4GQGA 4JQAA 1LQAA 5JH2A 5LIXX 3CV6A
chains in the Genus database with same CATH superfamily
3S5SA 3TTSA 3R8RA 1UWQA 1P0BA 2WO5A 3CUZA 2NX9A 2RDWA 2X1RA 3VDBA 2WJEA 3VK5A 4ZOEA 1EF3A 1JDEA 1XYMA 1FDZA 4RNHA 1VQTA 3G77A 1MNSA 1Q66A 4F9DA 3W2NA 4REQA 4AZIA 1GOQA 4ZXLA 3WK0A 2BHYA 5A6MA 1M6JA 1UW9A 2EKCA 1N82A 3WF1A 2WBKA 4B3ZA 4RE4A 2IMRA 3H23A 2V0TA 3ATZA 1A50A 1KTCA 1YIXA 1JR1A 2BP1A 4UTWC 3O6YX 4OJYA 5BWFA 1VR6A 4I5UA 1B0IA 1B5TA 3N14A 3LXCA 4XKYB 2NUYA 4FNQA 3GG7A 5EB8A 5FL1A 1YTDA 4LX4A 1F2JA 2H3BA 4XG1A 1PZ1A 3TH6A 2Q09A 2H3DA 2VC7A 2GL5A 4HCLA 1LF1A 3S1XA 3SN4A 3WUEA 5FF0A 5C0QA 2CETA 3LG3A 4LUYA 4XQ6A 1O66A 3LOTA 4GCAA 3FNDA 1OGSA 5FJPA 2DH2A 4UR7A 4CCDA 5ECUA 1MUCA 4GI4A 5CPOA 3FA4A 3G3MA 5M5DA 1US3A 3AXXA 4F79A 3MKCA 4UFHA 1Q7QA 4D6DA 5AC6A 4O14A 3FVDA 4UQAA 2WVVB 4FXRA 1NAL1 5M3WA 4GYKA 2ACQA 2J7EA 4MWAD 2WJDA 1H61A 4FHAA 6A3HA 1UROA 1OYBA 2ODOA 4KEMA 1QI3A 4NNAA 2OLSA 2ZC8A 3N15A 4JBRA 4IJRA 1ZQ5A 4DBWA 3C52A 3OHMB 1UR1A 2QLYA 4BI5A 3IGSA 3AYRA 2XISA 3ZMRA 3R13A 4W87A 5T9CE 4J9JA 4LF2A 3W75A 4BJHA 1W9VA 4FEZA 4PRTA 4QCFA 1BKSA 2WCSA 3IUIA 2GPTA 1VRDA 1JD7A 1U1UA 4TTUA 4J1OA 3SECA 1XF0A 1N2VA 1UA3A 3BMWA 3N17A 5BOOA 3L5LA 3QC3A 1U33A 3AIQA 3CS2A 3UR2A 2HNEA 2E0PA 5LNVA 1EIXA 2PSNA 1H5YA 3KTSA 3U4FA 1QK0A 3BL3A 5DBUA 5DLCA 4O54A 1XIEA 3N2OA 4KKXA 5CSSA 4TO8A 3QGAC 4WDTA 2PDJA 3W6MA 2P5NA 2R9RA 2HROA 4GVFA 1NOWA 1VLWA 1E6XM 4JCLA 2OQHA 2J7CA 2KZHA 3R2GA 3UCCA 2CYGA 1QHPA 2C71A 3IARA 1C8YA 3PZOA 1Q85A 4WDUA 3TAOA 2W0UA 3CYVA 3H70A 3AU6A 4MKNA 4NU7A 4RL3A 4DIAA 1VFOA 4CU7A 1ZLPA 4XIMA 4F0HA 3IWPA 4UTUA 2WANA 4WLCA 1TKKA 3DC8A 3ZJ6A 1EOMA 4QJ4B 2FLIA 3A5VA 3K1GA 2PD9A 5HDRA 1DJZA 1DV7A 4FIRA 3ATYA 4B3LA 5HNTA 1VD6A 3B0UX 3UNTA 3MDUA 4C91A 4H1ZA 5AVHA 4XD3A 1CX9A 3PB2A 1THFD 3BTNA 1JF6A 4WUIA 4JFWA 3VCNA 2D2JA 1KW1A 5CZSA 3ZR6A 3QVQA 4AXKA 1SZNA 1XIJA 3U5UA 2D0FA 3CZJA 4DF0A 3M4HA 3PP7A 1KM1A 2CHRA 4YTRA 1FWEC 3HQOA 4J7RA 2NXGA 1M68A 2ALRA 3UQNA 1CYGA 1YBQA 1KCXA 4LB4A 2QJIA 3SUUA 1UZ1A 3W2UA 3E02A 4Q8WA 2RGMA 1HJSA 5I3JA 1XUUA 5HMSA 3W7EA 3CAVA 1C9DA 4M82A 4N6EA 3HF3A 1NWTA 3TQPA 2XG9A 1UD2A 3AYTA 3VX0A 2XH2A 1E3ZA 5LHEA 3LEPA 2IKGA 4KWVA 3ZWSA 3RAOA 1KFJA 1K9DA 4GBDA 1NWUA 1PKMA 1EBGA 4TVUA 3AMLA 1ONXA 3GFYA 3WH5A 1S5TA 3UZWA 3F7JA 3W1PA 4AYGA 3OA5A 1BSIA 1W3TA 4XD6A 2C79A 4GUFA 4XZIA 3TFCA 2RDUA 3SCRA 5DMMA 4H8UA 1G01A 2NQ9A 4TMBA 3R0UA 3SAZA 2INFA 4QX4A 3BQ6A 3T40A 3VKAA 4S1FA 3WQDA 4FNSA 1A47A 2WSPA 3LLFA 2ZRUA 1FWRA 2WMGA 4XBJA 1DJYA 4I3GA 2PCEA 3R43A 2WZMA 2VGFA 2NV9A 3EDFA 4OBSA 1HJXA 3PTMA 1KTNA 5AHEA 1XR2A 3BOXA 3WMCA 5HWMA 5LKYA 3KVJA 2BFGA 2FH6A 4ZA0A 1YXCA 4YTQA 4C90A 4TOQA 4R88A 2CLPA 3RN6A 5I0DA 4QNWA 4JQAA 2YDSA 1A5UA 4WX2A 4JTUA 1UJPA 1TV7A 3AAMA 4C5ZA 1WOAA 1XX1A 3IUHA 4K1GA 4ZQNA 3PG8A 1ALDA 2I1OA 1VFMA 1EC9A 2I57A 3E38A 1XG3A 3IANA 2CITA 1PKYA 1XISA 4GKLA 3ITVA 1UQZA 3LI0A 3WQ5A 3W28A 5BU9A 5K4XA 2P0IA 1H09A 4BWLA 1H0IA 4Z17A 3NDOA 4PRWA 1TJ0A 1UC5A 7REQA 1PYMA 2FMNA 4WR3A 3GVQA 2WVTA 2X1IA 2R1MA 4IFKA 2QJHA 2IPWA 5HPOA 3LNPA 1UPMB 5CSRA 3R7MA 1Z42A 3AROA 1R30A 4F0RA 3A4AA 2VCBA 2HSAA 3GHUA 2ZUMA 4LAZA 3GXDA 4OT7A 4J27A 9XIAA 3IGHX 8CGTA 3TK7A 5MF5A 2VZOA 2NX3A 4DYKA 2OU4A 1UOZA 4EPDC 1XLLA 2VZVA 2QT3A 1SJBA 2TYSA 3WD4A 1E6QM 4TVCA 2E9MA 5CEWA 2F61A 3R12A 4NSBA 4OTKA 3WH6A 5BCAA 3TW6A 9XIMA 4DEFA 5IFPA 5JBEA 4JOMA 4PFMA 3N1AA 3VD4A 3QQ0A 2VX5A 1J0KA 1FWCC 1EJUC 4JKMA 4ONVA 4P5UA 3PAOA 3EXSA 1V02E 5XINA 1XFCA 3RX4A 1SZEA 3RFAA 3AHXA 4GI6A 2PC4A 4GQBA 4E8CA 1E51A 5E5CA 4MB1A 4RE3A 1KKOA 3WEZA 3PHAA 2QCDB 3SY8A 5C70A 2PA6A 2YA2A 4ERIA 5K9CA 3MT1A 2PDCA 3ZQ9A 3NQGA 1BPLB 1VS1A 3BAJA 2QXWA 4KFNA 3Q65A 3SRHA 1P6CA 1ITQA 4NZ4A 1B9BA 4C6BA 4LRSA 3AFBA 3ANYA 4KRUA 1ADSA 5IDIA 3TNOA 1JRBA 3ARSA 2ZRWA 2CBIA 1VFFA 3MSGA 5DCDA 4PEKA 5CH9A 4PMJA 3R8GA 3V1PA 1FWJC 4PTMA 5H8MA 3DH7A 4L1XA 3CNYA 3SFKA 3ICJA 2XIOA 3LERA 3TQKA 3GKAA 2GLKA 3EPNA 1IEVA 1TO3A 3LZ5A 4DUWA 1QDSA 2OT1A 2PGWA 1TTJA 2BY3A 2EPOA 1BSLA 4FR1A 3UZYA 1K7EA 3LMZA 2I5QA 5ABTA 2E6FA 5A8GA 1K1DA 2R82A 3N6QA 3C4UA 4XSMA 1AODA 2DUXA 4M0XA 3UCDA 1AFSA 2EJAA 4KETA 4EAMA 3A3HA 3N6JA 3EX4A 3RLHA 1W2VA 5EFDA 1BGGA 2CERA 3VOIA 3FXGA 3FK4A 5AHMA 1WXJA 1XRTA 1FWGC 5CG7A 3QY6A 3N6HA 4JTAA 1MFVA 3E5BA 4QROA 2E67A 3TYEA 4UQBA 2X8RA 1A53A 2OX4A 1DE6A 1OX4B 1W0MA 3A22A 1C91A 3DUGA 2PDPA 1W9XA 3A9BA 3TAKA 2VKZG 1P6WA 2MANA 1XIBA 4EKJA 1R3RA 1XCFA 4J3TA 2PWVA 3A13A 4XVEA 1EPXA 4P7RA 2PU1A 3GO2A 1WBHA 3STGA 1HXJA 1B9ZA 4A35A 3VGFA 2VTFA 2Z1VA 1A5OC 3LRLA 3R79A 3NL6A 3MHFA 4A3UA 4CD5A 1JULA 2HQAA 4F0KA 4O4VA 1MSSA 4IMCA 3T05A 1NFBA 1EBHA 3MYOA 1R3WA 2DVUA 3RF9A 2HS8A 5E9AA 4KRZA 1UWAA 4V28A 3GU9A 4O1BA 2ZUSA 4I90A 4MZ8A 3RLGA 2V38A 1IT8A 1RD5A 1EC7A 4GUHA 2J9XA 3EWXA 3CWOX 2JF7A 3CO8A 2C7FA 3AUJA 4JTGA 1GTHA 1GKRA 4CN6A 4B5UA 1PZ2A 3GXTA 1UPPA 4UC5A 1SO6A 5I23A 2VVSA 3T4CA 5J5RA 2HDJA 1HIZA 3EYPA 3R0DA 4ORMA 3KUMA 3PBWA 3BG3A 4DYJA 1IXOA 1BQGA 5LA2A 4JDYA 1CGYA 4BFAA 4QTGA 4JTIA 4FNPA 2QUVA 4EK7A 4Z1BA 3A3WA 3C0SA 4DPPA 4E2BA 4P2VA 2HEJA 2JBMA 3QSRA 4WSJA 1B3VA 3E2RA 3VPLA 2DT3A 3NZRA 3NO5A 2QVHA 3AS0A 1B3YA 5C2GA 3K13A 2YOCA 3LENA 4IMFA 1R38A 5D02A 3K5XA 4RDWA 1VYPX 2GJXB 2YCLA 1UA7A 3OG3A 5HMFA 3WZ0E 3U9IA 5D4YA 4K39A 3WD1A 4ZQCA 4NYYA 4E3TA 1X98A 4QEEA 3IVSA 3CQJA 1FTXA 1ZCCA 4UXDA 4PB4A 2Y88A 3MUAA 1J0IA 2VEFA 2B81A 4WXZA 3UPWA 3MMWA 3NXLA 4YN5A 5HQMA 2F38A 4HU4A 2FGBA 4JTRA 1ZBCA 3E49A 5I3GA 3W7DA 3W86A 5D8ZA 1PE1A 3HGSA 3MVTA 2XFYA 1WPCA 1TA3B 3VIIA 4LH8A 2FZ9A 1QCWA 2HPMA 3URBA 2EF9A 2H9AA 2ZXBA 3VKDA 4ECLA 3BH4A 2AQVA 4NL1A 1GVEA 3ZT6A 3MB9A 4A4AA 4PCTA 2TSYA 3CLMA 1I6NA 4GJJA 2FPYA 3AWOA 1OD0A 2E7FA 1U83A 4HHLA 3GDKA 4JX6A 1ZZMA 2BDQA 5HJLA 2J8TA 2PZNA 3M0YA 5MKGA 3S83A 1EJVC 1PS9A 5A95A 3W71A 4K6AA 2PCQA 5GJNA 3NL3A 1JCMP 3AHTA 3LHYA 1PB0A 2IPJA 1UIOA 2WC4A 3N2BA 3LMYA 1N7KA 4Y90A 5KINA 2CZEA 2VEPA 3GW3A 1GJPA 2QYGA 2Y63A 3F2DA 4LANA 4PSRA 2G5WA 3OYXA 1ZJAA 3SQLA 3VE9A 4HZ6A 4OQVA 1BF2A 2R6OA 1JCTA 4MY8A 3PZQA 4GMEA 2FZDA 5I2UA 4IM4A 5I7GA 3TYBA 1IXPA 3ENLA 4Q8TA 1WP6A 3SCNA 1W9PA 2OGJA 3HO8A 3LQGA 2WQPA 3UXDA 3D3FA 2ZUNA 1IZCA 2NZLA 4HNVA 4C6QA 3B8UA 4Y9MA 3N25A 1UKOA 5LIKX 4IUOA 1W37A 3EX1A 1XIGA 1E15A 2POTA 1LORA 4GCXA 3M44A 1LQ0A 2ZZ6A 3NA8A 4XO7A 4AD0A 5C9UA 2D22A 1J10A 4FX6M 2DSWA 2RFGA 3B0XA 3BQ5A 3FA3A 1X1ZA 1DHPA 2YW3A 4EIVA 3CTLA 4N4PA 2QQ6A 3W82A 3PUOA 4ZL1A 3Q37A 3GC2A 1KXTA 4AD4A 1XKYA 2GJRA 3LBOA 1MZRA 3N13A 3GNDA 4B2DA 2EXOA 1KCLA 3FSUA 3NSXA 3GAYA 2DW7A 1KKRA 3TR9A 3CL8A 4DBEA 3LGGA 1VBHA 3VVGA 5XIAA 4LYQA 4O0ZA 3KVMA 1OFQA 1TZ7A 2W79A 4X2PA 2PRHA 1PAMA 3G18A 3E2QA 1I1XA 2NX1A 3QPEA 1MI3A 4GOAA 1XSIA 1E4IA 1UWRA 3GKFA 1VB9A 2TMDA 4AWUA 1PCWA 5E0KA 4ZENA 3K8KA 3STEA 1GYLA 1CGTA 1BXBA 1W8GA 4M19A 2CLLA 1OFDA 2FKPA 3M16A 3SR7A 3TJ4A 5HNRA 3MPGA 1T6MA 2QPXA 3C2RA 5D09A 1CTNA 2WPGA 3STFA 1IQ8A 1DQUA 2XUCA 3UWUA 1DWIM 1P7TA 4S3GA 3U2OA 5FD0A 1Q6LA 1LUCB 2OSXA 1A3HA 4TUFA 4NJHA 4LV9A 2O0TA 2CXGA 3OVGA 5EMUA 4D71A 2VUYA 4GUIA 1SJDA 1LM1A 1VH7A 2WCGA 4IIGA 3MANA 1FFQA 4B92A 1X8FA 4PBFA 2TODA 3JS3A 4IIBA 3WFLA 2WCAA 3LV6A 5DX7A 1MMFA 1A3WA 1PTDA 2J7FA 3GG0A 1Y65A 5CC7A 1M1BA 1GW1A 3CBWA 4ZE5A 3LM3A 2ZX9A 2DPEA 2GJLA 3H12A 4IGHA 1WZKA 1Y5XA 2DSUA 2A2IA 2WMFA 4Q4MA 5C9RA 1T5AA 1JGMA 3SJ3A 3S2LA 3PJTA 3VM5A 1E9ZB 1FCVA 3T0CA 2ZDSA 4IIHA 2EG8A 5REQB 2UY3A 5BOEA 1B90A 3LHTA 4MMWA 4QG9A 4H8HA 1ONEA 1GK8A 2QCNA 4EWND 3DENA 5CAKA 5C55A 1ME9A 2BS9A 2Z24A 4QCEA 2A85A 2PGFA 4L5ZA 4EPBC 4PGLA 5H1WA 3EDDA 2WAGA 1TJRA 2XINA 3PSWA 1SW7A 1V02A 2W92A 2PAJA 4GC4A 3PULA 2GGHA 4G7FA 4XV0A 1BYDA 4MKSA 3IV3A 4E4UA 2BNJA 3CHVA 3UNDA 1J4EA 2PU0A 4XVDA 2XDFA 2VI0A 3G1SA 2Q8XA 2BG5A 4J3ZA 4NZCA 1UD3A 5HR6A 4QSHA 5ABFA 2FHBA 1Q6EA 1H7XA 1V93A 1NFPA 1EP3A 1VYSX 3OJGA 2C19A 5T26A 2AGTA 4F66A 1EWEA 3VFCA 1A5BA 1KGUA 3U57A 3S1WA 3EWZA 1GPWA 2IKHA 3VDAA 5PTDA 3EOOA 2QEZA 4A3HA 4JXCA 5DT7A 3WNNA 1A49A 4JIHA 3LYEA 4QISA 1YDYA 2FVMA 2G3MA 3B4UA 4PRRA 2BVYA 1AK5A 4H2CA 1W9BM 4UNKA 3L5AA 1CXKA 3INPA 3IK2A 4W89A 4RZBA 4IP4A 4ZR8A 3MU7A 3B8TA 4QAWA 4FF5A 3CMGA 2WQDA 4JY9A 1RLDA 3E2SA 1MNZA 3SSJA 1YPFA 1OM0A 5EMYA 5HNUA 3MZNA 2J6VA 3OVRA 3V5FA 3P0XA 3E0FA 3EPMA 2QGHA 1EYEA 3H2MA 5HK4A 4CNUA 2HXTA 1UH4A 3FYYA 1OGBA 3RCYA 1W1ZA 1LOLA 5TIMA 4X63A 1UKSA 3NXFA 5DEZA 2J13A 2PDLA 1ZSXA 2WSQA 5IDZA 3T81A 1E6NA 4ICCX 2W5FA 3A21A 3FEMA 3M9YA 4IMAA 4PMNA 3WJWA 4HOZA 1H63A 4KWSA 4IOTA 4O4WA 5AYBA 5AHIA 4ZOBA 1PX8A 1XLHA 2JKPA 1DJNA 1U1HA 3EA1A 5DMLA 2EO7A 5D30A 5I24A 1G4SA 5T91A 4M24A 3ZYZA 1PKLA 3ITXA 2RKXA 4LVBA 2L5HA 1V5XA 4H7CA 4TX8A 4GINA 3KFTA 5IXEA 3KHJA 3L2IA 1AQFA 3LPPA 4RPQA 2GQAA 3F4DA 2WHMA 1TV8A 1IV8A 3SCUA 2Z28A 3SSZA 2AKMA 2OO0A 3TUUA 4GIEA 4P8UA 1GQKA 2XVNA 2Y62A 2ZXQA 1ODZA 1NDZA 1EEXA 3N9KA 2GGEA 4AWEA 1CCWB 1HO1A 5F1VA 1NU5A 2VRJA 3W84A 2JGYA 2CIPA 2PDWA 2P8CA 4A8IA 4DAFA 1SR9A 5IOBA 4S3EA 4MF4A 1XD1A 2PDYA 3QZ6A 3KRUA 1H5VA 1QMLA 4AEOA 1EJWC 1GORA 3BMVA 3PR2A 1BXNA 4KIRA 3RXZA 2V8ZA 2WMIA 1QNOA 1J2BA 2J66A 3BAXA 4I9MA 1WAUA 4M6PA 4V33A 3VNMA 4JFUA 1RY8A 1TWWA 3OG2A 4QJ1A 2FZ8A 5JBFA 2PDBA 3TEVA 4NJKA 1WQ5A 3B97A 5DELA 3BJFA 3NPXA 1S38A 1VBUA 4NP7A 1XRFA 3IIVA 1W5MA 1JPDX 1CPUA 5A5WA 2HK0A 4L56A 3TMLA 1VEMA 3GUWA 3HURA 3BCFA 3TLQA 4BEUA 1MEHA 1TIWA 4AZ6A 1RQEA 3OZPA 1VHCA 1XUZA 1W1PA 1VBJA 4DO6A 4TXEA 1CB7B 4IGMA 4HU8A 3W88A 5TAOA 4WZHA 2PFHA 3BAWA 4MJZA 2PMQA 3POCA 2ACRA 1FP8A 1ISVA 4A3YA 5LGXA 3CO4A 3WQGA 4NZ5A 5G2IA 5A2BA 1E1FA 1M7PA 2Y8VA 3HM7A 1X38A 2J7GA 1PTGA 3MP5A 4KS0A 1LUCA 1S5WA 3QW4B 2H8ZA 3UXLA 1B3XA 1RUSA 5CLWA 5AC7A 1I0DA 2WPBA 2YXOA 3VC6A 4NI3A 4PR4A 3TYAA 3HV8A 4CVUA 3BAIA 4DZAA 1J93A 3MYPA 5LIWX 5BMWA 1DXIA 4DHGA 2E8YA 1GVFA 2VFIA 4H41A 4EWJA 2D1ZA 1YHTA 4NZ1A 1EKOA 1LWHA 3GIYA 4PMVA 5EMMA 1JIBA 2J27A 5LA1A 2ISFA 4FNUA 4NRSA 2WC3A 1D7FA 2XVLA 1C8XA 4CQ9A 4GABA 4MLJA 4JTHA 3OVPA 3GHRA 3PPFA 4E8GA 5CGTA 3AZSA 1CBGA 1AL8A 2G41A 3BANA 3S42A 2OODA 1IR2A 1TE6A 2JIEA 2D3LA 4FPSA 1G4TA 1JZ7A 2A21A 3MBFA 3EX3A 1JJKA 1QNVA 1QPRA 4UTHA 2RDTA 1EDTA 2Z1KA 5IM51 1I2NA 3DFQA 1NF7A 2A6NA 2R1NA 1E71M 2HE5A 3LTPA 1ZGDA 1WXYA 1REQB 4XTIA 4NJJA 1OCQA 3WIJA 1SR0A 1VPXA 1VENA 4H7VA 1QWGA 2C0AA 2HVMA 2XPKA 2Y7FA 4G7EA 4WKAA 3RPMA 5C7HA 4UQEA 3S6DA 5LGZA 4NF7A 4PL1A 2PDMA 1HTIA 1O95A 2ZZ1A 3K8MA 4E3VA 1EA0A 3S8HA 4IPLA 4ENLA 3GD6A 3KM8A 2PTYA 3V0TA 4QE4A 5JUVA 1SJAA 3S5NA 4O18A 1PYFA 2E9LA 2IQ0A 3BCDA 3UG3A 4S3JA 1Q6DA 2Z1SA 4WSHA 4LRTA 5CZTA 1IXNA 1ZALA 1DWAM 4R85A 5D2VA 2P88A 4Q8MA 2PLJA 1HN1A 3G22A 3W7OA 5D2WA 1R3QA 3ARUA 4H3DA 3KTCA 3IJ9A 1PZ3A 3VAVA 2V5LA 3GS6A 2E1DA 2WHLA 1TPFA 3WLNA 1RA5A 2O56A 5CJNA 2DVXA 1RP9A 2EHHA 2GOKA 4C65A 3DG3A 2YL8A 3I10A 2QPSA 4XWUA 5B7ZA 1V3MA 4LCQA 2GGJA 5L6UA 3FKRA 1V6YA 3M0IA 4HYRA 5U7SA 2V82A 3G1FA 4WY0A 2PDGA 4M8UA 4LS2A 4JTFA 4RZ6A 1M01A 1GVRA 4NRRA 1A0CA 2PWDA 4DPQA 1FUYA 1JG9A 2VGIA 3H53A 1A5MC 4QFUA 1OCJA 1WNOA 3H7VA 4GISA 2GWGA 1W1YA 1KLYA 4W84A 1L8PA 4LVAA 4KBXA 3W1RA 1GG0A 1NDYA 4NQ1A 2QHAA 1KBLA 2ADAA 1ODUA 2Q02A 1E4MM 2ZRVA 3IUDA 1ZAJA 3O9NA 3KL5A 3GH5A 1IXQA 2GUUA 1JYVA 1MQPA 4JTDA 3W1AA 2D69A 4KGLA 2J7BA 3HG3A 1BD0A 3WKZA 2XH7A 3H2NA 1DQWA 4WSKA 4DF1A 1E9IA 1EOKA 3AZRA 4S23A 1E9LA 4H00A 3H7RA 6PTDA 1VBRA 1YQ2A 5I6SA 4O1FA 3SQSA 1VJZA 3EEZA 4M6VA 4QITA 2A7NA 4HMCA 8A3HA 1FWNA 3BO9A 1GOIA 5FF3A 1FCUA 2YCKX 2Z2BA 2VFDA 3W7IA 3BWWA 1PSCA 3IJIA 1VCVA 1KLZA 3CQKA 4C6IA 3PJWA 2VDIA 1UYQA 4KEUA 3RO6A 1UR0A 3MUIA 2Z2AA 4PL2A 2FVLA 3DBNA 1XDLA 3DX5A 4LFYA 3IJ8A 3PNUA 3C2FA 4US6A 4W9TA 4KT2A 3OGSA 3EWCA 1CDGA 1J5SA 4WIWA 3SM0A 1QFEA 4GC3A 4IQEA 3VD3A 4JNYA 5LNWA 4P7QA 1F9CA 3KLLA 2NQHA 2WV8A 3OLEA 1RBOB 1DYSA 2OEMA 2E6YA 4S2CA 5F1UA 2GSEA 4FNTA 1TPC1 4S3KA 3MP4A 1H49A 1ZHAA 2ZDRA 3WJXA 4OKDA 3L67A 3G24A 2ZRXA 1V3HA 3VD9A 1QPQA 4JCMA 1WDQA 3PBVA 3N4AA 1L6WA 2A3EA 3LGEA 2OOFA 3D46A 4GNJA 4Y8FA 2EGZA 2OCZA 2BHUA 3VCCA 4CNNA 4U33A 1B30A 7PTDA 5C6MA 5M17A 1VFTA 3RUBL 2FZNA 5K2ZA 1T40A 3HPXA 4ZQPA 2EPLX 1VLIA 1MRAA 1Y0EA 4ORIA 5LA0A 1Q2RA 4W93A 4QP0A 1C7TA 3VOJA 1ML1A 1US2A 3LK6A 3P3BA 5BWAA 1MQQA 1H2JA 5AECA 1TUXA 2ZYFA 3QOMA 5A8NA 4I8YA 2X7WA 3RM4A 3AIEA 2OFJA 4DJEC 4ACYA 4H9YA 4W85A 2Y2WA 4YL2A 3ARPA 2WXDM 3S47A 5T8GA 4IFRA 3TC6A 3DYMA 3VABA 1SO5A 3URAA 3NQBA 1MVYA 3S5YA 3SCWA 4DJEA 5LZLA 1RP8A 3RLUA 2Q01A 1E0VA 1W3HA 3IJ7A 4JFTA 3PWIA 1PV8A 4OZOA 4YTTA 3C86A 1DTUA 3P80A 2JGQA 3KBSA 2JEPA 1HJWA 4MKVA 5CZJA 1EP2A 3TR2A 3PANA 4HOWA 1ELSA 1PDZA 2X16A 2EPMX 4Q4QA 3NQ7A 3GTNA 3NNTA 3M7WA 2F2HA 2ZFAA 3CIXA 1FWSA 2GDQA 1XCWA 4Q4PA 3VCRA 2J75A 3V4BA 1KV5A 2QUUA 3FS2A 4NJGA 2NQ5A 1UB3A 1W5QA 3IJDA 4CU6A 2FJKA 3T44A 5E70A 2GSJA 3NQ2A 4DJED 2VEGA 4I7VA 2RHGA 5FCZA 1DWJM 3BLKA 2SFPA 4R9XA 4UNIA 1R2SA 3C61A 3CWHA 2PWFA 5CGMA 5FEZA 4QQ3A 4LAOA 5DN1A 1FWFC 1AD4A 3OBAA 3WJYA 3KBJA 1E73M 1R6WA 1WDSA 4NJIA 1OF8A 4C1LA 3OODA 1UKTA 3OGRA 3LCLA 5HWNA 1Z8AA 4NNCA 3AHVA 4LGXA 2Y4SA 2ZZ7A 4O0QA 3K4WA 1Z44A 4V1XA 1OC6A 3THCA 1XDMA 5DQPA 2HBVA 4ZFMA 3MJMA 3DEQA 1BWKA 3W1UA 1I2QA 3WD3A 3DFHA 3DN5A 4JIEA 1F7BA 1TE1A 4E5TA 4G8TA 4R9OA 3GTHA 3QY7A 3W81A 1B4KA 3N73A 1D7KA 4N7QA 1QTWA 2VMFA 4DZHA 1JVNA 1CXLA 1GUVA 1S5MA 3QLLA 3NL2A 3VMPA 4YIWA 1OK6A 3W74A 3SN0A 5LIYX 1TCMA 5M03A 1RA0A 4EXBA 1X6LA 1EO5A 3TXVA 3U7VA 5HQEA 4D72A 1A0EA 3ZFHA 1P1XA 4EE9A 1AW5A 1C8QA 3TE9A 1CXEA 4FO4A 3N3TA 3UWWA 1Q7MA 4AVFA 1S5NA 3OW1A 3PAJA 1C92A 2XIIA 2QDDA 4OFCA 2VOTA 3A4XA 4R3UA 2OSYA 4XKMA 3T0BA 2DSKA 1W9UA 3EX2A 4LEFA 2VO5A 3ITCA 1KWKA 1TV2A 3W3OA 3AI0A 3HPFA 3QC0A 3I3BA 3SI9A 1HO4A 1EX5A 2DZBA 2BGSA 3PFMA 4YMZA 4Z2HA 4XAZA 1XM3A 2WVVA 3QOKA 3V5CA 5CGQA 1XINA 4QNEA 1LDCA 1BWLA 3E0VA 3COTA 3XISA 3QGVA 2GVYA 3UWVA 5CJ5A 5DO8A 3WN6A 3WY1A 5D9MA 1FHDA 2WMHA 4DJFC 4TR9A 5AC8A 4MZYA 9RUBA 4YPJA 3NPWA 1GOKA 4JYEA 3ABSA 5FIPA 3PZNA 4O1DA 1EQCA 2P3ZA 2A0NA 1K9TA 5DRIA 1ZS2A 2XGIA 1XGEA 2VFGA 2P10A 5DXXA 2C1GA 1XICA 3WLHA 1XYFA 4EF9A 4JX5A 2NV1A 1DP0A 2E6DA 3OIHA 4NKCA 2GVGA 1DJGA 3L4YA 4O52A 3DERA 3S9YA 3RMEA 1JI1A 1NQKA 2Z00A 3UR5A 2VT0A 1JDCA 3R89A 3HGRA 4C7FA 4JIRA 4Q8UA 3CT7A 3EXRA 2FH8A 4R7WA 1XH0A 4RPPA 3VXGA 3O2LA 5KEZA 5EGRA 3LPOA 1UR9A 4JYFA 1LQ2A 1W3NA 1SO4A 4U28A 3W1QA 1XLAA 3TP4A 4LUSB 4TTGA 3WD2A 1E4LA 4YHEA 4NZJA 5G4EA 3L9CA 3SFWA 1GOMA 4AX6A 1RVKA 1WV2A 4IFKB 2BASA 2QUNA 4FLQA 4G56A 1YTEA 2FZMA 1JAKA 1K3UA 4Q32A 3UG5A 1MW3A 3NOEA 3LV5A 2BTMA 5FACA 5JVLA 4G6CA 4JTEA 4HK6A 3WK3A 4C1NB 1DXEA 4G2DA 3FVMA 2PDKA 3B03A 3CC1A 4LUJA 3W25A 4UWMA 3NSMA 4L64A 3O0KA 2FHCA 2WM1A 1RBAA 4GRSA 1KRAC 3H26A 1H51A 1GHRA 4FXSA 4XIAA 3H24A 2C16A 1CLXA 3H2CA 4C6KA 3RYSA 3NM3A 1LG2A 1PIFA 4H19A 4CD4A 1LROA 4HNTA 5HWJA 3PTQA 4K38A 4UR9A 3WEOA 3AIVA 5CC6A 2E9BA 1KQYA 3HB9A 3SIZA 1VAHA 2GVLA 1D8WA 4GXMA 4KMQA 3GY1A 1PHWA 3UXKA 5A6TC 3RM8A 3UZJA 2ZZ4A 2YA0A 4BQ4A 2OWCA 2ZRZA 1O94A 3BAKA 1VIWA 3H4WA 2Q71A 1W5NA 3CASA 1MRQA 1QI0A 2ZUTA 3VKKA 2VR5A 2RH9A 3CZEA 1EGMA 2ZTKA 3KOYA 2ZRYA 3IJQA 1KRMA 2OKTA 3VA8A 1BG9A 5E1QA 2XVGA 1RCXB 2VNCA 4P7LA 3WK2A 3TYCA 4WDWA 3V36A 3VGGA 3JU2A 3VDCA 3PPHA 4U5KA 4IPPA 1XJBA 4NZ3A 2VQTA 3HA1A 4LALA 1DWFM 4YWIA 5LNRA 1DIOA 3OGVA 1G4PA 2WZIA 3QW3A 1TPWA 4HJWA 4NG3A 4S3DA 5DANA 4BK9A 3LHVA 3QQ1A 4F2TA 1V8EA 3I65A 3VD7A 4DWSA 3ITLA 3CUFA 3CPRA 1TX0A 3EX6A 4G5DA 3M0XA 1XLCA 2YCIX 1NQ6A 3BICA 4WJEA 2ZC1A 1FWDC 2AAMA 1V0NA 4KERA 2OSWA 1W1TA 4YVPA 4HA3A 5FAJA 2V63A 4AZBA 3DECA 4DB7A 3EB4A 1D9EA 1XLEA 3U2EA 1JZ6A 2E40A 3B3DA 4E2DA 3WUBA 3UCQA 4I6KA 4ZXOA 1ZUAX 3SRKA 4S38A 1XBYA 4CD8A 3CQ0A 3ZO9A 1AVAA 2I56A 2XSBA 1IT7A 4DO4A 2E09A 2W27A 3LA4A 1EUNA 3L68A 5I5RA 3LI1A 1ZAIA 3E2VA 4ZOCA 3KL0A 3WLJA 2Z7GA 1XYAA 1OFRA 4DBDA 1EP1A 3OO2A 2QKFA 4QE1A 5KMYA 1VHNA 1TREA 2RGLA 1K02A 4DUVA 1HT6A 3RITA 4PBEA 3VUSA 3W07A 5BYWA 1W3JA 4NXSA 5CSYA 3HQNA 3AU2A 3FV9A 3SBFA 3IJLA 1BXCA 3T6CA 5BU6A 1GKPA 3GDMA 4O1AA 4LAKA 1S39A 2ZX5A 5KZ6A 3VGEA 4EXAA 4QE5A 2EQDA 2XZ7A 4ICNA 1M65A 1WKDA 4BZYA 3FOKA 2CWNA 1DHKA 3S46A 3W00A 2F6UA 3MSRA 5AYZA 2GDUA 3L2LA 4H8VA 4LOCA 3M46A 3T08A 1DQXA 3U2ZA 3BAYA 4V1YA 4XZHA 1E5JA 3ME3A 5AKQA 4A22A 4AWTA 1CENA 2G4JA 3BOLA 4YYFA 2I5GA 3MCMA 2DEPA 4QDWA 5AB3A 4TIMA 1VYRA 2FTPA 3C3UA 1RK6A 2OZ0A 4P8WA 4GIRA 1OFOA 1UH2A 4Q6XA 4FS9A 4LQ1A 3OBEA 3GTFA 3W1XA 1ZJHA 2JQXA 1UC4A 3WNKA 3P14A 2AQOA 4E0CA 1XRVA 1BTCA 3LPGA 4ES4A 3CV7A 4MG4A 3B40A 4PUNA 2RJHA 3D0CA 1TPB1 5DXYA 2ON3A 2OEJA 4F4RA 4RXFA 3BXWA 3UZ5A 3PZGA 2G3JA 3VI2A 3AMDA 4QDMA 1KGWA 5EBUA 2AL1A 4KEVA 4YNGA 3GXNA 3W37A 2R1LA 3P5YA 3WBAA 1GVYA 3BE7A 1NARA 3T0AA 3GXMA 4RDVA 2QAPA 4PMQA 4A8RA 1TV3A 4ILSA 2DU2A 2DIEA 2D20A 2PTWA 4M6QA 4JEQA 1RLCL 3L12A 2ICSA 3C2VA 4AU0A 1GQIA 3NQAA 3O6CA 3H2AA 3VOFA 4PC8A 1U5VA 2QUMA 4YVXA 3P8JA 1BG4A 2VYOA 3F2CA 2V2HA 1LCOA 2WHKA 3MI3A 2QNEA 4LB3A 3WQVA 1GVOA 3O63A 1DPMA 3IJ6A 2QGYA 2V5BA 4OVXA 5RUBA 2QDGA 3WF3A 4ZSTA 4NAFA 3CZLA 1JUKA 4DWSC 1ZU8A 4IQLA 4AHQA 4GH1A 2DIJA 1KR1A 3II1A 1ISZA 1DE5A 4H4IA 4K1WA 4AVNA 3M5VA 1SPQA 3BLPX 5AYIA 3MV01 1Q6QA 5TNVA 1UD5A 3AMKA 3CU2A 5A6BA 5D37A 1CEOA 1O5XA 2YZRA 4QR6A 4FNRA 1S1PA 1IZJA 1XKJA 1UOKA 2V5CA 4ALDA 4UQ9A 5GNZA 3C3NA 5KZDA 1E70M 1EUAA 3CEUA 3UY8A 1QASA 1K03A 3UVAA 5FJOA 1FKXA 3GNPA 3DU0A 3PFRA 4M6UA 3WQ8A 1VFUA 3K46A 4LYKA 2FVKA 3W9ZA 3S1GA 1ISWA 4LBSA 5C2CA 1T41A 1EFZA 2F9RA 5ABHA 1HL2A 5F2IA 1KNWA 1FQ0A 1QO5A 4LUTA 1J6PA 3T0DA 4I6VA 1JEZA 3OHIA 4CQAA 5CBBA 3FDGA 4B4HA 3W2KA 4G1KA 4AF0A 3QGKC 3I7SA 3W2MA 1AMYA 3BURA 3TONA 1OQFA 4DAIA 1S2TA 3LZ3A 3WDPP 3KBVA 2XHYA 3TFXA 4DF2A 1K8CA 3FFSA 1HP4A 4JQ3A 2FDMA 1JYWA 1W32A 3GHTA 3S5ZA 1NEYA 2W3ZA 4WGHA 3AYSA 4AD1A 2J79A 3GVRA 1RSCA 2H6RA 4GX9A 4IXHA 1VKFA 3AISA 1WKFA 1JZ5A 4O1CA 4B9ZA 3W01A 3DIPA 2Y61A 3R4IA 4H83A 2A3AA 2GQ9A 3UYCA 2BXZA 3OLDA 3FAXA 5K7JA 2WOQA 2ZWYA 4I5RA 2PURA 4KCWA 2Y6ZA 3ITGA 4X9SA 2CC0A 1JZ4A 3SY1A 1EL3A 1C3FA 4LPCA 3FY1A 4N0RA 1Y7VA 4Q7IA 2CZ5A 2J7HA 4WOQA 4Z2GA 3TV8A 4WOZA 3TJLA 5BRBA 4AZ5A 4DWSB 3SCSA 5A2AA 1O6IA 4BF7A 1K8ZA 3G1VA 3T4WA 5KZEA 1E43A 1OJXA 5J8LA 1OT2A 4Z1AA 2YCEA 4OUEA 3WUGA 2LLEA 2ATMA 3LU2A 3L4XA 4EVZA 3KDNA 4F8XA 3QYSA 2O9TA 3WD0A 1XIFA 1G69A 3DKJA 1WO2A 4NAEA 3QM3A 4MWAE 1LOSA 3C8NA 1F74A 1YDNA 1XLKA 5HUPA 3EB3A 3KAOA 5G1TA 1LYXA 1F8MA 3UESA 1I1WA 4Y9AA 1JYNA 3MUCA 5AHFA 1UG6A 3BW4A 2ZICA 3N18A 3T9PA 3DHDA 4LBRA 3QZEA 1HKVA 2YL9A 3PPGA 2QPUA 2AOSA 4PCSA 4MJ2A 3M5YA 4HSOA 2XZ9A 3MW7A 3NDZA 4L61A 4CU8A 3V16A 3BOFA 3NJ3A 3URQA 3LSBA 4HZMA 4MUPA 1KFEA 4LBUA 1O12A 1TQJA 2FIQA 4NHVA 1XLJA 2PODA 3TOYA 3VC5A 3I6TA 4GZEA 3GXPA 1SW3A 3PZ9A 4N42A 4DO7A 2P53A 3HQPA 1R46A 1D8CA 5EKYA 4G9PA 2D0HA 6CGTA 3DFYA 2YLAA 1O5QA 2XYLA 3KXQA 2PI6A 1QOQA 3D47A 3BLOA 5EPDA 4N9DA 4XZNX 1ISXA 2DP3A 3E3HA 1BAGA 4JNMA 1TJPA 1JI2A 2PE4A 2ZE0A 3WDQA 1OFBA 5C2XA 3PUDA 4PTNA 2XTKA 4D8LA 4AMCA 4UCFA 1FX6A 1A5CA 5CC5A 1HJUA 3VMOA 4CEXC 1WDWA 3ARWA 4JHOA 2BOEX 1OZMA 5GNXA 4UTTC 2WVSA 5TD4A 5D32A 3QY8A 2QIIA 3TDFA 2J25A 3EAUA 2G4FA 1LT8A 4PCFA 3E0LA 4LC6A 4JYDA 1LRQA 2NXIA 3OZOA 4MPKA 3TYZA 5BXPA 3THUA 3NVDA 4LC8A 2ABBA 4QAIA 3GU1A 3GNXA 4MDPA 2WK2A 2WJZA 3G6LA 3PZMA 4MNKA 2HE8A 3TSBA 2PWUA 3PBMA 1B3ZA 3TROA 4QIUA 1NOUA 2PBOA 5DMNA 3WQ4A 5HBFA 4PUDA 4PUEA 1M04A 4KF1A 3ZWTA 1C9WA 2IKIA 4OBTA 4JTQA 5CPSA 3EZ4A 1XGDA 3HPZA 2GSHA 1TJ2A 4RDZA 1TV5A 3LGDA 2XIMA 2VENA 1W3KA 2GK1A 1KRBC 4H6QA 3S2CA 3EA2A 1OABA 1G6CA 4BY3A 1M7OA 1VCGA 5G1MA 3UWQA 5ABEA 3JW7A 3DBPA 4DJDA 4O13A 3I4EA 2O7SA 2XVPA 3DC0A 3LSCA 4L80A 3O6DA 4MJ4A 2A3BA 1R47A 3MA8A 1VEOA 3N19B 2WB5A 3CQHA 5AFDA 1RJPA 4O0KA 1VFLA 4DUXA 1XC4A 3ZR5A 2XH4A 2QDEA 3S4TA 1FBAA 1V03A 2DZSA 3ARYA 1E1CA 4DXXA 3QSTA 1I2OA 4I9AA 4MUZA 2OO6A 1EDQA 3GYEA 2NQLA 5ENLA 4GACA 4Q33A 5HMDA 4ADSA 4KWWA 3G5EA 3U4AA 3N2TA 4JZ5A 1WKEA 4KFPA 3UERA 4AIBA 1LBMA 1TR1A 4UTWA 1G0CA 2EPKX 4B5WA 4WDXA 2X0SA 5EFFA 4LF1A 2BVWA 3AS1A 4GK8A 3FLUA 1GQLA 3EWWA 3QHNA 1BTMA 3RX2A 1QNSA 4EOUA 4GXWA 2DQXA 3ELFA 4RNIA 1O60A 3PM6A 3GH7A 3V1HA 1LL7A 3MQTA 1V6XA 5FESA 2BY1A 3L4WA 1QOPA 3D3AA 2QJMA 4EPKA 3UGVA 1IEIA 3W7NA 1RHCA 1HG3A 5H6HA 4AHOA 2ZCGA 1MZHA 4XK2A 3N04A 2XIJA 1HGYA 3MS8A 2IQDA 5JIPA 2IXVA 2REQA 4XSLA 3JVAA 4B5VA 4QRNA 4MZ1A 4UTJA 4NI8A 3FXYA 4RDYA 1V3KA 2YBTA 8XIAA 2DT1A 4R33A 1R0MA 3SADA 2XWEA 2OWWA 5HATA 2CBUA 3KBNA 5ABFB 3GBDA 4HMDA 1OCNA 1XYZA 3O07A 3CH9A 2QCCA 3N2MA 2OTDA 4PTDA 3BGJA 1KM2A 1SM9A 5LNUA 3DXIA 1U1JA 4M1BA 3EDJA 1G1YA 2YXGA 2VEIA 4JQ1A 2XU2A 4HB7A 3Q67A 3MI2A 2ISWA 3CB8A 3Q45A 1AW1A 3C0LA 3PN8A 1W8SA 5E09A 1OC5A 4JFSA 3BLFA 3MO4A 4AB4A 3RRXA 3WLQA 4HN8A 3MUZ1 4W7WA 5J5DA 3DG7A 4XAGA 2VUNA 4PODA 5A69A 3E9AA 1UJQA 2HJPA 3MKKA 3O16A 3OP2A 4ML4A 3TW9A 3W1MA 2QCGA 4ATLA 5I3FA 4NIRA 4RNFA 8RUCA 1CGXA 1AZ2A 2VD9A 4BHYA 2PF8A 2GUYA 1JFHA 4M81A 3TW7A 2PLMA 2AAAA 1JNEA 4C6DA 2F8QA 3GDLA 3BLLA 1VEPA 4RX0A 3DHPA 3IPWA 2H90A 3VZXA 3CV1A 5FA5A 2OWXA 2UWFA 2Y5SA 3TOPA 3W2JA 4AMAA 3GR7A 1EJXC 2QUTA 1KM6A 3DGRA 3W73A 3WQ6A 3OOQA 4KEZA 2V5JA 1OC7A 4K8EA 1T7LA 4AXNA 3PF3A 3LTSA 1GWJA 1Q4NX 1UHVA 1H41A 4KH2A 4LNCA 3W76A 2UBPC 2D0GA 5FEXA 3GX9A 1EJSC 2WVUA 2F6KA 2NW0A 1MYRA 4IMEA 1XV8A 2A3CA 4IMGA 1A4LA 4AVOA 1NWRA 3UR8A 2Y5JA 3AMGA 4PUKA 1EEPA 1TELA 1XBZA 1GPFA 1KCKA 4B5NA 4YLWA 4JGDA 9CGTA 3S9ZA 1HP5A 4MPQA 2ATSA 4ASTA 4GIAA 3W1LA 3H7UA 5C9ZA 2HV5A 2EG6A 2X1SA 5BNKA 3EKGA 3VNYA 1UUMA 4F2BA 2I14A 4Z0JA 4HT3A 3WYZA 4XBSA 1L2QA 3FJ6A 1Q13A 2W67A 1SZGA 4W86A 1KFLA 3VOHA 4BWLC 4BQ5A 4KGJA 2CFFA 3B9OA 3G1RA 2W61A 5IHSA 4F40A 3RU6A 2X41A 2A6LA 2PWGA 1KFWA 1TPEA 2VJXA 4OHQA 1S3HA 2VZSA 2XM2A 6TAAA 4GGHA 1UZHA 3HOJA 5AOUA 4GJIA 5JQ9A 4IPIA 2V67A 3HZ3A 1MWOA 3WLTA 3W7KA 1H4PA 3W7CA 1Q63A 5GJPA 3B04A 1HGWA 4Y7EA 4IIEA 2TPSA 4LVFA 4K3ZA 1TZ9A 2ACUA 4B90A 4XUYA 3ARXA 1QI5A 5TBOA 1V0MA 3MO7A 3QR1A 5J04A 2W9MA 4D1IA 3ABQA 1UBSA 3L4ZA 1WZLA 1OIMA 3TNBA 3CH0A 1B31A 1H1YA 1S2VA 5IBXA 4AC7C 3T8QA 4UZUA 3O05A 4QQUA 2VC6A 3RG6A 2YX0A 4GFSA 4Z2KA 5DF0A 1ICSA 4WY0B 3VILA 4U2YA 1FH9A 1UR3M 1PL9A 4AIEA 2BOGX 2YB4A 1EB3A 3T1GA 5A6KA 3AWNA 3BCJA 2POZA 3G0UA 4LCSA 1EXBA 1CGVA 2INZA 1UH3A 4QG6A 3CUJA 4GI9A 4MFDA 2PZ0A 4JY8A 1MO0A 5D33A 2O4QA 2V9DA 2H8XA 3W0KA 4OOZA 2ZX6A 2A4AA 5KETA 1Z89A 8XIMA 1V08A 1DJQA 4UFIA 3GC5A 4Q8NA 3O6AA 4OUIA 3IIXA 3GB6A 3CTTA 4H9ZA 1KM3A 4BI6A 5IRPA 2FFIA 1CT5A 1LJYA 2Y0FA 3QV8A 1CECA 4R27A 1JQVA 4HHPA 3ZXWA 3W26A 2WNZA 2OJPA 3RCMA 1I2RA 4O28A 4PB5A 3WQEA 1J11A 1RK5A 1WDPA 4F9JA 3WNLA 2ISSA 3QFWA 2J78A 4UMBA 2G3IA 1XQKA 4AZCB 1SO3A 2D24A 4C6LA 5I79A 1X96A 3P93A 4MJMA 2QR6A 1UIPA 1BQCA 1NH6A 3QV7A 4KRTA 3WDJA 5C71A 1D2KA 1M9HA 3PPCA 4TMCA 1SMDA 2Y8UA 4J3UA 2ZADA 4HVXA 3ZJ8A 3LCXA 4W5ZA 4N2YA 3VNLA 5I06A 4GX8A 4FOUA 3A47A 1AZ1A 1SFTA 3SURA 1ITUA 1TPUA 4Q8QA 1UMLA 3B9EA 4XKYA 2CEQA 5G4WA 4N02A 3BV7A 2PDUA 4UTFA 2I9EA 4DXVA 3WQFA 2YL5A 3BZGA 2DV0A 4PE8A 4J3WA 1PTAA 5FOOA 4GY0A 3GNNA 1GW9A 3V75A 1PKNA 2HBXA 5D9PA 4PMRA 3W72A 2DGAA 1R3SA 4AH7A 1EHNA 1GOWA 4OBRA 1X6UA 1Y5WA 1OBAA 4UOQA 3BARA 5FKYA 3O1NA 3TN3A 3R11A 3LBMA 3W1TA 1ZJBA 2WZTA 4HD5A 3RM9A 2CBVA 3M47A 5C5YA 3TC7A 4UNLA 4ROPA 5I78A 3W27A 2WHJA 5CAHA 4QSFA 1IT0A 3PWAA 2Z6JA 3WCZA 4H7ZA 3VNIA 4B2DD 4YTSA 4JICA 4NNBA 3OQ8A 1OINA 3WNOA 4LNYA 1VP5A 3LPFA 4B5TA 1XL9A 1ICPA 2J74A 5D2YA 2YB1A 2Y7GA 4GQQA 1SW0A 4AG0A 1P48A 4LYRA 4AAJA 1TQXA 1K4HA 1W1VA 5D05A 1WUFA 4XAYA 3GHSA 1BVNP 4MB4A 1I9CB 1YBQB 3OZMA 5CJMA 1T0OA 5EA9A 1LBFA 3REQB 1WUEA 1JL8A 3W7HA 1SJCA 3P61A 2FMOA 1RV8A 3S6OA 1I8JA 1RY0A 1QW9A 3SRFA 1V7YA 1UMYA 2YW4A 4WJXA 3CM4A 4BR1A 5HA7A 2UZ9A 1X1OA 1GQNA 2R1PA 2WSYA 3I4KA 1RR2A 3PBYA 4RNJA 4Y9NA 2ABAA 1P0NA 2X1UA 4IGSA 3I7RA 3DYPA 3GTXA 4JN8A 3MSYA 1H50A 1XRSA 3EDEA 1JXJA 1UQYA 3CL6A 1ONRA 4B3KA 3KWSA 3SCTA 4H6KA 4H01A 2OZ8A 3N2CA 1DTNA 2FQIA 3K30A 4XAPA 3B05A 3MHUA 2G3NA 2X30A 4PCPA 1BEUA 2JEQA 2ESCA 4K7VA 2CCRA 1UP2A 2X2GA 3EWDA 1VBGA 2V6AA 2JFEX 4KESA 1OVDA 5CCZA 1TRDA 1DWGM 4GFIA 1FXQA 2XFWA 5DMYA 4HBKA 5G2WA 2BOFX 1L9WA 2AKZA 2WKJA 3BLEA 3CEPA 4A8LA 3M0VA 1R7OA 4XBKA 3G8RA 4GGBA 3W7MA 1QVBA 4O12A 4MWAA 2J7DA 1XGZA 3ORWA 4AZGA 3NTYA 2FB2A 4JKLA 3T2PA 4PB3A 3VTRA 4FMVA 1G7VA 4FSAA 4IF2A 5F4SA 3WBWA 2XIBA 3ITTA 3RPDA 2DJLA 1TVLA 2VHLA 3G2GA 2QAFA 4BCEA 2GVJA 3P7YA 2GJXA 2GUBA 4R7OA 3QR3A 2DVTA 3ZJKA 4GO8A 3KBMA 2ZTJA 1J01A 1V51A 4J28A 2NUXA 4PMDA 1VPYA 3A4WA 1TVPA 2J77A 1VRXA 2QCHA 1DKWA 1FWIC 2F84A 4AQLA 3QPYA 1TWSA 1W54A 3NQ8A 5H8PA 2VD8A 1KXHA 5A8MA 1GEQA 2IPGA 4JHZA 1TWIA 3VINA 4PSPA 4ZQOA 1S1RA 5BRPA 1GJUA 4HK5A 1UBPC 2NLIA 4GUGA 1UR8A 4RW3A 1S2WA 4ATDA 1K6AA 1BWVA 2B7NA 5L9FA 4QDPA 3DI1A 2X42A 3O0FA 4KPLA 2DT2A 3IACA 1M7JA 4Z1DA 4NAFB 4JX4A 1XLFA 2JKEA 1TMLA 4H9TA 5CBIA 1ZNNA 4NX0A 4GY7A 1YRRA 3U6WA 3VZZA 1I0BA 1TV4A 4MNLA 2Y89A 1E4NA 3PS7A 1Q6OA 4LTSA 2XJ7A 3R94A 4YHGA 2C6QA 5JIWA 2YBVA 5U4NA 7CGTA 1US0A 2YBUA 1J18A 3QHOA 3P0WA 2ACSA 5EY5A 2OGYA 1X1NA 1R3YA 2DFAA 4MY9A 1HFBA 1Z7AA 1Q3NA 3SCOA 2X1TA 1WOBA 2V2CA 1JZ3A 4RV3A 3VKJA 1F3TA 4FB7A 1YE4A 3BJSA 1K9EA 3WLLA 2RDXA 2ZA1A 3PBGA 4JTLA 1LRTA 2R1KA 4L1GA 4S3CA 1QO2A 3BSHA 1SSGA 1QPOA 1FWHC 3K8LA 3QPZA 3ABZA 1JPKA 4RR4A 1DIEA 3NWRA 4MYXA 1Q8AA 5A6BD 1CLKA 2C13A 3AIRA 3GSMA 3AXKA 4LV4A 1MEWA 1OCBA 4Q4RA 5I02A 5HANA 5D03A 3UWYA 1XXXA 4DJDD 3O3RA 1Q8JA 2HZGA 3BGGA 3S1VA 4C6NA 4I8DA 2ZZ5A 4JN6A 3UEQA 1S5VA 1J12A 1L6YA 4PTVA 3HQ1A 1X7FA 3L0GA 3P8IA 3CMFA 2G8ZA 1DXFA 4XD5A 5E0FA 4LUIA 1XSJA 1GVSA 3TZNA 2PPGA 1QI2A 1VZWA 3IIOA 1HQTA 4S3AA 2I17A 5E93A 3GIQA 1CGUA 3GNRA 4M29A 2O55A 2ZVIA 3F4WA 1ZP3A 4MLRA 3FJLA 1F61A 1V6TA 3AQUA 3LLXA 4HCHA 3L5MA 3RIKA 4A21A 3GVGA 1W1IE 1E0UA 1QWKA 3UG8A 1UKPA 4F3HA 2C8NA 1H1ZA 5BZAA 2O4MA 7REQB 4XZBA 1OFPA 2ZUUA 4Q6JA 1IGSA 1V0LA 2ALDA 3L21A 3M0ZA 2YSWA 3BPWA 3KX6A 1EGZA 4BF9A 5GVJA 4HPHA 2QULA 4AW7A 3WH9A 1HKMA 4JEJA 4CQ8A 1UD8A 4LYPA 2HISA 4DNMA 4FXFA 1ZL1A 1KWGA 3GUGA 4PMXA 3A64A 1RALA 5AZ1A 2NT1A 1POKA 4GY1A 4QLJA 2QCLA 3ZOAA 3FIGA 3LCWA 1X39A 3WFAA 1RBLA 5HOSA 5FF4A 4DO5A 4LY8A 4DBUA 3NQDA 4RV8A 1OF6A 1FOBA 5CQ1A 2GYIA 2VWTA 3P74A 1W9DM 1FHVA 1KXQA 1E56A 1JNDA 5HMEA 4CQDA 2VRQA 3EMZA 3VO0A 1HVQA 2CHNA 3CWNA 3M5ZA 3ZM8A 2VURA 3EOEA 1E0TA 2A3HA 3BSMA 1SGJA 2BODX 1DJWA 2RJGA 3PUEA 1R9YA 4B9YA 5AVNA 4DXKA 1E0WA 4DLFA 1GYMA 1S2CA 1JYXA 3N12A 2JALA 4FA3A 3MMUA 5JBDA 3QJAA 3QFEA 3I6RA 2Q6ZA 3VM7A 1OADA 2DY3A 3WUFA 1TR9A 5EMLA 5BW6A 3N9RA 3M07A 1YMYA 3VZYA 8TIMA 1NWSA 3A5FA 2Y7DA 3P81A 3CIWA 1A5AA 3KVKA 4M3PA 5AHNA 1FHLA 3AXMA 2YCLB 1OT1A 4C6OA 3PY2A 1CGWA 5JMUA 4IJBA 3QMTA 3T07A 2ZX7A 1KC7A 1Q4WA 5HJXA 3A24A 1R85A 4H9UA 3GW0A 1L6FA 1DVJA 5AC5A 3WBXA 2YCJA 3H22A 2E5BA 1UR2A 2PWEA 4CNSA 2J4GA 3ONCA 2VC5A 4WQ6A 4PUMA 5B80A 1Z6KA 3OLIA 1QUMA 3P60A 3ZSSA 2WKLA 4GYJA 3V18A 2J8GA 5GJMA 6REQB 1JZ8A 2GQ8A 1J2WA 4HQVA 3Q4DA 3UJSA 1ZB5A 4I7UA 3DGBA 3UPMA 4HYWA 4HSNA 2HK1A 2VELA 3TQ0A 3V5OA 2EPHA 3OVQA 2I16A 4BA0A 3JR2A 3QBUA 2J88A 4IQDA 1AQ0A 1PEZA 1OX4A 1TPDA 1RZMA 1AG1O 2O9OA 3EWYA 5FEPA 1KRCC 4EACA 3EWBX 3HJEA 3GDRA 1XG4A 1QRQA 3SEPA 3HTWA 3N34A 4JAWA 4UBPC 4D6GA 1DIKA 4HTYA 3SUSA 3AJXA 1F73A 3TX9A 3PC0A 2PDFA 1H7RA 2G95A 4L6HA 4GVHA 4HMEA 3TKFA 2A1YA 2HCVA 2HPIA 3PTDA 3E0IA 3FCPA 3SIMA 3FX4A 1J0JA 4FLOA 4JN7A 1BYBA 5LXEA 3ARTA 3TTOA 1LQAA 3SB0A 1ZCOA 1HKKA 2G50A 1CZ1A 2HVNA 4URIA 2D2GA 1K8XA 2F2KA 4M1RA 3FW6A 5HJYA 3CHEA 4HIBA 3UA4A 2Q3RA 1W17A 4D6JA 4CCCA 4AFYA 3TSMA 3QN3A 1FH8A 2QZRA 3QR0A 3M0MA 3NQCA 1IF2A 4MYAA 3TN6A 1QJWA 5HNNA 3TWBA 4MNJA 1P6BA 5FJJA 3E0WA 2DZPA 1KTBA 2V81A 1XPYA 1GJWA 3FGCA 2YGYA 2WZHA 3U3HA 3F1QA 1GZJA 2FJUB 4M56A 1GZ1A 4LS1A 4JD4A 1U5JA 3QLDA 3MC5A 3TCEA 3BLDA 5I3HA 3U8GA 3L65A 3L4VA 2OQLA 2D2HA 3U2CA 3OPSA 2Y1HA 3KCLA 4FI4A 2WMJA 4QS5A 2F6XA 3QTGA 1XS2A 1MW2A 4FP1A 1O1HA 3BGAA 4CN4A 2WBGA 1UKQA 2BXVA 1QNRA 3CMJA 4J40A 3M7SA 4RKAA 5HXMA 3TYDA 4D9PA 2VFEA 1AQMA 1AUSL 1NP0A 1LRNA 5HPCA 5A2CA 3CYJA 3HPAA 5KZMA 1DEDA 2D2OA 3VNZA 1D3GA 2PDHA 3FSTA 3O8AA 4J4KA 1QU4A 2WNNA 4C1KA 3T7VA 1M7XA 1TSIA 4OV4A 4ICMA 3G1YA 1Q5MA 3MSDA 1YX1A 1ECEA 4ZFCA 1SVDA 3M0JA 2VL4A 2DSZA 3C0QA 3T55A 4F0SA 4L9XA 3BLIA 3C0JA 4CEUC 4QXIA 3VX1A 4AEEA 2FFCA 1YXDA 4W7UA 2D23A 1UD4A 4TX6A 2Z6IA 1A5LC 3RK8A 5LXXA 2IS7A 4FX7A 3TCSA 4OGZA 1TZZA 3W7LA 1TPVA 1KBBA 4Y9OA 1LLOA 1R8LA 4D8AA 3QV9A 4L9ZA 3ZLGA 4AF0B 5F2GA 1Q7ZA 5FF7A 2PDXA 3S5OA 2G96A 3MUY1 1RPKA 2FGZA 5CKSA 1AJZA 1WDDA 1XSKA 1I75A 1TIMA 1Q65A 3W70A 4GBUA 4NAEB 3LLDA 3GIPA 4MGGA 4WK9A 1YTKA 2YZ5A 3F5KA 4GZIA 4OU1A 3W83A 1GEHA 1OEPA 2BVDA 1MW0A 2Z7KA 1SFSA 2WM0A 3LX9A 3WBYA 3W22A 1BKHA 1V79A 2C1IA 4US5A 4TU1A 2V68A 1JDFA 1NDVA 4KWOA 4F0LA 3F5JA 3WDIA 1X97A 4WF7A 1WYIA 1Y5VA 1FVPA 1P5BA 2QVNA 4O15A 3AUOA 1MW1A 3G1DA 1TWZA 3FYPA 3IVTA 5E6YA 2NUWA 3C2EA 4NUWA 5FJRA 1B1YA 2R8WA 1ME8A 1G9HA 3L0KA 3KZSA 1MXGA 3BC9A 1V6WA 3UY7A 4R34A 1NFGA 3GWQA 4MAZA 1JCJA 1NVMA 2YXXA 1XIMA 2GQ3A 5AC4A 3KRSA 1W31A 1TPH1 2QJNA 2YDAA 2J9ZA 2MNRA 3WG6A 1B4EA 4HK7A 5BXSA 1RQHA 4QJ5B 3IGXA 3NQ6A 3A6OA 3H2FA 1OB0A 4GYPC 3NZQA 3PVFA 4O50A 3ZVHB 1QW7A 2X09A 2X40A 3ES8A 3W1NA 1XYBA 1ADOA 2X7VA 1H7WA 5D9OA 2G37A 3PG9A 1EX1A 3M6DA 3REQA 3VDHA 4AIOA 2QDHA 3B8WA 1CWYA 1QBBA 5EYWA 3UPBA 1E0XA 1XH1A 1K9FA 1RAKA 1I60A 4O57A 2PDIA 4UQCA 1PX3A 2JE8A 5TQLA 3KVLA 4H9VA 3CPUA 5DCEA 3TA6A 4MAVA 2AGKA 1FDJA 1F05A 1ZPTA 3SJNA 2XN0A 4J2PA 5F2LA 4ADTA 1Z48A 1R87A 3MWAA 4Y6GA 4R7JA 3W6LA 1QHZA 5DCBA 3J7HA 3LXBA 3ERPA 3FHQA 2JF6A 3W7QA 4C6CA 3H2EA 4HP5A 1LL4A 2YKKA 1L0PA 3NO1A 3L2MA 3ZS4A 2ZX8A 4B4FA 1HF6A 5G2HA 3MDWA 1FXPA 5REQA 1OD8A 1RD6A 4AZCA 5IBXC 4ZVJA 1ECQA 4ZB2A 3CAQA 4DQWA 5BMXA 1W5PA 4UQDA 4YVVA 1DL3A 4OE7A 5JU6A 1BYCA 1RCOB 2QS8A 3WENA 2WJFA 1IIGA 2OYMA 3AHYA 1YXYA 4LJ3A 3VIPA 1EXPA 5K4ZA 1I2PA 2Z1XA 4X60A 1DOSA 3C5QA 3RILA 1Z41A 2EEXA 2G3FA 1WAWA 4F0MA 5BROA 2OZTA 1TJ1A 3VGBA 3K4DA 4CNTA 2PDNA 7ODCA 3UETA 1QNPA 3NZPA 4E4FA 3MMTA 1X7IA 4Q7NA 4YWSA 3I7QA 3DKLA 1J9YA 3R25A 4N9CA 3QMSA 1YKWA 1FWBC 1LOQA 1LT7A 3O06A 4GYFA 3MP3A 3A12A 1IWPA 1RPXA 4MVAA 2NSXA 4Z08A 3AIWA 3AO0A 3VUPA 4PBGA 5A6LA 5LIUX 4DLMA 1AH0A 3RNDA 3TXZA 3E1F1 4I9JA 1KO0A 4ZEPA 3QHMA 3VD5A 5DRCA 3ES7A 2FYMA 2FHFA 3BDKA 3EOLA 1JXKA 3CZGA 3GQYA 4NYUA 4EANA 1J6OA 1F76A 4BEQA 1XDJA 1Y8BA 3W6YA 1PO9A 3RDKA 3T0TA 1EZ2A 3DCPA 1WA3A 1TB3A 2Z0IA 4RW5A 3IEBA 2WSKA 3GNOA 1AD1A 3MY9A 4CGTA 1X6NA 5EMKA 2BY2A 1UWUA 3AXHA 3S1UA 2V5KA 1MQRA 3KEHA 4M5PA 3KE0A 4AD2A 2GZXA 1F5ZA 1B54A 3HGOA 4AEFA 4D1JA 3DI0A 4FK9A 3WJSA 1N8FA 3ISIX 4Q22A 2BVTA 3SO7A 1QPKA 5D38A 4L4OA 3GRIA 3KWXA 2YPIA 3GTIA 5HUOA 2ZA3A 4IUGA 3G1XA 3L4UA 3RLVA 3LRMA 2BSLA 3AZTA 1VF8A 3C56A 3W87A 2DORA 3EMCA 4UFJA 3WO8A 1H7OA 2DUAA 3UXIA 3VE7A 2Z4GA 4DX3A 4DNHA 1JCYA 1XI3A 2QIWA 4F2UA 3WLIA 2PUZA 4J5NA 3W53A 1PBGA 3SCQA 1PWLA 4A6GA 4GXPA 2QMKA 4HYVA 1JGIA 2FPTA 4REQB 4HNUA 3A9IA 1EYWA 4UTIA 3B8DA 3UA3A 3G6MA 1E5NA 4KW2A 3HN3A 4H6EA 4Y96A 1QK2A 2B4GA 5ABGA 5CPMA 3CHDA 1TA3A 3JRKA 3PZVA 4C6MA 2HS6A 3SUTA 5I07A 2PGEA 3TWAA 1XYCA 1EHAA 1EJTC 2V3DA 3LS9A 2V30A 3N4EA 1HX0A 1YYAA 3B8VA 4XISA 2QCDA 2WMIB 2VX6A 4FLRA 1UWIA 3WMLA 3W7PA 2YR1A 3KP0A 3WQCA 4L9YA 1WXZA 3H4XA 1OYCA 3GYCA 3RGTA 1U30A 5F2MA 1OYAA 4Z1CA 3W38A 2PD5A 1MDLA 2E6AA 4X22A 4ACZB 1GYNA 2W6RA 2J6XA 3DHUA 3HU7A 5FL0A 4PTXA 1UWTA 4Z42C 2PTXA 3VIOA 1EC8A 4GA8A 1WBJA 4ZO8A 2UV8G 3H55A 4X3ZA 4EX4A 1QBAA 1W2PA 4YJ5A 3M0HA 4PTWA 2Y5EA 3L4TA 4MB3A 3UFYA 1H3GA 4CLMA 3HIJA 3GE7A 4GH3A 4NASA 2BLEA 1BGAA 5H2ZA 1EPVA 3WQWA 7XIMA 4JFVA 3W2LA 4JKKA 1ZY9A 5A1AA 4L6OA 5C7VA 2XM1A 4L4MA 1XLIA 3FHAA 5CLTA 3VNDA 4BQ2A 4LEQA 2OXNA 4J2MA 4S2BA 1HL9A 1FRBA 1OZQA 4MY1A 1QR7A 5CPTA 4HPGA 2GGGA 4HU0A 1NIUA 5CG0A 1YNPA 3SN1A 3I3EA 5GPRA 2VP8A 3FEQA 2OB3A 4JIQA 5K3VA 3MCNA 1CIUA 3KCJA 1WZMA 4K68A 4WKFA 2QV4A 4S3BA 4ZO7A 4PCNA 1E6ZA 4ZSUA 1O7AA 3ARQA 2PRMA 1UP3A 2R24A 4WVXA 2R14A 2Y8KA 4RZ4A 4U31A 4GE8A 3ZVHA 1ISYA 1BRLB 1K7XA 3DFNA 2J62A 1FP9A 3DFPA 4MADA 1AA1B 3M43A 1AQHA 2ZUVA 4U5IA 2PB1A 3TIMA 4YCOA 3NQEA 4NT0A 3KOXA 1HJVA 7TAAA 1G7UA 4M7TA 6ENLA 3NGFA 4LXFA 1NSJA 2W63A 5MHBA 1EZWA 1PIIA 1HL8A 1A3XA 2ZBTA 4Z0SA 4UTTA 1PVNA 1H0GA 1IWAA 3PNZA 4RE2A 3ARVA 1ADDA 3KW3A 4L7ZA 4JQ4A 1KBJA 4UTLA 2DZXA 1UP0A 1W5OA 4MIMA 2BXYA 3T78A 4ZO9A 3KOFA 1REQA 4O53A 3HGJA 2C18A 2OR2A 3O15A 2WW5A 3AYVA 2WKGA 1KM4A 3S2MA 1B3WA 4FALA 4E4PA 3UZZA 1PPIA 1EIBA 3MJYA 3PJUA 5G1YA 1QPNA 4NY2A 3ZT7A 3EKZA 4ZBCA 1UZ4A 4HKPA 1CXHA 3DFSA 3BW2A 1QNQA 3BSGA 1XLBA 2BBFA 2CZFA 3URNA 2E5DA 1S3TC 3L66A 2VWSA 3KS5A 3U0HA 1B3OA 3CGTA 2I7GA 3W4RA 3RR1A 1Q6FA 3VIMA 4L4PA 2AL2B 5LIXX 3SUWA 3CV6A 5F7UA 3BG9A 4N9BA 4E6MA 2TRSA 3W7JA 3B8SA 3CQIA 5DT5A 3VOCA 3WF0A 3NAVA 1GG1A 1OX5A 3DFTA 1A80A 1AH3A 1GONA 1XIHA 4US5D 2ZKMX 4LAUA 2WSRA 3NYDA 3TLLA 1MFUA 4GHRA 4HPXA 2OLAA 1ZTVA 1YADA 3CJPA 2BV9A 1UUOA 1A5NC 3Q58A 4C6JA 4B15A 1ZFJA 4ZO6A 1G94A 5C8BB 3PZTA 3CUIA 4ZE4A 4UZSA 4IICA 2CLIA 2D73A 1GZGA 4JS3A 1OWQA 3IAQA 2BZNA 1GT8A 1SQ7A 3NDYA 2E3ZA 2CLOA 4JR5A 5EBAA 1MXSA 4DWDA 4F48A 3MKVA 1HNYA 3XIMA 4K8GA 3LD5A 2C15A 4Q8PA 2PBGA 3OU8A 1MEIA 1KGXA 3P82A 1M53A 4PEEA 1NM9A 4S3FA 3F2BA 2V3FA 1E6PA 2ZQ0A 4RUBA 4XZ9A 5CPLA 3RR4A 2CKRA 4R5EA 1XQLA 5DY2A 3ABXA 2A7PA 2YIHA 4NVTA 1R3TA 4MOZA 3TSDA 1L6GA 3HPSA 1W91A 3QZAA 1Z3NA 2Q3OA 1G4EA 3W29A 1JCXA 1XLMA 2E5CA 4B91A 2I5IA 5I3DA 2VEKA 3LB0A 4DYEA 3OIXA 1UASA 1EJ7L 1TTPA 4BI7A 3R1ZA 4PA8A 1CI1A 3LM7A 3LHZA 3EOSA 2GJPA 4UOZA 2B7PA 2A5HA 3S6TA 3VDGA 4GPNA 3KRBA 2W62A 1GQJA 2GWNA 4WXYA 3KP1A 3VKBA 1C93A 2CZDA 4DM1A 4EAYA 1KBIA 2ZE3A 3DOPA 3GZ3A 1POJA 1BHGA 2ZXDA 4W8AA 5CBJA 1P0KA 5GNYA 3M0KA 3FKKA 1LWIA 4L1WA 3LUTA 1UCWA 5K9DA 3TJXA 3VGDA 3VYLA 1R9XA 3RHGA 1Q2SA 1L6SA 5DBTA 4PYSA 1AW2A 5D04C 4JTSA 4AIUA 1EWDA 3WH7A 4ERAA 3KS6A 3PJXA 3QKZA 4CNPA 1F6PA 3MVIA 4MWAC 2VX4A 3ANVA 3PWGA 5A6AA 2ZVRA 4YU1A 3EB2A 1F6YA 4TV6A 1EA9C 2VXNA 4GNVA 4HPNA 1JDAA 2Q8ZA 4LCRA 2UY2A 4QS6A 4HNOA 4IIDA 3AICA 2A7RA 2Z27A 3W02A 1CXFA 3QQWA 2DZTA 1K70A 3DYOA 1PUDA 3WEMA 4IH3A 1DWHM 4PH6A 4CCZA 2QCEA 3LQLA 3CZKA 1E3XA 1XYLA 4WRHA 1JUEA 1BYAA 2XN2A 1V4YA 3N2XA 3ZLHA 4XZMX 3IIZA 1H11A 3LXAA 5CXPA 2Z26A 3D6NA 3ABRA 1M3UA 1D3HA 3UGRA 3NSNA 2W4XA 3GC4A 1KM0A 3WELA 4P7OA 4YTUA 4OECA 4HA1A 4P8VA 3HMJG 7ENLA 3H2OA 4MDOA 2YFOA 3CAWA 3THQA 3T2OA 4FX8A 1QHOA 4AYSA 1LP6A 2QF7A 2OKOA 1E6RA 1PCKA 3TC3A 3M64A 1TFVA 4J3XA 4S39A 3LCIA 3NM1A 4HNLA 1JUBA 3BVJA 4K37A 3GZAA 2RUSA 2PTDA 3BK0A 3B0PA 4ZZ9A 5FJTA 1FCQA 3N11A 3AXIA 4ZB0A 1TG7A 3WF4A 4G7EB 2BGQA 1P1MA 3FAWA 3PSVA 3E74A 4UUIA 4UB9A 2I9UA 1JDDA 2GDVA 4HN4A 3NEHA 2DW6A 3APGA 2PRLA 4BS0A 1KFKA 4UOJA 2O9PA 3EDKA 5H91A 1TTQA 4IMDA 3R5EA 4HHMA 4MTVA 3SRDA 5BXRA 3UJFA 5A94A 1NDWA 1WCGA 3IAPA 1OSEA 3FDKA 4IL0A 4ZTYA 2RAGA 3OA3A 2TAAA 4GZ7A 5E9XA 5HR7A 3WL1A 1BRLA 1GNXA 1TRIA 4LVDA 3A23A 1HW6A 1SUXA 5AYYA 1UWSA 2NWSA 3NQMA 1R2RA 2VOMA 4ZCWA 3FA5A 3LCFA 2PF0A 5FAGA 3NPVA 2HTMA 1HVXA 4IP7A 2FGLA 2GVEA 4MB5A 4D2JA 4MWAB 3E12A 3ZIZA 4AWSA 3H21A 3K2GA 5FSDC 3UJ2A 1YLVA 4LVGA 3P2VA 4M80A 2BHZA 4O1EA 2YLLA 1SZRA 3MTWA 3AIUA 3LY0A 4L6DA 4Q4KA 1J0YA 4LWWA 2CLFA 2J8FA 3WQPA 2NVCA 1LL6A 1SMAA 3NIYA 2MUCA 5IHRA 5CPQA 4GO9A 1W1B1 5LNSA 2VDGA 1R5YA 4JNZA 4GQGA 4FF7A 2WWDA 1S46A 1HKWA 4OV9A 1N55A 3T09A 2E8ZA 1XFBA 3WLRA 3NR0A 3LTYA 2V5DA 3U7BA 5XIMA 2YYUA 4IHCA 5DFAA 2VZTA 4D8ZA 1V3JA 4UR8A 5HINA 4PMUA 4UIOA 4K8HA 3VNJA 4EXQA 3MZ2A 1IEWA 4AX7A 1ZP4A 1Q6CA 4H9XA 1BLIA 3GFXA 5AY7A 1CLVA 3E6EA 1C7SA 4AC1X 4XB3A 5HAOA 5FEWA 3G3DA 3SGUA 2FPVA 4DWSD 5F4XA 4W8LA 5BOFA 3N3MA 3EOUA 3M0LA 4P61A 4KQNA 2CBJA 1NTHA 3LCHA 2Y70A 1R2TA 3UWEA 3CT2A 2YFNA 1S2AA 3ID7A 3NEVA 1UZDA 1KM5A 2G0WA 2CLKA 1Q6RA 3A4JA 2EKGA 1EDGA 3WMSA 3GK0A 2JKAA 4CVWA 1JPHA 1YDOA 4QLLA 1IEQA 2A79A 3CPGA 3QYQA 1K7FA 1NOFA 4CCEA 4D6FA 3K4AA 3GXIA 2XGBA 4PFHA 1JCNA 1IR1A 1TYGA 1P43A 3O7UA 4MNMA 3M41A 4GVGA 3QKEA 4D6CA 3C8FA 2E1WA 4X0NA 1V3LA 2P0OA 4Z2IA 3UU0A 1EO7A 1VFHA 1JPIA 2O92A 5T9BG 1JFXA 1IIHA 1XP3A 7A3HA 4K2SA 1XLDA 1QT1A 3B0VC 1W6TA 5TF0A 1IYXA 1P0EA 3A3XA 4ZODA 5F4WA 5M2FX 1O5RA 4LUSA 3EXTA 3MI6A 3TMQA 3WNMA 2XIQA 2Z29A 4BF5A 2C3ZA 3STCA 3LBCA 5IFTA 4GD0A 1KFCA 3OYZA 1QOXA 2FB3A 3PBUA 4X61A 1WDRA 1SFJA 1MDRA 3ZLFA 4DVOA 2CLMA 1FHUA 4W7VA 1KXVA 4YXGA 4CQBA 4AY7A 3H8AA 3WLPA 1IZKA 4JL2A 2VCAA 4P8XA 3UD6A 2Z25A 5C54A 4MM1A 2OG9A 4ZB5A 1QATA 1U5HA 2OZ3A 3EKLA 1LG1A 1O1ZA 2A3LA 3PB0A 4DUOA 3ZJ7A 3EMQA 1GVQA 4AY8A 2EBNA 4GQRA 2CWXA 4Q7BA 4XUGA 3S9IA 2EAWA 2E28A 4GLEA 4HU3A 1M03A 3N9SA 3HG5A 6TIMA 3HG4A 4J35A 3ZSTA 1XLGA 5FF2A 3VIHA 5I09A 3SCVA 3ITOA 1RJRA 4JTTA 3WBEA 2CLHA 3GDTA 3SGGA 2ISVA 4V27A 4I9TA 2ZIDA 2FTYA 1VC4A 3Q2DA 2EJ1A 4DI9A 2PDQA 3G1AA 1E9YB 6XIMA 1H1NA 4QEHA 3AC0A 2ZXAA 3UR7A 6XIAA 4E8DA 4A8NA 4KIEA 2C91A 4LS0A 4HA4A 4AZ7A 3RMJA 2E25A 3OB8A 1OFEA 4QJ3B 3LRKA 4PUUA 3PK7A 2B7OA 2Z2UA 3JZEA 4DRSA 4E2VA 4IISA 3R6IA 3FYOA 2PS2A 1T8QA 1AH4A 2QV5A 2VGGA 3CLWA 3GG8A 2D3NA 4WD0A 2WLZA 4AZHA 4GYPA 2HNHA 2P8BA 3V35A 4IGNA 1A0DA 3GAKA 4GQ0A 1OHLA 1YW1A 2GOUA 4XTDA 2DZAA 6REQA 1JD9A 4V15A 1XCXA 1EH9A 1Z32X 2OLHA 4HJFA 1YDVA 2PWHA 2OOGA 3NFUA 4FAMA 2Z1WA 4E2OA 1JCLA 1YNQA 3WMBA 1WB0A 4JIIX 2E77A 5GQBA 1IGWA 3FJNA 4CQCA 4DJFA 2OMAA 1XWYA 1CXIA 4J3VA 1DBTA 3NQFA 4MSSA 4JTCA 2BGNE 4IX0A 2R91A 3TVAA 1C8VA 2PP0A 5M1TA 2QMJA 1E40A 4IT1A 2ISDA 3M5XA 4H6RA 4ACZA 1YPIA 3JUGA 4YS1A 4JTJA 4ROQA 1RXOB 4Q8VA 5AYXA 5I3KA 3VOGA 2JK2A 1RVGA 2YA1A 2ZWZA 2VFFA 4IPNB 4PN2A 3L0NA 2BY0A 1V6VA 4A3QA 3EEGA 1B57A 4A3RA 2VRKA 3JZUA 3DZ1A 3K1DA 4UFKA 4C5YA 4TQTA 5CZKA 2ZUWA 2BWGA 1ENUA 2BMBA 2ZA2A 4X2RA 4H8NA 2YL6A 2CLEA 3CHCA 4O11A 2V3EA 1F8IA 2Y24A 4UMAA 1A4MA 1EGVA 5EL1A 1D3CA 3EGJA 3L7RA 4OWGA 4U3AA 4GNKB 4FR6A 3WLMA 1QI4A 1VFSA 3SW6A 3GVWA 5I77A 3MCOA 1U2YA 3GDBA 3AALA 1W3LA 1TTIA 4Y2WA 1A5SA 2QW5A 3VIKA 4HNNA 2VQUA 3KBWA 1GHSA 1DORA 3ARZA 1V6UA 3MUXA 4FOJA 5G5IA 4TX9A 2JIWA 2WNQA 2OQYA 2XSAA 3BZJA 3QMRA 2B7QA 1K6WA 3AHZA 1WZAA 1N8IA 4JL1A 3VGHA 3H6OA 3B0YA 2QJGA 4DJFD 2GGIA 4J3SA 5G4HC 3ARRA 3UF9A 5I3IA 5FI8A 1E72M 3PTKA 2NQZA 3VIJA 2PC8A 4DZIA 1VJSA 1PX4A 2X05A 1JQXA 4PMZA 4RK8A 3BMXA 3B9DA 2FDSA 3UVIA 1ZJIA 3V0UA 1YNYA 4V2XA 1BVZA 1J0HA 2B0MA 3F4NA 3WF2A 2WWCA 3VMNA 3SDOA 3B9NA 5ECVA 2XFRA 2IXUA 2X0YA 3YPIA 2CXEA 3KRZA 1HKJA 1PIGA 5D9NA 1ESWA 3NZ1A 3OEXA 1AL7A 4WCJA 4IPJA 1UD6A 2E68A 2X0HA 2P3EA 1J0ZA 4POCA 1I45A 3NCOA 1GOXA 2BX7A 4WJ8A 4DN1A 1V3IA 3R10A 1YE6A 3SUVA 3GG1A 3C2OA 5KITA 1O5KA 1QAPA 1FCBA 4HTBA 1FY6A