5AZFA

Crystal structure of lgg-1 complexed with a weel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
b'GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lgg-1
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 40
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azfA00
4IM0A 2LGXA 2CHZA 4ICVA 3PGEA 5DPWA 3RULA 4GB9A 4TKNA 2I1KA 3DCGA 2WDTB 4M0WB 5J17A 4WAAA 4PYUA 4NPNA 3PTFC 2AL6A 2D07B 2MLBA 4ZRKA 2N7EA 2BYFA 2ZPNA 2KLCA 2JPHA 4EOYA 2NPTA 1WGGA 3H6NA 3W1SA 5CHWA 4DHJD 2D2QA 3B0AA 4NJ6A 3I3TB 3PZDA 1GC7A 1EUVB 2L76A 4W9DA 4GN1A 4FN2A 2KLGA 5LLIA 4BKTA 1UD7A 4WJQA 4F8CB 2BF8B 5D94A 1V80A 3RD2A 3WAPA 2KQ7A 2UYZB 2KKCA 2DZMA 2M4NA 1TTNA 2EMTA 3CF6E 4AUQC 1X1MA 3RYTA 5CHFA 1E8ZA 1KM7A 5CX3A 4DBGA 4IM3A 1C3TA 4IG7B 2C9WB 3ZLZA 2FUHB 3LDZE 4KSLC 5IA7A 3DBLI 4FHKA 2EMSA 2NPTB 3L08A 3N32A 3T9LA 2BGFA 2IO1B 2KJHB 2RD0A 4OVVA 3WAOA 3ONSA 4NY0A 2MBQA 4HDOA 2DZJA 3QA8A 2LASA 1FXTB 2NBVB 2PEAA 3A9KA 2BPSA 4II2B 5DPTA 3X0WA 3VUXA 4LDTD 1TBEA 1WFYA 2NBUA 3AI5A 2V1YA 3A4RA 4GDKA 4JLCA 4G50A 3D32A 5E6OA 1EO6A 2MCNB 3ZW3A 2ZCCA 3HHMA 1A5RA 4A3OA 1WJ6A 2NCNA 4RM9A 3N3KB 5L83A 4E71A 3U30A 3M95A 3DVNU 5AZGA 3ZTDA 4HWIB 3UGBB 4BBNC 2KNBA 2HD5B 3VUWA 4IW0A 4WWPA 2C5LC 2JWZA 3BINA 2LRUA 2ZVNA 3VVWB 1YX5B 3ECIA 1P1AA 3H7SA 4G3XB 1WXMA 3VH4B 1WZ0A 2MBBB 5JH5C 4GMVA 3A9KB 1YJ1A 1WR6E 2J0KA 2KANA 2XEWA 1R4MI 3GZNI 4W9EA 4GDKB 1UZXB 4AWJA 3NS8A 1LQBA 5KHQA 3H7PA 5J18A 1YX6B 2QHOA 3AULA 3B1LX 3MHSD 2BWES 4HCPB 3VQIA 3PV1A 4KZ0A 4DDGD 3V6CB 2K6QA 1ISNA 5JZEB 1S1QB 4K7WA 4II3B 1WX7A 2GOWA 3V62A 5LXHA 3KW5B 2C60A 2M8SA 3IHPC 1WJUA 3DDCB 2AYOB 2LGDA 3APDA 4XX5A 3UQAA 1WH3A 1YIWA 3ZIMA 2ZPYA 4BKSD 5IAAC 1GG3A 3EECA 2B3AA 4FHJA 2LVQA 3QARA 2JVCA 3BY4B 2DAFA 3L13A 2M17A 3Q3FA 4EZJA 3PVLA 4NQLB 2V4LA 1V5TA 4GIVA 1C1YB 4W9IA 1GNUA 3V60A 3DBSA 3H7PB 4IWOA 3APFA 3SU8X 4E74A 3M3JA 4TV3A 4KSKC 1WX9A 3KH0A 1WGDA 3HIZA 2LVPA 2PE9A 3OLMD 5TR5A 5G55A 3UINB 2KC2A 2G3QB 4AJWA 2XBBC 2LVOA 1E8XA 2LI5A 4GU2A 4PS7A 3ZRFA 4MGZE 4P7IA 3VH3B 3AXCA 2JRHA 2Z59B 3QIJA 3JVZX 4CYEA 4RMAA 3EC8A 1QZEA 5JHBA 3UIPB 3ZUNA 3UF8A 5HKHA 2IBIB 3VXWA 2DX5B 3SD5A 3V61A 2RGFA 2NR2A 3R7RA 2JY6A 2CKHB 4ZYNA 4BKSA 4NAWA 2KN5A 4CHKA 1UGMA 4LJPB 2MBEA 2ASQA 5FR6A 3ZNGC 2KTFA 4F1SA 4JIOU 4KZCA 1XD3B 3PRPB 3EHVA 2O6VA 3ALBA 1LFDA 3GOEA 2K25A 3ZNZB 4KDIC 2FAZA 3AU4A 2BYEA 3QJZA 4X57B 1J8CA 5EDSA 2CS4A 3ZDMC 3N30A 3RZWC 3VDZA 1XQQA 3DBRI 2DZKA 3KUDB 1GC6A 1WE7A 2K8BA 4IC7B 4MDKE 5DPSA 3MJWA 4HCNB 4M8MA 1PQSA 3V6EB 4B6WA 5JHAA 1V49A 4TUUA 3IBEA 2O2VA 2JUOA 2R2QA 2DYOA 1BT0A 3TL5A 4NAWB 4URKA 2JZ3B 3ML9A 2L00B 4IM2A 5CHVC 3H9DA 2O6VB 2L0FA 4W9LA 2KDBA 4ANVA 4G11A 1UH6A 1XT9B 2ZNVB 2BYVE 4HDQA 4HJKA 3PREA 4I6LB 4RM8A 4KIKA 1WGYA 2KHWB 2YVCA 1LM8B 4BOZB 3VTWA 2KFKA 4DXAB 1I35A 3NZSA 4K7UA 1WXSA 1WGHA 3ZKJC 2GBKA 4GXBA 4WJPA 3OAWA 3PLUA 4I6NB 2KVRA 2K8CA 2V3SA 2C7NB 4EZKA 2R2OA 3VTUA 2O2VB 1WXVA 3S2AA 5D6JB 3HM6X 3ZO5B 3SHQA 2HJ8A 1UBQA 4W9HA 2LWPA 3L0WB 1WRDB 3ENEA 4K7SA 4MJSA 4KDLB 2NBWB 5DPRA 2A4ZA 3VHTC 5D2MB 1I42A 2G4DB 3M62B 4ICUA 2C7MB 4KIKB 1IPGA 2KDFB 5D7GA 4B95A 3QX1A 3NOBA 3PS6A 2KFKB 1UBIA 3DVNV 1TZ1A 1Q0WB 2L0TA 4DHZE 1WGRA 4BFRA 2FIDA 4EZLA 4MH0E 2GBMA 2Z0EB 1Q5WB 4PS3A 1YQBA 2RR9A 4FULA 3DQVA 1EF1A 2IO0B 4NQKE 2LD9A 1K8RB 1SE9A 3NY5A 2K8HA 5C1ZA 2OOBB 2IZVB 4MJSB 3L54A 3JSVA 3DVGX 4MSMB 2IYDB 3Q3JA 3B08A 3R3MA 3ZVVA 2K1FA 5E6NA 2L7RA 1RFAA 4A20A 3JYUA 2JRIB 2KDEB 3CMMB 4TQ0A 2ZZPB 2G45B 2MX2A 2BKRB 4XC2A 4AOFA 3PSEB 4HXDA 2N9XA 4WQOB 2KC1A 1E8YA 4ZDVA 2O6VD 4MM3A 4N9F4 2LXAA 2KX3A 3OJ4B 4FJVB 2DAJA 4MGYE 1E7UA 3EFUA 4WJOA 2MBHA 1Z2MA 2D11A 2GMIC 2KZRA 1AARA 3CSTA 4IUMB 2HE7A 4JQWC 3SDLC 3VTVA 3L16A 3JSVB 2LUEA 1SGHA 5AZHA 4EUTA 3WIMA 5C23A 4JGHB 1E5WA 2GBJA 1RLFA 2DYMA 2Y5BB 4IWPA 3T8MA 3R7QA 1CMXB 2UWQA 2WWZA 2AWTA 5DCNA 1J0GA 1TGZB 1R4NI 2A5UA 3M63B 2MA9B 2JT4B 1NDDA 3TCAA 2KX0A 1VD2A 2M0XA 4GDLA 3L17A 4FLHA 2M1MA 4MEMA 4M8NA 2KTRA 2N9PC 2PE6B 3H1UA 3ZNHB 3ZNID 3VAWA 1RAXA 3PRMB 2FCSA 4XZ4A 4FADA 2ZEQA 5L95C 2LZ6A 1IP9A 3JW0X 2FIFA 3TJPA 2YLMA 3TMPB 3PT2B 1Y8RC 1V5OA 3IFWB 4YL8A 1WY8A 4DWFA 4W9FA 3DPDA 3TIXA 1E8WA 4KV2A 1J19A 4PYZA 3RUIB 1KLVA 3NHEB 5BO4B 2MSED 2RPQA 2ZVOA 2ZNVC 5CTRC 2EKEC 3WAMA 3ZTCA 1V9JA 1OEYJ 4MSQB 2KXJA 2N7DA 2XK5A 1WIAA 4PS8A 2KWVB 2FCNA 3KUCB 2MWSB 2ZCBA 4GDLB 4W9KA 1OTRB 3RCZA 3WANA 3W1SC 1D3ZA 2KTRB 4DHZB 2RSUA 1E90A 2J0MA 2JF5A 1WYWB 2N1WA 1WJNA 2KDIA 5AEKB 1IYFA 1Q1OA 2KJRA 4EKUA 4W9JA 1U4AA 3ZRCA 3A33B 4EEWA 4K81A 1YD8U 4E3CA 1WMHA 4MELA 2DENB 3WA0A 1WJ4A 4MGKE 4ASWC 1WE6A 3O65B 4BBNF 2ZJDA 4HLEA 4A3PA 2JZZA 1V86A 3KYCD 2REXA 4BOSC 1V6EA 4ANXA 1WX8A 2DYBA 2N1VA 3WALA 2IY0B 5AZFA 2G4SA 2J0JA 2XK5B 4BVUC 2D10A 1P9DU 1VCBA 1E7VA 2IY1B 2NVUI 4IWQA 1F9JA 3PHWB 3PLVA 3QHTA 2KOXA 3IVFA 3HK0A 2GBNA 4BKGA 3PRZA 1WM3A 1H4RA 1LXDA 2PJHA 3AU5A 1WMHB 4AJYB 2N4FA 4LCDE 2I1JA 4OVUA 2AEHA 1WR1A 1P3QU 3P2BA 2KO3A 3QK0A 4TQ1A 4WJNA 4CO7A 3QQ8B 1L2NA 3QCAA 1Z5SB 3K9OB 2FNJB 2MW5A 2HTHA 2L8JA 4ANWA 2KQSA 2KFJA 2MP2A 4HPMB 1MG8A 3RT3B 4HK2A 1T0YA 5J2RA 4F7ZA 2KMAA 2LGYA 1EF5A 3KYDD 1WI0A 3MTNB 2L3ZA 2K6DB 4MGIE 2KK8A 3A4SC 4FBJB 3RZFA 3U8ZA 4DK5A 4J6IA 5G2NA 1ZKHA 2LXCA 3VFKA 1ZW7A 3QC8B 3VUYA 1NBFC 3APCA 5LXIB 1H8CA 3ZDTA 1KOTA 4KVGB 4FA6A 2DZIA 4GGQA 3ML8A 4ZRJA 1GJZA 4WWOA 3X23A 2CHXA 3CSFA 2KWCA 1WZ3A 2KD0A 3OJ3A 4AP4C 1OGWA 4GSWA 5E6PA 3TBLD 3DVGY 3QAQA 2CU1A 2K39A 4HPLB 4W9GA 2MP2B 2WX1A 1GUAB 4ANUA 4NJ7A 5KHOA 3U7DA 4I6PA 4DDID 1V2YA 1M94A 4K1RB 3C0RB 2KMCA 4DHJB 2JXXA 3A9JA 1OQYA 3A1QA 3NZUA 1WXAA 3L10B 4FJZA 2MQJA 1L7YA 3UQBA 2GBRA 2FCQA 2W9NA 2WYQA 4FJYA 1RRBA 4EFOA 1P98A 5GMVA 1P0RA 1WF9A 2AL3A 1S3SG 2VRRB 1JRUA 2OJRA 2CR5A 4ZRIA 1V81A 2J7QB 2C7HA 1G6JA 1HE8A 1NI2A 1OEYA 3DBHI 3HM3A 1SIFA 3PHXB 4W9CA 2N9EB 2WX0A 4G0NB 3W1YA 4LJOB 1ZGUB 3DOWA 2BWFA 4JL9A 3IG3A 2IO3B 1WM2A 3A9JB 2FCMA 2KJ6A 3A1QB 1KJTA 3R66C 2IO2B 4LDTB 2PPHA 4NNJB 2D3GA 2L05A 2Z0DB 3LJ3A 2NS5A 4GOCA 3PPAA 3K9PB 4HVBA 2DHZA 3KVFB 4B9KA 2CHWA 2MRPA 2LJ5A 4WWNA 2BKFA 3KUZA 1UELA 2MBOA 3UIOB 3QWZB 2LRWA 2KWUB
chains in the Genus database with same CATH superfamily
3MHZA 5DPWA 3AE7B 1F1HA 5J17A 2WDTB 2KAJA 3Q2AC 4PYUA 1XCTL 2N7EA 2ZPNA 1D4BA 4NJ6A 1F52A 3I3TB 4W9DA 2KLGA 1FRDA 4BKTA 2QJLA 1XCQL 5T8IA 1ZOYB 3CF6E 4A90A 2AX5A 2UU7A 5D3DA 3BWUD 2W82A 2WXMA 3OWEB 1FCLA 4JPSA 1TS5A 3N32A 5AUIA 1L6UA 2BGFA 2RD0A 1L4ZB 3WAOA 3ONSA 2MBQA 3N20C 1ZXIA 2NBVB 2PEAA 3A9KA 1TBEA 3Q3OC 5H8YE 2KQ4X 1N61A 3ZW3A 5G5GA 2GI9A 1GB1A 1WJ6A 2QC8A 3N3KB 2AQ2B 3AEAB 3M95A 3DVNU 5HI1A 4HWIB 4BBNC 2KNBA 3VUWA 1QOAA 1C76A 2JWZA 2LRUA 2ZVNA 1YX5B 3ECIA 3T3NA 3A9KB 1TJEA 3BIID 1VLBA 1K53A 2BWES 3PZ7A 3VQIA 3PV1A 4DDGD 4L1BA 5LXHA 4II3B 1VRAB 1JWMD 2M8SA 1WJUA 4XX5A 5G5HA 1QT9A 1YNTE 1HQRD 5IAAC 5GXGB 2M17A 1WSPA 1SJHD 2DBYA 4WWMA 3ZXVA 1C1YB 3URYA 4W9IA 1AW7A 1C78A 3HIZA 2KACA 4NJCA 4AJWA 1E8XA 1I4HA 3SR6A 3EC8A 4IDIA 3UF8A 1I4QA 2IBIB 4BAXA 2JY6A 4ZYNA 1XEEA 2KN5A 4NAWA 2MBEA 2ASQA 3NVZA 1D5MC 4JIOU 1XD3B 3PRPB 2O6VA 3ALBA 4YTMB 1TIFA 4PT5A 1E7PB 4KDIC 2BYEA 3FC4A 3KLSX 2BB6A 3DBRI 3KUDB 3I9V1 1GC6A 2K8BA 1R7SA 2KDMA 2MJDA 4IC7B 5DPSA 2K5PA 1VZ6A 2WDQB 2N0SB 2GB1A 1ZUD2 3Q3MC 3BK2A 4OW0A 5JHAA 3SFEB 2O2VA 1YN5A 2DYOA 1AYFA 1BT0A 4NAWB 4D2KA 4URKA 3MC9A 5CHVC 1PUTA 2O6VB 1Q10A 1D5ZC 1V1OA 2KDBA 4W9LA 2QILA 4G11A 1UH6A 2ZNVB 4HDQA 4HJKA 1FIQA 3V3XA 1WGYA 2D5GA 4BOZB 4RNAA 4DXAB 1ACCA 1WGHA 3OAWA 2M19A 2ZW0A 3VTUA 2O2VB 1J7BA 3ZO5B 1KLUD 2HJ8A 1UBQA 4W9HA 3L0WB 3EA6A 4MJSA 3VHTC 5D2MB 2WXOA 3QX1A 4IOIE 2MJ3A 3DVNV 3VR9B 4RGMA 4EZLA 1A70A 1KF6B 3SEBA 2B76B 2BS4B 2IO0B 4NQKE 3O13A 1I7HA 2IZVB 4MJSB 3JSVA 3R3MA 2L7RA 1RFAA 2V3PA 4TQ0A 2G45B 1KH0A 3PSEB 2QEJC 4WQOB 1CK1A 1XF5L 4MM3A 2ZW1A 1E7UA 3EFUA 4WJOA 2H88B 2RPVA 2HE7A 3DWGC 3SDLC 3TEZA 5MPOA 3JSVB 1SGHA 4EUTA 5C23A 3AEEB 3AMZA 2WLBA 4IWPA 3T8MA 2RMMA 1QOFA 3R7QA 1CMXB 2JQRB 2SEBD 3BYTB 1TGZB 2A5UA 3M63B 1EU4A 1QQRA 2JT4B 3NZ3A 4MM3B 2KX0A 2FUG1 3RNGC 3B2GA 3ZNHB 3ZNID 1QOBA 1RAXA 4XZ4A 1J7CA 5L95C 1IP9A 3ZYYX 3PT2B 4USAA 3NRZA 4KV2A 3RUIB 3NHEB 3ZJTA 2MSED 2ZNVC 1OEYJ 2WXRA 3KUCB 2ZCBA 1OTRB 1BXTA 1HA5A 2KDIA 5AEKB 1MI0A 4EKUA 4AQ7A 2BW2A 5HFYA 4EEWA 1K52A 1L4DB 1WMHA 3C19A 3Q8FA 4MELA 1FFVA 4MGKE 4ASWC 2ZJDA 4HLEA 2JZZA 2REXA 1RWSA 1WX8A 2DYBA 5AZFA 2G4SA 1TY0A 1E7VA 1YJIA 2IY1B 3PHWB 3QHTA 4TMAB 2VZKB 4BKGA 2K0PA 4RF1A 1H4RA 1LXDA 3AU5A 1WMHB 2IGDA 4OVUA 3P2BA 2KO3A 4WJNA 3FILA 3B9JA 2HTHA 4OHJA 4KGSA 4HPMB 1MG8A 2JX5A 1T0YA 5J2RA 1FPYA 3MTNB 1EF5A 3DHGC 4MGIE 2KK8A 3A4SC 3DBLB 4XWWA 3RPFC 4J6IA 5G2NA 1ZKHA 4LK0M 4DXGA 2ACZB 1KOTA 4KVGB 5C2TB 1HTQA 4FA6A 4WWOA 1L0VB 2HDEA 3X23A 2KN4A 3FILB 3OJ3A 3CSFA 2KWCA 4AP4C 2CU3A 5E6PA 4J3OD 2CU1A 4W9GA 1CJEA 4ANUA 1PGAA 4DDID 4I6PA 4LNKA 5E6JA 3A9JA 3AEDB 4FJZA 1NYRA 1D5XC 1R4MB 1C9FA 2WNMA 2W9NA 1JMLA 4US8A 2AL3A 4P1BC 1F77A 4YSZB 1TS2A 1NI2A 2LUMA 3HM3A 1SIFA 2IPKD 1PGBA 3A9JB 1ZP0B 4NAMA 4RH6A 2PPHA 2D3GA 2MHJA 2WXQA 4GOCA 3PPAA 3DHHC 3DBHB 2DHZA 2CHWA 1C77A 3KUZA 2MBOA 5IOIA 3TEWA 2LRWA 4RFBA 2I1KA 2INNE 2M0AA 1HXYD 1TS4A 3PTFC 1GB4A 2AL6A 2INPE 1MJDA 1NEKB 2L32A 1IUEA 4ZRKA 2IGGA 2BYFA 2ONQA 1E0ZA 3UI3A 2K9XA 4ITKA 2L1AA 3H6NA 3ZXRA 1SSNA 1GAQB 4XWTA 3PZDA 2L76A 3AN1A 4WJQA 2KQ7A 3BVMA 2JSVX 4DXFA 2KKCA 3NJTA 4QAYA 1TTNA 4AUQC 1X1MA 1KM7A 4YT0B 1UNSA 4IM3A 2C9WB 1AWDA 4KSLC 3DWMA 3IAS1 3L08A 1TKYA 3AV8A 3Q8BA 2DZJA 1WRIA 1FXTB 5DPTA 1YMHE 3HVZA 3VUXA 1WFYA 4WH4A 2W54A 1JWBD 3FKYA 4G50A 1FMAD 5L83A 3ZTDA 2L52A 3BINA 1UF0A 1VDVA 1T3QA 2FE8A 2G9HD 2MBBB 4GMVA 2KANA 3GZNI 3ETRA 1UZXB 4AWJA 5KHQA 1FCCC 5J18A 3B1LX 3MHSD 4HCPB 4KZ0A 5JZEB 1S1QB 4K7WA 5I4DA 2WDVB 3DDCB 3APDA 4BKSD 4P16A 1GG3A 4FHJA 2LVQA 2JVCA 3BY4B 2DAFA 2LMCA 3L13A 2X38A 4EZJA 4L23A 5H92C 1V5TA 3DBSA 4E74A 3APFA 4KSKC 3OLMD 2K3UA 5TR5A 5G55A 3UINB 2XBBC 2LVOA 2E6XA 1MHHE 3VH3B 2JRHA 2Z59B 4A6QA 4ARIA 2BB5A 3VXWA 2DX5B 3Q8AA 4JE3B 3R7RA 4CHKA 4ZYSA 4LJPB 3NUHB 3ZNGC 1RFKA 2K25A 4RCOA 2FAZA 3AU4A 4X57B 1N60A 1N62A 3ZDMC 3N30A 3RZWC 1T0QC 5LNK1 2GLSA 2MJEA 4MDKE 3KQ4A 3AE2B 4TUUA 3IBEA 3TL5A 3GE3C 3VRBB 3ML9A 2KYWA 1DGJA 3EGRA 1QF6A 4A8XC 4ANVA 3IT4B 1XT9B 2BYVE 1TS3A 3PREA 2YVCA 3P1MA 1JALA 3NZSA 4K7UA 2GBKA 1T0SC 3DHIC 2V3SA 1I4XA 2WHIA 3SHQA 2RDHA 4IKGA 3BZDB 1L6VA 1FNUA 4M00A 3Q6BA 4BZAA 4XE0A 2G4DB 3M62B 4ICUA 3Q8CA 4AS1A 2KDFB 2WXHA 5D7GA 4B95A 2PTLA 3NOBA 3RNFC 1T6BX 4MH8A 1UBIA 1WGRA 1MFWA 4HKZE 4MH0E 2GBMA 1LGRA 1RM6C 1Q5WB 4LTUA 4ZOHC 5HHDG 1ESFA 1SE9A 2K8HA 5C1ZA 2XNAC 3GS2A 3L54A 1GPXA 4KKJA 1FNWA 3Q3JA 3B08A 3AE5B 3JYUA 2JRIB 4XC2A 2BKRB 2PW9A 4AOFA 1ET6A 2N9XA 2WXFA 2BVCA 3OJ4B 5JXVA 1XLQA 2DAJA 2MBHA 1B1ZA 2KZRA 4Q2JA 3L16A 3RN9C 5AZHA 2PIAA 3WIMA 1C4CA 2DYMA 2OHFA 1UGJA 1J0GA 2DLBA 1R4NI 2BBCA 2Y5CA 3AECB 2MA9B 1VD2A 4GDLA 4FLHA 2N9PC 2PE6B 1TKGA 2FCSA 3JW0X 2TSSA 3LYYA 2QDFA 2WXNA 3DPDA 4O1NA 4PYZA 1KLVA 2ZVOA 3ZTCA 1TYGB 1CZPA 2KXJA 2XK5A 2FCNA 4GDLB 3AH7A 1ET9A 2PKOA 2N1WA 1IYFA 1TZOA 2K22A 1Q1OA 3SFDB 2WXGA 1U4AA 1SF0A 4K81A 2DENB 3WA0A 5D3IB 4A3PA 4ANXA 3WALA 2IJ0A 3P4QB 2XK5B 3N1YC 1T5XD 4CQNA 2N9KA 4ZHPA 3RNCC 2KOXA 1B9RA 5IN7A 3TUOA 1MHXA 3TEXA 3L4PA 2GBNA 1ZXHA 3RFZB 3GP7A 2R61A 2I1JA 4KX6B 1P3QU 4CO7A 1D6EC 1Z5SB 3QCAA 4LNIA 4DQOC 2KQSA 2N7JA 2L3ZA 4ACFA 2JZPA 3NVYA 1XLPA 2LXCA 3VFKA 2H89B 3QC8B 3VUYA 1H8CA 1N5XA 3ML8A 4ZRJA 3MJ5A 1WZ3A 1JCKB 2KD0A 1YQ3B 1OGWA 4GSWA 3TBLD 3DVGY 1QOGA 4NJ7A 1V2YA 1M94A 5C3JB 2FBWB 3ABVB 3BVGA 1OQYA 3A1QA 3NZUA 1WXAA 3RNAC 4TSSA 1NI3A 3Q14C 1K51A 1L7YA 2GBRA 2WYQA 3MC0B 4EFOA 1DOYA 2OJRA 1V81A 3WCQA 2J7QB 4C7YA 2C7HA 3BK1A 1G6JA 3DBHI 2N9EB 3NS1A 2OEDA 2WX0A 4LJOB 1ZGUB 2BWFA 4JL9A 2IO3B 1WM2A 3A1QB 2IO2B 1DYQA 2YEPF 2L05A 1E6EB 3R2TA 3K9PB 3MFGA 4HPPA 1YOVB 4IM0A 2LGXA 1SE4A 3NVVA 2CHZA 4ICVA 3PGEA 3RULA 4GB9A 4WAAA 1NENB 1SXTA 4NPNA 2KLCA 2JPHA 4EOYA 1F0ZA 3AM9A 3W2DA 1WGGA 3W1SA 4N59A 4OZCA 3AE1B 3AE3B 1GC7A 1EUVB 4FN2A 5LLIA 1J7AA 3Q69A 4F8CB 2E3TA 5D94A 3WAPA 1N63A 4XDCA 3HRDD 2JYTA 2RDGA 2DZMA 2QSDA 1YQ4B 2V3NA 3RMKC 1KTKA 5CX3A 5BYRA 4DBGA 4L2YA 1ZDXA 3LDZE 3T9LA 2ICIA 2EMSA 4M01A 2IO1B 2KJHB 4OVVA 4A55A 4NY0A 4HDOA 2YEPB 4II2B 1NVID 2NBUA 4JLCA 3P4SB 2MCNB 3VRAB 4RM9A 4E71A 3U30A 3W5UB 4LNFA 5AZGA 3UGBB 2HJ1A 2V9HA 4IW0A 4WWPA 2C5LC 4G3XB 1P1AA 3H7SA 5JH5C 2J0KA 4W9EA 4HJGE 3U2SC 1EU3A 1LQBA 1UWMA 4JX1C 3H7PA 1YX6B 2QHOA 5EE3A 1PDXA 1JW9D 1FO4A 5EE1A 1YN4A 4P6VF 3IAM1 3V6CB 1ISNA 4ARCA 3PO0A 3V62A 1WX7A 2GOWA 4LNOA 1QLBB 3RNBC 3ZQ4A 2AYOB 2LGDA 1RYJA 1I4GA 3ZIMA 3FAHA 3QARA 3Q3FA 4NQLB 2V4LA 3LXFA 3GE8C 4MACA 1GNUA 3H7PB 3SU8X 4YTNB 4TV3A 3KH0A 4XDDA 3H8HA 2Y3AA 2KC2A 1GOZA 1K50A 4GU2A 4PS7A 4MGZE 4P7IA 3IT6B 3AXCA 5TSSA 3QIJA 5BMIA 5JHBA 2XN9C 3ZUNA 1FNVA 2HTME 1C79A 1EM7A 1IGCA 1FFUA 1UGMA 4F1SA 3GOEA 3HUIA 4ZHOA 3ZNZB 3QJZA 4HRSA 2D3CA 2LEKA 2CS4A 3N1XC 1SE2A 1XQQA 4YSXB 3BYYB 1NYQA 2BS3B 2VH1A 1L0XB 3V6EB 1V49A 2JUOA 1CQVA 4IM2A 1N5WA 3H9DA 1JRPA 1HZ5A 4I6LB 4RM8A 2KHWB 1I4PA 1LM8B 3VTWA 3W9CB 1I35A 1WXSA 2Z8LA 3ZKJC 3PLUA 2KVRA 3N9YC 1FRRA 3S2AA 1WXVA 5D6JB 3U52E 4S17A 3EUB2 4GLSC 3ENEA 4K7SA 2NBWB 5DPRA 2A4ZA 1I42A 2NMQA 3PS6A 1WXQA 2NTSA 2KVZA 1TZ1A 1Q0WB 2FIDA 2Z0EB 1YQBA 2W3RA 1PGXA 1EF1A 4HEA1 2OOBB 2MH7A 2LGSA 2WU2B 2LJIA 2ON8A 1V8CA 2K1FA 5E6NA 4B0EA 4OZBA 2ZZPB 2MX2A 4REZA 4HXDA 1E8YA 4ZDVA 3AEGB 1ZDVA 4N6EB 2LXAA 2KX3A 4MGYE 1Z2MA 1AARA 3CSTA 4IUMB 4JQWC 2LUEA 1DOXA 3TSSA 1E5WA 2GBJA 2G1EA 3MC8A 2UWQA 2WWZA 2AWTA 4WAFA 3TCAA 1TKEA 1V97A 3L17A 3H1UA 2QIEB 2ZEQA 2PMVA 2YLMA 1JWAD 3IFWB 1V5OA 2WXPA 1WY8A 4W9FA 2LHDA 1E8WA 2EKEC 2CJNA 1V9JA 3LB8C 1QILA 2N7DA 4PS8A 2KWVB 4EE2A 3RCZA 4W9KA 4WIPA 3VR8B 1P7EA 2WU5B 4DHZB 2J0MA 2JF5A 3I5JC 4RGOS 1WJNA 2KJRA 1FXAA 4W9JA 3ZRCA 4PK1A 1TT5B 1FEHA 1YD8U 4E3CA 1JWUD 3TEYA 1WE6A 3O65B 3U4EG 1C4AA 1V86A 1VZ8A 1V6EA 4FXCA 2IY0B 1KLGD 4BVUC 2D10A 1VCBA 4N58A 1P7FA 2NVUI 2PVOD 1F9JA 3Q3NC 3PLVA 3P4PB 3IVFA 4WURA 1MG4A 3PRZA 5BYSA 1KFYB 1MPEA 1MVKA 2N4FA 4LCDE 3NG0A 2EKIA 2AEHA 1F2RC 2VH2A 2WDRB 3QK0A 3K9OB 2FNJB 3KWVA 2L8JA 2I38A 4ANWA 4HK2A 4F7ZA 2LGYA 1WI0A 3U8ZA 1WYGA 2OJWA 3BVZA 4DK5A 3AEBB 5LXIB 4NZLB 4C56C 4GGQA 1GJZA 1L0YB 1VJKA 1FXIA 5AUKA 1WWTA 2K39A 4HPLB 3AE8B 2QMTA 3U7DA 4K1RB 3C0RB 1ZPSA 2KMCA 3HVDA 4JWSC 2JXXA 2Q5WD 2MQJA 3GZNB 4FJYA 5GMVA 1P0RA 4ZRIA 2VRRB 4XGAB 1OEYA 3PHXB 4W9CA 2KMMA 4C7ZA 2IDYA 4G0NB 3E9SA 1JQ4A 4M0WA 2FCMA 3R66C 3Q8EA 1JWSD 3LJ3A 2NS5A 2CJOA 1FD6A 4HVBA 4B9KA 3KVFB 2MRPA 3T3OA 2LJ5A 2WGSA 2WP9B 4WWNA 1QKZA 2DWQA 4K3CA 1UWXA 3QWZB 1HZ6A 2BTEA 4TKNA 1DOIA 3DCGA 4M0WB 4P1CC 5BMGA 1V1PA 2D07B 2MLBA 2I2YA 2J42A 3E56A 2NPTA 4C00A 5CHWA 4DHJD 2D2QA 3B0AA 4LLGM 4GN1A 2N9LA 1YJJA 1UD7A 2BF8B 1V80A 3RD2A 2UYZB 2WQYB 2M4NA 2EMTA 4JWUC 2J53A 1V1PB 2WXKA 3RYTA 5CHFA 1E8ZA 1C3TA 4IG7B 3ZGZA 3ZLZA 2FUHB 1IBXA 5IA7A 3DBLI 4FHKA 2NPTB 1M4VA 3QA8A 2LASA 2BPSA 3X0WA 2KWDA 4LDTD 3AI5A 2V1YA 3A4RA 2KT7A 4GDKA 4WQMA 1AN8A 3D32A 5E6OA 1EO6A 4K3BA 2ZCCA 3HHMA 1L5PA 1Y56A 1A5RA 4A3OA 2NCNA 2BS2B 1IBXB 4A9AA 2HD5B 3R2IA 1UUPA 3VVWB 4US9A 1WXMA 3VH4B 3ZJVA 1WZ0A 4C80A 1YJ1A 3RI7C 1WR6E 2XEWA 1R4MI 3AE4B 4GDKB 3NS8A 1XLOA 2JU6X 3V05A 3AULA 2PLPA 2K6QA 3KW5B 3KWLA 2C60A 3IHPC 2BYTA 1N6ZA 3MP9A 3UQAA 1WH3A 1XLNA 1YIWA 2ZPYA 3R8BA 3EECA 2AQ1B 2B3AA 3PVLA 4GIVA 2WXLA 1EWYC 3V60A 4IWOA 3M3JA 1WX9A 1WGDA 3AB5A 2LVPA 2PE9A 4HKQA 2G3QB 2LI5A 3ZRFA 2NTTA 1SE3A 4CYEA 3JVZX 4RMAA 1QZEA 4KGRA 3UIPB 3EFCA 5HKHA 4R3DA 2JYEA 3SD5A 3V61A 2RGFA 4HROA 2NR2A 2CKHB 2DNFA 4BKSA 5FR3A 5FR6A 2KTFA 1VZ7A 4KZCA 1FM0D 2BT6A 3EHVA 2J4XA 1LFDA 3IXSA 1R4NB 4MT5A 1J8CA 4B0MA 5EDSA 3VDZA 1E9MA 2DZKA 2SAKA 1ZE3D 1WE7A 2PVGC 2BQQA 3MJWA 4HCNB 4OVZA 4M8MA 1PQSA 1OQRA 4B6WA 3AE6B 3P63A 2R2QA 3U7ZA 2JZ3B 2L00B 1JROA 2L0FA 3DBRB 4KIKA 5EE9A 2AQ3B 2KFKA 4GXBA 4WJPA 3J9CA 4I6NB 4RGNA 2K8CA 2WXJA 2C7NB 3C8YA 4EZKA 2R2OA 3HM6X 1SIJA 2D3BA 4LNNA 2INCC 2LWPA 1WRDB 2WS3B 4KDLB 2QCZA 4YTPB 4KIKB 2C7MB 1IPGA 1F2RI 1OFFA 1SEBD 2KFKB 3P42A 4YXDB 2L0TA 4DHZE 4BFRA 4PS3A 2RR9A 2W55A 4FULA 3DQVA 2LD9A 1K8RB 3NY5A 5FKAC 3DVGX 4RGTA 4MSMB 2IYDB 3W5VB 1I4RA 3PZ8A 3ZVVA 4A20A 2KDEB 3CMMB 2IGHA 2L83A 3N1ZC 1PFDA 2KC1A 1EWCA 5EE0A 2O6VD 4N9F4 3CWIA 4FJVB 2D11A 2GMIC 2M56B 3VTVA 2GRIA 4JGHB 4KKIA 4S0RA 1RLFA 5BMHA 2Y5BB 5DCNA 2V0GA 1ROEA 1NDDA 2M0XA 2M1MA 4MEMA 4M8NA 5IKCM 2KTRA 2LGIA 3VAWA 3I57A 3PRMB 4FADA 2LZ6A 3P4RB 2D3AA 2FIFA 2WXIA 3TJPA 3TMPB 4M02A 1KRHA 1Y8RC 4YL8A 4DWFA 3TIXA 1J19A 5BO4B 1E10A 2RPQA 5CTRC 3WAMA 4KGTA 4MSQB 1WIAA 2MWSB 3WANA 1D3ZA 4OZAA 3W1SC 3CIRB 2KTRB 5BYQA 2RSUA 1E90A 1WYWB 1HTOA 3A33B 3OG5A 4ZRPA 1WJ4A 1VR9A 4BBNF 5IO9A 2INDC 3KYCD 2LHEA 5IP4D 4BOSC 3ZJUA 2N1VA 1IGDA 2J0JA 1P9DU 4RF0A 1LO5D 4IWQA 3NVWA 2EELA 3HK0A 4YWGG 1SB3C 1WM3A 2LFIA 2PJHA 2JWUA 4AJYB 1WR1A 4TQ1A 3QQ8B 5FK9C 1L2NA 2MW5A 2KFJA 2MP2A 3RT3B 3I63C 2KMAA 3KYDD 2K6DB 3B2FA 2V4IB 2X8XX 4FBJB 3RZFA 4ZRQA 4C4VA 3AE9B 2MEKA 1SBBB 1ZW7A 1NBFC 3APCA 4H2AA 3ZDTA 2DZIA 1STEA 2Y5PA 1ENFA 2J52A 2CHXA 3QAQA 1SJED 1WGKA 2MP2B 2W3SA 5HG2A 2WX1A 1GUAB 1BMLC 5KHOA 3AEFB 4UDUC 3RNEC 4DHJB 1OQQA 4C4VB 3L10B 1TY2A 2RDBC 3UQBA 4XYCA 2FCQA 1C4PA 1T0RC 1RRBA 1HEZE 1P98A 1PYWD 1WF9A 1BUIC 1S3SG 2JXTA 1JRUA 2CR5A 2VZKD 1YN3A 1HE8A 3W1YA 3DOWA 3IG3A 2KJ6A 1KJTA 4LDTB 4NNJB 2Z0DB 4YSYB 1XO3A 2BKFA 1XXGA 1UELA 3UIOB 3GB1A 2KWUB
chains in the Genus database with same CATH topology
4IM0A 2LGXA 2CHZA 4ICVA 3PGEA 5DPWA 3RULA 4GB9A 4TKNA 2I1KA 3DCGA 2WDTB 4M0WB 5J17A 4WAAA 4PYUA 4NPNA 3PTFC 2AL6A 2D07B 2MLBA 4ZRKA 2N7EA 2BYFA 2ZPNA 2KLCA 2JPHA 4EOYA 2NPTA 1WGGA 3H6NA 3W1SA 5CHWA 4DHJD 2D2QA 3B0AA 4NJ6A 3I3TB 3PZDA 1GC7A 1EUVB 2L76A 4W9DA 4GN1A 4FN2A 2KLGA 5LLIA 4BKTA 1UD7A 4WJQA 4F8CB 2BF8B 5D94A 1V80A 3RD2A 3WAPA 2KQ7A 2UYZB 2KKCA 2DZMA 2M4NA 1TTNA 2EMTA 3CF6E 4AUQC 1X1MA 3RYTA 5CHFA 1E8ZA 1KM7A 5CX3A 4DBGA 4IM3A 1C3TA 4IG7B 2C9WB 3ZLZA 2FUHB 3LDZE 4KSLC 5IA7A 3DBLI 4FHKA 2EMSA 2NPTB 3L08A 3N32A 3T9LA 2BGFA 2IO1B 2KJHB 2RD0A 4OVVA 3WAOA 3ONSA 4NY0A 2MBQA 4HDOA 2DZJA 3QA8A 2LASA 1FXTB 2NBVB 2PEAA 3A9KA 2BPSA 4II2B 5DPTA 3X0WA 3VUXA 4LDTD 1TBEA 1WFYA 2NBUA 3AI5A 2V1YA 3A4RA 4GDKA 4JLCA 4G50A 3D32A 5E6OA 1EO6A 2MCNB 3ZW3A 2ZCCA 3HHMA 1A5RA 4A3OA 1WJ6A 2NCNA 4RM9A 3N3KB 5L83A 4E71A 3U30A 3M95A 3DVNU 5AZGA 3ZTDA 4HWIB 3UGBB 4BBNC 2KNBA 2HD5B 3VUWA 4IW0A 4WWPA 2C5LC 2JWZA 3BINA 2LRUA 2ZVNA 3VVWB 1YX5B 3ECIA 1P1AA 3H7SA 4G3XB 1WXMA 3VH4B 1WZ0A 2MBBB 5JH5C 4GMVA 3A9KB 1YJ1A 1WR6E 2J0KA 2KANA 2XEWA 1R4MI 3GZNI 4W9EA 4GDKB 1UZXB 4AWJA 3NS8A 1LQBA 5KHQA 3H7PA 5J18A 1YX6B 2QHOA 3AULA 3B1LX 3MHSD 2BWES 4HCPB 3VQIA 3PV1A 4KZ0A 4DDGD 3V6CB 2K6QA 1ISNA 5JZEB 1S1QB 4K7WA 4II3B 1WX7A 2GOWA 3V62A 5LXHA 3KW5B 2C60A 2M8SA 3IHPC 1WJUA 3DDCB 2AYOB 2LGDA 3APDA 4XX5A 3UQAA 1WH3A 1YIWA 3ZIMA 2ZPYA 4BKSD 5IAAC 1GG3A 3EECA 2B3AA 4FHJA 2LVQA 3QARA 2JVCA 3BY4B 2DAFA 3L13A 2M17A 3Q3FA 4EZJA 3PVLA 4NQLB 2V4LA 1V5TA 4GIVA 1C1YB 4W9IA 1GNUA 3V60A 3DBSA 3H7PB 4IWOA 3APFA 3SU8X 4E74A 3M3JA 4TV3A 4KSKC 1WX9A 3KH0A 1WGDA 3HIZA 2LVPA 2PE9A 3OLMD 5TR5A 5G55A 3UINB 2KC2A 2G3QB 4AJWA 2XBBC 2LVOA 1E8XA 2LI5A 4GU2A 4PS7A 3ZRFA 4MGZE 4P7IA 3VH3B 3AXCA 2JRHA 2Z59B 3QIJA 3JVZX 4CYEA 4RMAA 3EC8A 1QZEA 5JHBA 3UIPB 3ZUNA 3UF8A 5HKHA 2IBIB 3VXWA 2DX5B 3SD5A 3V61A 2RGFA 2NR2A 3R7RA 2JY6A 2CKHB 4ZYNA 4BKSA 4NAWA 2KN5A 4CHKA 1UGMA 4LJPB 2MBEA 2ASQA 5FR6A 3ZNGC 2KTFA 4F1SA 4JIOU 4KZCA 1XD3B 3PRPB 3EHVA 2O6VA 3ALBA 1LFDA 3GOEA 2K25A 3ZNZB 4KDIC 2FAZA 3AU4A 2BYEA 3QJZA 4X57B 1J8CA 5EDSA 2CS4A 3ZDMC 3N30A 3RZWC 3VDZA 1XQQA 3DBRI 2DZKA 3KUDB 1GC6A 1WE7A 2K8BA 4IC7B 4MDKE 5DPSA 3MJWA 4HCNB 4M8MA 1PQSA 3V6EB 4B6WA 5JHAA 1V49A 4TUUA 3IBEA 2O2VA 2JUOA 2R2QA 2DYOA 1BT0A 3TL5A 4NAWB 4URKA 2JZ3B 3ML9A 2L00B 4IM2A 5CHVC 3H9DA 2O6VB 2L0FA 4W9LA 2KDBA 4ANVA 4G11A 1UH6A 1XT9B 2ZNVB 2BYVE 4HDQA 4HJKA 3PREA 4I6LB 4RM8A 4KIKA 1WGYA 2KHWB 2YVCA 1LM8B 4BOZB 3VTWA 2KFKA 4DXAB 1I35A 3NZSA 4K7UA 1WXSA 1WGHA 3ZKJC 2GBKA 4GXBA 4WJPA 3OAWA 3PLUA 4I6NB 2KVRA 2K8CA 2V3SA 2C7NB 4EZKA 2R2OA 3VTUA 2O2VB 1WXVA 3S2AA 5D6JB 3HM6X 3ZO5B 3SHQA 2HJ8A 1UBQA 4W9HA 2LWPA 3L0WB 1WRDB 3ENEA 4K7SA 4MJSA 4KDLB 2NBWB 5DPRA 2A4ZA 3VHTC 5D2MB 1I42A 2G4DB 3M62B 4ICUA 2C7MB 4KIKB 1IPGA 2KDFB 5D7GA 4B95A 3QX1A 3NOBA 3PS6A 2KFKB 1UBIA 3DVNV 1TZ1A 1Q0WB 2L0TA 4DHZE 1WGRA 4BFRA 2FIDA 4EZLA 4MH0E 2GBMA 2Z0EB 1Q5WB 4PS3A 1YQBA 2RR9A 4FULA 3DQVA 1EF1A 2IO0B 4NQKE 2LD9A 1K8RB 1SE9A 3NY5A 2K8HA 5C1ZA 2OOBB 2IZVB 4MJSB 3L54A 3JSVA 3DVGX 4MSMB 2IYDB 3Q3JA 3B08A 3R3MA 3ZVVA 2K1FA 5E6NA 2L7RA 1RFAA 4A20A 3JYUA 2JRIB 2KDEB 3CMMB 4TQ0A 2ZZPB 2G45B 2MX2A 2BKRB 4XC2A 4AOFA 3PSEB 4HXDA 2N9XA 4WQOB 2KC1A 1E8YA 4ZDVA 2O6VD 4MM3A 4N9F4 2LXAA 2KX3A 3OJ4B 4FJVB 2DAJA 4MGYE 1E7UA 3EFUA 4WJOA 2MBHA 1Z2MA 2D11A 2GMIC 2KZRA 1AARA 3CSTA 4IUMB 2HE7A 4JQWC 3SDLC 3VTVA 3L16A 3JSVB 2LUEA 1SGHA 5AZHA 4EUTA 3WIMA 5C23A 4JGHB 1E5WA 2GBJA 1RLFA 2DYMA 2Y5BB 4IWPA 3T8MA 3R7QA 1CMXB 2UWQA 2WWZA 2AWTA 5DCNA 1J0GA 1TGZB 1R4NI 2A5UA 3M63B 2MA9B 2JT4B 1NDDA 3TCAA 2KX0A 1VD2A 2M0XA 4GDLA 3L17A 4FLHA 2M1MA 4MEMA 4M8NA 2KTRA 2N9PC 2PE6B 3H1UA 3ZNHB 3ZNID 3VAWA 1RAXA 3PRMB 2FCSA 4XZ4A 4FADA 2ZEQA 5L95C 2LZ6A 1IP9A 3JW0X 2FIFA 3TJPA 2YLMA 3TMPB 3PT2B 1Y8RC 1V5OA 3IFWB 4YL8A 1WY8A 4DWFA 4W9FA 3DPDA 3TIXA 1E8WA 4KV2A 1J19A 4PYZA 3RUIB 1KLVA 3NHEB 5BO4B 2MSED 2RPQA 2ZVOA 2ZNVC 5CTRC 2EKEC 3WAMA 3ZTCA 1V9JA 1OEYJ 4MSQB 2KXJA 2N7DA 2XK5A 1WIAA 4PS8A 2KWVB 2FCNA 3KUCB 2MWSB 2ZCBA 4GDLB 4W9KA 1OTRB 3RCZA 3WANA 3W1SC 1D3ZA 2KTRB 4DHZB 2RSUA 1E90A 2J0MA 2JF5A 1WYWB 2N1WA 1WJNA 2KDIA 5AEKB 1IYFA 1Q1OA 2KJRA 4EKUA 4W9JA 1U4AA 3ZRCA 3A33B 4EEWA 4K81A 1YD8U 4E3CA 1WMHA 4MELA 2DENB 3WA0A 1WJ4A 4MGKE 4ASWC 1WE6A 3O65B 4BBNF 2ZJDA 4HLEA 4A3PA 2JZZA 1V86A 3KYCD 2REXA 4BOSC 1V6EA 4ANXA 1WX8A 2DYBA 2N1VA 3WALA 2IY0B 5AZFA 2G4SA 2J0JA 2XK5B 4BVUC 2D10A 1P9DU 1VCBA 1E7VA 2IY1B 2NVUI 4IWQA 1F9JA 3PHWB 3PLVA 3QHTA 2KOXA 3IVFA 3HK0A 2GBNA 4BKGA 3PRZA 1WM3A 1H4RA 1LXDA 2PJHA 3AU5A 1WMHB 4AJYB 2N4FA 4LCDE 2I1JA 4OVUA 2AEHA 1WR1A 1P3QU 3P2BA 2KO3A 3QK0A 4TQ1A 4WJNA 4CO7A 3QQ8B 1L2NA 3QCAA 1Z5SB 3K9OB 2FNJB 2MW5A 2HTHA 2L8JA 4ANWA 2KQSA 2KFJA 2MP2A 4HPMB 1MG8A 3RT3B 4HK2A 1T0YA 5J2RA 4F7ZA 2KMAA 2LGYA 1EF5A 3KYDD 1WI0A 3MTNB 2L3ZA 2K6DB 4MGIE 2KK8A 3A4SC 4FBJB 3RZFA 3U8ZA 4DK5A 4J6IA 5G2NA 1ZKHA 2LXCA 3VFKA 1ZW7A 3QC8B 3VUYA 1NBFC 3APCA 5LXIB 1H8CA 3ZDTA 1KOTA 4KVGB 4FA6A 2DZIA 4GGQA 3ML8A 4ZRJA 1GJZA 4WWOA 3X23A 2CHXA 3CSFA 2KWCA 1WZ3A 2KD0A 3OJ3A 4AP4C 1OGWA 4GSWA 5E6PA 3TBLD 3DVGY 3QAQA 2CU1A 2K39A 4HPLB 4W9GA 2MP2B 2WX1A 1GUAB 4ANUA 4NJ7A 5KHOA 3U7DA 4I6PA 4DDID 1V2YA 1M94A 4K1RB 3C0RB 2KMCA 4DHJB 2JXXA 3A9JA 1OQYA 3A1QA 3NZUA 1WXAA 3L10B 4FJZA 2MQJA 1L7YA 3UQBA 2GBRA 2FCQA 2W9NA 2WYQA 4FJYA 1RRBA 4EFOA 1P98A 5GMVA 1P0RA 1WF9A 2AL3A 1S3SG 2VRRB 1JRUA 2OJRA 2CR5A 4ZRIA 1V81A 2J7QB 2C7HA 1G6JA 1HE8A 1NI2A 1OEYA 3DBHI 3HM3A 1SIFA 3PHXB 4W9CA 2N9EB 2WX0A 4G0NB 3W1YA 4LJOB 1ZGUB 3DOWA 2BWFA 4JL9A 3IG3A 2IO3B 1WM2A 3A9JB 2FCMA 2KJ6A 3A1QB 1KJTA 3R66C 2IO2B 4LDTB 2PPHA 4NNJB 2D3GA 2L05A 2Z0DB 3LJ3A 2NS5A 4GOCA 3PPAA 3K9PB 4HVBA 2DHZA 3KVFB 4B9KA 2CHWA 2MRPA 2LJ5A 4WWNA 2BKFA 3KUZA 1UELA 2MBOA 3UIOB 3QWZB 2LRWA 2KWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IM0 A;  2LGX A;  2CHZ A;  4ICV A;  3PGE A;  5DPW A;  3RUL A;  4GB9 A;  4TKN A;  2I1K A;  3DCG A;  2WDT B;  4M0W B;  5J17 A;  4WAA A;  4PYU A;  4NPN A;  3PTF C;  2AL6 A;  2D07 B;  2MLB A;  4ZRK A;  2N7E A;  2BYF A;  2ZPN A;  2KLC A;  2JPH A;  4EOY A;  2NPT A;  1WGG A;  3H6N A;  3W1S A;  5CHW A;  4DHJ D;  2D2Q A;  3B0A A;  4NJ6 A;  3I3T B;  3PZD A;  1GC7 A;  1EUV B;  2L76 A;  4W9D A;  4GN1 A;  4FN2 A;  2KLG A;  5LLI A;  4BKT A;  1UD7 A;  4WJQ A;  4F8C B;  2BF8 B;  5D94 A;  1V80 A;  3RD2 A;  3WAP A;  2KQ7 A;  2UYZ B;  2KKC A;  2DZM A;  2M4N A;  1TTN A;  2EMT A;  3CF6 E;  4AUQ C;  1X1M A;  3RYT A;  5CHF A;  1E8Z A;  1KM7 A;  5CX3 A;  4DBG A;  4IM3 A;  1C3T A;  4IG7 B;  2C9W B;  3ZLZ A;  2FUH B;  3LDZ E;  4KSL C;  5IA7 A;  3DBL I;  4FHK A;  2EMS A;  2NPT B;  3L08 A;  3N32 A;  3T9L A;  2BGF A;  2IO1 B;  2KJH B;  2RD0 A;  4OVV A;  3WAO A;  3ONS A;  4NY0 A;  2MBQ A;  4HDO A;  2DZJ A;  3QA8 A;  2LAS A;  1FXT B;  2NBV B;  2PEA A;  3A9K A;  2BPS A;  4II2 B;  5DPT A;  3X0W A;  3VUX A;  4LDT D;  1TBE A;  1WFY A;  2NBU A;  3AI5 A;  2V1Y A;  3A4R A;  4GDK A;  4JLC A;  4G50 A;  3D32 A;  5E6O A;  1EO6 A;  2MCN B;  3ZW3 A;  2ZCC A;  3HHM A;  1A5R A;  4A3O A;  1WJ6 A;  2NCN A;  4RM9 A;  3N3K B;  5L83 A;  4E71 A;  3U30 A;  3M95 A;  3DVN U;  5AZG A;  3ZTD A;  4HWI B;  3UGB B;  4BBN C;  2KNB A;  2HD5 B;  3VUW A;  4IW0 A;  4WWP A;  2C5L C;  2JWZ A;  3BIN A;  2LRU A;  2ZVN A;  3VVW B;  1YX5 B;  3ECI A;  1P1A A;  3H7S A;  4G3X B;  1WXM A;  3VH4 B;  1WZ0 A;  2MBB B;  5JH5 C;  4GMV A;  3A9K B;  1YJ1 A;  1WR6 E;  2J0K A;  2KAN A;  2XEW A;  1R4M I;  3GZN I;  4W9E A;  4GDK B;  1UZX B;  4AWJ A;  3NS8 A;  1LQB A;  5KHQ A;  3H7P A;  5J18 A;  1YX6 B;  2QHO A;  3AUL A;  3B1L X;  3MHS D;  2BWE S;  4HCP B;  3VQI A;  3PV1 A;  4KZ0 A;  4DDG D;  3V6C B;  2K6Q A;  1ISN A;  5JZE B;  1S1Q B;  4K7W A;  4II3 B;  1WX7 A;  2GOW A;  3V62 A;  5LXH A;  3KW5 B;  2C60 A;  2M8S A;  3IHP C;  1WJU A;  3DDC B;  2AYO B;  2LGD A;  3APD A;  4XX5 A;  3UQA A;  1WH3 A;  1YIW A;  3ZIM A;  2ZPY A;  4BKS D;  5IAA C;  1GG3 A;  3EEC A;  2B3A A;  4FHJ A;  2LVQ A;  3QAR A;  2JVC A;  3BY4 B;  2DAF A;  3L13 A;  2M17 A;  3Q3F A;  4EZJ A;  3PVL A;  4NQL B;  2V4L A;  1V5T A;  4GIV A;  1C1Y B;  4W9I A;  1GNU A;  3V60 A;  3DBS A;  3H7P B;  4IWO A;  3APF A;  3SU8 X;  4E74 A;  3M3J A;  4TV3 A;  4KSK C;  1WX9 A;  3KH0 A;  1WGD A;  3HIZ A;  2LVP A;  2PE9 A;  3OLM D;  5TR5 A;  5G55 A;  3UIN B;  2KC2 A;  2G3Q B;  4AJW A;  2XBB C;  2LVO A;  1E8X A;  2LI5 A;  4GU2 A;  4PS7 A;  3ZRF A;  4MGZ E;  4P7I A;  3VH3 B;  3AXC A;  2JRH A;  2Z59 B;  3QIJ A;  3JVZ X;  4CYE A;  4RMA A;  3EC8 A;  1QZE A;  5JHB A;  3UIP B;  3ZUN A;  3UF8 A;  5HKH A;  2IBI B;  3VXW A;  2DX5 B;  3SD5 A;  3V61 A;  2RGF A;  2NR2 A;  3R7R A;  2JY6 A;  2CKH B;  4ZYN A;  4BKS A;  4NAW A;  2KN5 A;  4CHK A;  1UGM A;  4LJP B;  2MBE A;  2ASQ A;  5FR6 A;  3ZNG C;  2KTF A;  4F1S A;  4JIO U;  4KZC A;  1XD3 B;  3PRP B;  3EHV A;  2O6V A;  3ALB A;  1LFD A;  3GOE A;  2K25 A;  3ZNZ B;  4KDI C;  2FAZ A;  3AU4 A;  2BYE A;  3QJZ A;  4X57 B;  1J8C A;  5EDS A;  2CS4 A;  3ZDM C;  3N30 A;  3RZW C;  3VDZ A;  1XQQ A;  3DBR I;  2DZK A;  3KUD B;  1GC6 A;  1WE7 A;  2K8B A;  4IC7 B;  4MDK E;  5DPS A;  3MJW A;  4HCN B;  4M8M A;  1PQS A;  3V6E B;  4B6W A;  5JHA A;  1V49 A;  4TUU A;  3IBE A;  2O2V A;  2JUO A;  2R2Q A;  2DYO A;  1BT0 A;  3TL5 A;  4NAW B;  4URK A;  2JZ3 B;  3ML9 A;  2L00 B;  4IM2 A;  5CHV C;  3H9D A;  2O6V B;  2L0F A;  4W9L A;  2KDB A;  4ANV A;  4G11 A;  1UH6 A;  1XT9 B;  2ZNV B;  2BYV E;  4HDQ A;  4HJK A;  3PRE A;  4I6L B;  4RM8 A;  4KIK A;  1WGY A;  2KHW B;  2YVC A;  1LM8 B;  4BOZ B;  3VTW A;  2KFK A;  4DXA B;  1I35 A;  3NZS A;  4K7U A;  1WXS A;  1WGH A;  3ZKJ C;  2GBK A;  4GXB A;  4WJP A;  3OAW A;  3PLU A;  4I6N B;  2KVR A;  2K8C A;  2V3S A;  2C7N B;  4EZK A;  2R2O A;  3VTU A;  2O2V B;  1WXV A;  3S2A A;  5D6J B;  3HM6 X;  3ZO5 B;  3SHQ A;  2HJ8 A;  1UBQ A;  4W9H A;  2LWP A;  3L0W B;  1WRD B;  3ENE A;  4K7S A;  4MJS A;  4KDL B;  2NBW B;  5DPR A;  2A4Z A;  3VHT C;  5D2M B;  1I42 A;  2G4D B;  3M62 B;  4ICU A;  2C7M B;  4KIK B;  1IPG A;  2KDF B;  5D7G A;  4B95 A;  3QX1 A;  3NOB A;  3PS6 A;  2KFK B;  1UBI A;  3DVN V;  1TZ1 A;  1Q0W B;  2L0T A;  4DHZ E;  1WGR A;  4BFR A;  2FID A;  4EZL A;  4MH0 E;  2GBM A;  2Z0E B;  1Q5W B;  4PS3 A;  1YQB A;  2RR9 A;  4FUL A;  3DQV A;  1EF1 A;  2IO0 B;  4NQK E;  2LD9 A;  1K8R B;  1SE9 A;  3NY5 A;  2K8H A;  5C1Z A;  2OOB B;  2IZV B;  4MJS B;  3L54 A;  3JSV A;  3DVG X;  4MSM B;  2IYD B;  3Q3J A;  3B08 A;  3R3M A;  3ZVV A;  2K1F A;  5E6N A;  2L7R A;  1RFA A;  4A20 A;  3JYU A;  2JRI B;  2KDE B;  3CMM B;  4TQ0 A;  2ZZP B;  2G45 B;  2MX2 A;  2BKR B;  4XC2 A;  4AOF A;  3PSE B;  4HXD A;  2N9X A;  4WQO B;  2KC1 A;  1E8Y A;  4ZDV A;  2O6V D;  4MM3 A;  4N9F 4;  2LXA A;  2KX3 A;  3OJ4 B;  4FJV B;  2DAJ A;  4MGY E;  1E7U A;  3EFU A;  4WJO A;  2MBH A;  1Z2M A;  2D11 A;  2GMI C;  2KZR A;  1AAR A;  3CST A;  4IUM B;  2HE7 A;  4JQW C;  3SDL C;  3VTV A;  3L16 A;  3JSV B;  2LUE A;  1SGH A;  5AZH A;  4EUT A;  3WIM A;  5C23 A;  4JGH B;  1E5W A;  2GBJ A;  1RLF A;  2DYM A;  2Y5B B;  4IWP A;  3T8M A;  3R7Q A;  1CMX B;  2UWQ A;  2WWZ A;  2AWT A;  5DCN A;  1J0G A;  1TGZ B;  1R4N I;  2A5U A;  3M63 B;  2MA9 B;  2JT4 B;  1NDD A;  3TCA A;  2KX0 A;  1VD2 A;  2M0X A;  4GDL A;  3L17 A;  4FLH A;  2M1M A;  4MEM A;  4M8N A;  2KTR A;  2N9P C;  2PE6 B;  3H1U A;  3ZNH B;  3ZNI D;  3VAW A;  1RAX A;  3PRM B;  2FCS A;  4XZ4 A;  4FAD A;  2ZEQ A;  5L95 C;  2LZ6 A;  1IP9 A;  3JW0 X;  2FIF A;  3TJP A;  2YLM A;  3TMP B;  3PT2 B;  1Y8R C;  1V5O A;  3IFW B;  4YL8 A;  1WY8 A;  4DWF A;  4W9F A;  3DPD A;  3TIX A;  1E8W A;  4KV2 A;  1J19 A;  4PYZ A;  3RUI B;  1KLV A;  3NHE B;  5BO4 B;  2MSE D;  2RPQ A;  2ZVO A;  2ZNV C;  5CTR C;  2EKE C;  3WAM A;  3ZTC A;  1V9J A;  1OEY J;  4MSQ B;  2KXJ A;  2N7D A;  2XK5 A;  1WIA A;  4PS8 A;  2KWV B;  2FCN A;  3KUC B;  2MWS B;  2ZCB A;  4GDL B;  4W9K A;  1OTR B;  3RCZ A;  3WAN A;  3W1S C;  1D3Z A;  2KTR B;  4DHZ B;  2RSU A;  1E90 A;  2J0M A;  2JF5 A;  1WYW B;  2N1W A;  1WJN A;  2KDI A;  5AEK B;  1IYF A;  1Q1O A;  2KJR A;  4EKU A;  4W9J A;  1U4A A;  3ZRC A;  3A33 B;  4EEW A;  4K81 A;  1YD8 U;  4E3C A;  1WMH A;  4MEL A;  2DEN B;  3WA0 A;  1WJ4 A;  4MGK E;  4ASW C;  1WE6 A;  3O65 B;  4BBN F;  2ZJD A;  4HLE A;  4A3P A;  2JZZ A;  1V86 A;  3KYC D;  2REX A;  4BOS C;  1V6E A;  4ANX A;  1WX8 A;  2DYB A;  2N1V A;  3WAL A;  2IY0 B;  5AZF A;  2G4S A;  2J0J A;  2XK5 B;  4BVU C;  2D10 A;  1P9D U;  1VCB A;  1E7V A;  2IY1 B;  2NVU I;  4IWQ A;  1F9J A;  3PHW B;  3PLV A;  3QHT A;  2KOX A;  3IVF A;  3HK0 A;  2GBN A;  4BKG A;  3PRZ A;  1WM3 A;  1H4R A;  1LXD A;  2PJH A;  3AU5 A;  1WMH B;  4AJY B;  2N4F A;  4LCD E;  2I1J A;  4OVU A;  2AEH A;  1WR1 A;  1P3Q U;  3P2B A;  2KO3 A;  3QK0 A;  4TQ1 A;  4WJN A;  4CO7 A;  3QQ8 B;  1L2N A;  3QCA A;  1Z5S B;  3K9O B;  2FNJ B;  2MW5 A;  2HTH A;  2L8J A;  4ANW A;  2KQS A;  2KFJ A;  2MP2 A;  4HPM B;  1MG8 A;  3RT3 B;  4HK2 A;  1T0Y A;  5J2R A;  4F7Z A;  2KMA A;  2LGY A;  1EF5 A;  3KYD D;  1WI0 A;  3MTN B;  2L3Z A;  2K6D B;  4MGI E;  2KK8 A;  3A4S C;  4FBJ B;  3RZF A;  3U8Z A;  4DK5 A;  4J6I A;  5G2N A;  1ZKH A;  2LXC A;  3VFK A;  1ZW7 A;  3QC8 B;  3VUY A;  1NBF C;  3APC A;  5LXI B;  1H8C A;  3ZDT A;  1KOT A;  4KVG B;  4FA6 A;  2DZI A;  4GGQ A;  3ML8 A;  4ZRJ A;  1GJZ A;  4WWO A;  3X23 A;  2CHX A;  3CSF A;  2KWC A;  1WZ3 A;  2KD0 A;  3OJ3 A;  4AP4 C;  1OGW A;  4GSW A;  5E6P A;  3TBL D;  3DVG Y;  3QAQ A;  2CU1 A;  2K39 A;  4HPL B;  4W9G A;  2MP2 B;  2WX1 A;  1GUA B;  4ANU A;  4NJ7 A;  5KHO A;  3U7D A;  4I6P A;  4DDI D;  1V2Y A;  1M94 A;  4K1R B;  3C0R B;  2KMC A;  4DHJ B;  2JXX A;  3A9J A;  1OQY A;  3A1Q A;  3NZU A;  1WXA A;  3L10 B;  4FJZ A;  2MQJ A;  1L7Y A;  3UQB A;  2GBR A;  2FCQ A;  2W9N A;  2WYQ A;  4FJY A;  1RRB A;  4EFO A;  1P98 A;  5GMV A;  1P0R A;  1WF9 A;  2AL3 A;  1S3S G;  2VRR B;  1JRU A;  2OJR A;  2CR5 A;  4ZRI A;  1V81 A;  2J7Q B;  2C7H A;  1G6J A;  1HE8 A;  1NI2 A;  1OEY A;  3DBH I;  3HM3 A;  1SIF A;  3PHX B;  4W9C A;  2N9E B;  2WX0 A;  4G0N B;  3W1Y A;  4LJO B;  1ZGU B;  3DOW A;  2BWF A;  4JL9 A;  3IG3 A;  2IO3 B;  1WM2 A;  3A9J B;  2FCM A;  2KJ6 A;  3A1Q B;  1KJT A;  3R66 C;  2IO2 B;  4LDT B;  2PPH A;  4NNJ B;  2D3G A;  2L05 A;  2Z0D B;  3LJ3 A;  2NS5 A;  4GOC A;  3PPA A;  3K9P B;  4HVB A;  2DHZ A;  3KVF B;  4B9K A;  2CHW A;  2MRP A;  2LJ5 A;  4WWN A;  2BKF A;  3KUZ A;  1UEL A;  2MBO A;  3UIO B;  3QWZ B;  2LRW A;  2KWU B; 
#chains in the Genus database with same CATH topology
 3MHZ A;  5DPW A;  3AE7 B;  1F1H A;  5J17 A;  2WDT B;  2KAJ A;  3Q2A C;  4PYU A;  1XCT L;  2N7E A;  2ZPN A;  1D4B A;  4NJ6 A;  1F52 A;  3I3T B;  4W9D A;  2KLG A;  1FRD A;  4BKT A;  2QJL A;  1XCQ L;  5T8I A;  1ZOY B;  3CF6 E;  4A90 A;  2AX5 A;  2UU7 A;  5D3D A;  3BWU D;  2W82 A;  2WXM A;  3OWE B;  1FCL A;  4JPS A;  1TS5 A;  3N32 A;  5AUI A;  1L6U A;  2BGF A;  2RD0 A;  1L4Z B;  3WAO A;  3ONS A;  2MBQ A;  3N20 C;  1ZXI A;  2NBV B;  2PEA A;  3A9K A;  1TBE A;  3Q3O C;  5H8Y E;  2KQ4 X;  1N61 A;  3ZW3 A;  5G5G A;  2GI9 A;  1GB1 A;  1WJ6 A;  2QC8 A;  3N3K B;  2AQ2 B;  3AEA B;  3M95 A;  3DVN U;  5HI1 A;  4HWI B;  4BBN C;  2KNB A;  3VUW A;  1QOA A;  1C76 A;  2JWZ A;  2LRU A;  2ZVN A;  1YX5 B;  3ECI A;  3T3N A;  3A9K B;  1TJE A;  3BII D;  1VLB A;  1K53 A;  2BWE S;  3PZ7 A;  3VQI A;  3PV1 A;  4DDG D;  4L1B A;  5LXH A;  4II3 B;  1VRA B;  1JWM D;  2M8S A;  1WJU A;  4XX5 A;  5G5H A;  1QT9 A;  1YNT E;  1HQR D;  5IAA C;  5GXG B;  2M17 A;  1WSP A;  1SJH D;  2DBY A;  4WWM A;  3ZXV A;  1C1Y B;  3URY A;  4W9I A;  1AW7 A;  1C78 A;  3HIZ A;  2KAC A;  4NJC A;  4AJW A;  1E8X A;  1I4H A;  3SR6 A;  3EC8 A;  4IDI A;  3UF8 A;  1I4Q A;  2IBI B;  4BAX A;  2JY6 A;  4ZYN A;  1XEE A;  2KN5 A;  4NAW A;  2MBE A;  2ASQ A;  3NVZ A;  1D5M C;  4JIO U;  1XD3 B;  3PRP B;  2O6V A;  3ALB A;  4YTM B;  1TIF A;  4PT5 A;  1E7P B;  4KDI C;  2BYE A;  3FC4 A;  3KLS X;  2BB6 A;  3DBR I;  3KUD B;  3I9V 1;  1GC6 A;  2K8B A;  1R7S A;  2KDM A;  2MJD A;  4IC7 B;  5DPS A;  2K5P A;  1VZ6 A;  2WDQ B;  2N0S B;  2GB1 A;  1ZUD 2;  3Q3M C;  3BK2 A;  4OW0 A;  5JHA A;  3SFE B;  2O2V A;  1YN5 A;  2DYO A;  1AYF A;  1BT0 A;  4NAW B;  4D2K A;  4URK A;  3MC9 A;  5CHV C;  1PUT A;  2O6V B;  1Q10 A;  1D5Z C;  1V1O A;  2KDB A;  4W9L A;  2QIL A;  4G11 A;  1UH6 A;  2ZNV B;  4HDQ A;  4HJK A;  1FIQ A;  3V3X A;  1WGY A;  2D5G A;  4BOZ B;  4RNA A;  4DXA B;  1ACC A;  1WGH A;  3OAW A;  2M19 A;  2ZW0 A;  3VTU A;  2O2V B;  1J7B A;  3ZO5 B;  1KLU D;  2HJ8 A;  1UBQ A;  4W9H A;  3L0W B;  3EA6 A;  4MJS A;  3VHT C;  5D2M B;  2WXO A;  3QX1 A;  4IOI E;  2MJ3 A;  3DVN V;  3VR9 B;  4RGM A;  4EZL A;  1A70 A;  1KF6 B;  3SEB A;  2B76 B;  2BS4 B;  2IO0 B;  4NQK E;  3O13 A;  1I7H A;  2IZV B;  4MJS B;  3JSV A;  3R3M A;  2L7R A;  1RFA A;  2V3P A;  4TQ0 A;  2G45 B;  1KH0 A;  3PSE B;  2QEJ C;  4WQO B;  1CK1 A;  1XF5 L;  4MM3 A;  2ZW1 A;  1E7U A;  3EFU A;  4WJO A;  2H88 B;  2RPV A;  2HE7 A;  3DWG C;  3SDL C;  3TEZ A;  5MPO A;  3JSV B;  1SGH A;  4EUT A;  5C23 A;  3AEE B;  3AMZ A;  2WLB A;  4IWP A;  3T8M A;  2RMM A;  1QOF A;  3R7Q A;  1CMX B;  2JQR B;  2SEB D;  3BYT B;  1TGZ B;  2A5U A;  3M63 B;  1EU4 A;  1QQR A;  2JT4 B;  3NZ3 A;  4MM3 B;  2KX0 A;  2FUG 1;  3RNG C;  3B2G A;  3ZNH B;  3ZNI D;  1QOB A;  1RAX A;  4XZ4 A;  1J7C A;  5L95 C;  1IP9 A;  3ZYY X;  3PT2 B;  4USA A;  3NRZ A;  4KV2 A;  3RUI B;  3NHE B;  3ZJT A;  2MSE D;  2ZNV C;  1OEY J;  2WXR A;  3KUC B;  2ZCB A;  1OTR B;  1BXT A;  1HA5 A;  2KDI A;  5AEK B;  1MI0 A;  4EKU A;  4AQ7 A;  2BW2 A;  5HFY A;  4EEW A;  1K52 A;  1L4D B;  1WMH A;  3C19 A;  3Q8F A;  4MEL A;  1FFV A;  4MGK E;  4ASW C;  2ZJD A;  4HLE A;  2JZZ A;  2REX A;  1RWS A;  1WX8 A;  2DYB A;  5AZF A;  2G4S A;  1TY0 A;  1E7V A;  1YJI A;  2IY1 B;  3PHW B;  3QHT A;  4TMA B;  2VZK B;  4BKG A;  2K0P A;  4RF1 A;  1H4R A;  1LXD A;  3AU5 A;  1WMH B;  2IGD A;  4OVU A;  3P2B A;  2KO3 A;  4WJN A;  3FIL A;  3B9J A;  2HTH A;  4OHJ A;  4KGS A;  4HPM B;  1MG8 A;  2JX5 A;  1T0Y A;  5J2R A;  1FPY A;  3MTN B;  1EF5 A;  3DHG C;  4MGI E;  2KK8 A;  3A4S C;  3DBL B;  4XWW A;  3RPF C;  4J6I A;  5G2N A;  1ZKH A;  4LK0 M;  4DXG A;  2ACZ B;  1KOT A;  4KVG B;  5C2T B;  1HTQ A;  4FA6 A;  4WWO A;  1L0V B;  2HDE A;  3X23 A;  2KN4 A;  3FIL B;  3OJ3 A;  3CSF A;  2KWC A;  4AP4 C;  2CU3 A;  5E6P A;  4J3O D;  2CU1 A;  4W9G A;  1CJE A;  4ANU A;  1PGA A;  4DDI D;  4I6P A;  4LNK A;  5E6J A;  3A9J A;  3AED B;  4FJZ A;  1NYR A;  1D5X C;  1R4M B;  1C9F A;  2WNM A;  2W9N A;  1JML A;  4US8 A;  2AL3 A;  4P1B C;  1F77 A;  4YSZ B;  1TS2 A;  1NI2 A;  2LUM A;  3HM3 A;  1SIF A;  2IPK D;  1PGB A;  3A9J B;  1ZP0 B;  4NAM A;  4RH6 A;  2PPH A;  2D3G A;  2MHJ A;  2WXQ A;  4GOC A;  3PPA A;  3DHH C;  3DBH B;  2DHZ A;  2CHW A;  1C77 A;  3KUZ A;  2MBO A;  5IOI A;  3TEW A;  2LRW A;  4RFB A;  2I1K A;  2INN E;  2M0A A;  1HXY D;  1TS4 A;  3PTF C;  1GB4 A;  2AL6 A;  2INP E;  1MJD A;  1NEK B;  2L32 A;  1IUE A;  4ZRK A;  2IGG A;  2BYF A;  2ONQ A;  1E0Z A;  3UI3 A;  2K9X A;  4ITK A;  2L1A A;  3H6N A;  3ZXR A;  1SSN A;  1GAQ B;  4XWT A;  3PZD A;  2L76 A;  3AN1 A;  4WJQ A;  2KQ7 A;  3BVM A;  2JSV X;  4DXF A;  2KKC A;  3NJT A;  4QAY A;  1TTN A;  4AUQ C;  1X1M A;  1KM7 A;  4YT0 B;  1UNS A;  4IM3 A;  2C9W B;  1AWD A;  4KSL C;  3DWM A;  3IAS 1;  3L08 A;  1TKY A;  3AV8 A;  3Q8B A;  2DZJ A;  1WRI A;  1FXT B;  5DPT A;  1YMH E;  3HVZ A;  3VUX A;  1WFY A;  4WH4 A;  2W54 A;  1JWB D;  3FKY A;  4G50 A;  1FMA D;  5L83 A;  3ZTD A;  2L52 A;  3BIN A;  1UF0 A;  1VDV A;  1T3Q A;  2FE8 A;  2G9H D;  2MBB B;  4GMV A;  2KAN A;  3GZN I;  3ETR A;  1UZX B;  4AWJ A;  5KHQ A;  1FCC C;  5J18 A;  3B1L X;  3MHS D;  4HCP B;  4KZ0 A;  5JZE B;  1S1Q B;  4K7W A;  5I4D A;  2WDV B;  3DDC B;  3APD A;  4BKS D;  4P16 A;  1GG3 A;  4FHJ A;  2LVQ A;  2JVC A;  3BY4 B;  2DAF A;  2LMC A;  3L13 A;  2X38 A;  4EZJ A;  4L23 A;  5H92 C;  1V5T A;  3DBS A;  4E74 A;  3APF A;  4KSK C;  3OLM D;  2K3U A;  5TR5 A;  5G55 A;  3UIN B;  2XBB C;  2LVO A;  2E6X A;  1MHH E;  3VH3 B;  2JRH A;  2Z59 B;  4A6Q A;  4ARI A;  2BB5 A;  3VXW A;  2DX5 B;  3Q8A A;  4JE3 B;  3R7R A;  4CHK A;  4ZYS A;  4LJP B;  3NUH B;  3ZNG C;  1RFK A;  2K25 A;  4RCO A;  2FAZ A;  3AU4 A;  4X57 B;  1N60 A;  1N62 A;  3ZDM C;  3N30 A;  3RZW C;  1T0Q C;  5LNK 1;  2GLS A;  2MJE A;  4MDK E;  3KQ4 A;  3AE2 B;  4TUU A;  3IBE A;  3TL5 A;  3GE3 C;  3VRB B;  3ML9 A;  2KYW A;  1DGJ A;  3EGR A;  1QF6 A;  4A8X C;  4ANV A;  3IT4 B;  1XT9 B;  2BYV E;  1TS3 A;  3PRE A;  2YVC A;  3P1M A;  1JAL A;  3NZS A;  4K7U A;  2GBK A;  1T0S C;  3DHI C;  2V3S A;  1I4X A;  2WHI A;  3SHQ A;  2RDH A;  4IKG A;  3BZD B;  1L6V A;  1FNU A;  4M00 A;  3Q6B A;  4BZA A;  4XE0 A;  2G4D B;  3M62 B;  4ICU A;  3Q8C A;  4AS1 A;  2KDF B;  2WXH A;  5D7G A;  4B95 A;  2PTL A;  3NOB A;  3RNF C;  1T6B X;  4MH8 A;  1UBI A;  1WGR A;  1MFW A;  4HKZ E;  4MH0 E;  2GBM A;  1LGR A;  1RM6 C;  1Q5W B;  4LTU A;  4ZOH C;  5HHD G;  1ESF A;  1SE9 A;  2K8H A;  5C1Z A;  2XNA C;  3GS2 A;  3L54 A;  1GPX A;  4KKJ A;  1FNW A;  3Q3J A;  3B08 A;  3AE5 B;  3JYU A;  2JRI B;  4XC2 A;  2BKR B;  2PW9 A;  4AOF A;  1ET6 A;  2N9X A;  2WXF A;  2BVC A;  3OJ4 B;  5JXV A;  1XLQ A;  2DAJ A;  2MBH A;  1B1Z A;  2KZR A;  4Q2J A;  3L16 A;  3RN9 C;  5AZH A;  2PIA A;  3WIM A;  1C4C A;  2DYM A;  2OHF A;  1UGJ A;  1J0G A;  2DLB A;  1R4N I;  2BBC A;  2Y5C A;  3AEC B;  2MA9 B;  1VD2 A;  4GDL A;  4FLH A;  2N9P C;  2PE6 B;  1TKG A;  2FCS A;  3JW0 X;  2TSS A;  3LYY A;  2QDF A;  2WXN A;  3DPD A;  4O1N A;  4PYZ A;  1KLV A;  2ZVO A;  3ZTC A;  1TYG B;  1CZP A;  2KXJ A;  2XK5 A;  2FCN A;  4GDL B;  3AH7 A;  1ET9 A;  2PKO A;  2N1W A;  1IYF A;  1TZO A;  2K22 A;  1Q1O A;  3SFD B;  2WXG A;  1U4A A;  1SF0 A;  4K81 A;  2DEN B;  3WA0 A;  5D3I B;  4A3P A;  4ANX A;  3WAL A;  2IJ0 A;  3P4Q B;  2XK5 B;  3N1Y C;  1T5X D;  4CQN A;  2N9K A;  4ZHP A;  3RNC C;  2KOX A;  1B9R A;  5IN7 A;  3TUO A;  1MHX A;  3TEX A;  3L4P A;  2GBN A;  1ZXH A;  3RFZ B;  3GP7 A;  2R61 A;  2I1J A;  4KX6 B;  1P3Q U;  4CO7 A;  1D6E C;  1Z5S B;  3QCA A;  4LNI A;  4DQO C;  2KQS A;  2N7J A;  2L3Z A;  4ACF A;  2JZP A;  3NVY A;  1XLP A;  2LXC A;  3VFK A;  2H89 B;  3QC8 B;  3VUY A;  1H8C A;  1N5X A;  3ML8 A;  4ZRJ A;  3MJ5 A;  1WZ3 A;  1JCK B;  2KD0 A;  1YQ3 B;  1OGW A;  4GSW A;  3TBL D;  3DVG Y;  1QOG A;  4NJ7 A;  1V2Y A;  1M94 A;  5C3J B;  2FBW B;  3ABV B;  3BVG A;  1OQY A;  3A1Q A;  3NZU A;  1WXA A;  3RNA C;  4TSS A;  1NI3 A;  3Q14 C;  1K51 A;  1L7Y A;  2GBR A;  2WYQ A;  3MC0 B;  4EFO A;  1DOY A;  2OJR A;  1V81 A;  3WCQ A;  2J7Q B;  4C7Y A;  2C7H A;  3BK1 A;  1G6J A;  3DBH I;  2N9E B;  3NS1 A;  2OED A;  2WX0 A;  4LJO B;  1ZGU B;  2BWF A;  4JL9 A;  2IO3 B;  1WM2 A;  3A1Q B;  2IO2 B;  1DYQ A;  2YEP F;  2L05 A;  1E6E B;  3R2T A;  3K9P B;  3MFG A;  4HPP A;  1YOV B;  4IM0 A;  2LGX A;  1SE4 A;  3NVV A;  2CHZ A;  4ICV A;  3PGE A;  3RUL A;  4GB9 A;  4WAA A;  1NEN B;  1SXT A;  4NPN A;  2KLC A;  2JPH A;  4EOY A;  1F0Z A;  3AM9 A;  3W2D A;  1WGG A;  3W1S A;  4N59 A;  4OZC A;  3AE1 B;  3AE3 B;  1GC7 A;  1EUV B;  4FN2 A;  5LLI A;  1J7A A;  3Q69 A;  4F8C B;  2E3T A;  5D94 A;  3WAP A;  1N63 A;  4XDC A;  3HRD D;  2JYT A;  2RDG A;  2DZM A;  2QSD A;  1YQ4 B;  2V3N A;  3RMK C;  1KTK A;  5CX3 A;  5BYR A;  4DBG A;  4L2Y A;  1ZDX A;  3LDZ E;  3T9L A;  2ICI A;  2EMS A;  4M01 A;  2IO1 B;  2KJH B;  4OVV A;  4A55 A;  4NY0 A;  4HDO A;  2YEP B;  4II2 B;  1NVI D;  2NBU A;  4JLC A;  3P4S B;  2MCN B;  3VRA B;  4RM9 A;  4E71 A;  3U30 A;  3W5U B;  4LNF A;  5AZG A;  3UGB B;  2HJ1 A;  2V9H A;  4IW0 A;  4WWP A;  2C5L C;  4G3X B;  1P1A A;  3H7S A;  5JH5 C;  2J0K A;  4W9E A;  4HJG E;  3U2S C;  1EU3 A;  1LQB A;  1UWM A;  4JX1 C;  3H7P A;  1YX6 B;  2QHO A;  5EE3 A;  1PDX A;  1JW9 D;  1FO4 A;  5EE1 A;  1YN4 A;  4P6V F;  3IAM 1;  3V6C B;  1ISN A;  4ARC A;  3PO0 A;  3V62 A;  1WX7 A;  2GOW A;  4LNO A;  1QLB B;  3RNB C;  3ZQ4 A;  2AYO B;  2LGD A;  1RYJ A;  1I4G A;  3ZIM A;  3FAH A;  3QAR A;  3Q3F A;  4NQL B;  2V4L A;  3LXF A;  3GE8 C;  4MAC A;  1GNU A;  3H7P B;  3SU8 X;  4YTN B;  4TV3 A;  3KH0 A;  4XDD A;  3H8H A;  2Y3A A;  2KC2 A;  1GOZ A;  1K50 A;  4GU2 A;  4PS7 A;  4MGZ E;  4P7I A;  3IT6 B;  3AXC A;  5TSS A;  3QIJ A;  5BMI A;  5JHB A;  2XN9 C;  3ZUN A;  1FNV A;  2HTM E;  1C79 A;  1EM7 A;  1IGC A;  1FFU A;  1UGM A;  4F1S A;  3GOE A;  3HUI A;  4ZHO A;  3ZNZ B;  3QJZ A;  4HRS A;  2D3C A;  2LEK A;  2CS4 A;  3N1X C;  1SE2 A;  1XQQ A;  4YSX B;  3BYY B;  1NYQ A;  2BS3 B;  2VH1 A;  1L0X B;  3V6E B;  1V49 A;  2JUO A;  1CQV A;  4IM2 A;  1N5W A;  3H9D A;  1JRP A;  1HZ5 A;  4I6L B;  4RM8 A;  2KHW B;  1I4P A;  1LM8 B;  3VTW A;  3W9C B;  1I35 A;  1WXS A;  2Z8L A;  3ZKJ C;  3PLU A;  2KVR A;  3N9Y C;  1FRR A;  3S2A A;  1WXV A;  5D6J B;  3U52 E;  4S17 A;  3EUB 2;  4GLS C;  3ENE A;  4K7S A;  2NBW B;  5DPR A;  2A4Z A;  1I42 A;  2NMQ A;  3PS6 A;  1WXQ A;  2NTS A;  2KVZ A;  1TZ1 A;  1Q0W B;  2FID A;  2Z0E B;  1YQB A;  2W3R A;  1PGX A;  1EF1 A;  4HEA 1;  2OOB B;  2MH7 A;  2LGS A;  2WU2 B;  2LJI A;  2ON8 A;  1V8C A;  2K1F A;  5E6N A;  4B0E A;  4OZB A;  2ZZP B;  2MX2 A;  4REZ A;  4HXD A;  1E8Y A;  4ZDV A;  3AEG B;  1ZDV A;  4N6E B;  2LXA A;  2KX3 A;  4MGY E;  1Z2M A;  1AAR A;  3CST A;  4IUM B;  4JQW C;  2LUE A;  1DOX A;  3TSS A;  1E5W A;  2GBJ A;  2G1E A;  3MC8 A;  2UWQ A;  2WWZ A;  2AWT A;  4WAF A;  3TCA A;  1TKE A;  1V97 A;  3L17 A;  3H1U A;  2QIE B;  2ZEQ A;  2PMV A;  2YLM A;  1JWA D;  3IFW B;  1V5O A;  2WXP A;  1WY8 A;  4W9F A;  2LHD A;  1E8W A;  2EKE C;  2CJN A;  1V9J A;  3LB8 C;  1QIL A;  2N7D A;  4PS8 A;  2KWV B;  4EE2 A;  3RCZ A;  4W9K A;  4WIP A;  3VR8 B;  1P7E A;  2WU5 B;  4DHZ B;  2J0M A;  2JF5 A;  3I5J C;  4RGO S;  1WJN A;  2KJR A;  1FXA A;  4W9J A;  3ZRC A;  4PK1 A;  1TT5 B;  1FEH A;  1YD8 U;  4E3C A;  1JWU D;  3TEY A;  1WE6 A;  3O65 B;  3U4E G;  1C4A A;  1V86 A;  1VZ8 A;  1V6E A;  4FXC A;  2IY0 B;  1KLG D;  4BVU C;  2D10 A;  1VCB A;  4N58 A;  1P7F A;  2NVU I;  2PVO D;  1F9J A;  3Q3N C;  3PLV A;  3P4P B;  3IVF A;  4WUR A;  1MG4 A;  3PRZ A;  5BYS A;  1KFY B;  1MPE A;  1MVK A;  2N4F A;  4LCD E;  3NG0 A;  2EKI A;  2AEH A;  1F2R C;  2VH2 A;  2WDR B;  3QK0 A;  3K9O B;  2FNJ B;  3KWV A;  2L8J A;  2I38 A;  4ANW A;  4HK2 A;  4F7Z A;  2LGY A;  1WI0 A;  3U8Z A;  1WYG A;  2OJW A;  3BVZ A;  4DK5 A;  3AEB B;  5LXI B;  4NZL B;  4C56 C;  4GGQ A;  1GJZ A;  1L0Y B;  1VJK A;  1FXI A;  5AUK A;  1WWT A;  2K39 A;  4HPL B;  3AE8 B;  2QMT A;  3U7D A;  4K1R B;  3C0R B;  1ZPS A;  2KMC A;  3HVD A;  4JWS C;  2JXX A;  2Q5W D;  2MQJ A;  3GZN B;  4FJY A;  5GMV A;  1P0R A;  4ZRI A;  2VRR B;  4XGA B;  1OEY A;  3PHX B;  4W9C A;  2KMM A;  4C7Z A;  2IDY A;  4G0N B;  3E9S A;  1JQ4 A;  4M0W A;  2FCM A;  3R66 C;  3Q8E A;  1JWS D;  3LJ3 A;  2NS5 A;  2CJO A;  1FD6 A;  4HVB A;  4B9K A;  3KVF B;  2MRP A;  3T3O A;  2LJ5 A;  2WGS A;  2WP9 B;  4WWN A;  1QKZ A;  2DWQ A;  4K3C A;  1UWX A;  3QWZ B;  1HZ6 A;  2BTE A;  4TKN A;  1DOI A;  3DCG A;  4M0W B;  4P1C C;  5BMG A;  1V1P A;  2D07 B;  2MLB A;  2I2Y A;  2J42 A;  3E56 A;  2NPT A;  4C00 A;  5CHW A;  4DHJ D;  2D2Q A;  3B0A A;  4LLG M;  4GN1 A;  2N9L A;  1YJJ A;  1UD7 A;  2BF8 B;  1V80 A;  3RD2 A;  2UYZ B;  2WQY B;  2M4N A;  2EMT A;  4JWU C;  2J53 A;  1V1P B;  2WXK A;  3RYT A;  5CHF A;  1E8Z A;  1C3T A;  4IG7 B;  3ZGZ A;  3ZLZ A;  2FUH B;  1IBX A;  5IA7 A;  3DBL I;  4FHK A;  2NPT B;  1M4V A;  3QA8 A;  2LAS A;  2BPS A;  3X0W A;  2KWD A;  4LDT D;  3AI5 A;  2V1Y A;  3A4R A;  2KT7 A;  4GDK A;  4WQM A;  1AN8 A;  3D32 A;  5E6O A;  1EO6 A;  4K3B A;  2ZCC A;  3HHM A;  1L5P A;  1Y56 A;  1A5R A;  4A3O A;  2NCN A;  2BS2 B;  1IBX B;  4A9A A;  2HD5 B;  3R2I A;  1UUP A;  3VVW B;  4US9 A;  1WXM A;  3VH4 B;  3ZJV A;  1WZ0 A;  4C80 A;  1YJ1 A;  3RI7 C;  1WR6 E;  2XEW A;  1R4M I;  3AE4 B;  4GDK B;  3NS8 A;  1XLO A;  2JU6 X;  3V05 A;  3AUL A;  2PLP A;  2K6Q A;  3KW5 B;  3KWL A;  2C60 A;  3IHP C;  2BYT A;  1N6Z A;  3MP9 A;  3UQA A;  1WH3 A;  1XLN A;  1YIW A;  2ZPY A;  3R8B A;  3EEC A;  2AQ1 B;  2B3A A;  3PVL A;  4GIV A;  2WXL A;  1EWY C;  3V60 A;  4IWO A;  3M3J A;  1WX9 A;  1WGD A;  3AB5 A;  2LVP A;  2PE9 A;  4HKQ A;  2G3Q B;  2LI5 A;  3ZRF A;  2NTT A;  1SE3 A;  4CYE A;  3JVZ X;  4RMA A;  1QZE A;  4KGR A;  3UIP B;  3EFC A;  5HKH A;  4R3D A;  2JYE A;  3SD5 A;  3V61 A;  2RGF A;  4HRO A;  2NR2 A;  2CKH B;  2DNF A;  4BKS A;  5FR3 A;  5FR6 A;  2KTF A;  1VZ7 A;  4KZC A;  1FM0 D;  2BT6 A;  3EHV A;  2J4X A;  1LFD A;  3IXS A;  1R4N B;  4MT5 A;  1J8C A;  4B0M A;  5EDS A;  3VDZ A;  1E9M A;  2DZK A;  2SAK A;  1ZE3 D;  1WE7 A;  2PVG C;  2BQQ A;  3MJW A;  4HCN B;  4OVZ A;  4M8M A;  1PQS A;  1OQR A;  4B6W A;  3AE6 B;  3P63 A;  2R2Q A;  3U7Z A;  2JZ3 B;  2L00 B;  1JRO A;  2L0F A;  3DBR B;  4KIK A;  5EE9 A;  2AQ3 B;  2KFK A;  4GXB A;  4WJP A;  3J9C A;  4I6N B;  4RGN A;  2K8C A;  2WXJ A;  2C7N B;  3C8Y A;  4EZK A;  2R2O A;  3HM6 X;  1SIJ A;  2D3B A;  4LNN A;  2INC C;  2LWP A;  1WRD B;  2WS3 B;  4KDL B;  2QCZ A;  4YTP B;  4KIK B;  2C7M B;  1IPG A;  1F2R I;  1OFF A;  1SEB D;  2KFK B;  3P42 A;  4YXD B;  2L0T A;  4DHZ E;  4BFR A;  4PS3 A;  2RR9 A;  2W55 A;  4FUL A;  3DQV A;  2LD9 A;  1K8R B;  3NY5 A;  5FKA C;  3DVG X;  4RGT A;  4MSM B;  2IYD B;  3W5V B;  1I4R A;  3PZ8 A;  3ZVV A;  4A20 A;  2KDE B;  3CMM B;  2IGH A;  2L83 A;  3N1Z C;  1PFD A;  2KC1 A;  1EWC A;  5EE0 A;  2O6V D;  4N9F 4;  3CWI A;  4FJV B;  2D11 A;  2GMI C;  2M56 B;  3VTV A;  2GRI A;  4JGH B;  4KKI A;  4S0R A;  1RLF A;  5BMH A;  2Y5B B;  5DCN A;  2V0G A;  1ROE A;  1NDD A;  2M0X A;  2M1M A;  4MEM A;  4M8N A;  5IKC M;  2KTR A;  2LGI A;  3VAW A;  3I57 A;  3PRM B;  4FAD A;  2LZ6 A;  3P4R B;  2D3A A;  2FIF A;  2WXI A;  3TJP A;  3TMP B;  4M02 A;  1KRH A;  1Y8R C;  4YL8 A;  4DWF A;  3TIX A;  1J19 A;  5BO4 B;  1E10 A;  2RPQ A;  5CTR C;  3WAM A;  4KGT A;  4MSQ B;  1WIA A;  2MWS B;  3WAN A;  1D3Z A;  4OZA A;  3W1S C;  3CIR B;  2KTR B;  5BYQ A;  2RSU A;  1E90 A;  1WYW B;  1HTO A;  3A33 B;  3OG5 A;  4ZRP A;  1WJ4 A;  1VR9 A;  4BBN F;  5IO9 A;  2IND C;  3KYC D;  2LHE A;  5IP4 D;  4BOS C;  3ZJU A;  2N1V A;  1IGD A;  2J0J A;  1P9D U;  4RF0 A;  1LO5 D;  4IWQ A;  3NVW A;  2EEL A;  3HK0 A;  4YWG G;  1SB3 C;  1WM3 A;  2LFI A;  2PJH A;  2JWU A;  4AJY B;  1WR1 A;  4TQ1 A;  3QQ8 B;  5FK9 C;  1L2N A;  2MW5 A;  2KFJ A;  2MP2 A;  3RT3 B;  3I63 C;  2KMA A;  3KYD D;  2K6D B;  3B2F A;  2V4I B;  2X8X X;  4FBJ B;  3RZF A;  4ZRQ A;  4C4V A;  3AE9 B;  2MEK A;  1SBB B;  1ZW7 A;  1NBF C;  3APC A;  4H2A A;  3ZDT A;  2DZI A;  1STE A;  2Y5P A;  1ENF A;  2J52 A;  2CHX A;  3QAQ A;  1SJE D;  1WGK A;  2MP2 B;  2W3S A;  5HG2 A;  2WX1 A;  1GUA B;  1BML C;  5KHO A;  3AEF B;  4UDU C;  3RNE C;  4DHJ B;  1OQQ A;  4C4V B;  3L10 B;  1TY2 A;  2RDB C;  3UQB A;  4XYC A;  2FCQ A;  1C4P A;  1T0R C;  1RRB A;  1HEZ E;  1P98 A;  1PYW D;  1WF9 A;  1BUI C;  1S3S G;  2JXT A;  1JRU A;  2CR5 A;  2VZK D;  1YN3 A;  1HE8 A;  3W1Y A;  3DOW A;  3IG3 A;  2KJ6 A;  1KJT A;  4LDT B;  4NNJ B;  2Z0D B;  4YSY B;  1XO3 A;  2BKF A;  1XXG A;  1UEL A;  3UIO B;  3GB1 A;  2KWU B; 
#chains in the Genus database with same CATH homology
 4IM0 A;  2LGX A;  2CHZ A;  4ICV A;  3PGE A;  5DPW A;  3RUL A;  4GB9 A;  4TKN A;  2I1K A;  3DCG A;  2WDT B;  4M0W B;  5J17 A;  4WAA A;  4PYU A;  4NPN A;  3PTF C;  2AL6 A;  2D07 B;  2MLB A;  4ZRK A;  2N7E A;  2BYF A;  2ZPN A;  2KLC A;  2JPH A;  4EOY A;  2NPT A;  1WGG A;  3H6N A;  3W1S A;  5CHW A;  4DHJ D;  2D2Q A;  3B0A A;  4NJ6 A;  3I3T B;  3PZD A;  1GC7 A;  1EUV B;  2L76 A;  4W9D A;  4GN1 A;  4FN2 A;  2KLG A;  5LLI A;  4BKT A;  1UD7 A;  4WJQ A;  4F8C B;  2BF8 B;  5D94 A;  1V80 A;  3RD2 A;  3WAP A;  2KQ7 A;  2UYZ B;  2KKC A;  2DZM A;  2M4N A;  1TTN A;  2EMT A;  3CF6 E;  4AUQ C;  1X1M A;  3RYT A;  5CHF A;  1E8Z A;  1KM7 A;  5CX3 A;  4DBG A;  4IM3 A;  1C3T A;  4IG7 B;  2C9W B;  3ZLZ A;  2FUH B;  3LDZ E;  4KSL C;  5IA7 A;  3DBL I;  4FHK A;  2EMS A;  2NPT B;  3L08 A;  3N32 A;  3T9L A;  2BGF A;  2IO1 B;  2KJH B;  2RD0 A;  4OVV A;  3WAO A;  3ONS A;  4NY0 A;  2MBQ A;  4HDO A;  2DZJ A;  3QA8 A;  2LAS A;  1FXT B;  2NBV B;  2PEA A;  3A9K A;  2BPS A;  4II2 B;  5DPT A;  3X0W A;  3VUX A;  4LDT D;  1TBE A;  1WFY A;  2NBU A;  3AI5 A;  2V1Y A;  3A4R A;  4GDK A;  4JLC A;  4G50 A;  3D32 A;  5E6O A;  1EO6 A;  2MCN B;  3ZW3 A;  2ZCC A;  3HHM A;  1A5R A;  4A3O A;  1WJ6 A;  2NCN A;  4RM9 A;  3N3K B;  5L83 A;  4E71 A;  3U30 A;  3M95 A;  3DVN U;  5AZG A;  3ZTD A;  4HWI B;  3UGB B;  4BBN C;  2KNB A;  2HD5 B;  3VUW A;  4IW0 A;  4WWP A;  2C5L C;  2JWZ A;  3BIN A;  2LRU A;  2ZVN A;  3VVW B;  1YX5 B;  3ECI A;  1P1A A;  3H7S A;  4G3X B;  1WXM A;  3VH4 B;  1WZ0 A;  2MBB B;  5JH5 C;  4GMV A;  3A9K B;  1YJ1 A;  1WR6 E;  2J0K A;  2KAN A;  2XEW A;  1R4M I;  3GZN I;  4W9E A;  4GDK B;  1UZX B;  4AWJ A;  3NS8 A;  1LQB A;  5KHQ A;  3H7P A;  5J18 A;  1YX6 B;  2QHO A;  3AUL A;  3B1L X;  3MHS D;  2BWE S;  4HCP B;  3VQI A;  3PV1 A;  4KZ0 A;  4DDG D;  3V6C B;  2K6Q A;  1ISN A;  5JZE B;  1S1Q B;  4K7W A;  4II3 B;  1WX7 A;  2GOW A;  3V62 A;  5LXH A;  3KW5 B;  2C60 A;  2M8S A;  3IHP C;  1WJU A;  3DDC B;  2AYO B;  2LGD A;  3APD A;  4XX5 A;  3UQA A;  1WH3 A;  1YIW A;  3ZIM A;  2ZPY A;  4BKS D;  5IAA C;  1GG3 A;  3EEC A;  2B3A A;  4FHJ A;  2LVQ A;  3QAR A;  2JVC A;  3BY4 B;  2DAF A;  3L13 A;  2M17 A;  3Q3F A;  4EZJ A;  3PVL A;  4NQL B;  2V4L A;  1V5T A;  4GIV A;  1C1Y B;  4W9I A;  1GNU A;  3V60 A;  3DBS A;  3H7P B;  4IWO A;  3APF A;  3SU8 X;  4E74 A;  3M3J A;  4TV3 A;  4KSK C;  1WX9 A;  3KH0 A;  1WGD A;  3HIZ A;  2LVP A;  2PE9 A;  3OLM D;  5TR5 A;  5G55 A;  3UIN B;  2KC2 A;  2G3Q B;  4AJW A;  2XBB C;  2LVO A;  1E8X A;  2LI5 A;  4GU2 A;  4PS7 A;  3ZRF A;  4MGZ E;  4P7I A;  3VH3 B;  3AXC A;  2JRH A;  2Z59 B;  3QIJ A;  3JVZ X;  4CYE A;  4RMA A;  3EC8 A;  1QZE A;  5JHB A;  3UIP B;  3ZUN A;  3UF8 A;  5HKH A;  2IBI B;  3VXW A;  2DX5 B;  3SD5 A;  3V61 A;  2RGF A;  2NR2 A;  3R7R A;  2JY6 A;  2CKH B;  4ZYN A;  4BKS A;  4NAW A;  2KN5 A;  4CHK A;  1UGM A;  4LJP B;  2MBE A;  2ASQ A;  5FR6 A;  3ZNG C;  2KTF A;  4F1S A;  4JIO U;  4KZC A;  1XD3 B;  3PRP B;  3EHV A;  2O6V A;  3ALB A;  1LFD A;  3GOE A;  2K25 A;  3ZNZ B;  4KDI C;  2FAZ A;  3AU4 A;  2BYE A;  3QJZ A;  4X57 B;  1J8C A;  5EDS A;  2CS4 A;  3ZDM C;  3N30 A;  3RZW C;  3VDZ A;  1XQQ A;  3DBR I;  2DZK A;  3KUD B;  1GC6 A;  1WE7 A;  2K8B A;  4IC7 B;  4MDK E;  5DPS A;  3MJW A;  4HCN B;  4M8M A;  1PQS A;  3V6E B;  4B6W A;  5JHA A;  1V49 A;  4TUU A;  3IBE A;  2O2V A;  2JUO A;  2R2Q A;  2DYO A;  1BT0 A;  3TL5 A;  4NAW B;  4URK A;  2JZ3 B;  3ML9 A;  2L00 B;  4IM2 A;  5CHV C;  3H9D A;  2O6V B;  2L0F A;  4W9L A;  2KDB A;  4ANV A;  4G11 A;  1UH6 A;  1XT9 B;  2ZNV B;  2BYV E;  4HDQ A;  4HJK A;  3PRE A;  4I6L B;  4RM8 A;  4KIK A;  1WGY A;  2KHW B;  2YVC A;  1LM8 B;  4BOZ B;  3VTW A;  2KFK A;  4DXA B;  1I35 A;  3NZS A;  4K7U A;  1WXS A;  1WGH A;  3ZKJ C;  2GBK A;  4GXB A;  4WJP A;  3OAW A;  3PLU A;  4I6N B;  2KVR A;  2K8C A;  2V3S A;  2C7N B;  4EZK A;  2R2O A;  3VTU A;  2O2V B;  1WXV A;  3S2A A;  5D6J B;  3HM6 X;  3ZO5 B;  3SHQ A;  2HJ8 A;  1UBQ A;  4W9H A;  2LWP A;  3L0W B;  1WRD B;  3ENE A;  4K7S A;  4MJS A;  4KDL B;  2NBW B;  5DPR A;  2A4Z A;  3VHT C;  5D2M B;  1I42 A;  2G4D B;  3M62 B;  4ICU A;  2C7M B;  4KIK B;  1IPG A;  2KDF B;  5D7G A;  4B95 A;  3QX1 A;  3NOB A;  3PS6 A;  2KFK B;  1UBI A;  3DVN V;  1TZ1 A;  1Q0W B;  2L0T A;  4DHZ E;  1WGR A;  4BFR A;  2FID A;  4EZL A;  4MH0 E;  2GBM A;  2Z0E B;  1Q5W B;  4PS3 A;  1YQB A;  2RR9 A;  4FUL A;  3DQV A;  1EF1 A;  2IO0 B;  4NQK E;  2LD9 A;  1K8R B;  1SE9 A;  3NY5 A;  2K8H A;  5C1Z A;  2OOB B;  2IZV B;  4MJS B;  3L54 A;  3JSV A;  3DVG X;  4MSM B;  2IYD B;  3Q3J A;  3B08 A;  3R3M A;  3ZVV A;  2K1F A;  5E6N A;  2L7R A;  1RFA A;  4A20 A;  3JYU A;  2JRI B;  2KDE B;  3CMM B;  4TQ0 A;  2ZZP B;  2G45 B;  2MX2 A;  2BKR B;  4XC2 A;  4AOF A;  3PSE B;  4HXD A;  2N9X A;  4WQO B;  2KC1 A;  1E8Y A;  4ZDV A;  2O6V D;  4MM3 A;  4N9F 4;  2LXA A;  2KX3 A;  3OJ4 B;  4FJV B;  2DAJ A;  4MGY E;  1E7U A;  3EFU A;  4WJO A;  2MBH A;  1Z2M A;  2D11 A;  2GMI C;  2KZR A;  1AAR A;  3CST A;  4IUM B;  2HE7 A;  4JQW C;  3SDL C;  3VTV A;  3L16 A;  3JSV B;  2LUE A;  1SGH A;  5AZH A;  4EUT A;  3WIM A;  5C23 A;  4JGH B;  1E5W A;  2GBJ A;  1RLF A;  2DYM A;  2Y5B B;  4IWP A;  3T8M A;  3R7Q A;  1CMX B;  2UWQ A;  2WWZ A;  2AWT A;  5DCN A;  1J0G A;  1TGZ B;  1R4N I;  2A5U A;  3M63 B;  2MA9 B;  2JT4 B;  1NDD A;  3TCA A;  2KX0 A;  1VD2 A;  2M0X A;  4GDL A;  3L17 A;  4FLH A;  2M1M A;  4MEM A;  4M8N A;  2KTR A;  2N9P C;  2PE6 B;  3H1U A;  3ZNH B;  3ZNI D;  3VAW A;  1RAX A;  3PRM B;  2FCS A;  4XZ4 A;  4FAD A;  2ZEQ A;  5L95 C;  2LZ6 A;  1IP9 A;  3JW0 X;  2FIF A;  3TJP A;  2YLM A;  3TMP B;  3PT2 B;  1Y8R C;  1V5O A;  3IFW B;  4YL8 A;  1WY8 A;  4DWF A;  4W9F A;  3DPD A;  3TIX A;  1E8W A;  4KV2 A;  1J19 A;  4PYZ A;  3RUI B;  1KLV A;  3NHE B;  5BO4 B;  2MSE D;  2RPQ A;  2ZVO A;  2ZNV C;  5CTR C;  2EKE C;  3WAM A;  3ZTC A;  1V9J A;  1OEY J;  4MSQ B;  2KXJ A;  2N7D A;  2XK5 A;  1WIA A;  4PS8 A;  2KWV B;  2FCN A;  3KUC B;  2MWS B;  2ZCB A;  4GDL B;  4W9K A;  1OTR B;  3RCZ A;  3WAN A;  3W1S C;  1D3Z A;  2KTR B;  4DHZ B;  2RSU A;  1E90 A;  2J0M A;  2JF5 A;  1WYW B;  2N1W A;  1WJN A;  2KDI A;  5AEK B;  1IYF A;  1Q1O A;  2KJR A;  4EKU A;  4W9J A;  1U4A A;  3ZRC A;  3A33 B;  4EEW A;  4K81 A;  1YD8 U;  4E3C A;  1WMH A;  4MEL A;  2DEN B;  3WA0 A;  1WJ4 A;  4MGK E;  4ASW C;  1WE6 A;  3O65 B;  4BBN F;  2ZJD A;  4HLE A;  4A3P A;  2JZZ A;  1V86 A;  3KYC D;  2REX A;  4BOS C;  1V6E A;  4ANX A;  1WX8 A;  2DYB A;  2N1V A;  3WAL A;  2IY0 B;  5AZF A;  2G4S A;  2J0J A;  2XK5 B;  4BVU C;  2D10 A;  1P9D U;  1VCB A;  1E7V A;  2IY1 B;  2NVU I;  4IWQ A;  1F9J A;  3PHW B;  3PLV A;  3QHT A;  2KOX A;  3IVF A;  3HK0 A;  2GBN A;  4BKG A;  3PRZ A;  1WM3 A;  1H4R A;  1LXD A;  2PJH A;  3AU5 A;  1WMH B;  4AJY B;  2N4F A;  4LCD E;  2I1J A;  4OVU A;  2AEH A;  1WR1 A;  1P3Q U;  3P2B A;  2KO3 A;  3QK0 A;  4TQ1 A;  4WJN A;  4CO7 A;  3QQ8 B;  1L2N A;  3QCA A;  1Z5S B;  3K9O B;  2FNJ B;  2MW5 A;  2HTH A;  2L8J A;  4ANW A;  2KQS A;  2KFJ A;  2MP2 A;  4HPM B;  1MG8 A;  3RT3 B;  4HK2 A;  1T0Y A;  5J2R A;  4F7Z A;  2KMA A;  2LGY A;  1EF5 A;  3KYD D;  1WI0 A;  3MTN B;  2L3Z A;  2K6D B;  4MGI E;  2KK8 A;  3A4S C;  4FBJ B;  3RZF A;  3U8Z A;  4DK5 A;  4J6I A;  5G2N A;  1ZKH A;  2LXC A;  3VFK A;  1ZW7 A;  3QC8 B;  3VUY A;  1NBF C;  3APC A;  5LXI B;  1H8C A;  3ZDT A;  1KOT A;  4KVG B;  4FA6 A;  2DZI A;  4GGQ A;  3ML8 A;  4ZRJ A;  1GJZ A;  4WWO A;  3X23 A;  2CHX A;  3CSF A;  2KWC A;  1WZ3 A;  2KD0 A;  3OJ3 A;  4AP4 C;  1OGW A;  4GSW A;  5E6P A;  3TBL D;  3DVG Y;  3QAQ A;  2CU1 A;  2K39 A;  4HPL B;  4W9G A;  2MP2 B;  2WX1 A;  1GUA B;  4ANU A;  4NJ7 A;  5KHO A;  3U7D A;  4I6P A;  4DDI D;  1V2Y A;  1M94 A;  4K1R B;  3C0R B;  2KMC A;  4DHJ B;  2JXX A;  3A9J A;  1OQY A;  3A1Q A;  3NZU A;  1WXA A;  3L10 B;  4FJZ A;  2MQJ A;  1L7Y A;  3UQB A;  2GBR A;  2FCQ A;  2W9N A;  2WYQ A;  4FJY A;  1RRB A;  4EFO A;  1P98 A;  5GMV A;  1P0R A;  1WF9 A;  2AL3 A;  1S3S G;  2VRR B;  1JRU A;  2OJR A;  2CR5 A;  4ZRI A;  1V81 A;  2J7Q B;  2C7H A;  1G6J A;  1HE8 A;  1NI2 A;  1OEY A;  3DBH I;  3HM3 A;  1SIF A;  3PHX B;  4W9C A;  2N9E B;  2WX0 A;  4G0N B;  3W1Y A;  4LJO B;  1ZGU B;  3DOW A;  2BWF A;  4JL9 A;  3IG3 A;  2IO3 B;  1WM2 A;  3A9J B;  2FCM A;  2KJ6 A;  3A1Q B;  1KJT A;  3R66 C;  2IO2 B;  4LDT B;  2PPH A;  4NNJ B;  2D3G A;  2L05 A;  2Z0D B;  3LJ3 A;  2NS5 A;  4GOC A;  3PPA A;  3K9P B;  4HVB A;  2DHZ A;  3KVF B;  4B9K A;  2CHW A;  2MRP A;  2LJ5 A;  4WWN A;  2BKF A;  3KUZ A;  1UEL A;  2MBO A;  3UIO B;  3QWZ B;  2LRW A;  2KWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...