5AZFA

Crystal structure of lgg-1 complexed with a weel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
molecule keywords Protein lgg-1
total genus 40
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azfA00
3V6EB 4TKNA 2KVRA 3U30A 4BKSD 2C7NB 4DDID 1OGWA 3JSVA 3EHVA 3KYDD 3OAWA 2D11A 2J7QB 4AOFA 4DHZB 2L76A 3ZLZA 4FULA 2XBBC 2PJHA 3HM3A 4HPMB 2GMIC 4LDTB 3T8MA 3V6CB 3NOBA 1WRDB 3EECA 2WX0A 3UF8A 4EZJA 2YLMA 2CR5A 2NS5A 4WWPA 3CSTA 2N4FA 3PPAA 2GBJA 4FJVB 2FUHB 2K25A 3ZO5B 5J18A 1RAXA 2LGDA 3N3KB 1WX7A 3Q3FA 4WJQA 4AJWA 4F8CB 2V3SA 4K7SA 3WAOA 1GG3A 3WA0A 3IBEA 4M8NA 2D07B 2KKCA 3A33B 2C7MB 4URKA 1LFDA 4TQ0A 3ZW3A 3M62B 2J0JA 5AZHA 2BF8B 5CHWA 1Z5SB 4II2B 5J17A 3PHXB 2KX3A 5L83A 2G4SA 4GDLB 1K8RB 1WJ6A 5CHVC 4ZRIA 2LJ5A 4W9LA 4I6LB 4EUTA 1WFYA 3VAWA 5C1ZA 1OEYA 2DAJA 3H9DA 3VDZA 4W9KA 2KDBA 2DX5B 2KLCA 3HK0A 4AJYB 1L7YA 4FJZA 5JHBA 1WGHA 4W9IA 4EZLA 1LXDA 2WDTB 3R7RA 4ANVA 4EFOA 3JYUA 4CYEA 2MCNB 3B0AA 2MWSB 1WXVA 1VD2A 4PS7A 2IYDB 3ZNID 5AZFA 4BBNF 2LXAA 3QHTA 4MH0E 4WWNA 4A3PA 2BYEA 2K39A 2KMAA 1H4RA 2KWVB 2NBVB 4II3B 4LJPB 2GOWA 2K6QA 2L8JA 3VTWA 3WANA 2KC2A 5HKHA 3NHEB 2IO0B 3EFUA 4KSKC 3RZFA 2CKHB 2D10A 3KH0A 4DWFA 3P2BA 4BKTA 3QA8A 4IWOA 3AU5A 4RMAA 3APCA 3K9OB 3H7PB 4W9DA 4DK5A 2ZVOA 2BGFA 1WE7A 1YQBA 2KANA 1WGGA 2KK8A 4GN1A 4WJNA 4KZCA 1GUAB 2RPQA 1WJ4A 4NQKE 5LXHA 3R7QA 2V1YA 3V61A 4BVUC 3KUCB 2K1FA 3M95A 4GMVA 4DBGA 4ZRJA 1YX6B 1V49A 4KVGB 4PYZA 1OTRB 4HXDA 2UYZB 1WR1A 4K81A 4BFRA 1NDDA 3MJWA 1AARA 2ZPNA 4AP4C 4MSMB 2OOBB 1C3TA 2AL3A 3C0RB 3OJ3A 4MGYE 2LI5A 1P98A 1WH3A 3RUIB 2JRIB 3AI5A 4GIVA 4AUQC 3ALBA 4GOCA 1XT9B 3A9KA 1E90A 5DPSA 3OJ4B 3QARA 1SIFA 4OVVA 4W9GA 4WJOA 1E7UA 3WAPA 2ZCBA 3QQ8B 2CHXA 3AXCA 4B9KA 3MHSD 3M63B 4W9CA 4MELA 2LXCA 3X23A 4EOYA 1TTNA 1GNUA 4IW0A 4ANUA 3N32A 3ZRFA 4KV2A 2LWPA 5BO4B 2B3AA 4WWOA 2DAFA 3KUDB 3W1YA 4WQOB 5E6PA 2EMTA 3L0WB 4W9HA 2N7EA 2C5LC 1E8ZA 1V5OA 3PS6A 1L2NA 2FAZA 1V80A 4LDTD 4E71A 2M17A 2DZIA 4ANWA 5LXIB 4KIKA 3DBRI 1GC6A 1V5TA 2PE9A 3VUXA 2M8SA 3DBSA 4FLHA 1JRUA 2KTRB 4DDGD 1V6EA 4DXAB 2KQ7A 1SGHA 2JZZA 2L05A 2MP2B 1V2YA 3DVNV 4ICUA 1IPGA 2FCMA 2WWZA 3A4SC 3ZDTA 1P3QU 3AU4A 3H6NA 3BINA 3L54A 3ZRCA 2MX2A 1S3SG 2L0TA 3DPDA 4K1RB 1UD7A 1YJ1A 1HE8A 2VRRB 1XQQA 2RD0A 3V62A 4DHZE 3ZKJC 2C60A 2G4DB 3PRZA 2NCNA 2MQJA 2L7RA 4ASWC 2KFKA 3PV1A 4IM3A 2GBMA 2NBWB 2OJRA 2PE6B 1YX5B 2NPTA 2EMSA 2NVUI 3DVGY 3NZUA 2N1WA 4BBNC 2KX0A 4KIKB 2O6VB 4N9F4 5JZEB 3RCZA 3L16A 1M94A 1T0YA 2D2QA 2ZNVC 2KNBA 4GSWA 3I3TB 1KLVA 4TV3A 1I35A 3ZTDA 3W1SA 2PEAA 4CHKA 2IY1B 3KUZA 1TBEA 2JY6A 1RRBA 2R2OA 1E8XA 3PLUA 4GDLA 5CX3A 3WALA 5J2RA 2IY0B 2GBNA 2JPHA 2KC1A 2RSUA 3VTVA 1RFAA 3H7SA 2ASQA 3UQBA 3S2AA 4JLCA 4M8MA 1J0GA 1H8CA 4E74A 3JW0X 1UBQA 1WM2A 2KO3A 3UQAA 3CSFA 4FJYA 4KDIC 3UGBB 2N7DA 2LZ6A 4HPLB 2KDEB 1LM8B 1SE9A 4MJSA 4W9EA 2DZKA 2FIDA 4F7ZA 5G55A 4HVBA 2K6DB 1WX9A 2N9PC 3ZTCA 1WIAA 1OEYJ 3HIZA 4IC7B 4E3CA 2MRPA 2MSED 2NPTB 3QC8B 4W9FA 2RR9A 4TQ1A 3T9LA 4IM0A 4MEMA 3IHPC 4KDLB 1X1MA 2D3GA 2I1JA 2ZPYA 3A1QA 2W9NA 5D6JB 1CMXB 4PYUA 3L13A 3DQVA 4K7UA 4HCPB 2GBKA 2KFKB 2R2QA 2XEWA 4FHKA 4HJKA 4RM8A 2KD0A 1V86A 4MM3A 3VXWA 2AWTA 2NBUA 1WGYA 2Z0DB 2LVPA 1J19A 2HD5B 3IVFA 3VH3B 2O6VA 2BYFA 2KLGA 1EF1A 2M4NA 4MDKE 2FCQA 3KYCD 4KSLC 3A4RA 2G3QB 3KVFB 2CHZA 1C1YB 1V81A 3ZNZB 3DOWA 2O2VB 4G50A 4HDOA 1Q0WB 3QIJA 1Q1OA 2BWES 3TIXA 1Q5WB 2LRWA 2C9WB 2V4LA 4ANXA 4EEWA 4GGQA 3DCGA 3PRPB 1UZXB 2MLBA 1WI0A 2Z59B 4MJSB 5D94A 4LCDE 1UBIA 2GBRA 2KWUB 2BKRB 2XK5A 5D7GA 3TJPA 1R4NI 3A9KB 4NAWB 3RT3B 2MBEA 4GDKB 3OLMD 5G2NA 2K8CA 5IA7A 4I6PA 2JXXA 5DPWA 3KW5B 2MA9B 3IG3A 3RD2A 4G3XB 3V60A 2BKFA 3CMMB 1R4MI 2A5UA 3QAQA 4B95A 5AZGA 4GXBA 3RZWC 3M3JA 4HDQA 2M0XA 3ZIMA 3VHTC 2ZJDA 1QZEA 3CF6E 4PS3A 3UIPB 3UIOB 1ISNA 3R3MA 2L3ZA 4A20A 2KFJA 2KZRA 1P0RA 2L00B 5DCNA 4IM2A 1MG8A 2O6VD 3VFKA 1A5RA 5L95C 2A4ZA 2CU1A 4JGHB 1PQSA 2CS4A 3PLVA 2QHOA 1UELA 1IP9A 4ZRKA 2DZJA 4NNJB 4BKGA 4KZ0A 5GMVA 2I1KA 4DHJD 2KXJA 1E8WA 4P7IA 5LLIA 1WGRA 4DHJB 3VTUA 2Y5BB 4MGIE 1P9DU 1P1AA 2IBIB 1Z2MA 3DDCB 3ML9A 4AWJA 1WXSA 1WY8A 3VUYA 2XK5B 2NR2A 3JSVB 4GB9A 2UWQA 1KM7A 3PREA 2JRHA 3JVZX 4WJPA 5JH5C 1ZGUB 4LJOB 2LGYA 2N9EB 2IO2B 3QK0A 2Z0EB 1FXTB 2KWCA 4IUMB 4XC2A 3ONSA 3WIMA 2LRUA 2DYOA 1GJZA 4IWQA 1TGZB 2DZMA 2REXA 2ZVNA 4XX5A 2KDFB 5EDSA 2M1MA 5IAAC 4FBJB 1ZW7A 4HLEA 3O65B 4GU2A 2JUOA 3EC8A 2WYQA 3X0WA 3QX1A 4J6IA 3NZSA 2ZCCA 2JZ3B 2KJRA 4K7WA 4GDKA 3PZDA 5TR5A 1WX8A 3IFWB 2AEHA 3HM6X 1D3ZA 4W9JA 3BY4B 1YD8U 3PHWB 3ZUNA 2YVCA 3D32A 1V9JA 1WMHB 1WGDA 5KHOA 2IZVB 1WM3A 5DPRA 2IO3B 2MBQA 3A9JB 4XZ4A 5DPTA 4NJ7A 4F1SA 1Y8RC 3APDA 2LD9A 4CO7A 3PRMB 3DBHI 3ML8A 5E6NA 3K9PB 3SHQA 1J8CA 2LVOA 1WF9A 4NPNA 1RLFA 4RM9A 1EUVB 2KHWB 3PGEA 3VUWA 3VQIA 1G6JA 3L17A 1NI2A 4JQWC 2K8HA 4NQLB 5FR6A 2HE7A 1WJNA 3ECIA 5KHQA 4JL9A 2KN5A 5D2MB 2N9XA 2N1VA 3L08A 3QCAA 4FHJA 3SD5A 3B1LX 1YIWA 2LVQA 4B6WA 4BOSC 3VVWB 3RYTA 1VCBA 1NBFC 2DENB 2J0MA 1WXAA 2ZZPB 4ICVA 3H1UA 3UINB 4IWPA 1UGMA 4M0WB 4BOZB 3Q3JA 4IG7B 2FIFA 1LQBA 3PT2B 2JVCA 3A1QB 4HCNB 1GC7A 2LGXA 3W1SC 3RULA 1E7VA 1E5WA 3GOEA 1WJUA 2DYMA 3VH4B 3SU8X 1WE6A 3ENEA 5AEKB 2MW5A 3QJZA 2IO1B 4FADA 2WX1A 5E6OA 3H7PA 1WR6E 2C7HA 4MSQB 2JWZA 1WMHA 2MBOA 3APFA 3ZDMC 3A9JA 3GZNI 2MBHA 5CTRC 3DVNU 3L10B 3LDZE 3TMPB 2LASA 3PVLA 2KJ6A 2KMCA 2RGFA 4HK2A 2JT4B 2KOXA 2MBBB 3DBLI 2LUEA 3LJ3A 3R66C 4NY0A 4WAAA 2CHWA 1ZKHA 3U7DA 2AYOB 2O2VA 4I6NB 2JF5A 3MTNB 4MGKE 5C23A 4BKSA 1TZ1A 2KJHB 2BYVE 2K8BA 4NAWA 1WYWB 4OVUA 3ZNGC 4PS8A 3WAMA 2L0FA 3HHMA 5JHAA 4EKUA 4G11A 2FCSA 2KTFA 3PTFC 4A3OA 3NS8A 4NJ6A 1KOTA 2BPSA 1UH6A 3ZVVA 1E8YA 2PPHA 3TCAA 2DHZA 1KJTA 4MGZE 4FN2A 2HTHA 2FCNA 3TL5A 4FA6A 2ZEQA 1IYFA 1U4AA 4TUUA 5CHFA 2KQSA 3QWZB 3ZNHB 2AL6A 3TBLD 2FNJB 2HJ8A 3N30A 2ZNVB 4EZKA 1XD3B 3AULA 3DVGX 1OQYA 1BT0A 1F9JA 4G0NB 3SDLC 1WXMA 1WZ3A 1EF5A 4HWIB 3B08A 4ZYNA 1WZ0A 3U8ZA 2KTRA 4ZDVA 2J0KA 2KDIA 4X57B 3NY5A 2MP2A 2BWFA 2EKEC 2G45B 1S1QB 1EO6A 4YL8A 1I42A 4JIOU 3PSEB 2DYBA
chains in the Genus database with same CATH superfamily
1SIJA 1SJHD 4C80A 1QILA 3U30A 3EHVA 3KYDD 4DHZB 2L76A 3AV8A 2CJOA 2WHIA 2PJHA 3HM3A 4HPMB 3V6CB 4EZJA 3BVGA 2I2YA 2NS5A 4WAFA 4PK1A 1MG4A 3AE1B 2WGSA 5C2TB 2K25A 1WSPA 3N3KB 3Q3FA 1KLUD 3RMKC 1L0YB 1ENFA 4TQ0A 2BYTA 3M62B 2BF8B 1SBBB 3PHXB 5L83A 5CHVC 5AUKA 4ZRIA 2LJ5A 4YTNB 1WFYA 1XLNA 1P7FA 3DWMA 2INNE 2KDBA 1YNTE 2RMMA 1EU3A 5BYRA 4FJZA 1LXDA 2HTME 3JYUA 4CYEA 2MCNB 3ZYYX 1ZOYB 3FAHA 1VD2A 1GB4A 4BBNF 2IYDB 2LXAA 4MH0E 3IT4B 2H89B 1TS3A 1H4RA 2NBVB 4LJPB 2GOWA 2H88B 2KC2A 3EFUA 2CKHB 3P2BA 4BKTA 1CK1A 5IOIA 3APCA 2QDFA 2D3CA 1YQBA 5LXHA 2D5GA 3P1MA 4DBGA 1V49A 4HXDA 1QKZA 1WR1A 4BFRA 2K22A 4AP4C 2ZPNA 1C3TA 1DOIA 3C0RB 1J7AA 3RUIB 4M01A 2WXNA 3BVZA 3OJ4B 4YWGG 3V05A 5FKAC 4TMAB 3M63B 2WS3B 1L4ZB 2VZKD 4ANUA 3N9YC 2B3AA 3KQ4A 3PS6A 2DZIA 2INDC 1GC6A 1V5TA 3DBSA 1N63A 1PGBA 2L05A 3ZDTA 2INPE 1UF0A 3L54A 2MX2A 1UD7A 1SE3A 4HJGE 4DHZE 2WU5B 5HG2A 3RNAC 4ASWC 2WXIA 3PV1A 4IM3A 4EE2A 1D6EC 1XXGA 1EWYC 3NZUA 2N1WA 4KIKB 3VR8B 1M4VA 3L16A 1M94A 3RNCC 3TEZA 2D2QA 4H2AA 1HQRD 4WIPA 3ZTDA 3KUZA 2JY6A 2R2OA 1E8XA 3WALA 1E9MA 2GBNA 2ZW1A 2RSUA 4M02A 1GAQB 4JLCA 2BB6A 2M19A 4KDIC 2LZ6A 2KDEB 1LM8B 4ZHOA 3MJ5A 1SE9A 4W9EA 5AUIA 5G55A 4IC7B 2MSED 3AE2B 4W9FA 4TQ1A 2RPVA 4M00A 1V1PB 1TZOA 1X1MA 2AQ1B 2D3GA 3A1QA 3L13A 3DQVA 2KDMA 2R2QA 2V0GA 1XLOA 3HRDD 2KAJA 3ZXVA 2O6VA 4RNAA 2M4NA 2KVZA 2FCQA 4KSLC 4N58A 5BMHA 1ZDVA 3ZNZB 3DOWA 4LNNA 1Q0WB 3MC9A 3P42A 1NVID 3DCGA 3PRPB 3C8YA 2XK5A 2KWUB 1ROEA 2BKRB 3LYYA 3A9KB 1UWXA 3Q2AC 4NAWB 3RT3B 4GDKB 5G2NA 2WNMA 1F77A 3RD2A 5LNK1 4G3XB 5H8YE 3V60A 1B1ZA 3CMMB 3URYA 5AZGA 1GB1A 3M3JA 1XLQA 1WRIA 3UIPB 5G5GA 2BBCA 3R3MA 2KFJA 2WXPA 2KZRA 1P0RA 2L00B 2BQQA 2O6VD 2IDYA 1AYFA 4N59A 4FXCA 3B2GA 4ZRKA 5H92C 3TUOA 4DHJD 2KXJA 1WGRA 2QJLA 1SE4A 4AWJA 1WXSA 1WY8A 3BZDB 3VUYA 2XK5B 4PT5A 4WJPA 5JH5C 2K3UA 1ZGUB 1ZUD2 2KWCA 3BK1A 1GJZA 1F2RC 4KKJA 1K52A 1QT9A 2ZVNA 2OHFA 5IAAC 4FBJB 4GU2A 1JROA 2JU6X 4YSYB 5HFYA 1QOAA 2LGSA 2JSVX 1RYJA 2JZ3B 2KJRA 4K7WA 3PZ7A 3IFWB 1D3ZA 1YD8U 3D32A 1WGDA 5KHOA 1WM3A 5DPRA 4XZ4A 5DPTA 3RNEC 3APDA 1JRPA 2LD9A 1IGDA 2VH1A 1J7CA 3K9PB 4K3BA 1RLFA 1EUVB 2KHWB 2LJIA 3DBHB 2X8XX 3L17A 4JQWC 4NQLB 2K8HA 2HE7A 3ECIA 4JL9A 2KN5A 3RFZB 4FHJA 3U7ZA 1KH0A 2J0MA 1TIFA 3AE9B 4BOZB 3LXFA 1HA5A 3Q3JA 1C78A 1LQBA 3PT2B 4HCNB 1GC7A 4TSSA 1E7VA 1WJUA 1V8CA 2WX1A 5E6OA 2C7HA 3E56A 4MSQB 2JWZA 2QC8A 3L4PA 1MHXA 5CTRC 4LNKA 2KMCA 2QEJC 2RDHA 1L6VA 3AEBB 2KOXA 3DBLI 1VJKA 1VR9A 4WAAA 2LUMA 1TY2A 1ZP0B 4I6NB 1KFYB 3H8HA 1EM7A 2N9LA 2MH7A 5GXGB 1WYWB 1FO4A 2L1AA 4L1BA 5JHAA 1GPXA 1CJEA 3FC4A 4NJ6A 3AEAB 3EUB2 1IBXA 4KGTA 2DHZA 1KJTA 2HTHA 2FCNA 3TL5A 1IYFA 3AE4B 5CHFA 1CQVA 3QWZB 1MI0A 2AL6A 3Q8AA 3TBLD 3N30A 4EZKA 3DVGX 2BS4B 3SDLC 1EF5A 5C3JB 3B08A 4KGRA 4ZYNA 2PVOD 4ZDVA 4X57B 3NY5A 4KGSA 4MH8A 3HVDA 1I4HA 5BYQA 3NVZA 4TKNA 3RNGC 2W82A 3ZLZA 4ITKA 2XBBC 3U2SC 4US8A 2GMIC 3NOBA 3AEGB 3UF8A 2YLMA 1TKGA 5G5HA 3N20C 3PPAA 4A55A 2FUHB 1FCLA 5J18A 2LGDA 3AEDB 2G9HD 4K7SA 1GG3A 2FE8A 3WA0A 4M8NA 2C7MB 3R8BA 2J0JA 5AZHA 4LNOA 1Z5SB 4II2B 5J17A 2G4SA 4GDLB 2BT6A 4I6LB 1QOGA 3VAWA 4OZCA 5C1ZA 4W9KA 2DX5B 2KLCA 1NYQA 4EZLA 2WDTB 4EFOA 2DWQA 3TEYA 3B0AA 2MWSB 2XN9C 2W3RA 1WXVA 3ETRA 4WWNA 1NYRA 1SXTA 2K39A 3KWVA 4JX1C 2K6QA 2QIEB 1WYGA 2JYEA 1VZ7A 5HKHA 4KSKC 2D10A 4DWFA 2OJWA 3QA8A 2G1EA 3AU5A 4RMAA 4W9DA 3H7PB 2BGFA 1TS4A 1WE7A 4YSZB 1WGGA 2KK8A 4WJNA 1FFUA 2WXRA 1PUTA 2V1YA 4BVUC 4C56C 4ARCA 3M95A 4PYZA 2UYZB 1NDDA 3MJWA 1XCTL 1T0RC 2V9HA 3OJ3A 4MGYE 1P98A 1WH3A 4AUQC 1WWTA 2B76B 1XT9B 3NVWA 5DPSA 4W9GA 4WJOA 4B9KA 3QQ8B 3AXCA 3MHSD 4HROA 4W9CA 5D3IB 3X23A 2JX5A 1HTQA 1XLPA 1ZPSA 4OW0A 1V5OA 1KF6B 1L2NA 2FAZA 4WQMA 4ANWA 5LXIB 4JWSC 4FLHA 5D3DA 4DDGD 1WXQA 3SFEB 2WXFA 1V2YA 3DVNV 4ICUA 4DXGA 1P3QU 3AU4A 4K1RB 1R7SA 2RD0A 4LLGM 4XDCA 4ZHPA 2GBMA 2WXQA 2YEPB 2KX0A 2O6VB 3T3NA 5JZEB 3RCZA 1EU4A 2GB1A 1SF0A 5FR3A 3I3TB 1KLVA 1TBEA 1V97A 1NENB 1RRBA 4OHJA 3MFGA 5J2RA 2IY0B 2JPHA 2KC1A 4MM3B 1RFAA 2ASQA 4D2KA 4M8MA 1UBQA 1D5XC 3CSFA 2FIDA 3EFCA 2K6DB 2N9PC 1XCQL 1WIAA 4E3CA 2RR9A 4MEMA 2I1JA 2ZPYA 4PYUA 2GBKA 2KFKB 2XEWA 4RM8A 1V86A 1PDXA 1WGYA 2Z0DB 2HD5B 4LK0M 3IVFA 3Q8BA 2KLGA 1JQ4A 4WH4A 3KYCD 2PLPA 3NRZA 2O2VB 4HDOA 3TIXA 2ACZB 2C9WB 2V4LA 4ANXA 1T0SC 1SSNA 3MC0B 3P4PB 1WI0A 2MLBA 5D94A 4BKGA 2GBRA 3TJPA 1YMHE 2AQ2B 1TY0A 3E9SA 3GB1A 2K8CA 4I6PA 2JXXA 2OEDA 1MJDA 2A5UA 4GXBA 1VZ8A 2M0XA 3VHTC 2J4XA 2BTEA 3C19A 2QILA 3CIRB 4YTPB 1LO5D 3VFKA 1A5RA 5L95C 2A4ZA 3BIID 3PLVA 2QHOA 4BZAA 4RGTA 2JXTA 4KZ0A 1NI3A 2I1KA 4DHJB 3VTUA 1QQRA 1P9DU 1C77A 1Z2MA 3ML9A 3JSVB 1BUIC 2UWQA 2JRHA 2E6XA 3QK0A 2N9EB 2IO2B 2LRUA 2Y5CA 3AE6B 2KT7A 2DZMA 4S17A 3N1XC 1I4RA 2WXGA 2M1MA 4HLEA 1XF5L 1JWBD 2WDVB 2J42A 1QF6A 1KTKA 3ZUNA 2K0PA 3A9JB 4NJ7A 1Y8RC 3P4RB 3PRMB 1YN3A 3AECB 3DBHI 4NPNA 3VQIA 5KHQA 3RNFC 4IOIE 1KLGD 3AEEB 3RYTA 2Z8LA 2DENB 3H1UA 3W5VB 3UINB 1ZXHA 4IG7B 1FD6A 2FIFA 2ON8A 2JVCA 3A1QB 1VDVA 3GOEA 2DYMA 3VH4B 1DOYA 3SU8X 2MW5A 3Q3NC 3QJZA 2IO1B 4FADA 1Q10A 1JWUD 1WR6E 1YN4A 2WXLA 2MBOA 2W55A 3A9JA 4IKGA 2MBHA 1DYQA 2LASA 3PVLA 1IUEA 2RGFA 2JT4B 3LJ3A 2LUEA 4JPSA 2MHJA 3BWUD 3NS1A 2PW9A 3N1ZC 2JYTA 1KRHA 4M0WA 4MGKE 1JCKB 5C23A 1HXYD 2BYVE 4NAWA 4UDUC 1I4PA 1FNVA 1L6UA 4EKUA 3PTFC 1JMLA 2PKOA 1KOTA 4NAMA 1ZDXA 4L2YA 3ZVVA 1D5MC 4FN2A 1I4GA 4FA6A 2ZEQA 1UUPA 4TUUA 1UNSA 2KQSA 2M56B 1FXAA 1V1OA 2HJ8A 2ZNVB 1XD3B 3AULA 1OQYA 5T8IA 1WXMA 3FILB 1PGXA 1FRRA 3RPFC 2KTRA 2KMMA 1MPEA 2TSSA 2MP2A 1RFKA 1K51A 1EO6A 4C4VB 3PSEB 2DYBA 1QOFA 1XEEA 3V6EB 4A9AA 1T6BX 2C7NB 1JWAD 1OGWA 2J7QB 3TSSA 1FM0D 2Y3AA 3Q8FA 2BW2A 3T8MA 2IGDA 1PGAA 2QSDA 2N4FA 4FJVB 1RAXA 4AJWA 2LFIA 3WAOA 2VZKB 2D3BA 3IBEA 2KKCA 3A33B 1LFDA 1N6ZA 5EE9A 3SEBA 5CHWA 2KX3A 1K8RB 4EUTA 4AQ7A 1OEYA 1PFDA 3H9DA 3VDZA 1DOXA 1L7YA 5JHBA 1WGHA 2RDGA 1N61A 1WGKA 3R7RA 4USAA 3ZXRA 4RGNA 1STEA 2W54A 1UWMA 1AN8A 3QHTA 4A3PA 2BYEA 2KMAA 4II3B 3WANA 3HVZA 3GZNB 1L5PA 2AQ3B 3K9OB 2WDQB 2ZVOA 2KANA 2RPQA 1WJ4A 3R7QA 3Q8EA 3V61A 3DBRB 2Q5WD 3KUCB 2K1FA 1C79A 1OTRB 3RN9C 1AARA 4MSMB 1PYWD 2AL3A 2L52A 2LI5A 4GIVA 3ALBA 4GOCA 2LHDA 4XE0A 4OVVA 3QARA 3AM9A 3WAPA 1E7UA 2ZCBA 2CHXA 1E10A 4MELA 2LXCA 4EOYA 3ZJVA 2FUG1 2BVCA 5BO4B 4WWOA 3SR6A 3KUDB 1TS2A 3W1YA 5E6PA 2EMTA 1E8ZA 2DBYA 3LB8C 1MFWA 3DBLB 4P16A 1V80A 3R2TA 4E71A 4KIKA 1MHHE 3DBRI 2QCZA 1FIQA 2PE9A 3VUXA 2M8SA 2WLBA 2LMCA 2JZZA 2WWZA 2IJ0A 3AE8B 3B9JA 5EE3A 3BINA 3ZRCA 1S3SG 2L0TA 3DPDA 4WURA 1YJ1A 3V62A 5EE0A 3NJTA 2MQJA 2KQ4X 2KFKA 2NBWB 3I57A 2JZPA 3AMZA 2IGGA 2WQYB 1T3QA 2NPTA 2EMSA 2AX5A 3ZGZA 1JW9D 4BBNC 5BMGA 4P1BC 4N9F4 3RI7C 1E0ZA 1IGCA 1T0YA 2K9XA 2ZNVC 4GSWA 3R2IA 4ZRQA 4KX6B 3KLSX 3W1SA 2IY1B 4GDLA 5CX3A 3PLUA 2PIAA 4B0MA 3VTVA 3H7SA 3AE7B 3S2AA 1J0GA 4E74A 3JW0X 3ZJTA 1WM2A 2KO3A 3AN1A 2HDEA 3UQAA 1QLBB 3UGBB 3BK2A 2LGIA 1I4XA 4MJSA 2DZKA 4HVBA 1WX9A 4L23A 2MRPA 2NPTB 4OVZA 1XO3A 3RNBC 1C4CA 4IM0A 1T0QC 4KDLB 2W9NA 1CMXB 3GP7A 3IXSA 1C76A 4FHKA 4HJKA 3MP9A 2KD0A 2WP9B 3BYYB 1E7PB 2AWTA 2LVPA 3VH3B 2BYFA 2BS3B 2DLBA 4MDKE 4IDIA 4N6EB 2G3QB 2WXJA 3KVFB 2R61A 4R3DA 3QIJA 1Q1OA 2BWES 1HZ6A 4EEWA 1T5XD 4GGQA 1F1HA 1N60A 1UZXB 4MJSB 4LCDE 1UBIA 5D7GA 1D4BA 1R4NI 2WDRB 3OLMD 4P6VF 5IA7A 1R4MB 3KW5B 3IG3A 3N1YC 3QAQA 4B95A 2N7JA 1C9FA 1AWDA 3RZWC 1D5ZC 4HDQA 2ZJDA 1QZEA 3CF6E 3B2FA 3UIOB 1ISNA 4ARIA 4A20A 2L3ZA 3DHGC 1VZ6A 2PMVA 5DCNA 4IM2A 1MG8A 4A6QA 4JGHB 2CU1A 1PQSA 2XNAC 1UELA 2DZJA 3AEFB 4NNJB 5GMVA 1E8WA 4P7IA 1FCCC 4WWMA 4YT0B 1JWSD 2IBIB 1N5XA 1AW7A 1ET9A 3PREA 4LJOB 1GOZA 1FXTB 5TSSA 4IUMB 4IWQA 2REXA 4XX5A 2KDFB 5EDSA 3EC8A 2WYQA 2X38A 3X0WA 3QX1A 4J6IA 3PZDA 5TR5A 2SAKA 3VR9B 4RGOS 3PO0A 2AEHA 4W9JA 3I9V1 2PTLA 3PHWB 2YVCA 1V9JA 1RWSA 5IKCM 2IZVB 2IO3B 2KN4A 1FRDA 4K3CA 4CO7A 1DGJA 4NZLB 5E6NA 4A90A 1J8CA 2LVOA 4RM9A 1G6JA 3PGEA 3VUWA 2V3PA 4HKZE 5FR6A 1F0ZA 1WJNA 1YOVB 1OQRA 2N9XA 2N1VA 1YIWA 2LVQA 4B6WA 4BOSC 1HTOA 4CQNA 1NBFC 1JWMD 2ZZPB 5E6JA 4J3OD 4IWPA 3U4EG 4XGAB 3FILA 3FKYA 3W1SC 2LGXA 4P1CC 3RULA 1E5WA 4XDDA 1FXIA 2DNFA 1N62A 4A8XC 4HEA1 4XWTA 3APFA 3GZNI 5EE1A 3L10B 2K5PA 3TMPB 2KJ6A 3NG0A 2MBBB 1P7EA 2N0SB 1MVKA 2CHWA 3AB5A 3GE8C 3ZQ4A 2O2VA 2PVGC 1EWCA 3Q6BA 4BKSA 3W9CB 4YTMB 1ESFA 2KJHB 4MT5A 2L83A 4OVUA 3ZNGC 3ABVB 2MJ3A 2L0FA 3HHMA 3KWLA 2L32A 1YN5A 5BMIA 2BPSA 1UH6A 1E8YA 1SEBD 4MGZE 2LEKA 3BYTB 3ZNHB 2FNJB 1C4AA 1BT0A 1F9JA 4G0NB 1CZPA 1WZ3A 2WXMA 5BYSA 2M0AA 2N9KA 1WZ0A 3U8ZA 2BWFA 2HJ1A 2EKEC 1S1QB 1I42A 4GLSC 1HEZE 2KVRA 4BKSD 4DDID 3JSVA 2MJDA 3OAWA 4AOFA 2D11A 1IBXB 4FULA 2RDBC 2WXHA 1FNUA 4LDTB 1WRDB 3EECA 2WX0A 2CR5A 4WWPA 3WCQA 3CSTA 2CJNA 4ZYSA 2GBJA 3ZO5B 1WX7A 4F8CB 4WJQA 2V3SA 4NJCA 3NVYA 2D07B 4URKA 3ZW3A 2GI9A 1I4QA 3P63A 1WJ6A 4W9LA 1BXTA 2DAJA 3HK0A 4AJYB 1FEHA 4W9IA 4JWUC 4ANVA 2GLSA 4US9A 4PS7A 3ZNID 5AZFA 2KWVB 1K50A 3VRBB 1F2RI 2L8JA 3VTWA 3NHEB 2KYWA 4RF0A 2IO0B 4REZA 3U52E 3RZFA 3KH0A 4IWOA 3GE3C 2FBWB 4DK5A 4YSXB 4GN1A 2J52A 3I63C 4KZCA 1GUAB 4NQKE 3Q14C 1OQQA 3OWEB 3W2DA 4LNFA 4GMVA 3J9CA 4ZRJA 1YX6B 4KVGB 4K81A 5JXVA 2OOBB 4ACFA 3AE5B 2GRIA 2JRIB 3AI5A 4HPPA 3Q69A 1TJEA 3A9KA 1E90A 1SIFA 2V3NA 1A70A 1TTNA 1GNUA 1YQ4B 4IW0A 1SE2A 1C4PA 3N32A 1R4NB 3ZRFA 4KV2A 2LWPA 2DAFA 4WQOB 2ICIA 3IAM1 2N7EA 1E6EB 2C5LC 3L0WB 4W9HA 5HHDG 4LDTD 2M17A 1JRUA 2KTRB 4DXAB 1V6EA 2KQ7A 2KACA 1SGHA 2MP2B 1IPGA 2FCMA 3A4SC 5IP4D 4C4VA 3H6NA 2I38A 3HUIA 1HE8A 2VRRB 1XQQA 3ZKJC 2C60A 2G4DB 3PRZA 4C7YA 1SJED 2NCNA 2L7RA 1J7BA 1YJIA 2OJRA 2PE6B 3ZJUA 1YX5B 2EELA 3EA6A 1Y56A 2NVUI 3DHHC 3DVGY 1YQ3B 2JQRB 4LNIA 2KNBA 2MEKA 4TV3A 1I35A 3AH7A 2PEAA 2ZW0A 4CHKA 1TS5A 1UGJA 2W3SA 3NZ3A 4RCOA 2UU7A 3T3OA 3UQBA 4HRSA 4BAXA 1H8CA 3V3XA 4FJYA 2N7DA 1F52A 4HPLB 4F7ZA 3ZTCA 3HIZA 1OEYJ 2IPKD 3QC8B 3T9LA 3SFDB 3IHPC 2YEPF 1N5WA 5D6JB 2SEBD 2CU3A 4K7UA 4HCPB 4AS1A 3IT6B 4MM3A 3VXWA 2QMTA 2NBUA 1J19A 1L0XB 3GS2A 1EF1A 4DXFA 5IO9A 3A4RA 2NTSA 2CHZA 1C1YB 1V81A 4G50A 3Q3MC 1Q5WB 2LRWA 3Q8CA 4OZBA 2MJEA 2Z59B 3NUHB 4YXDB 2MBEA 5DPWA 2MA9B 2BKFA 4O1NA 1R4MI 1TT5B 3TEXA 1FMAD 1ZE3D 4PS3A 3O13A 3PZ8A 3W5UB 2V4IB 1L4DB 4RFBA 1V1PA 2CS4A 1IP9A 2NMQA 2E3TA 3MHZA 4C7ZA 3UI3A 1SB3C 3EGRA 1QOBA 5LLIA 2Y5BB 4MGIE 1P1AA 4JE3B 3DDCB 4HKQA 2NR2A 1NEKB 4GB9A 2NTTA 1KM7A 3JVZX 2LGYA 1I7HA 2Z0EB 4XC2A 2KWDA 3ONSA 3WIMA 2DYOA 1TGZB 1FPYA 1ZW7A 3O65B 2JUOA 1ACCA 4Q2JA 3NZSA 2ZCCA 2WXKA 4GDKA 1WX8A 2D3AA 1ZXIA 3HM6X 3DHIC 2JWUA 3BY4B 2BB5A 1JALA 3I5JC 1WMHB 3ZIMA 2MBQA 4F1SA 3NVVA 1FNWA 1TKYA 3AE3B 1TKEA 3ML8A 3OG5A 5I4DA 3SHQA 1WF9A 1TYGB 2ONQA 4B0EA 1NI2A 1B9RA 5D2MB 3DWGC 3L08A 3QCAA 3SD5A 3B1LX 1HZ5A 1FFVA 2BS2B 2WXOA 3VVWB 1VCBA 1WXAA 4ICVA 4LTUA 4RGMA 2VH2A 1K53A 4MACA 3MC8A 1UGMA 4M0WB 4C00A 2Y5PA 3CWIA 4XWWA 1LGRA 5FK9C 1WE6A 3ENEA 5AEKB 2LHEA 4ZOHC 3H7PA 4S0RA 2IGHA 1WMHA 5MPOA 3ZDMC 4RH6A 3DVNU 2WU2B 3LDZE 4HK2A 3R66C 1VLBA 4NY0A 1ZKHA 3U7DA 2AYOB 3BVMA 4QAYA 3TEWA 2JF5A 3MTNB 1YJJA 2INCC 1TZ1A 3P4SB 2K8BA 4PS8A 3WAMA 3IAS1 4G11A 1RM6C 2FCSA 2KTFA 4A3OA 3NS8A 2PPHA 3TCAA 4ZRPA 5HI1A 1U4AA 3Q3OC 4DQOC 3VRAB 4RF1A 1OFFA 4HWIB 1BMLC 1L0VB 5IN7A 1ET6A 2J0KA 2KDIA 4KKIA 4XYCA 3P4QB 2J53A 2EKIA 2G45B 4YL8A 4JIOU 1VRAB 4OZAA
chains in the Genus database with same CATH topology
3V6EB 4TKNA 2KVRA 3U30A 4BKSD 2C7NB 4DDID 1OGWA 3JSVA 3EHVA 3KYDD 3OAWA 2D11A 2J7QB 4AOFA 4DHZB 2L76A 3ZLZA 4FULA 2XBBC 2PJHA 3HM3A 4HPMB 2GMIC 4LDTB 3T8MA 3V6CB 3NOBA 1WRDB 3EECA 2WX0A 3UF8A 4EZJA 2YLMA 2CR5A 2NS5A 4WWPA 3CSTA 2N4FA 3PPAA 2GBJA 4FJVB 2FUHB 2K25A 3ZO5B 5J18A 1RAXA 2LGDA 3N3KB 1WX7A 3Q3FA 4WJQA 4AJWA 4F8CB 2V3SA 4K7SA 3WAOA 1GG3A 3WA0A 3IBEA 4M8NA 2D07B 2KKCA 3A33B 2C7MB 4URKA 1LFDA 4TQ0A 3ZW3A 3M62B 2J0JA 5AZHA 2BF8B 5CHWA 1Z5SB 4II2B 5J17A 3PHXB 2KX3A 5L83A 2G4SA 4GDLB 1K8RB 1WJ6A 5CHVC 4ZRIA 2LJ5A 4W9LA 4I6LB 4EUTA 1WFYA 3VAWA 5C1ZA 1OEYA 2DAJA 3H9DA 3VDZA 4W9KA 2KDBA 2DX5B 2KLCA 3HK0A 4AJYB 1L7YA 4FJZA 5JHBA 1WGHA 4W9IA 4EZLA 1LXDA 2WDTB 3R7RA 4ANVA 4EFOA 3JYUA 4CYEA 2MCNB 3B0AA 2MWSB 1WXVA 1VD2A 4PS7A 2IYDB 3ZNID 5AZFA 4BBNF 2LXAA 3QHTA 4MH0E 4WWNA 4A3PA 2BYEA 2K39A 2KMAA 1H4RA 2KWVB 2NBVB 4II3B 4LJPB 2GOWA 2K6QA 2L8JA 3VTWA 3WANA 2KC2A 5HKHA 3NHEB 2IO0B 3EFUA 4KSKC 3RZFA 2CKHB 2D10A 3KH0A 4DWFA 3P2BA 4BKTA 3QA8A 4IWOA 3AU5A 4RMAA 3APCA 3K9OB 3H7PB 4W9DA 4DK5A 2ZVOA 2BGFA 1WE7A 1YQBA 2KANA 1WGGA 2KK8A 4GN1A 4WJNA 4KZCA 1GUAB 2RPQA 1WJ4A 4NQKE 5LXHA 3R7QA 2V1YA 3V61A 4BVUC 3KUCB 2K1FA 3M95A 4GMVA 4DBGA 4ZRJA 1YX6B 1V49A 4KVGB 4PYZA 1OTRB 4HXDA 2UYZB 1WR1A 4K81A 4BFRA 1NDDA 3MJWA 1AARA 2ZPNA 4AP4C 4MSMB 2OOBB 1C3TA 2AL3A 3C0RB 3OJ3A 4MGYE 2LI5A 1P98A 1WH3A 3RUIB 2JRIB 3AI5A 4GIVA 4AUQC 3ALBA 4GOCA 1XT9B 3A9KA 1E90A 5DPSA 3OJ4B 3QARA 1SIFA 4OVVA 4W9GA 4WJOA 1E7UA 3WAPA 2ZCBA 3QQ8B 2CHXA 3AXCA 4B9KA 3MHSD 3M63B 4W9CA 4MELA 2LXCA 3X23A 4EOYA 1TTNA 1GNUA 4IW0A 4ANUA 3N32A 3ZRFA 4KV2A 2LWPA 5BO4B 2B3AA 4WWOA 2DAFA 3KUDB 3W1YA 4WQOB 5E6PA 2EMTA 3L0WB 4W9HA 2N7EA 2C5LC 1E8ZA 1V5OA 3PS6A 1L2NA 2FAZA 1V80A 4LDTD 4E71A 2M17A 2DZIA 4ANWA 5LXIB 4KIKA 3DBRI 1GC6A 1V5TA 2PE9A 3VUXA 2M8SA 3DBSA 4FLHA 1JRUA 2KTRB 4DDGD 1V6EA 4DXAB 2KQ7A 1SGHA 2JZZA 2L05A 2MP2B 1V2YA 3DVNV 4ICUA 1IPGA 2FCMA 2WWZA 3A4SC 3ZDTA 1P3QU 3AU4A 3H6NA 3BINA 3L54A 3ZRCA 2MX2A 1S3SG 2L0TA 3DPDA 4K1RB 1UD7A 1YJ1A 1HE8A 2VRRB 1XQQA 2RD0A 3V62A 4DHZE 3ZKJC 2C60A 2G4DB 3PRZA 2NCNA 2MQJA 2L7RA 4ASWC 2KFKA 3PV1A 4IM3A 2GBMA 2NBWB 2OJRA 2PE6B 1YX5B 2NPTA 2EMSA 2NVUI 3DVGY 3NZUA 2N1WA 4BBNC 2KX0A 4KIKB 2O6VB 4N9F4 5JZEB 3RCZA 3L16A 1M94A 1T0YA 2D2QA 2ZNVC 2KNBA 4GSWA 3I3TB 1KLVA 4TV3A 1I35A 3ZTDA 3W1SA 2PEAA 4CHKA 2IY1B 3KUZA 1TBEA 2JY6A 1RRBA 2R2OA 1E8XA 3PLUA 4GDLA 5CX3A 3WALA 5J2RA 2IY0B 2GBNA 2JPHA 2KC1A 2RSUA 3VTVA 1RFAA 3H7SA 2ASQA 3UQBA 3S2AA 4JLCA 4M8MA 1J0GA 1H8CA 4E74A 3JW0X 1UBQA 1WM2A 2KO3A 3UQAA 3CSFA 4FJYA 4KDIC 3UGBB 2N7DA 2LZ6A 4HPLB 2KDEB 1LM8B 1SE9A 4MJSA 4W9EA 2DZKA 2FIDA 4F7ZA 5G55A 4HVBA 2K6DB 1WX9A 2N9PC 3ZTCA 1WIAA 1OEYJ 3HIZA 4IC7B 4E3CA 2MRPA 2MSED 2NPTB 3QC8B 4W9FA 2RR9A 4TQ1A 3T9LA 4IM0A 4MEMA 3IHPC 4KDLB 1X1MA 2D3GA 2I1JA 2ZPYA 3A1QA 2W9NA 5D6JB 1CMXB 4PYUA 3L13A 3DQVA 4K7UA 4HCPB 2GBKA 2KFKB 2R2QA 2XEWA 4FHKA 4HJKA 4RM8A 2KD0A 1V86A 4MM3A 3VXWA 2AWTA 2NBUA 1WGYA 2Z0DB 2LVPA 1J19A 2HD5B 3IVFA 3VH3B 2O6VA 2BYFA 2KLGA 1EF1A 2M4NA 4MDKE 2FCQA 3KYCD 4KSLC 3A4RA 2G3QB 3KVFB 2CHZA 1C1YB 1V81A 3ZNZB 3DOWA 2O2VB 4G50A 4HDOA 1Q0WB 3QIJA 1Q1OA 2BWES 3TIXA 1Q5WB 2LRWA 2C9WB 2V4LA 4ANXA 4EEWA 4GGQA 3DCGA 3PRPB 1UZXB 2MLBA 1WI0A 2Z59B 4MJSB 5D94A 4LCDE 1UBIA 2GBRA 2KWUB 2BKRB 2XK5A 5D7GA 3TJPA 1R4NI 3A9KB 4NAWB 3RT3B 2MBEA 4GDKB 3OLMD 5G2NA 2K8CA 5IA7A 4I6PA 2JXXA 5DPWA 3KW5B 2MA9B 3IG3A 3RD2A 4G3XB 3V60A 2BKFA 3CMMB 1R4MI 2A5UA 3QAQA 4B95A 5AZGA 4GXBA 3RZWC 3M3JA 4HDQA 2M0XA 3ZIMA 3VHTC 2ZJDA 1QZEA 3CF6E 4PS3A 3UIPB 3UIOB 1ISNA 3R3MA 2L3ZA 4A20A 2KFJA 2KZRA 1P0RA 2L00B 5DCNA 4IM2A 1MG8A 2O6VD 3VFKA 1A5RA 5L95C 2A4ZA 2CU1A 4JGHB 1PQSA 2CS4A 3PLVA 2QHOA 1UELA 1IP9A 4ZRKA 2DZJA 4NNJB 4BKGA 4KZ0A 5GMVA 2I1KA 4DHJD 2KXJA 1E8WA 4P7IA 5LLIA 1WGRA 4DHJB 3VTUA 2Y5BB 4MGIE 1P9DU 1P1AA 2IBIB 1Z2MA 3DDCB 3ML9A 4AWJA 1WXSA 1WY8A 3VUYA 2XK5B 2NR2A 3JSVB 4GB9A 2UWQA 1KM7A 3PREA 2JRHA 3JVZX 4WJPA 5JH5C 1ZGUB 4LJOB 2LGYA 2N9EB 2IO2B 3QK0A 2Z0EB 1FXTB 2KWCA 4IUMB 4XC2A 3ONSA 3WIMA 2LRUA 2DYOA 1GJZA 4IWQA 1TGZB 2DZMA 2REXA 2ZVNA 4XX5A 2KDFB 5EDSA 2M1MA 5IAAC 4FBJB 1ZW7A 4HLEA 3O65B 4GU2A 2JUOA 3EC8A 2WYQA 3X0WA 3QX1A 4J6IA 3NZSA 2ZCCA 2JZ3B 2KJRA 4K7WA 4GDKA 3PZDA 5TR5A 1WX8A 3IFWB 2AEHA 3HM6X 1D3ZA 4W9JA 3BY4B 1YD8U 3PHWB 3ZUNA 2YVCA 3D32A 1V9JA 1WMHB 1WGDA 5KHOA 2IZVB 1WM3A 5DPRA 2IO3B 2MBQA 3A9JB 4XZ4A 5DPTA 4NJ7A 4F1SA 1Y8RC 3APDA 2LD9A 4CO7A 3PRMB 3DBHI 3ML8A 5E6NA 3K9PB 3SHQA 1J8CA 2LVOA 1WF9A 4NPNA 1RLFA 4RM9A 1EUVB 2KHWB 3PGEA 3VUWA 3VQIA 1G6JA 3L17A 1NI2A 4JQWC 2K8HA 4NQLB 5FR6A 2HE7A 1WJNA 3ECIA 5KHQA 4JL9A 2KN5A 5D2MB 2N9XA 2N1VA 3L08A 3QCAA 4FHJA 3SD5A 3B1LX 1YIWA 2LVQA 4B6WA 4BOSC 3VVWB 3RYTA 1VCBA 1NBFC 2DENB 2J0MA 1WXAA 2ZZPB 4ICVA 3H1UA 3UINB 4IWPA 1UGMA 4M0WB 4BOZB 3Q3JA 4IG7B 2FIFA 1LQBA 3PT2B 2JVCA 3A1QB 4HCNB 1GC7A 2LGXA 3W1SC 3RULA 1E7VA 1E5WA 3GOEA 1WJUA 2DYMA 3VH4B 3SU8X 1WE6A 3ENEA 5AEKB 2MW5A 3QJZA 2IO1B 4FADA 2WX1A 5E6OA 3H7PA 1WR6E 2C7HA 4MSQB 2JWZA 1WMHA 2MBOA 3APFA 3ZDMC 3A9JA 3GZNI 2MBHA 5CTRC 3DVNU 3L10B 3LDZE 3TMPB 2LASA 3PVLA 2KJ6A 2KMCA 2RGFA 4HK2A 2JT4B 2KOXA 2MBBB 3DBLI 2LUEA 3LJ3A 3R66C 4NY0A 4WAAA 2CHWA 1ZKHA 3U7DA 2AYOB 2O2VA 4I6NB 2JF5A 3MTNB 4MGKE 5C23A 4BKSA 1TZ1A 2KJHB 2BYVE 2K8BA 4NAWA 1WYWB 4OVUA 3ZNGC 4PS8A 3WAMA 2L0FA 3HHMA 5JHAA 4EKUA 4G11A 2FCSA 2KTFA 3PTFC 4A3OA 3NS8A 4NJ6A 1KOTA 2BPSA 1UH6A 3ZVVA 1E8YA 2PPHA 3TCAA 2DHZA 1KJTA 4MGZE 4FN2A 2HTHA 2FCNA 3TL5A 4FA6A 2ZEQA 1IYFA 1U4AA 4TUUA 5CHFA 2KQSA 3QWZB 3ZNHB 2AL6A 3TBLD 2FNJB 2HJ8A 3N30A 2ZNVB 4EZKA 1XD3B 3AULA 3DVGX 1OQYA 1BT0A 1F9JA 4G0NB 3SDLC 1WXMA 1WZ3A 1EF5A 4HWIB 3B08A 4ZYNA 1WZ0A 3U8ZA 2KTRA 4ZDVA 2J0KA 2KDIA 4X57B 3NY5A 2MP2A 2BWFA 2EKEC 2G45B 1S1QB 1EO6A 4YL8A 1I42A 4JIOU 3PSEB 2DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6E B;  4TKN A;  2KVR A;  3U30 A;  4BKS D;  2C7N B;  4DDI D;  1OGW A;  3JSV A;  3EHV A;  3KYD D;  3OAW A;  2D11 A;  2J7Q B;  4AOF A;  4DHZ B;  2L76 A;  3ZLZ A;  4FUL A;  2XBB C;  2PJH A;  3HM3 A;  4HPM B;  2GMI C;  4LDT B;  3T8M A;  3V6C B;  3NOB A;  1WRD B;  3EEC A;  2WX0 A;  3UF8 A;  4EZJ A;  2YLM A;  2CR5 A;  2NS5 A;  4WWP A;  3CST A;  2N4F A;  3PPA A;  2GBJ A;  4FJV B;  2FUH B;  2K25 A;  3ZO5 B;  5J18 A;  1RAX A;  2LGD A;  3N3K B;  1WX7 A;  3Q3F A;  4WJQ A;  4AJW A;  4F8C B;  2V3S A;  4K7S A;  3WAO A;  1GG3 A;  3WA0 A;  3IBE A;  4M8N A;  2D07 B;  2KKC A;  3A33 B;  2C7M B;  4URK A;  1LFD A;  4TQ0 A;  3ZW3 A;  3M62 B;  2J0J A;  5AZH A;  2BF8 B;  5CHW A;  1Z5S B;  4II2 B;  5J17 A;  3PHX B;  2KX3 A;  5L83 A;  2G4S A;  4GDL B;  1K8R B;  1WJ6 A;  5CHV C;  4ZRI A;  2LJ5 A;  4W9L A;  4I6L B;  4EUT A;  1WFY A;  3VAW A;  5C1Z A;  1OEY A;  2DAJ A;  3H9D A;  3VDZ A;  4W9K A;  2KDB A;  2DX5 B;  2KLC A;  3HK0 A;  4AJY B;  1L7Y A;  4FJZ A;  5JHB A;  1WGH A;  4W9I A;  4EZL A;  1LXD A;  2WDT B;  3R7R A;  4ANV A;  4EFO A;  3JYU A;  4CYE A;  2MCN B;  3B0A A;  2MWS B;  1WXV A;  1VD2 A;  4PS7 A;  2IYD B;  3ZNI D;  5AZF A;  4BBN F;  2LXA A;  3QHT A;  4MH0 E;  4WWN A;  4A3P A;  2BYE A;  2K39 A;  2KMA A;  1H4R A;  2KWV B;  2NBV B;  4II3 B;  4LJP B;  2GOW A;  2K6Q A;  2L8J A;  3VTW A;  3WAN A;  2KC2 A;  5HKH A;  3NHE B;  2IO0 B;  3EFU A;  4KSK C;  3RZF A;  2CKH B;  2D10 A;  3KH0 A;  4DWF A;  3P2B A;  4BKT A;  3QA8 A;  4IWO A;  3AU5 A;  4RMA A;  3APC A;  3K9O B;  3H7P B;  4W9D A;  4DK5 A;  2ZVO A;  2BGF A;  1WE7 A;  1YQB A;  2KAN A;  1WGG A;  2KK8 A;  4GN1 A;  4WJN A;  4KZC A;  1GUA B;  2RPQ A;  1WJ4 A;  4NQK E;  5LXH A;  3R7Q A;  2V1Y A;  3V61 A;  4BVU C;  3KUC B;  2K1F A;  3M95 A;  4GMV A;  4DBG A;  4ZRJ A;  1YX6 B;  1V49 A;  4KVG B;  4PYZ A;  1OTR B;  4HXD A;  2UYZ B;  1WR1 A;  4K81 A;  4BFR A;  1NDD A;  3MJW A;  1AAR A;  2ZPN A;  4AP4 C;  4MSM B;  2OOB B;  1C3T A;  2AL3 A;  3C0R B;  3OJ3 A;  4MGY E;  2LI5 A;  1P98 A;  1WH3 A;  3RUI B;  2JRI B;  3AI5 A;  4GIV A;  4AUQ C;  3ALB A;  4GOC A;  1XT9 B;  3A9K A;  1E90 A;  5DPS A;  3OJ4 B;  3QAR A;  1SIF A;  4OVV A;  4W9G A;  4WJO A;  1E7U A;  3WAP A;  2ZCB A;  3QQ8 B;  2CHX A;  3AXC A;  4B9K A;  3MHS D;  3M63 B;  4W9C A;  4MEL A;  2LXC A;  3X23 A;  4EOY A;  1TTN A;  1GNU A;  4IW0 A;  4ANU A;  3N32 A;  3ZRF A;  4KV2 A;  2LWP A;  5BO4 B;  2B3A A;  4WWO A;  2DAF A;  3KUD B;  3W1Y A;  4WQO B;  5E6P A;  2EMT A;  3L0W B;  4W9H A;  2N7E A;  2C5L C;  1E8Z A;  1V5O A;  3PS6 A;  1L2N A;  2FAZ A;  1V80 A;  4LDT D;  4E71 A;  2M17 A;  2DZI A;  4ANW A;  5LXI B;  4KIK A;  3DBR I;  1GC6 A;  1V5T A;  2PE9 A;  3VUX A;  2M8S A;  3DBS A;  4FLH A;  1JRU A;  2KTR B;  4DDG D;  1V6E A;  4DXA B;  2KQ7 A;  1SGH A;  2JZZ A;  2L05 A;  2MP2 B;  1V2Y A;  3DVN V;  4ICU A;  1IPG A;  2FCM A;  2WWZ A;  3A4S C;  3ZDT A;  1P3Q U;  3AU4 A;  3H6N A;  3BIN A;  3L54 A;  3ZRC A;  2MX2 A;  1S3S G;  2L0T A;  3DPD A;  4K1R B;  1UD7 A;  1YJ1 A;  1HE8 A;  2VRR B;  1XQQ A;  2RD0 A;  3V62 A;  4DHZ E;  3ZKJ C;  2C60 A;  2G4D B;  3PRZ A;  2NCN A;  2MQJ A;  2L7R A;  4ASW C;  2KFK A;  3PV1 A;  4IM3 A;  2GBM A;  2NBW B;  2OJR A;  2PE6 B;  1YX5 B;  2NPT A;  2EMS A;  2NVU I;  3DVG Y;  3NZU A;  2N1W A;  4BBN C;  2KX0 A;  4KIK B;  2O6V B;  4N9F 4;  5JZE B;  3RCZ A;  3L16 A;  1M94 A;  1T0Y A;  2D2Q A;  2ZNV C;  2KNB A;  4GSW A;  3I3T B;  1KLV A;  4TV3 A;  1I35 A;  3ZTD A;  3W1S A;  2PEA A;  4CHK A;  2IY1 B;  3KUZ A;  1TBE A;  2JY6 A;  1RRB A;  2R2O A;  1E8X A;  3PLU A;  4GDL A;  5CX3 A;  3WAL A;  5J2R A;  2IY0 B;  2GBN A;  2JPH A;  2KC1 A;  2RSU A;  3VTV A;  1RFA A;  3H7S A;  2ASQ A;  3UQB A;  3S2A A;  4JLC A;  4M8M A;  1J0G A;  1H8C A;  4E74 A;  3JW0 X;  1UBQ A;  1WM2 A;  2KO3 A;  3UQA A;  3CSF A;  4FJY A;  4KDI C;  3UGB B;  2N7D A;  2LZ6 A;  4HPL B;  2KDE B;  1LM8 B;  1SE9 A;  4MJS A;  4W9E A;  2DZK A;  2FID A;  4F7Z A;  5G55 A;  4HVB A;  2K6D B;  1WX9 A;  2N9P C;  3ZTC A;  1WIA A;  1OEY J;  3HIZ A;  4IC7 B;  4E3C A;  2MRP A;  2MSE D;  2NPT B;  3QC8 B;  4W9F A;  2RR9 A;  4TQ1 A;  3T9L A;  4IM0 A;  4MEM A;  3IHP C;  4KDL B;  1X1M A;  2D3G A;  2I1J A;  2ZPY A;  3A1Q A;  2W9N A;  5D6J B;  1CMX B;  4PYU A;  3L13 A;  3DQV A;  4K7U A;  4HCP B;  2GBK A;  2KFK B;  2R2Q A;  2XEW A;  4FHK A;  4HJK A;  4RM8 A;  2KD0 A;  1V86 A;  4MM3 A;  3VXW A;  2AWT A;  2NBU A;  1WGY A;  2Z0D B;  2LVP A;  1J19 A;  2HD5 B;  3IVF A;  3VH3 B;  2O6V A;  2BYF A;  2KLG A;  1EF1 A;  2M4N A;  4MDK E;  2FCQ A;  3KYC D;  4KSL C;  3A4R A;  2G3Q B;  3KVF B;  2CHZ A;  1C1Y B;  1V81 A;  3ZNZ B;  3DOW A;  2O2V B;  4G50 A;  4HDO A;  1Q0W B;  3QIJ A;  1Q1O A;  2BWE S;  3TIX A;  1Q5W B;  2LRW A;  2C9W B;  2V4L A;  4ANX A;  4EEW A;  4GGQ A;  3DCG A;  3PRP B;  1UZX B;  2MLB A;  1WI0 A;  2Z59 B;  4MJS B;  5D94 A;  4LCD E;  1UBI A;  2GBR A;  2KWU B;  2BKR B;  2XK5 A;  5D7G A;  3TJP A;  1R4N I;  3A9K B;  4NAW B;  3RT3 B;  2MBE A;  4GDK B;  3OLM D;  5G2N A;  2K8C A;  5IA7 A;  4I6P A;  2JXX A;  5DPW A;  3KW5 B;  2MA9 B;  3IG3 A;  3RD2 A;  4G3X B;  3V60 A;  2BKF A;  3CMM B;  1R4M I;  2A5U A;  3QAQ A;  4B95 A;  5AZG A;  4GXB A;  3RZW C;  3M3J A;  4HDQ A;  2M0X A;  3ZIM A;  3VHT C;  2ZJD A;  1QZE A;  3CF6 E;  4PS3 A;  3UIP B;  3UIO B;  1ISN A;  3R3M A;  2L3Z A;  4A20 A;  2KFJ A;  2KZR A;  1P0R A;  2L00 B;  5DCN A;  4IM2 A;  1MG8 A;  2O6V D;  3VFK A;  1A5R A;  5L95 C;  2A4Z A;  2CU1 A;  4JGH B;  1PQS A;  2CS4 A;  3PLV A;  2QHO A;  1UEL A;  1IP9 A;  4ZRK A;  2DZJ A;  4NNJ B;  4BKG A;  4KZ0 A;  5GMV A;  2I1K A;  4DHJ D;  2KXJ A;  1E8W A;  4P7I A;  5LLI A;  1WGR A;  4DHJ B;  3VTU A;  2Y5B B;  4MGI E;  1P9D U;  1P1A A;  2IBI B;  1Z2M A;  3DDC B;  3ML9 A;  4AWJ A;  1WXS A;  1WY8 A;  3VUY A;  2XK5 B;  2NR2 A;  3JSV B;  4GB9 A;  2UWQ A;  1KM7 A;  3PRE A;  2JRH A;  3JVZ X;  4WJP A;  5JH5 C;  1ZGU B;  4LJO B;  2LGY A;  2N9E B;  2IO2 B;  3QK0 A;  2Z0E B;  1FXT B;  2KWC A;  4IUM B;  4XC2 A;  3ONS A;  3WIM A;  2LRU A;  2DYO A;  1GJZ A;  4IWQ A;  1TGZ B;  2DZM A;  2REX A;  2ZVN A;  4XX5 A;  2KDF B;  5EDS A;  2M1M A;  5IAA C;  4FBJ B;  1ZW7 A;  4HLE A;  3O65 B;  4GU2 A;  2JUO A;  3EC8 A;  2WYQ A;  3X0W A;  3QX1 A;  4J6I A;  3NZS A;  2ZCC A;  2JZ3 B;  2KJR A;  4K7W A;  4GDK A;  3PZD A;  5TR5 A;  1WX8 A;  3IFW B;  2AEH A;  3HM6 X;  1D3Z A;  4W9J A;  3BY4 B;  1YD8 U;  3PHW B;  3ZUN A;  2YVC A;  3D32 A;  1V9J A;  1WMH B;  1WGD A;  5KHO A;  2IZV B;  1WM3 A;  5DPR A;  2IO3 B;  2MBQ A;  3A9J B;  4XZ4 A;  5DPT A;  4NJ7 A;  4F1S A;  1Y8R C;  3APD A;  2LD9 A;  4CO7 A;  3PRM B;  3DBH I;  3ML8 A;  5E6N A;  3K9P B;  3SHQ A;  1J8C A;  2LVO A;  1WF9 A;  4NPN A;  1RLF A;  4RM9 A;  1EUV B;  2KHW B;  3PGE A;  3VUW A;  3VQI A;  1G6J A;  3L17 A;  1NI2 A;  4JQW C;  2K8H A;  4NQL B;  5FR6 A;  2HE7 A;  1WJN A;  3ECI A;  5KHQ A;  4JL9 A;  2KN5 A;  5D2M B;  2N9X A;  2N1V A;  3L08 A;  3QCA A;  4FHJ A;  3SD5 A;  3B1L X;  1YIW A;  2LVQ A;  4B6W A;  4BOS C;  3VVW B;  3RYT A;  1VCB A;  1NBF C;  2DEN B;  2J0M A;  1WXA A;  2ZZP B;  4ICV A;  3H1U A;  3UIN B;  4IWP A;  1UGM A;  4M0W B;  4BOZ B;  3Q3J A;  4IG7 B;  2FIF A;  1LQB A;  3PT2 B;  2JVC A;  3A1Q B;  4HCN B;  1GC7 A;  2LGX A;  3W1S C;  3RUL A;  1E7V A;  1E5W A;  3GOE A;  1WJU A;  2DYM A;  3VH4 B;  3SU8 X;  1WE6 A;  3ENE A;  5AEK B;  2MW5 A;  3QJZ A;  2IO1 B;  4FAD A;  2WX1 A;  5E6O A;  3H7P A;  1WR6 E;  2C7H A;  4MSQ B;  2JWZ A;  1WMH A;  2MBO A;  3APF A;  3ZDM C;  3A9J A;  3GZN I;  2MBH A;  5CTR C;  3DVN U;  3L10 B;  3LDZ E;  3TMP B;  2LAS A;  3PVL A;  2KJ6 A;  2KMC A;  2RGF A;  4HK2 A;  2JT4 B;  2KOX A;  2MBB B;  3DBL I;  2LUE A;  3LJ3 A;  3R66 C;  4NY0 A;  4WAA A;  2CHW A;  1ZKH A;  3U7D A;  2AYO B;  2O2V A;  4I6N B;  2JF5 A;  3MTN B;  4MGK E;  5C23 A;  4BKS A;  1TZ1 A;  2KJH B;  2BYV E;  2K8B A;  4NAW A;  1WYW B;  4OVU A;  3ZNG C;  4PS8 A;  3WAM A;  2L0F A;  3HHM A;  5JHA A;  4EKU A;  4G11 A;  2FCS A;  2KTF A;  3PTF C;  4A3O A;  3NS8 A;  4NJ6 A;  1KOT A;  2BPS A;  1UH6 A;  3ZVV A;  1E8Y A;  2PPH A;  3TCA A;  2DHZ A;  1KJT A;  4MGZ E;  4FN2 A;  2HTH A;  2FCN A;  3TL5 A;  4FA6 A;  2ZEQ A;  1IYF A;  1U4A A;  4TUU A;  5CHF A;  2KQS A;  3QWZ B;  3ZNH B;  2AL6 A;  3TBL D;  2FNJ B;  2HJ8 A;  3N30 A;  2ZNV B;  4EZK A;  1XD3 B;  3AUL A;  3DVG X;  1OQY A;  1BT0 A;  1F9J A;  4G0N B;  3SDL C;  1WXM A;  1WZ3 A;  1EF5 A;  4HWI B;  3B08 A;  4ZYN A;  1WZ0 A;  3U8Z A;  2KTR A;  4ZDV A;  2J0K A;  2KDI A;  4X57 B;  3NY5 A;  2MP2 A;  2BWF A;  2EKE C;  2G45 B;  1S1Q B;  1EO6 A;  4YL8 A;  1I42 A;  4JIO U;  3PSE B;  2DYB A; 
#chains in the Genus database with same CATH topology
 1SIJ A;  1SJH D;  4C80 A;  1QIL A;  3U30 A;  3EHV A;  3KYD D;  4DHZ B;  2L76 A;  3AV8 A;  2CJO A;  2WHI A;  2PJH A;  3HM3 A;  4HPM B;  3V6C B;  4EZJ A;  3BVG A;  2I2Y A;  2NS5 A;  4WAF A;  4PK1 A;  1MG4 A;  3AE1 B;  2WGS A;  5C2T B;  2K25 A;  1WSP A;  3N3K B;  3Q3F A;  1KLU D;  3RMK C;  1L0Y B;  1ENF A;  4TQ0 A;  2BYT A;  3M62 B;  2BF8 B;  1SBB B;  3PHX B;  5L83 A;  5CHV C;  5AUK A;  4ZRI A;  2LJ5 A;  4YTN B;  1WFY A;  1XLN A;  1P7F A;  3DWM A;  2INN E;  2KDB A;  1YNT E;  2RMM A;  1EU3 A;  5BYR A;  4FJZ A;  1LXD A;  2HTM E;  3JYU A;  4CYE A;  2MCN B;  3ZYY X;  1ZOY B;  3FAH A;  1VD2 A;  1GB4 A;  4BBN F;  2IYD B;  2LXA A;  4MH0 E;  3IT4 B;  2H89 B;  1TS3 A;  1H4R A;  2NBV B;  4LJP B;  2GOW A;  2H88 B;  2KC2 A;  3EFU A;  2CKH B;  3P2B A;  4BKT A;  1CK1 A;  5IOI A;  3APC A;  2QDF A;  2D3C A;  1YQB A;  5LXH A;  2D5G A;  3P1M A;  4DBG A;  1V49 A;  4HXD A;  1QKZ A;  1WR1 A;  4BFR A;  2K22 A;  4AP4 C;  2ZPN A;  1C3T A;  1DOI A;  3C0R B;  1J7A A;  3RUI B;  4M01 A;  2WXN A;  3BVZ A;  3OJ4 B;  4YWG G;  3V05 A;  5FKA C;  4TMA B;  3M63 B;  2WS3 B;  1L4Z B;  2VZK D;  4ANU A;  3N9Y C;  2B3A A;  3KQ4 A;  3PS6 A;  2DZI A;  2IND C;  1GC6 A;  1V5T A;  3DBS A;  1N63 A;  1PGB A;  2L05 A;  3ZDT A;  2INP E;  1UF0 A;  3L54 A;  2MX2 A;  1UD7 A;  1SE3 A;  4HJG E;  4DHZ E;  2WU5 B;  5HG2 A;  3RNA C;  4ASW C;  2WXI A;  3PV1 A;  4IM3 A;  4EE2 A;  1D6E C;  1XXG A;  1EWY C;  3NZU A;  2N1W A;  4KIK B;  3VR8 B;  1M4V A;  3L16 A;  1M94 A;  3RNC C;  3TEZ A;  2D2Q A;  4H2A A;  1HQR D;  4WIP A;  3ZTD A;  3KUZ A;  2JY6 A;  2R2O A;  1E8X A;  3WAL A;  1E9M A;  2GBN A;  2ZW1 A;  2RSU A;  4M02 A;  1GAQ B;  4JLC A;  2BB6 A;  2M19 A;  4KDI C;  2LZ6 A;  2KDE B;  1LM8 B;  4ZHO A;  3MJ5 A;  1SE9 A;  4W9E A;  5AUI A;  5G55 A;  4IC7 B;  2MSE D;  3AE2 B;  4W9F A;  4TQ1 A;  2RPV A;  4M00 A;  1V1P B;  1TZO A;  1X1M A;  2AQ1 B;  2D3G A;  3A1Q A;  3L13 A;  3DQV A;  2KDM A;  2R2Q A;  2V0G A;  1XLO A;  3HRD D;  2KAJ A;  3ZXV A;  2O6V A;  4RNA A;  2M4N A;  2KVZ A;  2FCQ A;  4KSL C;  4N58 A;  5BMH A;  1ZDV A;  3ZNZ B;  3DOW A;  4LNN A;  1Q0W B;  3MC9 A;  3P42 A;  1NVI D;  3DCG A;  3PRP B;  3C8Y A;  2XK5 A;  2KWU B;  1ROE A;  2BKR B;  3LYY A;  3A9K B;  1UWX A;  3Q2A C;  4NAW B;  3RT3 B;  4GDK B;  5G2N A;  2WNM A;  1F77 A;  3RD2 A;  5LNK 1;  4G3X B;  5H8Y E;  3V60 A;  1B1Z A;  3CMM B;  3URY A;  5AZG A;  1GB1 A;  3M3J A;  1XLQ A;  1WRI A;  3UIP B;  5G5G A;  2BBC A;  3R3M A;  2KFJ A;  2WXP A;  2KZR A;  1P0R A;  2L00 B;  2BQQ A;  2O6V D;  2IDY A;  1AYF A;  4N59 A;  4FXC A;  3B2G A;  4ZRK A;  5H92 C;  3TUO A;  4DHJ D;  2KXJ A;  1WGR A;  2QJL A;  1SE4 A;  4AWJ A;  1WXS A;  1WY8 A;  3BZD B;  3VUY A;  2XK5 B;  4PT5 A;  4WJP A;  5JH5 C;  2K3U A;  1ZGU B;  1ZUD 2;  2KWC A;  3BK1 A;  1GJZ A;  1F2R C;  4KKJ A;  1K52 A;  1QT9 A;  2ZVN A;  2OHF A;  5IAA C;  4FBJ B;  4GU2 A;  1JRO A;  2JU6 X;  4YSY B;  5HFY A;  1QOA A;  2LGS A;  2JSV X;  1RYJ A;  2JZ3 B;  2KJR A;  4K7W A;  3PZ7 A;  3IFW B;  1D3Z A;  1YD8 U;  3D32 A;  1WGD A;  5KHO A;  1WM3 A;  5DPR A;  4XZ4 A;  5DPT A;  3RNE C;  3APD A;  1JRP A;  2LD9 A;  1IGD A;  2VH1 A;  1J7C A;  3K9P B;  4K3B A;  1RLF A;  1EUV B;  2KHW B;  2LJI A;  3DBH B;  2X8X X;  3L17 A;  4JQW C;  4NQL B;  2K8H A;  2HE7 A;  3ECI A;  4JL9 A;  2KN5 A;  3RFZ B;  4FHJ A;  3U7Z A;  1KH0 A;  2J0M A;  1TIF A;  3AE9 B;  4BOZ B;  3LXF A;  1HA5 A;  3Q3J A;  1C78 A;  1LQB A;  3PT2 B;  4HCN B;  1GC7 A;  4TSS A;  1E7V A;  1WJU A;  1V8C A;  2WX1 A;  5E6O A;  2C7H A;  3E56 A;  4MSQ B;  2JWZ A;  2QC8 A;  3L4P A;  1MHX A;  5CTR C;  4LNK A;  2KMC A;  2QEJ C;  2RDH A;  1L6V A;  3AEB B;  2KOX A;  3DBL I;  1VJK A;  1VR9 A;  4WAA A;  2LUM A;  1TY2 A;  1ZP0 B;  4I6N B;  1KFY B;  3H8H A;  1EM7 A;  2N9L A;  2MH7 A;  5GXG B;  1WYW B;  1FO4 A;  2L1A A;  4L1B A;  5JHA A;  1GPX A;  1CJE A;  3FC4 A;  4NJ6 A;  3AEA B;  3EUB 2;  1IBX A;  4KGT A;  2DHZ A;  1KJT A;  2HTH A;  2FCN A;  3TL5 A;  1IYF A;  3AE4 B;  5CHF A;  1CQV A;  3QWZ B;  1MI0 A;  2AL6 A;  3Q8A A;  3TBL D;  3N30 A;  4EZK A;  3DVG X;  2BS4 B;  3SDL C;  1EF5 A;  5C3J B;  3B08 A;  4KGR A;  4ZYN A;  2PVO D;  4ZDV A;  4X57 B;  3NY5 A;  4KGS A;  4MH8 A;  3HVD A;  1I4H A;  5BYQ A;  3NVZ A;  4TKN A;  3RNG C;  2W82 A;  3ZLZ A;  4ITK A;  2XBB C;  3U2S C;  4US8 A;  2GMI C;  3NOB A;  3AEG B;  3UF8 A;  2YLM A;  1TKG A;  5G5H A;  3N20 C;  3PPA A;  4A55 A;  2FUH B;  1FCL A;  5J18 A;  2LGD A;  3AED B;  2G9H D;  4K7S A;  1GG3 A;  2FE8 A;  3WA0 A;  4M8N A;  2C7M B;  3R8B A;  2J0J A;  5AZH A;  4LNO A;  1Z5S B;  4II2 B;  5J17 A;  2G4S A;  4GDL B;  2BT6 A;  4I6L B;  1QOG A;  3VAW A;  4OZC A;  5C1Z A;  4W9K A;  2DX5 B;  2KLC A;  1NYQ A;  4EZL A;  2WDT B;  4EFO A;  2DWQ A;  3TEY A;  3B0A A;  2MWS B;  2XN9 C;  2W3R A;  1WXV A;  3ETR A;  4WWN A;  1NYR A;  1SXT A;  2K39 A;  3KWV A;  4JX1 C;  2K6Q A;  2QIE B;  1WYG A;  2JYE A;  1VZ7 A;  5HKH A;  4KSK C;  2D10 A;  4DWF A;  2OJW A;  3QA8 A;  2G1E A;  3AU5 A;  4RMA A;  4W9D A;  3H7P B;  2BGF A;  1TS4 A;  1WE7 A;  4YSZ B;  1WGG A;  2KK8 A;  4WJN A;  1FFU A;  2WXR A;  1PUT A;  2V1Y A;  4BVU C;  4C56 C;  4ARC A;  3M95 A;  4PYZ A;  2UYZ B;  1NDD A;  3MJW A;  1XCT L;  1T0R C;  2V9H A;  3OJ3 A;  4MGY E;  1P98 A;  1WH3 A;  4AUQ C;  1WWT A;  2B76 B;  1XT9 B;  3NVW A;  5DPS A;  4W9G A;  4WJO A;  4B9K A;  3QQ8 B;  3AXC A;  3MHS D;  4HRO A;  4W9C A;  5D3I B;  3X23 A;  2JX5 A;  1HTQ A;  1XLP A;  1ZPS A;  4OW0 A;  1V5O A;  1KF6 B;  1L2N A;  2FAZ A;  4WQM A;  4ANW A;  5LXI B;  4JWS C;  4FLH A;  5D3D A;  4DDG D;  1WXQ A;  3SFE B;  2WXF A;  1V2Y A;  3DVN V;  4ICU A;  4DXG A;  1P3Q U;  3AU4 A;  4K1R B;  1R7S A;  2RD0 A;  4LLG M;  4XDC A;  4ZHP A;  2GBM A;  2WXQ A;  2YEP B;  2KX0 A;  2O6V B;  3T3N A;  5JZE B;  3RCZ A;  1EU4 A;  2GB1 A;  1SF0 A;  5FR3 A;  3I3T B;  1KLV A;  1TBE A;  1V97 A;  1NEN B;  1RRB A;  4OHJ A;  3MFG A;  5J2R A;  2IY0 B;  2JPH A;  2KC1 A;  4MM3 B;  1RFA A;  2ASQ A;  4D2K A;  4M8M A;  1UBQ A;  1D5X C;  3CSF A;  2FID A;  3EFC A;  2K6D B;  2N9P C;  1XCQ L;  1WIA A;  4E3C A;  2RR9 A;  4MEM A;  2I1J A;  2ZPY A;  4PYU A;  2GBK A;  2KFK B;  2XEW A;  4RM8 A;  1V86 A;  1PDX A;  1WGY A;  2Z0D B;  2HD5 B;  4LK0 M;  3IVF A;  3Q8B A;  2KLG A;  1JQ4 A;  4WH4 A;  3KYC D;  2PLP A;  3NRZ A;  2O2V B;  4HDO A;  3TIX A;  2ACZ B;  2C9W B;  2V4L A;  4ANX A;  1T0S C;  1SSN A;  3MC0 B;  3P4P B;  1WI0 A;  2MLB A;  5D94 A;  4BKG A;  2GBR A;  3TJP A;  1YMH E;  2AQ2 B;  1TY0 A;  3E9S A;  3GB1 A;  2K8C A;  4I6P A;  2JXX A;  2OED A;  1MJD A;  2A5U A;  4GXB A;  1VZ8 A;  2M0X A;  3VHT C;  2J4X A;  2BTE A;  3C19 A;  2QIL A;  3CIR B;  4YTP B;  1LO5 D;  3VFK A;  1A5R A;  5L95 C;  2A4Z A;  3BII D;  3PLV A;  2QHO A;  4BZA A;  4RGT A;  2JXT A;  4KZ0 A;  1NI3 A;  2I1K A;  4DHJ B;  3VTU A;  1QQR A;  1P9D U;  1C77 A;  1Z2M A;  3ML9 A;  3JSV B;  1BUI C;  2UWQ A;  2JRH A;  2E6X A;  3QK0 A;  2N9E B;  2IO2 B;  2LRU A;  2Y5C A;  3AE6 B;  2KT7 A;  2DZM A;  4S17 A;  3N1X C;  1I4R A;  2WXG A;  2M1M A;  4HLE A;  1XF5 L;  1JWB D;  2WDV B;  2J42 A;  1QF6 A;  1KTK A;  3ZUN A;  2K0P A;  3A9J B;  4NJ7 A;  1Y8R C;  3P4R B;  3PRM B;  1YN3 A;  3AEC B;  3DBH I;  4NPN A;  3VQI A;  5KHQ A;  3RNF C;  4IOI E;  1KLG D;  3AEE B;  3RYT A;  2Z8L A;  2DEN B;  3H1U A;  3W5V B;  3UIN B;  1ZXH A;  4IG7 B;  1FD6 A;  2FIF A;  2ON8 A;  2JVC A;  3A1Q B;  1VDV A;  3GOE A;  2DYM A;  3VH4 B;  1DOY A;  3SU8 X;  2MW5 A;  3Q3N C;  3QJZ A;  2IO1 B;  4FAD A;  1Q10 A;  1JWU D;  1WR6 E;  1YN4 A;  2WXL A;  2MBO A;  2W55 A;  3A9J A;  4IKG A;  2MBH A;  1DYQ A;  2LAS A;  3PVL A;  1IUE A;  2RGF A;  2JT4 B;  3LJ3 A;  2LUE A;  4JPS A;  2MHJ A;  3BWU D;  3NS1 A;  2PW9 A;  3N1Z C;  2JYT A;  1KRH A;  4M0W A;  4MGK E;  1JCK B;  5C23 A;  1HXY D;  2BYV E;  4NAW A;  4UDU C;  1I4P A;  1FNV A;  1L6U A;  4EKU A;  3PTF C;  1JML A;  2PKO A;  1KOT A;  4NAM A;  1ZDX A;  4L2Y A;  3ZVV A;  1D5M C;  4FN2 A;  1I4G A;  4FA6 A;  2ZEQ A;  1UUP A;  4TUU A;  1UNS A;  2KQS A;  2M56 B;  1FXA A;  1V1O A;  2HJ8 A;  2ZNV B;  1XD3 B;  3AUL A;  1OQY A;  5T8I A;  1WXM A;  3FIL B;  1PGX A;  1FRR A;  3RPF C;  2KTR A;  2KMM A;  1MPE A;  2TSS A;  2MP2 A;  1RFK A;  1K51 A;  1EO6 A;  4C4V B;  3PSE B;  2DYB A;  1QOF A;  1XEE A;  3V6E B;  4A9A A;  1T6B X;  2C7N B;  1JWA D;  1OGW A;  2J7Q B;  3TSS A;  1FM0 D;  2Y3A A;  3Q8F A;  2BW2 A;  3T8M A;  2IGD A;  1PGA A;  2QSD A;  2N4F A;  4FJV B;  1RAX A;  4AJW A;  2LFI A;  3WAO A;  2VZK B;  2D3B A;  3IBE A;  2KKC A;  3A33 B;  1LFD A;  1N6Z A;  5EE9 A;  3SEB A;  5CHW A;  2KX3 A;  1K8R B;  4EUT A;  4AQ7 A;  1OEY A;  1PFD A;  3H9D A;  3VDZ A;  1DOX A;  1L7Y A;  5JHB A;  1WGH A;  2RDG A;  1N61 A;  1WGK A;  3R7R A;  4USA A;  3ZXR A;  4RGN A;  1STE A;  2W54 A;  1UWM A;  1AN8 A;  3QHT A;  4A3P A;  2BYE A;  2KMA A;  4II3 B;  3WAN A;  3HVZ A;  3GZN B;  1L5P A;  2AQ3 B;  3K9O B;  2WDQ B;  2ZVO A;  2KAN A;  2RPQ A;  1WJ4 A;  3R7Q A;  3Q8E A;  3V61 A;  3DBR B;  2Q5W D;  3KUC B;  2K1F A;  1C79 A;  1OTR B;  3RN9 C;  1AAR A;  4MSM B;  1PYW D;  2AL3 A;  2L52 A;  2LI5 A;  4GIV A;  3ALB A;  4GOC A;  2LHD A;  4XE0 A;  4OVV A;  3QAR A;  3AM9 A;  3WAP A;  1E7U A;  2ZCB A;  2CHX A;  1E10 A;  4MEL A;  2LXC A;  4EOY A;  3ZJV A;  2FUG 1;  2BVC A;  5BO4 B;  4WWO A;  3SR6 A;  3KUD B;  1TS2 A;  3W1Y A;  5E6P A;  2EMT A;  1E8Z A;  2DBY A;  3LB8 C;  1MFW A;  3DBL B;  4P16 A;  1V80 A;  3R2T A;  4E71 A;  4KIK A;  1MHH E;  3DBR I;  2QCZ A;  1FIQ A;  2PE9 A;  3VUX A;  2M8S A;  2WLB A;  2LMC A;  2JZZ A;  2WWZ A;  2IJ0 A;  3AE8 B;  3B9J A;  5EE3 A;  3BIN A;  3ZRC A;  1S3S G;  2L0T A;  3DPD A;  4WUR A;  1YJ1 A;  3V62 A;  5EE0 A;  3NJT A;  2MQJ A;  2KQ4 X;  2KFK A;  2NBW B;  3I57 A;  2JZP A;  3AMZ A;  2IGG A;  2WQY B;  1T3Q A;  2NPT A;  2EMS A;  2AX5 A;  3ZGZ A;  1JW9 D;  4BBN C;  5BMG A;  4P1B C;  4N9F 4;  3RI7 C;  1E0Z A;  1IGC A;  1T0Y A;  2K9X A;  2ZNV C;  4GSW A;  3R2I A;  4ZRQ A;  4KX6 B;  3KLS X;  3W1S A;  2IY1 B;  4GDL A;  5CX3 A;  3PLU A;  2PIA A;  4B0M A;  3VTV A;  3H7S A;  3AE7 B;  3S2A A;  1J0G A;  4E74 A;  3JW0 X;  3ZJT A;  1WM2 A;  2KO3 A;  3AN1 A;  2HDE A;  3UQA A;  1QLB B;  3UGB B;  3BK2 A;  2LGI A;  1I4X A;  4MJS A;  2DZK A;  4HVB A;  1WX9 A;  4L23 A;  2MRP A;  2NPT B;  4OVZ A;  1XO3 A;  3RNB C;  1C4C A;  4IM0 A;  1T0Q C;  4KDL B;  2W9N A;  1CMX B;  3GP7 A;  3IXS A;  1C76 A;  4FHK A;  4HJK A;  3MP9 A;  2KD0 A;  2WP9 B;  3BYY B;  1E7P B;  2AWT A;  2LVP A;  3VH3 B;  2BYF A;  2BS3 B;  2DLB A;  4MDK E;  4IDI A;  4N6E B;  2G3Q B;  2WXJ A;  3KVF B;  2R61 A;  4R3D A;  3QIJ A;  1Q1O A;  2BWE S;  1HZ6 A;  4EEW A;  1T5X D;  4GGQ A;  1F1H A;  1N60 A;  1UZX B;  4MJS B;  4LCD E;  1UBI A;  5D7G A;  1D4B A;  1R4N I;  2WDR B;  3OLM D;  4P6V F;  5IA7 A;  1R4M B;  3KW5 B;  3IG3 A;  3N1Y C;  3QAQ A;  4B95 A;  2N7J A;  1C9F A;  1AWD A;  3RZW C;  1D5Z C;  4HDQ A;  2ZJD A;  1QZE A;  3CF6 E;  3B2F A;  3UIO B;  1ISN A;  4ARI A;  4A20 A;  2L3Z A;  3DHG C;  1VZ6 A;  2PMV A;  5DCN A;  4IM2 A;  1MG8 A;  4A6Q A;  4JGH B;  2CU1 A;  1PQS A;  2XNA C;  1UEL A;  2DZJ A;  3AEF B;  4NNJ B;  5GMV A;  1E8W A;  4P7I A;  1FCC C;  4WWM A;  4YT0 B;  1JWS D;  2IBI B;  1N5X A;  1AW7 A;  1ET9 A;  3PRE A;  4LJO B;  1GOZ A;  1FXT B;  5TSS A;  4IUM B;  4IWQ A;  2REX A;  4XX5 A;  2KDF B;  5EDS A;  3EC8 A;  2WYQ A;  2X38 A;  3X0W A;  3QX1 A;  4J6I A;  3PZD A;  5TR5 A;  2SAK A;  3VR9 B;  4RGO S;  3PO0 A;  2AEH A;  4W9J A;  3I9V 1;  2PTL A;  3PHW B;  2YVC A;  1V9J A;  1RWS A;  5IKC M;  2IZV B;  2IO3 B;  2KN4 A;  1FRD A;  4K3C A;  4CO7 A;  1DGJ A;  4NZL B;  5E6N A;  4A90 A;  1J8C A;  2LVO A;  4RM9 A;  1G6J A;  3PGE A;  3VUW A;  2V3P A;  4HKZ E;  5FR6 A;  1F0Z A;  1WJN A;  1YOV B;  1OQR A;  2N9X A;  2N1V A;  1YIW A;  2LVQ A;  4B6W A;  4BOS C;  1HTO A;  4CQN A;  1NBF C;  1JWM D;  2ZZP B;  5E6J A;  4J3O D;  4IWP A;  3U4E G;  4XGA B;  3FIL A;  3FKY A;  3W1S C;  2LGX A;  4P1C C;  3RUL A;  1E5W A;  4XDD A;  1FXI A;  2DNF A;  1N62 A;  4A8X C;  4HEA 1;  4XWT A;  3APF A;  3GZN I;  5EE1 A;  3L10 B;  2K5P A;  3TMP B;  2KJ6 A;  3NG0 A;  2MBB B;  1P7E A;  2N0S B;  1MVK A;  2CHW A;  3AB5 A;  3GE8 C;  3ZQ4 A;  2O2V A;  2PVG C;  1EWC A;  3Q6B A;  4BKS A;  3W9C B;  4YTM B;  1ESF A;  2KJH B;  4MT5 A;  2L83 A;  4OVU A;  3ZNG C;  3ABV B;  2MJ3 A;  2L0F A;  3HHM A;  3KWL A;  2L32 A;  1YN5 A;  5BMI A;  2BPS A;  1UH6 A;  1E8Y A;  1SEB D;  4MGZ E;  2LEK A;  3BYT B;  3ZNH B;  2FNJ B;  1C4A A;  1BT0 A;  1F9J A;  4G0N B;  1CZP A;  1WZ3 A;  2WXM A;  5BYS A;  2M0A A;  2N9K A;  1WZ0 A;  3U8Z A;  2BWF A;  2HJ1 A;  2EKE C;  1S1Q B;  1I42 A;  4GLS C;  1HEZ E;  2KVR A;  4BKS D;  4DDI D;  3JSV A;  2MJD A;  3OAW A;  4AOF A;  2D11 A;  1IBX B;  4FUL A;  2RDB C;  2WXH A;  1FNU A;  4LDT B;  1WRD B;  3EEC A;  2WX0 A;  2CR5 A;  4WWP A;  3WCQ A;  3CST A;  2CJN A;  4ZYS A;  2GBJ A;  3ZO5 B;  1WX7 A;  4F8C B;  4WJQ A;  2V3S A;  4NJC A;  3NVY A;  2D07 B;  4URK A;  3ZW3 A;  2GI9 A;  1I4Q A;  3P63 A;  1WJ6 A;  4W9L A;  1BXT A;  2DAJ A;  3HK0 A;  4AJY B;  1FEH A;  4W9I A;  4JWU C;  4ANV A;  2GLS A;  4US9 A;  4PS7 A;  3ZNI D;  5AZF A;  2KWV B;  1K50 A;  3VRB B;  1F2R I;  2L8J A;  3VTW A;  3NHE B;  2KYW A;  4RF0 A;  2IO0 B;  4REZ A;  3U52 E;  3RZF A;  3KH0 A;  4IWO A;  3GE3 C;  2FBW B;  4DK5 A;  4YSX B;  4GN1 A;  2J52 A;  3I63 C;  4KZC A;  1GUA B;  4NQK E;  3Q14 C;  1OQQ A;  3OWE B;  3W2D A;  4LNF A;  4GMV A;  3J9C A;  4ZRJ A;  1YX6 B;  4KVG B;  4K81 A;  5JXV A;  2OOB B;  4ACF A;  3AE5 B;  2GRI A;  2JRI B;  3AI5 A;  4HPP A;  3Q69 A;  1TJE A;  3A9K A;  1E90 A;  1SIF A;  2V3N A;  1A70 A;  1TTN A;  1GNU A;  1YQ4 B;  4IW0 A;  1SE2 A;  1C4P A;  3N32 A;  1R4N B;  3ZRF A;  4KV2 A;  2LWP A;  2DAF A;  4WQO B;  2ICI A;  3IAM 1;  2N7E A;  1E6E B;  2C5L C;  3L0W B;  4W9H A;  5HHD G;  4LDT D;  2M17 A;  1JRU A;  2KTR B;  4DXA B;  1V6E A;  2KQ7 A;  2KAC A;  1SGH A;  2MP2 B;  1IPG A;  2FCM A;  3A4S C;  5IP4 D;  4C4V A;  3H6N A;  2I38 A;  3HUI A;  1HE8 A;  2VRR B;  1XQQ A;  3ZKJ C;  2C60 A;  2G4D B;  3PRZ A;  4C7Y A;  1SJE D;  2NCN A;  2L7R A;  1J7B A;  1YJI A;  2OJR A;  2PE6 B;  3ZJU A;  1YX5 B;  2EEL A;  3EA6 A;  1Y56 A;  2NVU I;  3DHH C;  3DVG Y;  1YQ3 B;  2JQR B;  4LNI A;  2KNB A;  2MEK A;  4TV3 A;  1I35 A;  3AH7 A;  2PEA A;  2ZW0 A;  4CHK A;  1TS5 A;  1UGJ A;  2W3S A;  3NZ3 A;  4RCO A;  2UU7 A;  3T3O A;  3UQB A;  4HRS A;  4BAX A;  1H8C A;  3V3X A;  4FJY A;  2N7D A;  1F52 A;  4HPL B;  4F7Z A;  3ZTC A;  3HIZ A;  1OEY J;  2IPK D;  3QC8 B;  3T9L A;  3SFD B;  3IHP C;  2YEP F;  1N5W A;  5D6J B;  2SEB D;  2CU3 A;  4K7U A;  4HCP B;  4AS1 A;  3IT6 B;  4MM3 A;  3VXW A;  2QMT A;  2NBU A;  1J19 A;  1L0X B;  3GS2 A;  1EF1 A;  4DXF A;  5IO9 A;  3A4R A;  2NTS A;  2CHZ A;  1C1Y B;  1V81 A;  4G50 A;  3Q3M C;  1Q5W B;  2LRW A;  3Q8C A;  4OZB A;  2MJE A;  2Z59 B;  3NUH B;  4YXD B;  2MBE A;  5DPW A;  2MA9 B;  2BKF A;  4O1N A;  1R4M I;  1TT5 B;  3TEX A;  1FMA D;  1ZE3 D;  4PS3 A;  3O13 A;  3PZ8 A;  3W5U B;  2V4I B;  1L4D B;  4RFB A;  1V1P A;  2CS4 A;  1IP9 A;  2NMQ A;  2E3T A;  3MHZ A;  4C7Z A;  3UI3 A;  1SB3 C;  3EGR A;  1QOB A;  5LLI A;  2Y5B B;  4MGI E;  1P1A A;  4JE3 B;  3DDC B;  4HKQ A;  2NR2 A;  1NEK B;  4GB9 A;  2NTT A;  1KM7 A;  3JVZ X;  2LGY A;  1I7H A;  2Z0E B;  4XC2 A;  2KWD A;  3ONS A;  3WIM A;  2DYO A;  1TGZ B;  1FPY A;  1ZW7 A;  3O65 B;  2JUO A;  1ACC A;  4Q2J A;  3NZS A;  2ZCC A;  2WXK A;  4GDK A;  1WX8 A;  2D3A A;  1ZXI A;  3HM6 X;  3DHI C;  2JWU A;  3BY4 B;  2BB5 A;  1JAL A;  3I5J C;  1WMH B;  3ZIM A;  2MBQ A;  4F1S A;  3NVV A;  1FNW A;  1TKY A;  3AE3 B;  1TKE A;  3ML8 A;  3OG5 A;  5I4D A;  3SHQ A;  1WF9 A;  1TYG B;  2ONQ A;  4B0E A;  1NI2 A;  1B9R A;  5D2M B;  3DWG C;  3L08 A;  3QCA A;  3SD5 A;  3B1L X;  1HZ5 A;  1FFV A;  2BS2 B;  2WXO A;  3VVW B;  1VCB A;  1WXA A;  4ICV A;  4LTU A;  4RGM A;  2VH2 A;  1K53 A;  4MAC A;  3MC8 A;  1UGM A;  4M0W B;  4C00 A;  2Y5P A;  3CWI A;  4XWW A;  1LGR A;  5FK9 C;  1WE6 A;  3ENE A;  5AEK B;  2LHE A;  4ZOH C;  3H7P A;  4S0R A;  2IGH A;  1WMH A;  5MPO A;  3ZDM C;  4RH6 A;  3DVN U;  2WU2 B;  3LDZ E;  4HK2 A;  3R66 C;  1VLB A;  4NY0 A;  1ZKH A;  3U7D A;  2AYO B;  3BVM A;  4QAY A;  3TEW A;  2JF5 A;  3MTN B;  1YJJ A;  2INC C;  1TZ1 A;  3P4S B;  2K8B A;  4PS8 A;  3WAM A;  3IAS 1;  4G11 A;  1RM6 C;  2FCS A;  2KTF A;  4A3O A;  3NS8 A;  2PPH A;  3TCA A;  4ZRP A;  5HI1 A;  1U4A A;  3Q3O C;  4DQO C;  3VRA B;  4RF1 A;  1OFF A;  4HWI B;  1BML C;  1L0V B;  5IN7 A;  1ET6 A;  2J0K A;  2KDI A;  4KKI A;  4XYC A;  3P4Q B;  2J53 A;  2EKI A;  2G45 B;  4YL8 A;  4JIO U;  1VRA B;  4OZA A; 
#chains in the Genus database with same CATH homology
 3V6E B;  4TKN A;  2KVR A;  3U30 A;  4BKS D;  2C7N B;  4DDI D;  1OGW A;  3JSV A;  3EHV A;  3KYD D;  3OAW A;  2D11 A;  2J7Q B;  4AOF A;  4DHZ B;  2L76 A;  3ZLZ A;  4FUL A;  2XBB C;  2PJH A;  3HM3 A;  4HPM B;  2GMI C;  4LDT B;  3T8M A;  3V6C B;  3NOB A;  1WRD B;  3EEC A;  2WX0 A;  3UF8 A;  4EZJ A;  2YLM A;  2CR5 A;  2NS5 A;  4WWP A;  3CST A;  2N4F A;  3PPA A;  2GBJ A;  4FJV B;  2FUH B;  2K25 A;  3ZO5 B;  5J18 A;  1RAX A;  2LGD A;  3N3K B;  1WX7 A;  3Q3F A;  4WJQ A;  4AJW A;  4F8C B;  2V3S A;  4K7S A;  3WAO A;  1GG3 A;  3WA0 A;  3IBE A;  4M8N A;  2D07 B;  2KKC A;  3A33 B;  2C7M B;  4URK A;  1LFD A;  4TQ0 A;  3ZW3 A;  3M62 B;  2J0J A;  5AZH A;  2BF8 B;  5CHW A;  1Z5S B;  4II2 B;  5J17 A;  3PHX B;  2KX3 A;  5L83 A;  2G4S A;  4GDL B;  1K8R B;  1WJ6 A;  5CHV C;  4ZRI A;  2LJ5 A;  4W9L A;  4I6L B;  4EUT A;  1WFY A;  3VAW A;  5C1Z A;  1OEY A;  2DAJ A;  3H9D A;  3VDZ A;  4W9K A;  2KDB A;  2DX5 B;  2KLC A;  3HK0 A;  4AJY B;  1L7Y A;  4FJZ A;  5JHB A;  1WGH A;  4W9I A;  4EZL A;  1LXD A;  2WDT B;  3R7R A;  4ANV A;  4EFO A;  3JYU A;  4CYE A;  2MCN B;  3B0A A;  2MWS B;  1WXV A;  1VD2 A;  4PS7 A;  2IYD B;  3ZNI D;  5AZF A;  4BBN F;  2LXA A;  3QHT A;  4MH0 E;  4WWN A;  4A3P A;  2BYE A;  2K39 A;  2KMA A;  1H4R A;  2KWV B;  2NBV B;  4II3 B;  4LJP B;  2GOW A;  2K6Q A;  2L8J A;  3VTW A;  3WAN A;  2KC2 A;  5HKH A;  3NHE B;  2IO0 B;  3EFU A;  4KSK C;  3RZF A;  2CKH B;  2D10 A;  3KH0 A;  4DWF A;  3P2B A;  4BKT A;  3QA8 A;  4IWO A;  3AU5 A;  4RMA A;  3APC A;  3K9O B;  3H7P B;  4W9D A;  4DK5 A;  2ZVO A;  2BGF A;  1WE7 A;  1YQB A;  2KAN A;  1WGG A;  2KK8 A;  4GN1 A;  4WJN A;  4KZC A;  1GUA B;  2RPQ A;  1WJ4 A;  4NQK E;  5LXH A;  3R7Q A;  2V1Y A;  3V61 A;  4BVU C;  3KUC B;  2K1F A;  3M95 A;  4GMV A;  4DBG A;  4ZRJ A;  1YX6 B;  1V49 A;  4KVG B;  4PYZ A;  1OTR B;  4HXD A;  2UYZ B;  1WR1 A;  4K81 A;  4BFR A;  1NDD A;  3MJW A;  1AAR A;  2ZPN A;  4AP4 C;  4MSM B;  2OOB B;  1C3T A;  2AL3 A;  3C0R B;  3OJ3 A;  4MGY E;  2LI5 A;  1P98 A;  1WH3 A;  3RUI B;  2JRI B;  3AI5 A;  4GIV A;  4AUQ C;  3ALB A;  4GOC A;  1XT9 B;  3A9K A;  1E90 A;  5DPS A;  3OJ4 B;  3QAR A;  1SIF A;  4OVV A;  4W9G A;  4WJO A;  1E7U A;  3WAP A;  2ZCB A;  3QQ8 B;  2CHX A;  3AXC A;  4B9K A;  3MHS D;  3M63 B;  4W9C A;  4MEL A;  2LXC A;  3X23 A;  4EOY A;  1TTN A;  1GNU A;  4IW0 A;  4ANU A;  3N32 A;  3ZRF A;  4KV2 A;  2LWP A;  5BO4 B;  2B3A A;  4WWO A;  2DAF A;  3KUD B;  3W1Y A;  4WQO B;  5E6P A;  2EMT A;  3L0W B;  4W9H A;  2N7E A;  2C5L C;  1E8Z A;  1V5O A;  3PS6 A;  1L2N A;  2FAZ A;  1V80 A;  4LDT D;  4E71 A;  2M17 A;  2DZI A;  4ANW A;  5LXI B;  4KIK A;  3DBR I;  1GC6 A;  1V5T A;  2PE9 A;  3VUX A;  2M8S A;  3DBS A;  4FLH A;  1JRU A;  2KTR B;  4DDG D;  1V6E A;  4DXA B;  2KQ7 A;  1SGH A;  2JZZ A;  2L05 A;  2MP2 B;  1V2Y A;  3DVN V;  4ICU A;  1IPG A;  2FCM A;  2WWZ A;  3A4S C;  3ZDT A;  1P3Q U;  3AU4 A;  3H6N A;  3BIN A;  3L54 A;  3ZRC A;  2MX2 A;  1S3S G;  2L0T A;  3DPD A;  4K1R B;  1UD7 A;  1YJ1 A;  1HE8 A;  2VRR B;  1XQQ A;  2RD0 A;  3V62 A;  4DHZ E;  3ZKJ C;  2C60 A;  2G4D B;  3PRZ A;  2NCN A;  2MQJ A;  2L7R A;  4ASW C;  2KFK A;  3PV1 A;  4IM3 A;  2GBM A;  2NBW B;  2OJR A;  2PE6 B;  1YX5 B;  2NPT A;  2EMS A;  2NVU I;  3DVG Y;  3NZU A;  2N1W A;  4BBN C;  2KX0 A;  4KIK B;  2O6V B;  4N9F 4;  5JZE B;  3RCZ A;  3L16 A;  1M94 A;  1T0Y A;  2D2Q A;  2ZNV C;  2KNB A;  4GSW A;  3I3T B;  1KLV A;  4TV3 A;  1I35 A;  3ZTD A;  3W1S A;  2PEA A;  4CHK A;  2IY1 B;  3KUZ A;  1TBE A;  2JY6 A;  1RRB A;  2R2O A;  1E8X A;  3PLU A;  4GDL A;  5CX3 A;  3WAL A;  5J2R A;  2IY0 B;  2GBN A;  2JPH A;  2KC1 A;  2RSU A;  3VTV A;  1RFA A;  3H7S A;  2ASQ A;  3UQB A;  3S2A A;  4JLC A;  4M8M A;  1J0G A;  1H8C A;  4E74 A;  3JW0 X;  1UBQ A;  1WM2 A;  2KO3 A;  3UQA A;  3CSF A;  4FJY A;  4KDI C;  3UGB B;  2N7D A;  2LZ6 A;  4HPL B;  2KDE B;  1LM8 B;  1SE9 A;  4MJS A;  4W9E A;  2DZK A;  2FID A;  4F7Z A;  5G55 A;  4HVB A;  2K6D B;  1WX9 A;  2N9P C;  3ZTC A;  1WIA A;  1OEY J;  3HIZ A;  4IC7 B;  4E3C A;  2MRP A;  2MSE D;  2NPT B;  3QC8 B;  4W9F A;  2RR9 A;  4TQ1 A;  3T9L A;  4IM0 A;  4MEM A;  3IHP C;  4KDL B;  1X1M A;  2D3G A;  2I1J A;  2ZPY A;  3A1Q A;  2W9N A;  5D6J B;  1CMX B;  4PYU A;  3L13 A;  3DQV A;  4K7U A;  4HCP B;  2GBK A;  2KFK B;  2R2Q A;  2XEW A;  4FHK A;  4HJK A;  4RM8 A;  2KD0 A;  1V86 A;  4MM3 A;  3VXW A;  2AWT A;  2NBU A;  1WGY A;  2Z0D B;  2LVP A;  1J19 A;  2HD5 B;  3IVF A;  3VH3 B;  2O6V A;  2BYF A;  2KLG A;  1EF1 A;  2M4N A;  4MDK E;  2FCQ A;  3KYC D;  4KSL C;  3A4R A;  2G3Q B;  3KVF B;  2CHZ A;  1C1Y B;  1V81 A;  3ZNZ B;  3DOW A;  2O2V B;  4G50 A;  4HDO A;  1Q0W B;  3QIJ A;  1Q1O A;  2BWE S;  3TIX A;  1Q5W B;  2LRW A;  2C9W B;  2V4L A;  4ANX A;  4EEW A;  4GGQ A;  3DCG A;  3PRP B;  1UZX B;  2MLB A;  1WI0 A;  2Z59 B;  4MJS B;  5D94 A;  4LCD E;  1UBI A;  2GBR A;  2KWU B;  2BKR B;  2XK5 A;  5D7G A;  3TJP A;  1R4N I;  3A9K B;  4NAW B;  3RT3 B;  2MBE A;  4GDK B;  3OLM D;  5G2N A;  2K8C A;  5IA7 A;  4I6P A;  2JXX A;  5DPW A;  3KW5 B;  2MA9 B;  3IG3 A;  3RD2 A;  4G3X B;  3V60 A;  2BKF A;  3CMM B;  1R4M I;  2A5U A;  3QAQ A;  4B95 A;  5AZG A;  4GXB A;  3RZW C;  3M3J A;  4HDQ A;  2M0X A;  3ZIM A;  3VHT C;  2ZJD A;  1QZE A;  3CF6 E;  4PS3 A;  3UIP B;  3UIO B;  1ISN A;  3R3M A;  2L3Z A;  4A20 A;  2KFJ A;  2KZR A;  1P0R A;  2L00 B;  5DCN A;  4IM2 A;  1MG8 A;  2O6V D;  3VFK A;  1A5R A;  5L95 C;  2A4Z A;  2CU1 A;  4JGH B;  1PQS A;  2CS4 A;  3PLV A;  2QHO A;  1UEL A;  1IP9 A;  4ZRK A;  2DZJ A;  4NNJ B;  4BKG A;  4KZ0 A;  5GMV A;  2I1K A;  4DHJ D;  2KXJ A;  1E8W A;  4P7I A;  5LLI A;  1WGR A;  4DHJ B;  3VTU A;  2Y5B B;  4MGI E;  1P9D U;  1P1A A;  2IBI B;  1Z2M A;  3DDC B;  3ML9 A;  4AWJ A;  1WXS A;  1WY8 A;  3VUY A;  2XK5 B;  2NR2 A;  3JSV B;  4GB9 A;  2UWQ A;  1KM7 A;  3PRE A;  2JRH A;  3JVZ X;  4WJP A;  5JH5 C;  1ZGU B;  4LJO B;  2LGY A;  2N9E B;  2IO2 B;  3QK0 A;  2Z0E B;  1FXT B;  2KWC A;  4IUM B;  4XC2 A;  3ONS A;  3WIM A;  2LRU A;  2DYO A;  1GJZ A;  4IWQ A;  1TGZ B;  2DZM A;  2REX A;  2ZVN A;  4XX5 A;  2KDF B;  5EDS A;  2M1M A;  5IAA C;  4FBJ B;  1ZW7 A;  4HLE A;  3O65 B;  4GU2 A;  2JUO A;  3EC8 A;  2WYQ A;  3X0W A;  3QX1 A;  4J6I A;  3NZS A;  2ZCC A;  2JZ3 B;  2KJR A;  4K7W A;  4GDK A;  3PZD A;  5TR5 A;  1WX8 A;  3IFW B;  2AEH A;  3HM6 X;  1D3Z A;  4W9J A;  3BY4 B;  1YD8 U;  3PHW B;  3ZUN A;  2YVC A;  3D32 A;  1V9J A;  1WMH B;  1WGD A;  5KHO A;  2IZV B;  1WM3 A;  5DPR A;  2IO3 B;  2MBQ A;  3A9J B;  4XZ4 A;  5DPT A;  4NJ7 A;  4F1S A;  1Y8R C;  3APD A;  2LD9 A;  4CO7 A;  3PRM B;  3DBH I;  3ML8 A;  5E6N A;  3K9P B;  3SHQ A;  1J8C A;  2LVO A;  1WF9 A;  4NPN A;  1RLF A;  4RM9 A;  1EUV B;  2KHW B;  3PGE A;  3VUW A;  3VQI A;  1G6J A;  3L17 A;  1NI2 A;  4JQW C;  2K8H A;  4NQL B;  5FR6 A;  2HE7 A;  1WJN A;  3ECI A;  5KHQ A;  4JL9 A;  2KN5 A;  5D2M B;  2N9X A;  2N1V A;  3L08 A;  3QCA A;  4FHJ A;  3SD5 A;  3B1L X;  1YIW A;  2LVQ A;  4B6W A;  4BOS C;  3VVW B;  3RYT A;  1VCB A;  1NBF C;  2DEN B;  2J0M A;  1WXA A;  2ZZP B;  4ICV A;  3H1U A;  3UIN B;  4IWP A;  1UGM A;  4M0W B;  4BOZ B;  3Q3J A;  4IG7 B;  2FIF A;  1LQB A;  3PT2 B;  2JVC A;  3A1Q B;  4HCN B;  1GC7 A;  2LGX A;  3W1S C;  3RUL A;  1E7V A;  1E5W A;  3GOE A;  1WJU A;  2DYM A;  3VH4 B;  3SU8 X;  1WE6 A;  3ENE A;  5AEK B;  2MW5 A;  3QJZ A;  2IO1 B;  4FAD A;  2WX1 A;  5E6O A;  3H7P A;  1WR6 E;  2C7H A;  4MSQ B;  2JWZ A;  1WMH A;  2MBO A;  3APF A;  3ZDM C;  3A9J A;  3GZN I;  2MBH A;  5CTR C;  3DVN U;  3L10 B;  3LDZ E;  3TMP B;  2LAS A;  3PVL A;  2KJ6 A;  2KMC A;  2RGF A;  4HK2 A;  2JT4 B;  2KOX A;  2MBB B;  3DBL I;  2LUE A;  3LJ3 A;  3R66 C;  4NY0 A;  4WAA A;  2CHW A;  1ZKH A;  3U7D A;  2AYO B;  2O2V A;  4I6N B;  2JF5 A;  3MTN B;  4MGK E;  5C23 A;  4BKS A;  1TZ1 A;  2KJH B;  2BYV E;  2K8B A;  4NAW A;  1WYW B;  4OVU A;  3ZNG C;  4PS8 A;  3WAM A;  2L0F A;  3HHM A;  5JHA A;  4EKU A;  4G11 A;  2FCS A;  2KTF A;  3PTF C;  4A3O A;  3NS8 A;  4NJ6 A;  1KOT A;  2BPS A;  1UH6 A;  3ZVV A;  1E8Y A;  2PPH A;  3TCA A;  2DHZ A;  1KJT A;  4MGZ E;  4FN2 A;  2HTH A;  2FCN A;  3TL5 A;  4FA6 A;  2ZEQ A;  1IYF A;  1U4A A;  4TUU A;  5CHF A;  2KQS A;  3QWZ B;  3ZNH B;  2AL6 A;  3TBL D;  2FNJ B;  2HJ8 A;  3N30 A;  2ZNV B;  4EZK A;  1XD3 B;  3AUL A;  3DVG X;  1OQY A;  1BT0 A;  1F9J A;  4G0N B;  3SDL C;  1WXM A;  1WZ3 A;  1EF5 A;  4HWI B;  3B08 A;  4ZYN A;  1WZ0 A;  3U8Z A;  2KTR A;  4ZDV A;  2J0K A;  2KDI A;  4X57 B;  3NY5 A;  2MP2 A;  2BWF A;  2EKE C;  2G45 B;  1S1Q B;  1EO6 A;  4YL8 A;  1I42 A;  4JIO U;  3PSE B;  2DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...