5AZ2L

Crystal structure of the fab fragment of 9e5, a murine monoclonal antibody specific for human epiregulin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
b'DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLHPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-human epiregulin antibody 9E5 Fab heavy chain
molecule tags Immune system
publication title Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES
pubmed doi rcsb
total genus 54
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5az2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5az2L01
4LSUH 5JORB 1CQYA 2AJUH 2OTWA 3BWAA 1QHPA 1T1WB 2HJKA 2BVUA 3VXSB 3DWTA 2CDEA 3JWOL 5T1KB 3IDNB 2D4FA 4NJ9L 1K8DB 5BZWB 4IRJA 3CMOL 1E4KC 4F57H 5DJCB 3SGKA 5HGAB 2ZUTA 3A67L 3BIKB 3L3HB 4P23D 3KWWA 5EFIB 3UXFA 4XC3H 1C5BH 4DKFL 1IAIM 5CFHA 3UYRL 5JW3L 3VFPA 1GPOL 5C0BD 4I18A 1CU4L 3DV4A 1RULL 3QIBC 2EDJA 3BD3A 5HJ3B 4GLRH 1A4KB 5GGSA 4NQCB 1XF4A 2XNAB 1T1XB 2Q1EA 1P4BL 4XGZA 1F58H 4TQEH 2ZP0T 4EIZC 4ZDHB 1I9RH 4A2LA 4XCEA 5D72L 1A6VH 1NAMH 1IQWH 4V2BA 5D7SH 5DC0A 5EB9A 5LCVH 3I3BA 5F1IA 1RPQA 4JG1L 3ZLQC 1RZFL 4S2SB 1CVSC 4D9RD 3WNMA 2G2RB 5D9SB 2BNQD 1K4DA 3GJEB 4X8JB 4Z7UF 4E41E 3QUZC 2P49B 3V0AC 5DUMH 3P30H 3QUZA 1QSFB 5TQ0L 1KGCE 4XI5D 3ZYZA 3VRLF 5ITFA 2VDOL 2DAVA 1P7QB 4DFHA 5JR1L 4U1IA 1T7ZA 1IGYB 1NSNH 2XA8L 3GDBA 3S34H 4NJAH 3FFCB 2OLDA 3BUYB 3VGEA 3QQ3B 4FQQB 2I07A 1I3RA 5DUPH 3S96A 2HRLA 4PG2A 5DJDA 3ZZ1A 3G6JB 3O4OC 4UDUB 5IUSA 1FORH 1EO8L 3NIFF 5HHPB 4OCWH 3PWPE 3MACL 3HZYA 2NXZD 4H88L 3V6ZA 5D96C 1WGOA 4TPRL 2R23A 1IBGL 1ES0A 4PJ7A 1HQ4B 3THMH 2YPLA 3O6FD 3GBML 5HDOA 5C0EA 4F9PA 1J1XH 3S3PA 4D9LL 3CFCL 2RGSA 3VD4A 1Z2KA 5CZXD 4DVRH 3VD7A 1P2CB 1J8HE 2FZ3B 1BEYL 3BJLA 4OV5B 1F2QA 3O41B 2MQCA 2PNDA 1PJ9A 5EU6B 5IB5B 2NTFB 4Y2DA 2VERN 3G6JF 1I8LA 5EBLA 5IIEA 3BZEA 3BHBB 3B6SA 3U79A 1B0WA 2Q8BL 3SKMA 1ZEAH 4ZS6D 2MJWA 4FXKA 1WCQA 2AVGA 1RZIA 5ICXB 4N8VB 1I9IL 3AXLB 5FECA 2EO1A 1DUYB 3QUYA 3W5NA 4J3VA 1KXVC 3T4YB 2DBJA 2Z31D 2F54A 2IFGA 1WITA 5C0ND 3U9PH 1I7ZB 3MR9A 4D2NA 4ODVH 3T04D 1A1OB 1BFOB 2GYSA 3HC0B 5EUOF 5IHBA 3TGXA 4XPFL 3ULSB 3QRGL 1HQRA 4LPWA 1XH3A 3A6CH 3OKDA 1AY1L 2Y36H 1SEQH 3TO4A 1N8ZA 5JW4Q 4NHCH 2EDQA 3IDGB 1J88A 1CFSB 2KDGA 3G6JA 4PJAB 4QOKE 1E6JL 3RNQA 4BM7A 1RUKH 1WC7A 2I60H 3FN0L 3QFDB 4PYHA 1IM9B 3MRQA 3VDAA 3QPQC 2WM0A 2ICWB 4G9FB 5CP3A 2X4PA 3GJFB 3G5VB 4J12A 1A7OH 1WZKA 3UTQB 5EBMA 2J1KA 3NH7L 2GAZB 1LP9E 4GW1B 3S4SB 3PE9A 3QDGA 1N6UA 5DEGA 2W92A 5C3TA 1DBBL 2UWEE 3VE0B 3OKEA 2DTML 5DRWA 1FORL 5EIIA 4J8RA 4EBQH 3DX7B 1IBGH 5MEND 1ZLVK 3P4MB 2BRRL 5F1OB 1FL3B 5I73C 3LH2L 2BOCB 1OGAA 4BFBD 5IFJB 5MEOA 3TCLB 3KPOA 3CDYA 4AEIH 3F7VB 3V8OA 4I3RL 4MA3A 5IHUL 4GMSH 2X40A 3ARRA 4U31A 2F74B 4A6YL 4OBRA 3WFBH 4UV4H 4ETQB 4B7IA 2V7NA 1NEZB 1EAPA 2IQAA 5FM8A 5CSZB 3VWKC 4UAOC 3EOBB 3QG6A 1AXTL 1EZVX 4AIXA 5AG9A 3CU1A 3RNQB 1NBVL 5ISZE 1RUMH 4OZFA 4O2FB 5F3HB 4LHJB 4MLIA 1IM3B 4RAHA 2X4PB 3GJFA 3WS6A 4G42B 2A1WL 2R4RL 5CEXB 5DJ8B 3HG1A 1WBZB 1BF2A 2Z35B 2FEDC 3PGFH 2IAMC 3OAUH 4NQUA 3L5HA 2V5SA 2EDLA 3AM8C 4NWUL 4XH2B 5DD6A 3PP4L 3QPXL 1OAYL 3CK0H 1LO3L 2AK1H 5F89A 1X3DA 3JUZA 3E2HB 3HUJB 2UWEB 2Y36L 4M62H 3O3UN 5E5MB 4IRSD 1EAJA 4FQXA 4BSWA 4LMQI 5J9PB 4E41B 4JFFB 2F54D 2E6PA 3JV5A 4WHTA 3UJIH 2BXYA 4N90E 4UV7L 1WV7T 4OZGA 2E7CA 2WWMD 4NYLA 1QSFE 4YDLC 2BRQA 3V4UL 5D1XA 4M61A 5CP3H 1WFTA 2ZKHL 2Z93B 1A7QL 4AMKH 1OP9A 4ZOBA 2H32H 1S7SA 3BIBX 3HMXL 5IVXF 5HDBF 2NX5E 3SKNA 4K7PH 4MCYA 4XXCC 2BDNH 3H9SE 4QF1B 3SKUD 1ROWA 1OARL 2JJSA 3EYQC 1YEIL 1P1ZA 4G9DA 1P4IL 4R7NB 3MCKB 4UT7H 3O3BA 1UACL 4YFEA 5JUEL 5AYQA 3EDDA 4IDJH 4POUB 4LVEA 2E7LC 5HVFB 4X6CA 1OF2A 5GS0D 1J10A 1HH9A 1KBGH 5C0AA 3WNKA 3SBWA 2A6IA 5E08H 1G9MH 2QQKH 4I3GA 1JP5A 1AJ7H 4PRPD 4P5TC 2DMCA 4N0RA 5DHVH 4JM2B 4G42A 3CGTA 1AGFA 2D9CA 1QPXA 4OM0H 2XZQL 2J5LB 2H2SC 5HY9B 4KHTL 4F7EA 4ZXBA 4XZUB 1KCRL 1OAZL 5GZOD 2JCCE 2IQ9H 2XRAL 2J88H 1ZLVH 5C2BH 4WIQA 4M8QA 5HYJA 1DQLH 1FL5B 4NJAL 1FN4A 2ESVB 2HWZL 4X6DF 1T83C 3MOAH 5DJ2A 3T1FA 5C8JB 4LEXL 2UZIL 2RJMA 3QEUA 2DB8A 4XP1H 5F1NB 3O9WC 3OPZL 5HJ3A 2KZWA 4KZDH 1HZHL 5ITFB 5GSVA 3LMJL 4LASL 4YBHA 1U91B 3KYMA 4LSQL 3ZE2E 1G9NH 4JG0L 3Q1SL 2DKMA 3MACH 3P4OB 4HZAA 2W0FB 3VI4F 1LILA 5K9JH 1CFQA 5D4QA 2FJFB 3LB6D 1I7UA 1CVRA 3QJFA 4XBGA 1HN1A 4O51B 3T3PE 3ZKQD 5C0FB 5IBLC 1UEYA 1MFEH 3QFJE 1IGTB 4ZYKA 4JDVB 5F6IB 1FYTA 4HUMB 1M7IA 2J3SA 4J1UA 2AS5M 1ZOXA 1QSFD 4M6NL 2A0LD 3LPGA 5EWIL 5GGTH 2CDFA 2FX9H 2NMSA 4ELME 4L4VB 5E4EB 1V7MH 1OAKL 5BMFH 2AEQH 4B53A 2IANB 1KGCD 2R56L 5IG7A 1E4XH 1DCLA 4OZGF 2D0GA 1BD2D 4XNMA 1IILE 4LSDA 3MLZH 5DURB 3ZSSA 4ZFGL 1A1NA 5D1XC 2CLRA 4LNVA 2KQMA 4RMSA 3BVNB 5C6TH 2HKHL 3H9YA 5MERA 4ZUUB 4N5EC 2P7TA 1I4FB 5BZDA 4BQ9A 5DQ9A 4J2XA 1TVHA 2ZCLH 3EO0B 4NO0A 1MEXH 3O45A 3KYMB 4OQTH 5FFLA 1TPXB 3HR6A 4WW2B 2XPGA 2EDWA 4WJ5B 4L5FL 1EXUA 2NLJB 3IVKA 4HBCH 1RFDL 3RPIA 2BVYA 5AUMA 3U46B 1H8OA 3ZE0E 4AG4H 4G8GB 1PLGH 1U8LB 1F4XH 4WV1C 1A3LH 4X6CF 4P5TD 2ZCKL 2Q3AA 1Q1JH 5DHYA 2BSRA 4Y1AD 5F7UA 1W72A 4HS8L 4X98B 4QCIA 2HG5A 4HFUL 4ELMF 1TLKA 4QTIH 5J56B 1U92B 4NHUB 2AKRA 3ARBB 5FUCE 3H3KA 4PJGA 1VENA 1L7TL 3OAZK 1NMBL 2BK8A 3ALPA 3FB6B 1IAII 4JRYB 2R1XB 2GK0A 4QRUB 1UZ6E 2NNAA 4NNYA 2DJSA 3SJVA 4FABH 2H2SD 5F9DC 3SDAC 2BOBB 1Z0MA 2R4SL 4NN7C 1ZT7B 4E0RA 3VXPB 4XVSH 3OKYA 2AJUL 4YDJA 1K6QH 2DQIH 4ODHL 1VACA 4U1LA 4XH2A 2XPGB 2VR5A 2PW1A 3F5WA 1JI1A 4MD0A 4Z8FH 5I75C 1N3NB 3QEGH 4NCC1 5F3BA 5INDA 4B5EA 1ORQB 1NDGA 3C87A 3C5ZC 4CU7A 4IRSC 5E8PA 3R8QA 2NY3C 2QL1A 1GGIL 5EU3A 2VZVA 1RI8A 4I0PC 4IRZH 2A6IB 1A9BA 4RDQG 2AEQL 5FYLL 4EOWH 3Q6GL 2WWMC 3V4PL 2EZ0D 2R8SL 3U36A 3VXOA 3UYRH 1CDIA 2VLJD 4AM0A 5E6IA 3O6KH 3VI3E 4G7YL 4WI3A 4C4KO 1LK2B 4BQ8A 3H9SB 2WP3O 3G04B 3MTRA 4M5ZH 3O3DB 3HPLA 4WY7L 4NO5B 4CN1A 4XAKE 5FOJA 5BVPH 1G6RL 3WXWL 1QZ1A 2WIIB 4PJBE 5KSBB 3K4ZA 3ARGA 4M3JA 1M1SA 5A3ID 5MEOB 5F7NC 4ZUSA 3SJVD 1OCWH 1HHIA 1JFQL 1MIEH 1ZSDA 2VLRA 5HD8D 1CGUA 3S98A 3STBA 1BZ7A 3KPPB 1MF2L 3IAQA 1S9XA 5DRWB 1CFQB 2HTLD 4PGCA 4DUWA 4KJQD 3ESVF 4I18B 5DGRA 3PWJB 4LKCA 5D2NB 1VFOA 4NM8H 5CZKA 5IEKB 4NBZB 2LFGA 4HCRA 2XN9A 1KN4H 1BM3L 3HI1B 4FTVB 2KQNA 3S88L 3H7BA 4OGXH 2DM7A 4HH9A 5DJCA 4Y1AA 4S1DC 5TF1H 2FHFA 3D0LB 4LOUC 1FG9C 2BVOA 1CBVL 4QOKA 4C56D 2ZOLA 4DKEL 3ZKSD 5CBEB 2E9WA 1MPAL 1OSZA 3HE6A 1UWXK 2W9LA 3QZWA 1UB5A 1WSST 4F33B 4OF8A 12E8H 1X5YA 2QV2A 4O2EB 3QAZB 3DXAA 5IB3B 4Z7VE 1MAJA 3OKNB 3RBGA 2EE3A 1P4IH 4YHIB 3WJJA 1EHNA 2QHLA 3DARA 3MLXL 1MFAL 1RURH 5DHVB 4H20H 2FO4A 4MB5A 4IJ3B 2AERT 1KBGL 3L5JA 1NC4D 3W0WA 1HHJA 3CLEL 1S8DB 4PY7B 4WHTB 5TGBA 1HH6A 4XNZB 1DBJH 4PB0H 4G6AD 3VXQA 4HMEA 1TTGA 1MRDH 4NZTH 3MRBA 3LIZL 4PJDF 4OM0L 5E6IC 3VH8A 4YXLL 1JZ3A 3FMGL 4LHUB 2BC4A 4PJHB 3HE7A 1QLEL 5CJBA 2PTVA 2ID5A 2WANA 3MOAL 1YEKH 5M94B 3UTSB 2CDFB 2J8OA 4LSSH 2A6DB 1JPTH 4WV1B 1QFUL 1TJHH 1XH3B 1CI5A 1P1ZB 4G9DB 5EIQA 4P99A 4IS6B 3N0PB 4JPVH 4KKCD 5D1XB 2YN3A 2H2PC 5ALCH 1AXIB 5DGQA 3GRWL 5CWSA 3F6LA 4MNQD 3CNKA 2C1OA 3LY6A 4KTDL 3TPKA 4PJEF 3VMNA 2W0PA 4HQQH 1FDLH 3PV6B 3QH3B 4Y4FC 2EZ0C 5I8EB 4RA0C 1NC4A 1BOGB 1KT2A 4WTZA 1OAUL 3MNVA 4LSVH 3MV8D 3DECA 3T77B 2W9EL 2NW3A 3FZUD 1TVBB 2EC9U 4ZO7A 1YC8A 3MMEB 3QUMB 3W11C 1LEGB 1B4JL 4UZGA 4PJFF 4WO4B 1INQA 4Z7NE 2HH0L 1BLNA 2OP4H 3IFLL 1KC5L 2KZ1B 3G5ZA 4PJCB 1OGTB 3UPRB 5FYJL 3C5SB 5C07E 3ULVE 1G7IB 3JTTB 3IXTB 1JPGB 4NWTL 3D9AH 3FFDB 3P4MA 4CJ1A 4I48B 3E3QE 2IWGA 4EI5B 3RY5A 1AKJB 2CQVA 3QUXC 1IKNA 1RZ7L 1OAQH 4WHDA 4YGVA 1AGFB 1YEGL 4PRPA 3U2SA 2D31B 4N5UA 4GJTB 1WVZA 2R23B 3ARBC 4P3DB 4WV1A 3LS5L 3TNNB 2ZUXA 4EUPA 3IB4A 1RZIB 1D9KD 3GO1H 4FMKA 5BRZE 5D8JL 4QRRE 3KYKH 5C7XL 2V7NB 3U9UB 3E8UH 4IOIA 5LCVL 5C9JA 3FTGB 1U41A 4O9HL 3VFMA 1B0RA 3RZCD 4UV4L 1A6VL 1IAMA 1AGBA 5D6DA 2IEPA 4KKAD 3WLBA 5HDLA 4WU5A 4IMKC 5HI5C 1KB5A 3B2VH 2VMFA 4MA1B 3UTQA 5LQBL 3GSVA 1YEEL 3VI4E 5J13B 5DS8A 5L88L 1UWXH 3MUGB 4L8SB 5JW5B 3L3KA 4YHOL 3VA6A 4TUOB 5F6HI 4NRXA 4ZUVB 2X7LB 4Q6IC 5JPMB 5CCKL 3ULVD 3BZDA 3VXTB 1HKLL 4LF3A 3WO3B 4LCYB 1Q9LB 1SYSB 1XF2B 4MAYB 4ZOCA 4I0PB 4NOFA 5H35B 2ATKA 1FL3A 1X5GA 3QEHA 4LSSL 1H3XA 1GC1H 5IBUB 3HE7D 1LO4H 1A9BB 3BPLC 4HHAA 1WIOA 3VFGH 3JWNC 4YUEH 1AKJA 2DQUH 3WEXB 3BESR 2CMRH 2DQFB 4MB4A 3BP7A 2AI0H 2CIIA 1CICD 1FDLL 1CXLA 1CFVL 3TN0A 3GSRB 1E6JH 4OGXL 3K8LA 5J06A 2VQTA 4GS7B 1I1FB 2ADIA 3WCYA 2JB6A 1HINH 4MQTB 4K9EH 4JFXB 3TV3H 5L0QB 2OK0L 5I17A 1SJHA 1UKQA 2NXZC 3VFVA 1P4LA 2PTTB 2HMID 1NGZA 5HYQA 3TC9A 4JHAH 1KLUB 1U93B 3MRNA 4ODSL 4YHNB 3DUSB 4QHUA 3LSOA 4NRZA 4E5XB 3BO8B 4LCIL 1JZ7A 3PUCA 2DTMH 4Z78B 3RWJB 1YN6A 4X7SH 5FM5M 2OXGA 5JNYA 3C8HA 3BN9C 4N0YL 4OKVB 1E4WL 4BELD 1U95B 5L2KA 1I8KA 3MJ9L 1U92A 1YJDH 1G9EA 1RQ5A 1KB9J 4F7MA 1SJXA 4YWGH 4LQFL 3MGAA 3RWFB 3BYYA 2FB4L 5EA0H 2D7TL 1W8NA 1MVFA 2XY1A 4DZBA 4MNGA 4ZFOB 4M48H 1KJMA 2FBOJ 3H7BB 3TBVA 2D7QA 2DL2A 3DX9B 3DX6A 4FQIL 4YHLL 2I27N 2R69H 3MNZA 3CXDH 5KVEL 2CIKA 3B5TA 3F7YB 3JVGA 4UTAL 5GRJH 3RDTC 1A0QL 3HR5B 3L5IA 1KTDB 1TZHA 3LD8C 1P6AB 4HC1A 1Z5LB 4P9HC 1MHPH 2WV3A 2IGFL 3IDMB 1RZJL 1KTLB 3U82B 2MKLC 3PV6A 4BK4A 3ARGB 5BV7H 4XNXH 4X5XA 4N0CC 4DCQA 1MI5A 3QIWB 4LEOB 1SY6L 5LGJB 1MWAB 1OP5K 5KVDH 1DQLL 4NKOB 2IPUG 4JREB 3HZMB 4XNMB 1LE5A 1NCUA 3MRKA 2FIKA 4NSKB 4ZS6C 3VFWA 5JOPE 5HHVL 2FX8H 3AU1A 5KSAA 3TO4D 4X9GA 1ORQA 4PREA 1XR8B 3R06B 1TTUA 5HYSA 2OTWB 3BWAB 4P59H 5GSRA 5FCUH 2C7UA 3VWJD 3EO1A 4K8RH 3NCJH 4UB0L 3MBEB 1MCSA 1HEZB 4CMHB 4MSWA 3RTQB 1MJUL 1HQRB 3IFLH 4Y8DC 3T0VA 3G5XB 4PJEB 4F37F 4ZTOL 4GFTB 4WI2A 1TVHB 3BGFB 4ZAKD 3L3HA 4HIEB 4AM0B 5DJ0A 2F5BH 3OKOA 2BSSB 3UTTD 2OI9C 1J11A 4HMDA 1IC7L 2IPTL 4X99B 3W39B 4M7ZC 3OX8B 8FABA 4PJ5A 2YBRB 5F7DA 4IM8A 1OARH 2YK1L 3ZKNC 4KFZC 3STLA 1PYWA 3D39B 2IMNA 4RAVB 5EBGA 1C5DA 3Q5OA 4FTVD 4KI5D 5TJWK 2VLJE 4M7JH 1J0ZA 1L9MA 4MJIB 1JIBA 5JIKA 1KCLA 4DGIH 3GI8L 5D7JA 2DLIA 3LN4B 3U7WL 4QT5A 1Y6NR 1RVFL 2DTSA 3MQIA 1QEWA 4EVNB 1NUFA 4NHUA 1IVLA 1EGJA 4UILL 3FO9A 1WBYA 2OJZL 2HFGL 4HF5L 3U46A 4X9HA 4HXAL 1NAML 3BEWA 3IXAB 4OJFL 4X7TA 5I73B 4PJ9A 1P5UA 3NA9L 5TE6L 3MYZA 1UEMA 1EDQA 3PHSA 4YJZL 3ZDXF 1WTGT 3EYSL 3IDYC 1KN2H 4BQCA 4Y4KC 3TBYA 4X9BA 2VIRA 4QHNA 4RGOL 1I1FA 2ADIB 3VG0L 1LO4L 2I07B 2P8MA 3VG9B 1MCWM 1AR1D 4PJEE 4B7LA 3RKDC 3IU4L 4TSCL 4U6XA 4LHUD 1FZJA 1YPZF 2YD1A 5GRUL 4BJLA 1L7TH 4NNYB 3CCHA 2I9TA 4L4VA 2F58H 1CDUA 5EOQH 3WFZA 3PWUB 4RFEA 3MLTB 3C2SA 4I0CC 4NRYA 2VOTA 4PV8A 3X3GH 5ID0A 4LKXB 5D1XD 1I7UB 3OWEA 4PJDE 3UTZB 4KVCH 4XVJH 3BN3B 3DUHA 1ERNA 3MJ9H 2Y7QA 3GUTA 5I1GL 2BVTA 5EUOB 4R4ND 5C07D 1IC5L 4K7PY 5BZWA 4ZUSB 3MRMA 1M71A 1M7IB 2QSTA 1C7TA 1NLBL 4N8CH 4UAOB 4ZDHA 3QUMH 3U0TB 3DYOA 3FT2A 3MNZB 3MRCB 3EOTL 3E3QC 5J11C 4L1HA 3ETBF 2RFXB 2ICWI 3TBYB 1AQKH 5IMKA 4BZYA 4OTXH 3X13B 4K9EC 3RFZC 2VE6B 4NO2B 1UM4L 4JRXB 2D9QB 4UTAH 5JIPA 4MXQC 3L5WA 2J88L 5MEQB 4JRYA 4MA7H 2V6HA 4XBPA 1JNHA 3MFFA 2XTJE 5MERB 1LO0L 1CT8A 2X9XA 4OFYA 1RUQL 4Y16B 3OPZH 3V6FA 3WXVL 2O5XL 1LGVA 3O11B 4ODBD 5HHMD 4RGNC 4UILH 2IMMA 4JO1L 5KZCB 3NN8B 2ZUQC 1BX2B 3HAEB 1HHKB 1FNSL 4ZXBD 2X89D 2XQYK 3CFKB 3REVB 3MCLH 1FFOA 5B3JF 3RVXC 2VABB 4OUUA 2P45B 4POZD 4PRHA 2P1YA 5E2JA 5J3HD 1N64H 3R06A 4C56B 3GJFK 4RBPH 2CR6A 4A2MA 1YMHB 5GJTL 3ECBB 3IAPA 3KPOB 5C0AD 4JFZL 2QSQA 4PRBA 4IDLA 5JIHA 1XZ0B 1T03H 4GBXA 4I4WB 5KW9H 1F90H 4LIQL 4AENB 2UV3A 4JFOB 3C6LC 4JQVA 5E2UH 2FR4B 4YHPB 1RHHA 1VCAA 1JGDA 4MNGE 5JO5B 1BP3B 3HMXH 3MRIA 5IVZA 1V3MA 3JV4A 4W6WB 4P46C 4ELKB 5IVXE 1U8NA 3HMWL 1NMCB 3ARVA 3C60A 1KIQA 4C55A 2FWOA 3AS2A 4K23L 2JKXA 3AB0C 1YEIH 5A2FA 4XTRD 2AXGB 4FHBD 1R5IB 2C1PA 1MFCH 3MBXL 2IPUK 4NBYB 4HJGB 2MSPA 3K80A 3HE7B 3O9WD 4N90D 1AQDB 2JTDA 5DRNA 2DOCA 3DMMC 5GGVH 2YD2A 4X6EB 5BS0E 4BSWB 5J9PA 4U6VH 1I7RA 2CIIB 2F5AH 4GSDL 2F53D 1KFAL 1MJJB 1A3RH 1X5FA 2DQEL 2DIJA 5DTFA 1Q9KA 4G8IA 3OR6A 1EBPA 1RIHL 2HTKC 4KVNL 5MP6L 4OIIH 3FB7B 2R1WA 4KPHL 2ARJA 4NQSA 4NN6C 2UWEA 5IBTL 1DLHA 1GJIA 2PO6C 2P42B 2XIDA 4BK5A 5DD3H 3BX7C 4MJ6A 4P2OD 4LCCA 4WFEE 4JFHE 4N9GB 5DJ6B 2ZCHH 1ZAGA 3N50A 2E9JA 4M5YL 3UAJC 4CVUA 5ICXA 5JDSA 3SJVE 1NBVH 4NNPL 5CGMA 1TJGL 2XA8H 3GSWB 5D7KE 4ZUWB 4JGMA 1S7QB 1X4YA 4G8EA 4LRIC 1OP3H 5KSVB 4C58B 4WVRA 4FZ8L 3CZFB 3GKWL 3IJHA 1AY1H 3U0PB 1DANU 2VZ3A 1EA9C 2F9BT 3F65A 3QIWA 4HUWA 1D6VL 4KXZI 4Z0XA 1E4KA 2ZSWA 1U8MA 4JO2H 3TP4A 4U1GC 3VXRE 5DRZB 4JGJA 2PN5A 1IMHC 4LLMB 4YIQB 1JV5B 3BYTA 4JANB 5F7HA 4WWKD 3MRIB 1FZKB 1YMME 3U9UA 3MJ6A 5FF6A 4QHLB 2DQTL 4NN5C 1S9WA 1KXQE 5LKNA 3ARZA 1RIVL 3C5ZA 3V52L 1UZ8B 3NPSB 3MRHA 1UXSA 4MHHG 2NYYC 3ZKND 1BQHB 4Z0XB 2Q8AH 2V2WA 5DJXA 4PJGF 1FNFA 3S4SA 3WBDA 5INCB 2PXYA 1IKFH 1F3RB 1I75A 3L3OA 2VZ1A 4NQVB 3W5MA 1TITA 2X89A 2EICA 4GOSA 3L6FA 3WD5H 3H3BC 4ODTL 4OZ4B 3B8SA 2GFBA 4K3JH 5D2LB 4GRLC 5L2JA 4GMSL 3L95B 4L8BA 3MRFB 1JHTA 4OFYD 4CBPA 5D1ZA 4QXUH 1H15A 4XBPB 4YBLC 1WWBX 4FFVC 2NW3B 3SGDI 4NQTA 5IMOB 1JNLH 3QUZD 1FNGB 1MHCB 3OHXA 4YXLH 4JFYB 1TJIL 2WQRA 1U42A 3WXWH 1FVEA 5DI8B 4LBEB 3RWDA 4I0PD 5EUOE 4WY7H 4ODVL 1NAKH 4X9FA 5C71A 4ZS7H 2JJTA 5C08B 4Y1AE 4PD4J 1I1RA 5E56A 3TN0D 4Y4FD 3NIFE 4D3CL 4OCXH 1FNSH 4R0LB 5TF0A 3P11H 1DSFL 3NCCB 3JV6A 1YNTA 2UWEF 2COQA 3LKNB 5GS3A 2UYLA 5T1DL 1T6WA 2OX5A 1WIUA 3QPXH 4AENA 5BQ7A 1CD0A 1JRHI 4ONFL 2NPLX 3GM8A 4L4JA 1UADC 1D5ZB 1FGVH 4OCWL 2VYRE 1AC6A 1Q8MA 1A7OL 3RVTD 3IF1B 1GGCH 4Y4KD 4P23A 4M93C 5DT1L 1F90L 4YHZL 1Z3GH 2VISA 1RY7B 1SM3H 1D5XB 4OLEA 4MVBC 3VGBA 2R39A 2MHAA 1CTNA 1S7UB 3HC4H 4GAGL 4C59B 3VRJB 5MHSD 2CDGB 3ARSA 1BAFH 4XCFL 4YXHL 2AJVH 3BRDA 2XWBA 4FQCL 3RY4A 5C9JB 2R0WH 3RY6A 4Q2ZA 4ONHB 1RURL 1JMZA 2RB8A 4YDIH 2P46B 1P7KA 4U1MA 1KFAH 4HS6B 2Q8BH 1MUJA 1ODAA 4XC3L 4P4KA 1CWVA 4U6VL 4ODHH 1XF3A 3E8UL 5AD0B 3CZJA 2WW8A 4Y0GA 3GO1L 3LEXB 5IJVA 4MA7L 1QRNA 3PL6D 3ULVH 4PRIB 5J7CC 4FQ1L 1AI1L 3MYJA 4HCRH 4IRZL 3QCUL 2B4CH 2O5XH 5IP4A 3VD9A 3S37L 3BQUA 5FUOH 3BISA 4U6TA 4XVTH 3VD3A 4HV8B 1A6UL 4H0GA 3IKCB 5FYKH 3FRPG 3TZVD 2YOCA 1EFQA 2HN7A 1T83A 2VZSA 1ZHLB 1TDQA 4HJ0C 5E0QA 4PRAA 1K2DB 3PABA 4NO3B 1F8TL 3OJDA 4P5KB 5D2NC 1NAMB 4HUUB 4XI5C 1AD9A 1PKQA 4BH7A 3ABZA 3GI9H 5DWUL 1IC4H 5I2IA 4ENED 5FXCH 4GQ9H 2NX5D 3MRGA 3MRRA 4JZJA 5CIPH 1GHFH 1E6OL 1OB1B 2NW2B 4LKXA 4KJWD 1JGUL 3TCXA 1RJYB 1JGLH 3KPQB 4O58H 1AD0B 5I8CA 3B9AA 5IW6B 4C4KT 4ZAKA 3S34L 2HJKB 2H32A 4P2QB 1ZTXH 1RU9L 4WFHD 1UC6A 2DBLL 2C7UB 3DHJA 2UUDH 4QRTB 4XTRC 3NZ8B 1MJ8L 5FB8A 2A9NH 4Q9RH 5D7JB 3KR3L 5MHSE 4ZNEE 4JVUA 1ZT7A 5HGAA 2EKSA 5A3IC 1FCGA 2ZSVA 1GOFA 2YSSB 2O5YH 3V5KB 3VFPB 4CDGC 1BX2A 2JJSC 3DMMA 2VC2L 2Y6SC 3FOMB 4KQ3H 4GRMA 1RJYA 4YO0A 4F58L 1J18A 4R26H 5SWSE 3ELAT 4U6YA 3OG4B 4WFFE 5EO9A 3QEGL 4MGXA 4JN2A 5JXAH 5TPWL 3LKPB 4Z7NF 1KPUB 5DUBA 1HXYB 1PG7W 3U36B 2PKDA 4LGPB 4XP4H 1KENH 2XKNA 4X6FB 3EYOB 1BWMA 3BQUC 4Z7OE 1LO5A 5ILTL 5KVFL 5F6HJ 3SE3C 3MUZ1 4QOKD 3FFCD 1KIRA 4C56A 5L7XH 3P9MB 3C9NB 2IANE 4PJ9D 2HFTA 4N8PA 1AI1H 4UINH 5I66B 3CLFH 5DHYB 2W65B 1CIUA 5E1AB 3EYUH 2XN9D 3NIDF 4R0LC 3FFCA 1B3JA 3EBAA 35C8L 1OB1A 2NW2A 3C09B 2NY1B 1RZJH 3I84A 3HI6H 3GB7A 3ARDA 1RZGA 1QPPA 4XRCB 1DEEB 1IKNC 2VAAB 2OZ4A 3QJHA 4GRMB 4YO0B 4O4YL 5TDPB 4QY8A 3SDXF 3LKRB 2QJDA 1XGRA 4M6OH 1AFVH 1C5DB 4AEFA 1T89C 4LGRB 4PPTA 4UU9A 5IOPA 3FAWA 2XACC 5C0JB 5ICZA 4P59L 2R9HC 5FKPB 3TYFB 3MLWH 3MRCA 4LVOB 4XWGL 3T4AB 3DVGA 4X99A 4H88H 3FO1A 4RMRA 1BF8A 1PQZA 2WQ8A 3H9SA 4Q6IB 5AAWA 1E0OB 4OB5H 4UDTA 3T0WA 4K3EH 4GG8B 1VFAB 1CICA 2GK0B 4F15B 2FSEA 3INUH 2EDHA 4ENEC 1JF1A 2IH1B 4QGTA 1BQSA 3BPLB 4NQDE 4KY1H 3SDXB 2RCSL 3LPWA 3OJMB 4HWEH 1XIWD 4YDIL 5EU5B 3ROOB 5IEHA 5JPNA 3CFJA 5C0BB 4G5ZL 5DDHB 2RFXA 3SE8H 5ACLA 3QXDB 4WFHE 2QR0B 4AEHL 1R24A 3HNVL 4QHKJ 2CXGA 3FO2B 1MAMH 3TN0C 1H0DA 1D5XA 1B2WH 2BX5A 2Z4QB 3MLVL 4ACPA 2D03L 3HFMH 4KWUA 5EU7E 3T3ME 3T65A 3V79C 2AK4E 1G7PB 4HKZB 5EO0B 1KCSH 1TQCB 4RISL 1X5KA 4MCZB 1FZKA 3JTSB 1IL1B 1QG3A 5J1AA 3JWDH 2EXYC 2H8PB 3I50L 3QO1A 1FL6A 1B90A 2BJMH 4H1LH 1GZQA 1FFPA 2DKSA 3G5VA 2FGWL 5F96L 5MENB 1T3FA 3OAUL 5K59F 2C4FT 3GEWB 1BIIA 2Y07L 4LHQB 5CEYA 4R2GC 4MDIB 2FX8L 2FDBP 4MMXC 1YZZA 3D69A 2EH7L 4XCNB 3WNOA 2A9NL 1RZKH 5I6XB 5BV7B 4PJBB 1PD6A 5D7JC 2AP2A 1IARB 1J5OL 1LO3H 2AK1L 3QDMB 3IETA 1RU9H 4ORGB 1NFKA 7CGTA 3MZGB 1CQKA 2X4NB 5IFHL 5J6GA 3DNKA 1A14H 1QFHA 1FSKB 2B0SL 2R0LL 4K3DH 1WCBA 1DLHB 2N7BA 5HPOA 2X1OA 2P7TB 3TV3L 4HGKC 1OOAA 4CVXA 3EJJX 3RVWD 3QIWC 2UYLB 4LDEB 3NGBB 4GKNB 1A7QH 5ISZB 1KF9B 4Z7WF 2NY5L 3G5YA 2AEIT 5TPWH 3V0VB 3FB5A 5HDBE 4FQ1H 2GSGB 3I02B 5E70A 1B0GA 1QSEE 4M3KB 5BO1L 2R69L 1M05A 3L3JB 3FRUB 1B0RB 5F88B 3KPNA 5FUOL 3CLEH 1HCVA 3NTCL 4QRTA 4GUPA 2OJEA 4XPHL 3UBXI 5SWZA 3V5DA 2Z35A 1A6PA 2X4TB 4MA3B 5E8NB 2OR9L 4OCXL 4Y4FA 1QBML 3IFPA 5K9KA 3W39A 4JPIB 4JM4H 4L9LB 2F54B 1BVZA 2UY6A 4I0PA 2GJ6A 3IXTA 2DQJH 3SOBL 2BHYA 4U3HA 4LCYA 3RX5A 5EZJA 5TH2B 3G9VA 5DA4A 3ZDYE 4D9RE 4YGVB 1KIPA 3DPBA 4MHHI 1IM3A 2OJEB 3VJ6B 3QDME 4DZ8A 4JJHA 4X4ZA 2F74A 4UTBL 4OZFH 3S88H 4E41A 1D9KA 3MLPA 3BE1L 4U1HB 1AO7E 1UB6A 1NCCL 1EAPB 2IQAB 1MH5B 5D93C 3G5ZB 4ZFFA 5KS9E 4KK9C 5HGBA 1I3UA 3C8DA 2Q7YA 4OD2A 3LN5A 5FGCE 1TXKA 1T66D 3CVIH 3V9FA 1H15B 4E9LA 1IJ9A 2P43B 3MRFA 3Q2CA 3UTTE 4F7TA 4P4KD 5C09A 1CGXA 1AR1C 1JUFB 4PJ8B 3OR7A 1RAMA 2G60H 1WBZA 2ZKHH 3T2NH 2V2XB 3MLXH 1EO8H 1KJVA 5K9OB 2ZJSL 2LQRA 2NZ9D 1CF8L 3H0TB 5I1KH 3RHWF 4NYLB 3PGCA 3O3BB 4JHAL 3RQ3A 4WUUD 4BYHA 3JV0A 4OD2B 5EN2B 4PJAA 5IK3B 5A2LH 3VU2A 3O3AB 3TCLA 1DN2A 4OIBA 1AGDA 4HD9A 3TBVB 5E95B 4CNIA 3RWIA 1WZMA 5FO8A 3F7RA 2JJTC 3SKJH 1T1ZA 4MNQA 3AVEA 2ESVE 3DVIA 5FO7A 5KSUB 4PRDA 3TN0B 5CJXC 3IGAB 2K9UA 4TVPH 4DTGH 4ZAKC 3PF2A 1NEUA 4J6RL 4NQDB 1S7XB 3D87B 3V4VH 1XIWA 5J1AB 3ZL4L 1S9WB 5KN5B 5IT2H 3HB3C 2Q7YB 4O2FA 4FA8A 5H35A 3HFML 3U0PA 4GRLA 3S4SG 1DBMH 4M43H 1ZHKA 5D7SL 3IDNA 5TE4L 5IHLB 2GTZA 3U0TA 2JELL 4LLMA 2CKBA 4LK4A 4JM4L 3L3KB 2J4WL 4U49A 4JZNB 3TNMB 2AXFA 1FV1A 3DVNB 1BQHG 3LAFA 4UQ3B 5TQ0H 3ES6A 1Q72H 4FG6C 5J11B 3U83A 3CFJB 1NMAH 1IGML 1UB5B 4JDTL 3W0WD 3QRGH 3LRGA 4K07A 5AWNL 1RUAH 2ZNWA 4PGBA 4F7CB 4ZPVA 5I71C 3HG1D 1H3PL 2VKWA 1BBJB 1CE1H 5ACZB 1Q72L 2EE6A 2NNAB 4NT6B 3OKNA 3MFFB 4PJ9B 1C12B 5GS1A 4E42B 1R3KA 4X6DA 4XWOC 4NQXA 1A14L 3JZ7A 3T65B 3X3FH 3SDAB 4U7KA 2AAVA 1NFDF 4P46D 5EU6E 1MCEA 2JE8A 3CPLA 2HKFH 3JTSA 3TJEH 2ADGA 5DC9B 3GSNL 3C6LD 4YHKL 3GK8L 4QRQA 5JORA 2HFEA 1O7SA 3MLYH 4H1LA 1E27B 4LRIA 1XGRB 4MJ4A 1UXSB 2A74A 2JJUA 4U6HA 1OGAD 4PGDB 3RA7L 2LAAA 2V7HB 3ZO0A 4X6BA 2E8YA 1QFWL 2GUOA 5FCSH 4MD4A 4WJ5A 5DDHA 1YNLH 3V0WH 1U2HA 4L4TB 5CHNB 3CVHB 3OKLA 5J6HB 5ANME 5I16B 3D2UD 2PO6D 5GGSY 4PTTB 1UKSA 3F58H 5IEKA 5FGSA 4HPYL 3F7PC 2SEBB 3DO7B 1NKRA 5EOCH 1WBXB 4JKMA 2HG5B 3BH9B 4N0UB 4JRYD 3KAAA 1FQ9C 5CD5D 1YEDB 2XXMB 5E6ID 4Q6YA 2VIRB 4QHNB 2NXYC 1YEKL 4PJCA 1X6NA 4JN1H 4Y4HD 1UYWL 2XTJD 5ICYB 3UJTL 3IDGA 4JQIH 2FECL 1II4E 2X42A 4YX2L 3RPIB 2PUQT 3QXDA 5EBWB 3VFRB 3I75B 1LK3H 1I3GL 2NTFA 1G7HB 4HFUH 4OLXL 4OFPA 1QSFA 4P2QA 3MRMB 4OD3L 1RJLA 1RZKL 4FOMA 4JN2B 4XX1E 1VPOH 5EO9B 3MA7A 2NY4D 2WLYA 2XA3A 1MHHA 4FFZH 3UBXB 3EFDL 1DVFB 4QCIB 1KEGH 1WT5A 1XT5A 1G1YA 1VACB 4XNQB 3BP4A 4JFQA 3FRPA 3VXUE 3BRFA 1C1EH 2DQCH 3DMMB 3K3QA 3QNZB 4KY1L 5SV4A 4K3GA 1R24B 3H3PL 4F2MA 2CKBL 1HILA 1MRFH 2VR9A 5EUOA 3MXVL 5J3HC 3UJJL 1KUMA 3U0WH 1T04B 3JWDC 4OB5L 2HKHH 3CFEA 3FT2B 2FLRT 2BFVH 5GZOC 5IMLB 1GGIH 4MDIA 1PW3A 4G8FA 1G7LB 1LK2A 3GI8H 4PG9B 1H3WM 3ZKMD 3QEQA 1SYVA 4DKAA 4O51A 1FL6B 4OZHB 4GBXD 4HMCA 4ZUTB 2CXKA 5IF0A 1ZKAA 1W0YT 1QNZH 2YRPA 3D25B 1ND0B 3C9NA 3GIVA 5DJAB 1I4FA 4WHCA 4AIZB 4WUKL 1YYML 5C0GA 5CINL 2B5IC 1T04A 4HBCL 2DICA 2XYCA 3CMGA 5EC2B 5IB2A 2A77H 2BY1A 2AXJA 3QCVL 2QQNH 4GAFB 2YUXA 3EOYG 4Y16D 2YD6A 4RIRA 2VAAA 4W6YB 1FNLA 4NQCA 1VESA 2R0KH 4ZUTA 4MA8H 3MA9L 5GISL 3GMOA 3NZ8A 3O6LH 4HH9B 2W91A 3H42L 5DMGC 4XP9H 1LEKA 1GYAA 5A43C 4HWZB 1LEIA 5EZOL 4CVWA 4R8WL 1RK0A 3OJDB 4RFNC 4ODUA 1BD2A 1F6AA 3EDKA 3PG2A 1CXFA 2HJFB 3MV8E 3V5KA 4Z7UA 3ARBD 3NPSC 3BKYL 4WO4C 4Y4HB 5I76B 1OP3K 4GW4B 1ADQL 43C9A 4TSCH 4FFZL 2D0HA 4OLUH 5T3XL 4MNQE 4K7FA 5I1IH 1G9NL 2YRLA 3EZ8A 3PL6C 5T1KD 4IRSA 1A6TA 4KH2A 2Z4QA 1S7RA 2ZJSH 3WO4C 2ORBL 1MJ7H 3RIAK 2YK1H 5HI5D 4P9HL 5I18H 1IAKB 3RX7A 4QF1A 4APQC 3MLYL 1YEJH 3TO4C 3V95A 5AG8A 1G9MC 3UTOA 1FVDA 5SX4I 5DFTA 4PJ8C 4QXUL 4Y4HA 4PV8B 5ID0B 5MI0C 3VFOB 2DQDL 4J4PD 4OZHA 5TDPA 1QSVA 4PJ9C 4WHYG 4BUGA 3GSQA 4I13B 4NT6A 3LQAH 1QFWM 3QG7L 4QHKI 4KAQH 1KENL 1K8DA 2YEZB 4KROB 1LWRA 3MLUH 1S7UA 2VDRL 4Y88A 5EZLA 3IJYB 1AP2A 1FJ1A 1ZA6A 3ZTJG 1ACYH 1IAOB 4ZO9A 1Q94B 5IWLC 2IBZX 4UIMA 1EHLH 3GHEL 4KK6C 3D85A 3TVMB 3WFEL 4JFDA 3JWOC 4KK8C 4QXWA 3RGVD 3ROLA 1CXIA 1XR8A 2CO6B 5BS0A 1JWUA 2ENYA 3SDDC 4RZCA 4G7VL 1M4KA 2QSCL 3ZMRA 1OVZA 4H8WL 3WFHA 3VG0H 3QEQD 1DN0A 3M8OL 1KIUA 1GGBL 3QUXA 3QHFL 4MD4B 3KPRE 4Q9RL 4WI4A 1KCVH 1HSAB 4OKVA 3NCJL 4F7CA 2HYMA 5J6HA 3GMLB 1V7NH 4X9IA 3GFUA 3BVNA 3I9GL 2Z91A 3L3DA 1AGDB 2PF6A 3NFSH 1FVCA 2NXZB 3O2DL 2OL3B 4NGHH 5BJTB 2V2WB 3V7AG 1V3JA 2Q86A 1JTTA 3RZCB 1TVBA 1FO0A 2WZPD 2K7QA 1KPRB 4FQPA 4C56E 3F6IA 1MCPL 3S5LA 1WAAF 1FRGH 4YZFF 5IESL 3UTTA 2I5YL 3P77A 4HG4J 2B0SH 3PHOA 5EU4A 2E6JA 1KB5H 4I5BB 3D0VB 1ZK9A 3SKJL 1EJOL 3IF1A 1S7SB 1IC1A 1G6RB 4YHIA 4QGYA 5CEZH 1T80A 1YMMA 1D5MA 1T6VN 4KI5F 3QCUH 4PGJA 4PLNC 2ZSWB 5HHQB 2GAZA 5F7WC 3DO3A 5HI4C 4X7FC 3GSVB 2MHAB 2CIKB 2X4UB 4XT1C 1A2YA 1N6VA 4U1HA 1S7WB 3MRPA 4KRMB 4PP2A 5L9DH 4NC1C 1OSZB 1CDGA 1UA6H 3SDYH 3EOAB 2B5IB 1LE5B 4YGAB 3MRBB 1OTUC 3MRLA 4P23B 5FYJE 4TSBH 1DDHB 2OL3L 3MV9D 3OG6B 3QEUB 4HBQA 4JN1L 2BVQA 3O9WA 5E99L 1VKXB 2XICA 4M7KH 3I6KA 3BZFB 5D7IF 3QIBA 4K71B 3DI2B 4TUJB 3BDYL 1HYRC 1N59B 1QO3A 4N5ED 2F8VA 4LFHD 5EPMB 4PRIA 1A6AB 2XN9E 4ZXBC 3RUGF 5FA3B 3LQAC 3DTXA 3H0TA 4Y7MA 4LARL 4XXDB 3DRQB 3HLAB 2E7BA 5KSVA 1MY5A 4ZFFB 1DR9A 5HYQB 3SBWC 1CGSH 1WISA 5C09D 2GSIA 1MCOH 1FVCB 1V05A 1UZ8A 2Q3ZA 3B9DA 4LPCA 2X6MA 4LARH 2VZTA 3SO3B 3O8XC 4I2XA 2ADFH 4U1KA 5MENA 1U8HB 3MBEC 4S1QH 4JFDD 1JYWA 4WGVB 3X12A 4XCYA 4LLVB 3OHXB 2DI9A 4X4YA 5FA3A 1F4AA 1A9EA 3GRWA 4WFFD 1UH3A 3QB7C 3HA0A 1X5JA 1ITBB 5TDNB 1CZ8H 3UYOD 3MV8B 2PYEB 3CFCH 3HAEH 4W4OA 5M95B 3PWVA 3KYOB 3AY4A 5ALBL 2NQCA 4YWGL 2V5MA 2Y25A 3RIFK 1OAXL 5C6PB 2NY3D 2QLVB 2VN7A 4QEGA 1T0NA 1JZ6A 3BIAX 1UVQB 1WZ1H 5T1LA 1YN7A 4I77L 2JB6B 1U8JB 3MCKA 4I8DA 1DUZA 5KSAC 2P5EE 1PEWA 1VA9A 5I15H 5IM7A 1ZVSA 4RGND 3I02A 4EN3D 3WLBB 4LRNL 5I19H 4IRSB 4OCYH 1YDPB 3GSOB 3RKDD 4MCYB 4ZTPH 1EEYA 3OL2A 4ONGH 3HC3H 1MCKA 2R0KL 1NAKL 1QSZA 3QUYD 5FGBA 3WN5C 4KTDH 1FVEB 5DI8A 4ZOEA 1F6LL 3DYPA 3NCFB 4JFEB 4NKIL 1FYTE 2AKRB 3ARBA 4WEMB 3MLTA 1CL7H 1C5CL 5LGKA 1D5ZA 4P0DA 4WFGE 3KPPA 5JQ6H 1J8KA 1ZXQA 2BNRB 3QPQD 1MLBA 1K5NA 5B8CA 2K3TA 2EDXA 3FT4A 3OF6D 2YN5A 4WW1B 1WJ3A 4LVOC 1OCWL 3GSOA 3JV6B 4ONFH 4CUCA 1X9QA 1KC5H 4U0RC 4L8CB 2Z31B 3VWKA 1XCTA 3RZCA 4WENB 5EC1A 3D0LA 4YQXL 2D3VA 4OBSA 4NPYA 2HP4A 1RUAL 2ZNXA 3RZCC 1RMFH 1BFTA 4G6KL 1KJ2H 1CGTA 1CYGA 1NL0L 1X44A 3QO1B 4WI8A 4LIQH 4PJXA 5DMYA 4BZ2H 5GZNC 4U3CA 1MPAH 4OV5A 1HOCA 1K4CA 2FNBA 5JW3H 5I1KL 5HTSA 5KG9A 2ED7A 3SGKC 1GOGA 5E1AA 1IAKA 1NCWL 1YPZA 1MCWW 3KLHC 1LQSR 1DQJA 1HHIB 1J0KA 3S8WA 1IM9D 2ZUSA 3S36H 3WO4B 2PO6B 3CH1B 3RVUC 3DGGA 4NKDA 1XGUB 5IBTH 4R7DA 1YEGH 5IJKA 2D03H 5D7JD 5EIVA 3MRLB 1NLDH 1G7MA 3DV4B 1MFAH 1KEMH 2X05A 3V6OC 3SCMC 5JXAL 1R5WB 4ALAL 3WFEH 6CGTA 5GXBB 4J1UB 4FTVA 4JM2D 5IGXH 3QI9D 5KSBA 3DGCR 2GJ6D 1BIHA 5DO2D 1KACB 3L3IB 3LHPH 1MWAH 4C83B 1PG7X 4PJ5D 4PJIF 3VRIA 4PD4K 2KKQA 1JPFA 3OKDB 3NGBC 4OT1L 5KJRL 4JY5H 4OGYH 2F19H 1RUPH 5I76A 1JGVL 3M8OH 2CUMA 4HUXB 4KUCD 5FYKL 1CD9B 3WXVH 4M7LL 1J1OH 2IBBA 4AK1A 4KKCC 4PJ7E 1SMOA 4XPTL 2VXTL 3GSXB 2ARWA 3MCLL 2QTEA 1XF4B 2XNAA 3WIFA 2R2HB 5JMOC 3QUYC 4W68A 5C0DA 3CVIL 4IMKA 3WFCL 2YA0A 4LFHG 4X6EA 5FV1L 3RP1A 5HDQH 1AE6L 1S7WA 3CUPA 3QQ3A 1EXUB 5I9QC 3VXQB 1Q94A 2QKIB 1F5WA 5EOQL 4LMQE 3CMOH 3OJVC 4JCMA 5CZXC 4EDWH 4IRJD 3EHBC 1K6QL 2AEPH 3UTZA 2XN9B 2EXYD 1A64A 3FFCE 4ZTOH 3DI3B 5DJAA 1D3CA 5F7EL 4RMUA 1W72L 3OKKA 3DJ9A 4OLYL 2YPVL 1RIUH 5HHOD 3PIQB 1BPVA 1F00I 2BVPA 4JRXE 4QLRA 4Z8FL 1SVCP 1FPTH 4F9PC 4YBLB 3MJ9A 3BW9A 2BSTB 3NAAH 1D7FA 2YPVH 4N1EA 5D7IE 4P9HH 3L5XL 5GRVL 4JFFD 2FIKB 4NSKA 4OGZA 4GW5A 1RJZA 1V7ML 4NZRH 4KZEH 2QR0A 3P3YA 4L3EE 5ELIA 2VB5A 4QRUA 5DK0B 4N0YH 3RTQD 4HG4K 4HFWA 5L8LB 3UZEA 2B1AH 2F5AL 3HZKA 4JFHD 4PBVC 1R3HA 5ICZB 1CU4H 2HJLB 4P5TA 5JIIA 2DMKA 5C0GB 1LE9B 3VXRD 1QQDA 2DLGA 3P2TA 4BFIB 1INDH 5GZND 3RVWC 4X6FA 4XNQA 2VDMH 4RMQA 4MCZA 5B8CC 4OLZL 1OLZA 3LHPL 4M1GH 2QKIA 4PFEA 1BFSA 3EFFA 2VLRD 4XRCA 3BEVA 1A1NB 1KG0A 4GG8A 3QO0B 2AV7B 5CINH 3BRGC 2P5WB 2YR3A 5IQ9B 5GHWH 4XC1L 1YMHA 2WIIA 4OLZH 3VFSB 4AIOA 1I8IB 2F19L 4JFDE 3HPJB 3ZE2F 4HLJA 1MCIA 5JHLH 3IFNL 3SKOB 5I1LA 4Y5YB 3CUPB 5DD0L 3BFOA 4FABL 3KNBB 2M2DA 3O0RL 2VDLL 3WNLA 5JW4R 2A83A 1TNMA 3QXUA 2A0LC 3KPSD 2H26B 2Y07H 1YUHA 2DS4A 1DQTA 2H1PH 4XB7A 1XF3B 5F3HA 3OKKB 3GIVB 4F7PB 3HCVB 1EEQA 3LKQB 3EJYC 1QBAA 4KJWC 3KG5A 2HMIC 2P8PA 3GHBL 1XGQA 1IT9H 3QQ9C 3QR2A 4U1SA 4W4OC 3AGVA 4G9FE 4TUOA 1MREH 1NCWH 3BPOB 5IB4B 1N7MH 4JPKL 1RIVH 5IB1B 5F44A 3V5HB 3Q6GH 4BKLA 2J2ZA 3UJJH 4GW5B 1I1CA 1WZ1L 2YPKA 3ZT6A 5JLZB 4M6NH 3HZVA 1BAFL 1AQKL 3IJSB 4XCFH 3QFJD 2HT4D 4DOHB 4OLWH 1FIGH 4ZSOB 4TTDC 4B50A 5CD3B 4HLZH 3SJVB 3T3PF 1YNLL 3SQOH 4YC2C 4NOBA 4K3JL 1AD9B 1PKQB 4LGSB 5LWYH 2IAMD 2V2XA 4MQSB 4OZFG 2X7LA 2P5WE 5LXGH 3B2UD 5MEPA 1JJUA 4NUGL 2CSPA 1NUGA 1AHWC 5C6WH 4JVPA 3QP3A 2CLVB 3N1FC 2Q87A 3WHXB 2A83B 2P24B 3DV6A 3WDIA 4OZGE 1ZLSH 3UMTA 3H9HB 2ICWA 4LCUB 5F1NA 4LP4A 3K7UA 2FBJL 2L0DA 1C5CH 3SGEI 2FD6H 1INDL 2APFA 5J12C 4ODXA 3ZL4H 5AWNH 2LVEA 3TH3T 1CGWA 5CGTA 5T33H 2B7DT 3H6JA 3O4LB 4HIIA 4LSQH 1MJ8H 2MFNA 2FH6A 2DM4A 1SYSA 2BP3A 4OSUL 4URTB 3MROB 4PJIB 1QFOA 3CFDA 2PYEA 1MUJB 1NC4B 3GMRA 4KHXH 4HJJL 2O93L 3UZVB 1IGCL 4PJEA 5E1HB 5I74B 5C0AE 4LSPL 3L3OB 1NEZA 3EO9H 4PJFB 1MFDL 4HKXA 3BSZL 4XPAH 1JBJA 4K8RL 1BVLB 3KLAA 4TSAL 3GSXA 4H8WC 2EEBA 4BQBA 1CTOA 4RFOH 3UTSD 3B9VA 3H7LA 1OW0A 2DLHA 1I1AA 2HFFB 2AJVL 4XP6L 1BFVH 2YD9A 2D0FA 2WLZA 3SE4A 3V7AE 4GKNA 3IGAA 3MV9B 3BP4B 3HKFA 3MLRL 3RIAF 1EJOH 4KK6D 4OZGB 1CK0H 5ETUB 5IKCB 2D7PA 1JNNH 3IU3B 3LN9A 4OT1H 4ZPVB 5C09E 4GAJH 2X2YA 5HGGS 1HDMA 1OF2B 3K1KC 4WCYH 3ARFC 1A7RH 3MROA 1JWMB 4UIKH 2BVQB 2HN7B 1R3KB 3O9WB 4J6RH 4S0TD 1VKXA 2EECA 1Y6MR 4FNLH 3HNTL 2AGJL 5DJXB 5CUSH 1OAYH 1DL7H 4NFCA 3RUGE 3B8YA 2ADJB 2HTLC 4Y5XC 2IBZY 3GSUA 4RQQA 4OFIA 3V4VL 5JDSB 1H9VA 2FEEL 3PJSA 3HE6D 3WNNA 3GSNA 2DDQH 2ZUUA 3WHE1 2JELH 2A9MH 1JPSL 3O2VH 5TDNA 4M8VA 3U1SH 4D8PB 3DX7A 1Q9LA 4LU5H 3L95A 4L8BB 5I1DB 1S5IL 1G6RA 1N0XL 1YEHL 5F6IC 4OLVH 3U4BL 4R2GD 1G7JB 2CLZB 3KYOA 1JPSH 2PETA 4MB3A 1CGSL 1T1ZB 2NY1C 2DQTH 4U1KB 1N64L 3WIIH 1ZT1A 4R90L 2EYSB 1D9KB 1T5WB 1JGLL 3UCRA 1WT5C 3T1WA 5ITBL 1A9EB 4GXVL 3GMPB 3N85L 5ENWB 4PRID 5HGBB 3KPMB 4YDKH 4BA8A 5I9QB 2WBWB 5DEFA 3MRHB 4JE4B 3O2WH 3Q3GB 3VXMA 3WD5L 1IT9L 1HSBB 3BZFA 2Z91B 2CRZA 3X11B 3TFKD 1FRGL 2JK5B 4YAQA 1P7QA 3OR7B 1HNGA 1JK8B 3G6JE 1LEGA 3LQAL 1NCTA 3UAJD 4WWKB 1KB9K 4EN3B 2UZXB 3HG1B 4Y2OA 3LDBC 2VL5A 1RZ7H 3KS0H 1EUTA 5LWYL 4PY8J 4DAGL 3K81A 4ZNEA 1G7IA 3JTTA 5BVJA 5IMMB 1KCSL 5DVNA 3MRNB 4TUJA 3B9EA 4YHNA 4WI9A 1W0VB 1JNNL 4RRPG 3KLDA 1AHWB 2E5EA 4PJGE 5C1MB 1RIHH 1L7IL 2VQ1B 1AC0A 1BGXH 4JZJC 5SWSA 1A7NH 3VGGA 1N8ZB 3ZKXB 3OMZA 1UM6H 1HYSD 5CGYD 3JXAA 1CLOH 4G7VH 3IRZA 2GEEA 2Y9RT 2NY0C 4R97B 5FYKU 5B8CB 2NY5C 3EYUL 4GLRI 3QNXB 1T7YA 4HJGA 5D1ZD 1FC1A 2R1YB 2E6QA 4M02A 3E6FB 3CCHB 1Q0YL 4YHZH 4IHOB 1I7RB 1F3JA 1CD8A 1IGJA 4FQJL 4DEPC 4G8FB 1LE9A 1S7VB 4HX1B 1BHGA 5EZIL 4HK3N 2QSVA 4WW2F 2NY6B 2PXYD 1WEJL 5GGQL 2W0LA 3MCG1 4JO2L 2Y06L 1S5IH 3MJ7B 3UP1A 3E6HA 1MNUL 4HIHA 5TF1L 3R1GH 4AL8L 4P4KC 3QIUD 4K94H 4RZCB 4JRWA 1SY6A 2AV7A 3EZJB 3EDEA 5CIPA 4LLYB 5KBNC 5IVNA 4U1IB 3BXNA 4QOKB 1T0NB 5BV7C 3ULUE 4KK9D 1Z0NA 4RFOL 4IIQA 4YK4B 5IB4A 4F58H 1NH6A 4NRYB 4ZNCD 1HSAA 4JVWA 1MJ7L 4I3RH 4V1DD 4WTZG 4KROC 3LRSB 4PJGB 1LP9B 4XPGL 1N3NA 4XP6H 3FO2A 3GMOB 1IE5A 3GBLA 3AAZA 1KLFA 1I8IA 1UFUA 4J4PA 3DMMD 5DURD 2R0ZL 4BZ1L 5FYJU 5DUML 1FVDB 1Q9OA 1TQBC 3OXRB 3ALXA 2WNGA 8FABB 5IJKC 3BKCH 3SPVA 1RZGB 5D1QD 3VFOA 5L8KB 2B4CC 5EOTA 2LU4A 3CXHJ 4X0KA 1MWAL 4ZYKB 3NIGE 4X7TB 5EH1A 5ID1A 4L4TE 3I50H 4YPJA 4HWZA 2A77L 2YEZA 5GRZA 1CT8B 1S3KH 5FA4B 1HHJB 4OLXH 4OSUH 2EDDA 2P47B 3QSKB 2J7LA 1INEH 2XXCB 3Q0HA 5JA9A 3MA9H 1EERB 3AC0A 1NPUA 5F71A 4K7FB 4JFZH 1HIMH 3A0OA 3SDXE 4POZC 4OCSH 3QAZC 1VGKA 1FG2B 2AQ2A 1T1XA 5F88A 3L3GB 2CJUL 5C0BE 2EDTA 3L1OH 4R26L 5HYEA 2WBJC 5J1TC 1NMBH 2DRUA 5C0JA 3SDXA 1TZIA 4XNYH 2NYYD 4JAMA 3QDHA 2NCMA 3MREA 1T66C 5D2LE 1RIUL 3O2DH 3RAJH 2AABH 2EIBA 5DK2B 5EU7C 1IEAA 5GGUB 1VGEH 3LRSA 4ZG1A 5HGHA 3LS4H 3N9GH 4ISVB 3S97C 4AQ1B 3A6BL 2F5BL 4XX1G 3B43A 3UC0H 3KXFE 4H26A 1UM4H 3PDDA 4G7YH 3HZKB 4YNYA 3WSQH 1U58B 4X98A 2B8OT 1GPOH 5C6TL 1VERA 4PGEB 2AJSL 3KXFA 2VRAA 1Q9WA 3P9LA 2E27H 1L0XA 5KTEL 1A6ZB 4DGIL 1NFDA 4OKDA 5H37G 1LD9A 1U9KA 1ZHBB 5F9JA 5KOMC 3UJTH 1GZQB 5FK9B 1BVKB 3SDCB 2P5WA 5IQ9A 2NY0B 3N1QC 4JB9L 1K3IA 1RUPL 3RI5F 5T3ZL 3TEUA 2Q76A 3IT8D 4O58L 1FE8H 2DLTA 4OZHE 2ITDB 3BIKA 3LN4A 2YKLH 2NY1D 1VPOL 5JXEA 3H8NA 2FJFA 4I0KA 5IV2A 4IRJC 3AU1B 5KSAB 1A6ZA 3I2CH 4A6YB 4D0BB 1FN4B 4G3YL 1ZLUH 4R90H 3IJSA 2A6JA 1G7HA 5M7QA 4XWGH 5JHDB 1BQLL 4MDJA 5ECJE 4X4XB 1KJVB 4OLUL 4Y2DC 5T3XH 1OGAE 1PX3A 5E5UB 4M61B 1T20B 1X5HA 2IFFL 3D48R 1V5JA 5GGRY 5LBSL 2A73A 1KPVA 4P4RA 1DANT 1N5AB 1NANI 5DO2C 4QYOB 3S37X 1NFIA 2NY2C 3IDXH 1LD9B 1KLUA 1U93A 2ERJC 2HRPL 4ZOAA 3QA3A 4U6XB 3O6ML 3VXSD 5E5MA 5HSFA 1KJ2B 4I9WD 2FLBT 2DLEA 2FB4H 4MA1C 5E7FA 5GGRB 3ARGC 2Z31C 3T2QA 5E08L 1VFMA 5DMKA 3GSUB 3QQNA 1LDPH 2NY6C 4RMTA 3SKOA 2B39A 2N56A 1BZ9B 5CZVH 1T1YA 1JHLH 4PG2C 3SCMD 3RPKA 3AS1A 3RWGA 1OAXH 4ZAKB 2OR7A 4QO1A 5FHAH 5DLMH 2RR3A 3S36X 4XVUD 4JO4L 1X5ZA 1Z5LA 4QHMB 1QLRA 3CX2A 3DBXB 5D6CA 3MNVB 4KRPD 2VXVH 3WSQL 1J12A 1JHTB 2P8LA 3IDIB 2A6KA 4FFYL 2QQNL 4D9QD 1K8IA 4NKMB 4F9LC 3EYQD 4L5FH 4JHZA 5JW4M 1GC1L 3PABB 4NO3A 2HJLA 4P5TB 3P9WB 3EO0A 5FGCB 4WWKA 5KVMC 4XHQA 4LASH 4P2QE 4TSBL 4KGLA 4DN3H 3ARQA 1B88A 3TJHC 3MRGB 4JZJB 3DRTB 4JZOB 1FE8L 1OSPL 4JR9H 1DBKH 3T1FB 5JHDE 2CMRL 4PREB 4UV7H 1OQOA 4FXLA 6FABH 3TZVC 4V1DE 5ITBH 1OP5H 1W0VA 1FGVL 1MCBA 4FXGA 2XZAH 3SDAA 5IHZA 1QRNB 4RMWA 4K9EL 4HQQL 2YC1A 3QWOA 3G6AB 4DGVL 3F7QA 5HHNA 3ULUD 2XKNB 5SWSB 5D1QC 4HAGA 1ZA3B 1X5XA 1SJHB 1T89A 4P48A 5B3JE 2OBGA 4P3CH 4YHYC 1IC7H 2PTTA 4Z77A 5AD0A 3BMWA 2VZUA 3FQRB 1MCCA 4QRRD 3CU7A 1B6UA 2HKFL 3UDWC 4E5XA 4BSVB 1VGEL 1MFDH 3D9AL 3NA4A 3KS0J 1WQVT 2I24N 4RQQB 2F53A 1KELH 2YD4A 3UEZA 5FYLE 3O3EA 5E4EC 2YRZA 1MLBB 2GY7B 3PGCB 5LQBH 4NQEE 5B4MC 5IWLA 3P0VL 5B38G 2GSIB 3VDBA 2VUOA 4KJPC 4FFWD 2DQJL 2DI8A 2GJZB 1E4JA 4ZMAT 4TTGA 3RX8A 3K1DA 1MHHB 1J1PL 4XNXL 5TE7L 3RVXD 3LQZB 5K9KB 5TQ2H 1E4XI 1WAAA 2W38A 4JFEA 4JY4A 1ETZB 3HNTH 3O3EB 4XNUL 3TO2B 3QUYB 2XZCL 4PJXB 4V1DB 3FCTB 3OB0K 2NXYB 3WFDH 5DD1L 4UOW0 1IC4L 2APVA 4K2UH 1BGXL 5EBWA 3VFRA 4Y4HC 3ET9F 2JB5L 4O02H 2I9LB 3P4LA 3KLAB 4U3XA 1CL7L 1RUQH 3QIBB 1HXMB 1VFBB 3KYNA 3IDYB 1MSPA 4GAYB 4JRXD 4U05A 3GJFH 3RTQC 1U8QA 1XCTB 4I2XB 4AEEA 1FNGA 1MHCA 1R6VA 3QCTL 1SBSH 5L2KD 1RZ8A 4AL8H 4NM8L 4D0CA 3CPLB 3RWCA 3U4BH 3MXWL 2ZG2A 1PX4A 1UVQA 2EDKA 3M45A 2CRYA 2ILLA 2DQUL 3EGSB 1B4JH 2XQBL 4PYGA 1EPFA 1ZANH 1YNKL 3QUZB 5FUZL 1BBJA 1C16B 1NGYB 2HFFA 5E5RB 1TMCB 2NY7H 4HKBB 1OPGH 1U8HA 2IBGA 4Q97A 5DSCA 3X17A 2JK5A 4K7PX 4YAQB 3DX8B 2VDNL 2C3WA 1Q38A 3FQTB 4KQ4L 3RWCB 4BZ2L 4J7RA 1OAQL 1NJ9A 3SY0A 1QR1B 3GZKA 5H2BA 3OKMA 5GGVL 1LDPL 1MH5A 5CJOL 4D0BA 2PYFB 2XFXA 1T7XA 1IAIH 2ARJB 5GRYA 4XPBH 3V6OE 4R4FH 4HWEL 2XQYG 2DQEH 4QRPD 4O9HH 2A6KB 1XF5A 2P8PB 4LLAA 1AO7D 1M7DA 3P0VH 4PJXE 5D8JH 3WKML 2EYTB 4IS6A 2B2XH 4RFEB 2FECI 3QXTA 3MLSL 3T0DA 4PIRF 4DAGH 2F8OA 4HKJB 4M7KL 1A7RL 5DEZA 4Y5VC 2FJGA 3MGTB 4D0DA 4XPHH 4D8PA 5SWQA 3AFLA 3KDMB 4XPFH 1YDPA 5FYKE 4DN3L 3Q3GA 2DQHL 5AZ2L 2QADD 1O0VA 2BY0A 1BOYA 1T7WA 3GHEH 4PP1C 4XGZB 4M4RA 2A2QT 1U8QB 1JZ4A 2Q86B 1T2JA 4XXCA 1ZMYA 4EI5D 2DD8H 4JQXA 4Z0BH 1R0AH 1INQB 3DSNA 4N0FB 2ADFL 4RFNB 4K2UL 3V0VA 2I25N 3SE3A 4OF3A 3RIFF 1CDHA 3UTSE 4DKEH 1HWGB 4AT6B 5ADOL 1WIPA 4NO2A 4WO4D 3K2MC 1CFVH 4ORGA 4YLQT 4XAKD 1RHFA 3EO9L 2C4XA 2XZAL 2D7MA 2FSEB 5AAMA 1FZJB 2E9IA 5AYUH 1GL4B 3WFCH 32C2B 2AJZB 4P5MB 2VUYA 1L6ZA 2GCYA 1JTOA 1MCNA 4XHJC 5IROA 3IFOB 1T22A 4GMTH 4XCYB 4GRWB 4EKXA 3DVGB 1CZ8L 4LSUL 4X4YB 1XGTB 4HEME 5HYFA 2KUTA 4QNPE 3IYLW 2V9RA 4S1RL 4DGYL 2VR4A 3C60B 4TPRH 3J8F7 3RGVC 3TIDB 3V4PH 5CZVL 3KLSA 3SE9L 4Z7UE 5IF0B 3OTTA 3T77A 3C08L 2OYPA 4F7PA 1IFHL 3LOWA 3OBAA 5KANI 2E27L 4I3SL 3RKPA 1JF1B 2IH1A 1SJVA 3HNVH 4ZUUA 4CW1A 5A16A 4M5ZL 5EPMA 3LZFL 2F54E 3MJ8A 5J0BA 5IEHB 1I1YA 1IL1A 5EU5A 2GJJA 5DK3A 4L29B 5L6YH 4R9HA 4JO1H 1GXEA 2PW1B 4GT7A 4X8JA 2NZIA 3IDJB 1C7SA 1JRHL 3KPSE 5I1CH 4MJID 1ZV5A 1HILB 3W9DA 3VD5A 1EFXB 3IRPX 1AO7B 4J3TA 2HT4C 1ZHNB 4K3HA 4LAJH 1IGYA 3K0WA 3J7HA 2VITA 1A3LL 1D6EB 4Y5YA 3KPSA 3VXME 4XZUA 5ABDE 4FZEL 1U8PA 3D3VD 2XTJB 3OKOB 1HK6A 5EZOH 3K46A 1WLHA 4M6OL 4NZJA 4L29A 4Y19E 5E2VL 2HH0H 3T0ED 3KNBA 1OLLA 1T2QL 4FFWC 3OZ9L 4G6MH 2OR8A 1P7HL 1ZGLA 4YQXH 1CDBA 3LKRA 3SGJC 1H5BB 5DQDH 1MIML 2W65A 3QBTB 1LEKB 1NGQL 2DM2A 1N2RA 2Y06H 1ES0B 2VLRB 5FCUL 3C5JA 4PGEA 3S5LB 1QQDB 1UCBL 3PDOA 1URLA 2VH5L 3UDWA 5AYUL 1YY8A 5C0NC 3L3JA 1OTUD 3EJZD 5FHBH 2R56H 1MJUH 4MNGB 2HTKD 3CSYB 3KPRA 1ZGLB 5B21A 1FC2D 4BH8B 2AXGA 5E8DH 1JWSB 4YEFA 3Q48A 1EMTL 1UQSA 2P5EA 3CFBB 4XHJD 1LEIB 1YPZB 2KH2B 5FHBL 3IDXL 1LNUB 3HB3D 1TZHB 3KPSB 25C8L 2LU7A 3TFKC 1MQKH 3FONA 3WN5B 2BNQB 3QEQB 2IAND 3L7EA 2Z9TA 3FOMA 1F4HA 4WGWB 4MNHB 3GJEA 4NO0D 1T0PB 1A6WL 1NGZB 4YZFE 3KPRB 4HFWB 1MQKL 3VFNA 3WJLA 4LVNC 2ZOKA 3D3VE 3HI6L 3VWKB 1MHPL 2GI7A 5FHAL 4PJ5E 3GGWB 1BQUA 4YX2H 4WEUD 3H42H 1EVTC 5DZNA 3KHOA 4WWKC 4CVZA 1G6RH 1MCHA 1KJ3L 4HS8H 3RNKB 5EOCL 2DI7A 4JKPL 4X7DC 5J13C 2Y5TA 4R3SA 3CLFL 4L8SC 5KVDL 3L7EB 3S35X 3UO1H 4GRWF 1HI6A 4O2CA 3QEHB 1INEL 4OCMC 4JO3H 5KS9F 1HYSC 3GSQB 2IAMB 2H26A 1J0YA 5HDQL 1S9VA 3VXUA 1XF5B 4QWWC 4U7SA 1WEJH 3DX6B 1P84J 5JHDA 2YXFA 4K3EL 1LO2H 5EG6C 2ZG3A 3L1OL 5DQDL 1MRFL 4JQVC 2CGRH 2NX5A 1XGTA 1AIFA 4R7DB 5FUZH 1ZWIA 5L0QC 3ULVC 2NR6D 1BQLH 5H8DA 3NAAL 4PLJD 4Q58C 4OZIE 3UX9B 4WDIA 2E9BA 4EI6B 2R29H 1A5FL 2FO1A 1IGTA 3L5XH 4GRLB 3MLZL 2YWYA 1NEZG 4HIXL 3FN3A 1KJ2L 5EA0L 3QEQE 4LEOA 1D5BB 4HK3J 4IDJL 1YJDL 2GJ6E 2AW2A 1OT2A 1IGIL 1S7VA 4Q0XH 4HJ0D 5E03A 4X5WA 1U95A 5H94B 5L2KB 3QRFM 1UM5L 5AZEL 4ALAH 4GG6A 4TNVK 3T8XA 4M00A 5IBUG 3ZYJA 4BZ1H 4M9PA 3FAXA 4FQLL 3WFBL 5DJ2B 3OB0H 1DDHA 5FM5O 5ACZA 2F53E 2V5YA 5CEZE 2AJYH 2LTQB 4R97C 1EV2E 2B4CL 3QYCA 1WBXA 2DIAA 2VN4A 2ADJA 4GXUN 3RDTB 3WLWD 5JNYB 5JXEC 3ES6B 5C0IA 3QDJB 3RWDB 3QQ4B 4D0DB 4R7NA 1F4XL 2VLJB 1SY6H 1F8TH 1YEDA 3QXAB 4QXTB 3RGVB 1FZMA 4UNVA 3WYRA 5D5MF 1AD0A 2OCFD 3AMKA 4M93B 5DR5H 1UM6L 4EI5A 1MELA 5D2LA 5L2JB 1A3QA 4XCCL 1S7TB 2JCCA 3BKMH 1T2QH 4LCCC 4RX4A 5DT1H 5E8OB 1NMAL 3WDJA 2I60L 3FN0H 1SHMA 1G7LA 5CLWA 3O2VL 3OF6A 2EE9A 1FBIL 3HHRB 3SY0B 5GIRB 4EDXB 3GMPA 4P2CG 2G5BB 3LMJH 4KHXL 3VFMB 4CL7A 5HYSB 4HV8A 4FQJH 1NUNB 5E2WH 1FFNB 3VXMB 4GMTL 4YBQD 1G1CA 2JJVA 4XMKH 5DEFB 1FYTD 1YQ2A 3DHMA 2QADB 5L2KE 2VISB 3N85H 4Y19B 2YA2A 4OI7A 4LIQE 5CJOH 2CKBH 5J89A 4EN3A 4K7PL 3LZFH 2WBJA 2ED8A 3I3EA 4MXWL 2BMKA 4LF3B 3WMSA 3WNPA 1QFWH 1QLRB 4JHWL 4WU7A 1MEXL 4M9OA 3WUWG 1HXMA 4XAWH 1R5WA 4S1SL 3DXAD 1AGBB 3CZFA 5GRJL 5GSRB 4NKQB 3KYNB 2H6PB 1AXTH 1TZGH 4JHBA 4MQXC 4ZS7L 5E99H 5HBBA 4OM1L 4NN7B 3DSFH 4CKVX 3DUUB 1OTTD 1IQDB 2K1MA 2AGJH 5ETUA 3EGSA 4GG6F 3E6HB 5ADPH 2X1WL 1HCFX 1YPZE 4L9DA 4LQ1A 5FF6B 2BZDA 4MS8C 1LP9A 3VXTA 3WHXA 2B2XL 5I16A 4UT6L 2PCPA 3PWVB 3C5ZB 2J4WH 5BRZA 1C08A 3ARUA 4HH8A 5GS2D 3E6FA 3CD4A 4S10A 4Z78A 5ADOH 3U2SB 1EEYB 3WJLC 5C08D 2CK0L 3DTXB 4JLRB 43CAB 4AYFA 3DUUA 5F9WC 5C0RH 3DETD 4XP5L 1RZ8B 1ZVHA 1D6VH 5GIRA 2XWJA 4R4BB 2VLME 4BKLB 4Z0BL 1WWCA 3QDGD 3QXWA 3S35L 3CVHH 3RUGB 2MKWA 3KYAA 1PZUB 1BOGA 1KT2B 2CO7B 1NBZA 3MO1B 3K4AA 1IEHA 3WL9A 2AJ3A 3VG9C 1R3JA 2DJ4A 3MPCA 4LLWB 1XR9A 1DBBH 5DMGD 4UBDC 2H6PA 5I75B 5DJ8A 3QIUB 1H5BC 4H25A 1RD6A 5FYJH 2VAJA 1GIGH 3REWB 2XQBH 5HHNB 5E9DA 3PXJA 5EO1A 3FQWB 3GIZL 2ZPKL 3PWPA 1FIGL 2CUIA 2XI9A 3KPLA 4KRPC 3P4NA 3OR6B 5D7LB 2Q8AL 3ULVF 3MBXH 4K3DL 1J0IA 4KUZL 3QHTC 5LG1A 4S2SA 2X41A 1XF2A 3OGCA 2Y4SA 4L8DB 1R3LB 1CF8H 2QBWA 3EOTH 1XFPA 5F1SA 3HMXA 4R0LA 4Y19D 4JPKH 1KLGA 3TBSB 4KKLD 1J8HD 4Z7WE 1KB5L 1KELL 4YEEA 1A6WH 3VFSA 4WFED 4S1SH 3TYFA 3RDTA 4KI5E 3VXPA 4LRNH 4F8TA 1REIA 4M1DH 3RWHA 4IEFB 1S5HA 4R96B 1FP5A 4UIKL 3SQOL 2FBJH 3V2AR 1KG0B 4G8IB 4ISVA 5DQJA 2JF1A 3DXAB 1JNHB 5IB3A 1MHEA 1R5IA 1JWMA 1JMXA 1ULVA 3TA3C 1T5XA 1C08B 2AQ1A 3F12B 2ZG1A 4JKPH 4IRJB 3RL1A 5DC4B 1FNEA 2FJHA 2Z92B 1DBKL 5I1LB 3D6GA 5BXFB 4XMLH 1HHHA 2EIDA 3B9KD 3SOBH 6FABL 5DR5L 2VABA 4OUUB 4PRHB 5GJTH 3ZYOA 1DBAL 1Q9KB 1QOKA 2FGWH 5F96H 5JHLL 1I3RB 4RAUA 3DBXA 1A6TB 4Y2DB 4DUXA 3ECBA 1F45A 2CD0A 1XGYH 1ADQH 3EYVB 1S9VB 3O4OB 1NCCH 5D96B 3L3DB 4LSPH 1EVUA 3RGHA 3CC5B 3BZEB 2R29L 3PIQA 5D5MB 3QUMA 2RHEA 3GMMB 2CPCA 5K9OA 3NFSL 3IJYA 4NCC2 2ZZUT 5C2UB 3ULUF 4UQ2B 5KVGH 3C6LB 3QXAA 4QXTA 3BH8B 3RGVA 3INUL 1EMTH 1MI5E 3RJQB 3LS5H 2G2RA 4QRSA 2GFBB 3VXRB 4DVBA 2RCSH 2W59A 3TYGH 2NY5H 2DYPA 1FAIL 3GBNL 4I48A 5I30L 4GSDH 3RWEB 3VXSA 5DFVD 1ZS8B 1D5BA 1MCPH 1EFXA 4EXKA 1BIIB 4UU9B 5IOPB 4PRBB 2GIYA 1VB9A 3TA3A 1YY9C 2C3HA 3DVFA 5B22A 4X4XA 1U58A 5E6IB 1YYMH 1NCDH 5D7LD 3FMGH 5FYLH 4JCLA 2GY5A 3ULUC 3BGMB 3ZTNH 4G6JH 1MCLA 2J6EL 1B0GB 1KIQB 1ZE3C 1CLZL 4A6YH 1U8NB 5D93B 4M1CC 4MQ7B 2QADC 4I3SH 2DJUA 4Q7DA 3SHSA 1DBJL 5LXGL 4RISH 4AQOA 3FQXB 4KTEH 5A2IH 4G6JL 4M5YH 2AJXL 4JQXC 3QUXB 3O6KL 2OJZH 4GAJL 4XP1L 9CGTA 1JL8A 4NM4L 3K74B 1OY3B 4X8XA 4XC1H 4H8WH 2ZSVB 1HHGB 2BJML 5TE6H 1ZWIB 1LO0H 3LVEA 5HI3C 4OJFH 2AK4B 4KKLC 1N26A 4UDUA 1Z9MA 5DZLA 2IG2H 4NZUH 2A6JB 3U30B 5FO9A 4MYWB 4LHUA 4JEGB 4H26B 5TFSH 3HCVA 1JYNA 4JR9L 2Q6WA 4N9GA 4Y16A 1F3JB 1LNUA 3MJ8B 4JO3L 2R2BB 2VLLA 1I9JL 4YHYB 4ODWB 2KL6A 4BFIA 2CK2A 5JPNB 4OCSL 3BH8A 4G6ML 1KPVB 3JWOH 4MNHA 1W72H 3KXFD 5SX5K 2FATL 5E2UL 1Z9SA 1PKQE 2X4NA 5J6GB 2OZ4H 4NDMA 1FLRH 2MPAH 1U8LA 1ZHBA 1CN4A 5F9JB 4JDZA 2O61B 4S1RH 4DGYH 3W9DB 1C1EL 3BPNB 5CSGA 5HVHB 1FO0B 1UQSB 2P5EB 3CFBA 1DLFH 2B1AL 4CVZB 3LS4L 3N9GL 3WIHL 4KQ3L 3ULUL 3NIDE 1IC5H 3HAEA 3OAYK 2DM3A 1IGFH 2X4RB 1VDGA 1AXSA 3RVVC 3GB7B 1ZEAL 4XBGB 3S36L 3O6MH 1F13A 5KN5A 4NDMB 4F2MB 3D39A 5HHOB 5I71B 2OMNA 4ETYA 5MEQA 4GG6E 1FYTB 1WF5A 5DJYA 3OXSA 2YUZA 1V3KA 5I1CL 2VQUA 3F58L 1DSFH 3P11L 4AG4L 5D1ZC 4KRPB 4X6CE 3ZDZE 3MRRB 2R2BA 3WV0A 2X1XR 3F7YA 4KTEL 4M03A 2DD8L 2IALB 1R0AL 4Z7WB 1JCKA 2C4FU 1P69B 1OT1A 4JY6B 5GGTA 5KOVC 4G8GA 3NA9H 5DD5H 5DWUH 4Q6IA 5F3BB 3ARPA 2AEWA 3E2HC 4TNWK 2IH3A 3CSYA 5KAQG 1PZ5A 2CUHA 2PXYC 1AE6H 1J0JA 5CS7A 2BSRB 1GAFL 4IOFC 4F3FA 5T3ZD 4Z6AT 1X4XA 3D2UB 1EUUA 1W8OA 4NKIH 4P2YA 3MA7B 3SGDH 1J8HA 2HWZH 4HC1L 4P2QD 3U4EA 5DQ9B 2X09A 4HT1L 4LBEA 4UBDD 4JFYA 4JJ5B 5D6DC 5IW1B 3KR3H 2NZ9C 4PR5B 5GRVK 1N4XH 2DBLH 2A73B 4P4RB 2X4SB 3QCTH 1BMGA 4DVBB 3FFDA 2XY2A 4KROD 1F3DH 3ME0A 1MCDA 3EO1B 3AREA 2D4DA 3ALWA 3D2UA 1MWAA 3O8XD 3LH2H 3H3PH 1MFEL 4JHWH 4LAQH 1ACZA 4XPGH 4L3EA 4NZRL 4KZEL 1IFHH 4F80A 2EC8A 4JPWH 1EO7A 3CSBA 3KLHD 1G7QA 4V1DA 5EWIH 5GPRA 4TNVF 3MUHL 4PJBF 5FUCC 3OB8A 4ELMA 1A4JA 3RU8H 5LAXB 4X6CB 3QULA 2EIEA 1UACH 2R1YA 2X44D 4M1DL 2OL3H 4XP4L 1MI5B 1Q0XH 3VWJC 4CMHC 4M1GL 2HLAA 4RBPK 1KEML 3B4NA 4JM2C 4U33A 5E00A 4PRDB 1JHKH 4FNLL 4QT5B 1G0DA 4J23A 3HC3L 1NJ9B 4WNQB 1SBBA 4PJXF 1AGEA 1DQDL 1CR9L 1YN7B 1YEEH 5JOFB 5TE4H 3BP5B 1U3ZA 4GKSA 3A6CL 4ERSL 1NCNA 1F4WL 2PR4L 1B9ZA 3CAFA 1KIRB 2C3GA 3Q5YA 2ZWLT 4TYUA 1QVOA 2FL5A 2XZCH 3FQRA 2VLKD 3WEXA 5I1EH 4CJ0A 2IG2L 1EZVY 2IQ9L 1W0WA 3BKJL 3BO8A 3QNYB 1OAUH 2VXTH 5BXFA 1FV1B 3DVNA 4PY7A 1OTSD 3VFGL 3VGFA 1CE1L 4S1QL 3VXSE 5ESQA 1ADQA 5KZCD 3VXNA 4PGBB 5IW6A 5K93A 5HGHB 5ESVA 1NGQH 3NCMA 3TJEL 1HSBA 1AKJD 5IW3A 4JG0H 1NBQA 4CNIB 2Z31A 4GBXC 2D7NA 1ZHNA 5D7IB 3FO0H 1FBIH 4GUPB 1K85A 1OL0A 5E6YA 1CFNA 4K94L 5E6ZA 3I6LD 3HN3A 3O4LD 4NPYB 4RNRB 4UB0H 2AXFB 4UQ3A 1FGNL 4JY4B 3N06B 3BDXA 4QRQB 1XIWB 4BUHA 1ORSA 2XT1B 1TENA 1OAKH 2H32B 3AREC 3U0WL 1DP0A 4K55A 4JKKA 4I77H 5I1DA 1KCKA 4NNXB 4Y2DD 4HXBL 1BZQK 1FGNH 1KTLA 2I5YH 4GO6B 1ED3B 2JCCB 3F12A 4PS4L 4RA3A 4KQ4H 1J87A 4KVNH 4DWHA 1J86A 1CS6A 3WHE0 5CD5C 2UVFA 3U9PL 3HR5A 1U8KB 1MOEA 4OQTA 2YPLD 1FZMB 4WUUA 3FL7A 1U8OA 1U3HB 1CIDA 1OGTA 3ROLB 1DUZB 3SPVB 5JPMA 2QHRH 1J1PH 5C08A 1MQ8A 3A6OA 4KAQL 1QYGH 2A1WH 2R4RH 1BVLA 2BC4B 4PJHA 2I9LA 1JZ8A 3BN9D 4XNUH 4NNPH 1GVIA 5BRZD 1OSPH 2F8XC 1FFRA 3X14B 3QI9C 5CEYB 2MQ0A 2VWEE 4FZ8H 4WHYH 2ZUWA 3BP7B 2XWTB 4G43B 1QFPA 2R15A 3LQZA 4XCCH 2ESVD 2OI9B 4APQB 4OFDA 3D18B 4RDQF 1ZLUK 4F7EB 1YEHH 4LSVL 3PWPB 1CXHA 1U3HA 4IOIB 3V7MA 3MV7D 1DUYA 1CFBA 1UH4A 1QSED 3CVHA 3OKLB 2VZOA 3L5WB 5E8PB 3HRZA 1HDMB 2EH8L