5AZFA

Crystal structure of lgg-1 complexed with a weel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
b'GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lgg-1
molecule tags Protein binding
source organism Caenorhabditis elegans
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
total genus 40
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azfA00
2N9EB 4MGYE 4DDGD 2NBVB 1V9JA 3SDLC 3SHQA 4EZKA 3N3KB 4FBJB 2AEHA 4NJ7A 1VD2A 3W1SC 5CTRC 3PHWB 1JRUA 3UIOB 1E8WA 2KC2A 2ZEQA 4I6PA 1WYWB 4WQOB 2O6VB 2MP2A 3IHPC 3N30A 2RR9A 1LXDA 2XK5A 4JL9A 2DHZA 3JSVA 4IC7B 2XBBC 1P1AA 4ZDVA 4JGHB 4IG7B 4LDTB 2KX0A 3JVZX 2GBKA 2KJRA 2BYVE 3TCAA 2HD5B 2JWZA 2MP2B 3QARA 2BF8B 2LGYA 1KM7A 3VHTC 4BFRA 2KMAA 2D11A 3ZKJC 2NBUA 4JQWC 3DVNU 3ZVVA 3DDCB 2R2OA 3H7PB 4GIVA 3D32A 3RZFA 1I35A 1WI0A 2CU1A 2KDBA 1E8ZA 1GNUA 5C23A 2IO3B 4GSWA 4ANXA 2C9WB 3VUWA 3ZRCA 4HJKA 3UF8A 4DHZB 2KTFA 2LWPA 1UBQA 3UQAA 1G6JA 4HK2A 3ZW3A 3QA8A 4FADA 5L95C 3NZSA 4E74A 2PJHA 3A1QA 2KXJA 2G3QB 2HTHA 5DPWA 5LXHA 4IUMB 4RM9A 2N1WA 2MCNB 2JRIB 4ICVA 5IA7A 3I3TB 4KV2A 2L7RA 4BVUC 4TUUA 3QX1A 4ANVA 5AEKB 2DZMA 3LDZE 2LGDA 3NZUA 2AWTA 3A1QB 2EMSA 2EMTA 4JIOU 2KZRA 4KSLC 5L83A 3B08A 4NAWB 3R7QA 2KMCA 4G3XB 3PRZA 3DBRI 2N9PC 3ZTCA 1J0GA 2WYQA 2J0KA 4PS7A 3UINB 2N9XA 2M8SA 2GOWA 3PV1A 4KIKB 1SIFA 1WZ3A 1R4MI 4WJPA 3L0WB 2IY1B 2LVOA 5DCNA 4GU2A 4I6LB 1WGYA 2AL6A 3VTVA 2MSED 3DBHI 4URKA 1F9JA 2PPHA 3DQVA 2DYOA 5BO4B 3TBLD 4EOYA 1M94A 1V80A 4CYEA 1PQSA 2J0JA 4WJQA 3MTNB 4HVBA 1T0YA 2KX3A 3NOBA 2MBHA 3PREA 4RM8A 2ZPNA 4BBNC 4F1SA 1SGHA 4ZYNA 4AJWA 4TQ1A 4GOCA 5D94A 3UQBA 1YQBA 2KWVB 4W9GA 5E6PA 2DZKA 4K7WA 5D7GA 2FCSA 2IBIB 1P0RA 2MA9B 1WXVA 5CX3A 5JHBA 4KDLB 1Y8RC 3JSVB 2RSUA 2AYOB 1UGMA 2D3GA 5JHAA 1WJUA 2CHWA 1TBEA 3L54A 2DZJA 3QIJA 4HLEA 5CHFA 3ML9A 5E6NA 1Q5WB 3SD5A 1WGGA 2JY6A 2AL3A 3H7PA 1XT9B 3APDA 4FJVB 4LJOB 4IW0A 5JH5C 2IO2B 2I1JA 2ZNVB 1OGWA 2K1FA 4MGIE 3R66C 1E90A 3A4SC 4F8CB 1R4NI 1XQQA 2WWZA 2ZVNA 3C0RB 3H9DA 3A9JB 1Q1OA 3VH3B 3VAWA 2XEWA 3DVGY 1RAXA 4GDLB 3VH4B 1BT0A 3AULA 1E5WA 1UBIA 3DCGA 2M17A 3QJZA 4BKGA 4ANUA 4FHJA 3U30A 3ZIMA 3ENEA 3L13A 4ASWC 2FUHB 4KDIC 2JVCA 1WIAA 2GBRA 1H8CA 3L10B 4HPLB 3HK0A 3AU5A 1WMHB 3A9KB 4GDLA 2L76A 3AI5A 3BY4B 1WX7A 3APCA 2C7HA 1RLFA 2V4LA 3V6EB 1GUAB 2Z0DB 4GDKB 4BKSD 1C3TA 3PRMB 2A4ZA 1UELA 2DENB 3PHXB 3IFWB 1YX5B 3CSFA 2LVPA 4KIKA 3L08A 2ZCCA 2OOBB 5E6OA 5GMVA 1C1YB 1WGRA 1YX6B 1KOTA 2N7EA 3NY5A 2ZVOA 3X0WA 4YL8A 3KH0A 3KYDD 4GXBA 2ZJDA 4OVVA 1WR1A 4A3PA 2C5LC 2CHXA 2RGFA 2KLCA 2VRRB 4MSMB 4HDOA 4ZRIA 1ZKHA 2M1MA 4WJNA 3Q3FA 5KHOA 2JXXA 4PS8A 1WY8A 3RCZA 2KKCA 2LD9A 2K6DB 1V5OA 1WM3A 4DBGA 2FCMA 1NBFC 2C7MB 2JUOA 2N1VA 2NVUI 2L0TA 3VVWB 2FAZA 4M8MA 4W9JA 4MJSB 2JF5A 4FN2A 1E7VA 2CR5A 1K8RB 2B3AA 1V2YA 4EZLA 4XC2A 4XZ4A 2KWCA 3P2BA 3CSTA 2LJ5A 2KFJA 1EO6A 2KLGA 3B0AA 3N32A 5LLIA 1Z2MA 1J19A 2ZPYA 1V81A 5AZGA 3V61A 4A3OA 2BYEA 3B1LX 4NY0A 4AJYB 5HKHA 5LXIB 4W9IA 1TTNA 1WJ4A 2MBOA 3M3JA 3RT3B 4B95A 2KC1A 3PPAA 4K81A 2KO3A 4FJYA 3QCAA 3U8ZA 3QWZB 3ZDTA 2K8BA 2L8JA 3ML8A 2O6VD 2KNBA 2MBEA 1MG8A 4AP4C 4KZCA 1GG3A 1WE7A 1GJZA 4TKNA 4EUTA 2C60A 2N4FA 4NAWA 1YIWA 3A9JA 4HCNB 4M0WB 4W9LA 3DVGX 2BKRB 1FXTB 2FCQA 2G4DB 3BINA 1I42A 3V6CB 2PEAA 2EKEC 2HE7A 3KUZA 4W9DA 3VDZA 4EFOA 2DYBA 4LCDE 2KFKA 1P98A 4WAAA 2K8CA 1IYFA 1UZXB 2BYFA 2FIFA 1YD8U 2Z59B 2ZNVC 3DOWA 3DBSA 3PSEB 4FJZA 4RMAA 3ZNZB 4K7UA 2RD0A 2RPQA 1TGZB 3TL5A 5G2NA 4HWIB 3WAPA 4IWPA 3QHTA 3KVFB 4II3B 1XD3B 5AZFA 3UGBB 4E71A 3HM6X 4LJPB 4XX5A 4A20A 2K25A 3IBEA 4IM2A 2BPSA 3H7SA 4DDID 4GDKA 2R2QA 3HHMA 5C1ZA 4AWJA 2GBMA 3APFA 3R7RA 4GB9A 1WXMA 4CHKA 4MELA 1GC7A 2LASA 2MW5A 3QC8B 3VUYA 5J18A 2D10A 2KDFB 1D3ZA 1GC6A 2LZ6A 4ZRJA 2N7DA 2LGXA 1SE9A 3RUIB 2DAFA 4DK5A 3JYUA 4G11A 3Q3JA 3S2AA 2OJRA 3V60A 4TQ0A 4WWOA 5JZEB 4TV3A 3RZWC 2Z0EB 2WX0A 3A33B 3R3MA 4NQLB 2LUEA 3AU4A 1S3SG 4G50A 3PVLA 4AOFA 2NCNA 2LRWA 1WX8A 1WGHA 2DYMA 3PTFC 3WA0A 4CO7A 3L17A 1RRBA 4PYZA 3ZNHB 2KK8A 3M63B 4MGKE 4P7IA 1V86A 1Z5SB 5DPRA 3WALA 3EHVA 2J7QB 3OJ3A 3PLUA 2NR2A 2K39A 2GBNA 1UH6A 3K9PB 3OLMD 4LDTD 3ZDMC 2M0XA 1P9DU 3H1UA 3OJ4B 4F7ZA 1LM8B 2NS5A 1RFAA 2FNJB 1S1QB 4NPNA 3TJPA 1E8XA 1WF9A 4BOSC 1U4AA 3HM3A 1WRDB 3K9OB 2JZZA 2KHWB 3KYCD 4II2B 4PS3A 3M95A 2C7NB 3DVNV 4NJ6A 4JLCA 2L0FA 5FR6A 3WAMA 4DHJB 4IWQA 1UD7A 2G4SA 4DXAB 2FCNA 2GBJA 4IWOA 5EDSA 4EZJA 3VUXA 3RD2A 1V49A 2NPTA 2V3SA 3AXCA 4EEWA 2DZIA 4MDKE 1NI2A 1WGDA 2KWUB 3TMPB 4DHZE 1V5TA 5D6JB 1LQBA 4W9FA 4N9F4 2IY0B 3JW0X 3KUCB 2FIDA 1Q0WB 4EKUA 2JT4B 2WX1A 3EFUA 2O2VB 3QAQA 3UIPB 5CHVC 2L05A 2LI5A 3ECIA 2NPTB 2LXCA 1WR6E 4FULA 1L2NA 4AUQC 2K6QA 2L00B 2KDIA 2IZVB 2LRUA 2MLBA 2IO1B 4MSQB 4KVGB 2J0MA 3CF6E 1J8CA 5J2RA 2DAJA 3RYTA 3MJWA 1EUVB 3A9KA 3PS6A 3X23A 2JRHA 3TIXA 2PE9A 3O65B 4WWNA 3ALBA 4K7SA 1WMHA 4NQKE 2I1KA 3ZNID 1H4RA 3W1YA 4HCPB 1WX9A 3W1SA 4DHJD 2JZ3B 3WIMA 2W9NA 4FHKA 2KOXA 3ZO5B 2CKHB 2G45B 3T9LA 2BWES 5AZHA 5IAAC 2JPHA 1VCBA 1E7UA 1ISNA 2YVCA 1WH3A 1IP9A 3IVFA 2D2QA 2UYZB 3PGEA 2KQ7A 1L7YA 4MM3A 2M4NA 5J17A 4M8NA 4IM0A 5TR5A 4FLHA 4MEMA 3V62A 4ZRKA 2QHOA 2BWFA 2KANA 3ZLZA 3ZRFA 1KLVA 2WDTB 4GMVA 4W9CA 3CMMB 3LJ3A 2KTRA 2ASQA 2CHZA 3L16A 3PLVA 2BKFA 3M62B 1WJ6A 4WWPA 3VFKA 4J6IA 2XK5B 1WE6A 1EF5A 3DPDA 2CS4A 3H6NA 4E3CA 3OAWA 2NBWB 3RULA 1WM2A 4B6WA 2IO0B 2KTRB 3VXWA 1OEYJ 3U7DA 5DPSA 3PZDA 2Y5BB 3EC8A 1KJTA 3VQIA 3ZTDA 3NHEB 3PT2B 4HDQA 1WFYA 4ANWA 1WXAA 4NNJB 4BKSA 3QK0A 4X57B 4KZ0A 3T8MA 2KVRA 4BBNF 1OEYA 4KSKC 3DBLI 1NDDA 4I6NB 2O2VA 2MBBB 1QZEA 4IM3A 1AARA 4HPMB 4FA6A 4PYUA 1ZGUB 2K8HA 1EF1A 1ZW7A 3PRPB 1YJ1A 2HJ8A 2MBQA 3KW5B 1IPGA 2MWSB 5KHQA 2ZCBA 2REXA 1CMXB 1HE8A 1WXSA 3EECA 1OTRB 2MX2A 4HXDA 4MH0E 3QQ8B 2YLMA 2KFKB 4W9EA 5DPTA 2L3ZA 3WAOA 3A4RA 4OVUA 1OQYA 4W9HA 1LFDA 3VTWA 2DX5B 2V1YA 5D2MB 3SU8X 5CHWA 2KJ6A 2KJHB 4B9KA 2PE6B 2A5UA 4W9KA 4MGZE 3ZUNA 4GN1A 3GOEA 2MQJA 1A5RA 1E8YA 2D07B 3KUDB 3MHSD 3ONSA 3ZNGC 4DWFA 1P3QU 2KDEB 3WANA 1TZ1A 4BKTA 2KN5A 3GZNI 2MRPA 2UWQA 3VTUA 1V6EA 4MJSA 2LXAA 4BOZB 2GMIC 2ZZPB 4K1RB 4WJOA 2IYDB 5G55A 2KD0A 2KQSA 2BGFA 3IG3A 1WJNA 1X1MA 2O6VA 3HIZA 4ICUA 4GGQA 2LVQA 4G0NB 1WZ0A 3NS8A
chains in the Genus database with same CATH superfamily
1I4RA 2MJDA 3SDLC 1ZXHA 4EZKA 3N3KB 3NS1A 4FBJB 4NJ7A 1VD2A 3W1SC 1JRUA 4WQOB 2O6VB 3IHPC 1YJIA 4C4VB 2DHZA 3JSVA 5IOIA 2Q5WD 1EU3A 2LGSA 3JVZX 2GBKA 1C79A 3I57A 3AM9A 2JWZA 4C56C 3QARA 2KMAA 4RGTA 3R8BA 1I35A 4ACFA 2R2OA 3Q3NC 1GNUA 2AQ1B 5C23A 4ANXA 3VUWA 2BT6A 3UQAA 4UDUC 5IKCM 1G6JA 4JPSA 3NZSA 3A1QA 2KXJA 2G3QB 2H88B 4AS1A 4RM9A 2JRIB 1ZXIA 1T6BX 5IA7A 2BQQA 4BVUC 3QX1A 2WU5B 3OG5A 3LDZE 4D2KA 1N5XA 3NZUA 3A1QB 3LB8C 5L83A 2KZRA 2N9PC 2WYQA 2N9XA 2M8SA 4DXFA 1PGAA 1R4NB 5EE1A 2WU2B 3PV1A 1WZ3A 2XN9C 1AWDA 4GU2A 2VH1A 1F9JA 4EOYA 1N5WA 4CYEA 1PQSA 3N1YC 4HVBA 4RM8A 1SGHA 5BMHA 4ZYNA 4OW0A 1YQBA 4W9GA 5E6PA 5D7GA 1P0RA 2MA9B 3T3OA 1IGDA 1FM0D 1C78A 3P4SB 5JHAA 2QDFA 3QIJA 4HLEA 4J3OD 3SD5A 1WGGA 2JY6A 3H7PA 1XT9B 3UI3A 5JH5C 4MH8A 1E90A 3A4SC 3FKYA 1XQQA 2GRIA 2D3BA 2ZVNA 3A9JB 1I4HA 4M0WA 2PMVA 2XEWA 1RAXA 1XO3A 1BT0A 4IOIE 3VRBB 1E5WA 1UBIA 3MC8A 4ANUA 1N60A 3ZIMA 3ZJUA 3ZQ4A 2KDMA 1D4BA 3NZ3A 3AU5A 2L76A 3BY4B 1KF6B 3APCA 3W5UB 3V6EB 1GUAB 3PRMB 2NTTA 1UELA 2DENB 3PHXB 2LVPA 4KIKA 5E6OA 5FK9C 2QIEB 1SE4A 2ZJDA 4QAYA 1E9MA 1K51A 1JWBD 1QQRA 3U4EG 4ZRIA 2M1MA 5KHOA 1B9RA 2JXXA 3AEFB 4PS8A 2N9KA 1C4AA 1SJHD 1K52A 2JF5A 2DLBA 1E7VA 2CR5A 2B3AA 1T0RC 4XC2A 4EZLA 5FR3A 1QLBB 1V81A 2JXTA 4WQMA 5AZGA 2BYEA 3B1LX 4AJYB 5LXIB 1UGJA 4C7YA 3EGRA 3PPAA 1PDXA 5H92C 4GLSC 2KNBA 1TS4A 2NTSA 4B0EA 2WXOA 1TT5B 1SBBB 2N4FA 1WWTA 3DVGX 1FXTB 5GXGB 2G4DB 3V6CB 3KUZA 1VLBA 2DYBA 1IYFA 2I2YA 4WAAA 2BYFA 2FIFA 4RF0A 4FJZA 3ZNZB 2RPQA 3WAPA 4IWPA 3QHTA 3HM6X 4RGNA 4DDID 1FPYA 3HHMA 5C1ZA 3APFA 3P63A 4WWMA 2AQ2B 2LASA 3VUYA 1FCCC 2KDFB 1GC6A 2LZ6A 4ZRJA 3RUIB 3ZJTA 2BTEA 3JYUA 4TQ0A 4L23A 4WWOA 5JZEB 5BYSA 3V3XA 2Z0EB 2M56B 2WX0A 3R3MA 1ESFA 1ROEA 1YNTE 2OEDA 4G50A 3PVLA 4AOFA 5LNK1 3WA0A 1RFKA 2KK8A 1XEEA 1L6VA 1Z5SB 2DWQA 2LHEA 1QKZA 3WALA 3PLUA 1C4CA 4YWGG 1P9DU 2NS5A 1UF0A 2FNJB 3R2IA 2K22A 3HM3A 2JZZA 1VDVA 3WAMA 4DHJB 2L0FA 2FCNA 5EDSA 2MH7A 3RD2A 1V49A 1F2RC 4MDKE 1V8CA 3TMPB 4DHZE 4KGRA 1NI3A 2WXFA 1I4GA 3JW0X 1JRPA 2QILA 4KGTA 4B0MA 3QAQA 5CHVC 1J7CA 1C76A 3ECIA 3ZGZA 1L2NA 4OZBA 1CQVA 1Q10A 2W54A 4MSQB 1DGJA 2J0MA 2INCC 4LNOA 3P42A 3MP9A 3PS6A 1TKYA 3BK1A 3ALBA 1SIJA 4ZRPA 3U2SC 2PLPA 1VCBA 3TEYA 1ISNA 1E7UA 4KKIA 2E6XA 2UYZB 4ARCA 4MM3A 4P16A 1DOXA 3VR9B 4MEMA 2QHOA 2KANA 4TMAB 1KLVA 2DNFA 4W9CA 2BKFA 1UWMA 3M62B 4WWPA 4J6IA 3GP7A 1BUIC 3H6NA 5EE3A 2VZKB 3BVZA 3VXWA 3RFZB 3IT4B 3PZDA 4HDQA 1WFYA 1WXAA 3AE4B 1FO4A 4BBNF 1FNWA 2O2VA 2MBBB 4PYUA 2HJ8A 3KW5B 1IPGA 2MWSB 1P7EA 3ETRA 1OQYA 2W82A 3VTWA 2DX5B 1YQ3B 1E10A 1R7SA 2PE6B 1AN8A 1JWAD 4MGZE 3GOEA 1E8YA 2JWUA 3WANA 1TZ1A 4BKTA 1JQ4A 2UWQA 2K0PA 2GMIC 1MHXA 4WJOA 2IYDB 5EE0A 1N62A 1WJNA 1ET9A 3NVYA 1WZ0A 3NS8A 4S0RA 3RNEC 1YN5A 1V9JA 3DBRB 2EKIA 3B9JA 5CTRC 3PHWB 3UIOB 2ZEQA 4I6PA 1WYWB 3V05A 4IC7B 2Y5PA 2XBBC 4JX1C 4ZDVA 1EWCA 1TKGA 1QOFA 3HRDD 3IAS1 3L4PA 1KM7A 4BFRA 1OFFA 2NBUA 4JQWC 3ZVVA 4EFOA 3DDCB 3CWIA 3H7PB 1WI0A 1L5PA 2CU1A 2KDBA 1E8ZA 2IO3B 4AQ7A 3SEBA 1I4PA 2YEPF 4HJKA 1MHHE 2LWPA 4YTMB 4HK2A 3ZW3A 1C4PA 5L95C 2MCNB 1ACCA 2QCZA 4IDIA 3OWEB 2X38A 1QOAA 3DHIC 2AWTA 2EMSA 3Q6BA 4NAWB 4REZA 3R7QA 4RH6A 2BYTA 3UINB 3DHGC 1WXQA 1DOYA 2V9HA 4KIKB 1SIFA 2IY1B 2MEKA 4OVZA 3MC9A 3VTVA 1WGKA 3N20C 2PPHA 3TBLD 1V80A 3SFDB 2N7JA 3MTNB 1T0YA 3NOBA 2MBHA 2ZPNA 2PVOD 4C7ZA 3IT6B 1SE2A 2KWVB 1I4QA 2QEJC 2DZKA 4K7WA 3B2GA 3JSVB 2PTLA 1TS5A 4P1BC 2AYOB 2RPVA 2MHJA 3TEWA 1WJUA 4N6EB 1QF6A 1RYJA 1FXIA 3ML9A 3PO0A 1Q5WB 1FXAA 2AL3A 1IBXB 4FJVB 1T0SC 3Q8EA 1OGWA 2FE8A 3R66C 3GE3C 1R4NI 4YSXB 1Q1OA 2CJNA 5IN7A 2WP9B 3QJZA 1F77A 4RNAA 2LMCA 3L13A 3E56A 2WHIA 4ASWC 2G9HD 2SEBD 3A9KB 1XCQL 1RWSA 2C7HA 1R4MB 2D3CA 4GDKB 4BKSD 4A55A 1JMLA 1YX5B 3CSFA 3L08A 1SF0A 2OOBB 2ZCCA 3W5VB 2NMQA 1IUEA 2HTME 4YL8A 4LLGM 4GXBA 2GB1A 2YEPB 1D6EC 2C5LC 2RGFA 1OQRA 3Q3FA 2L52A 2KKCA 4DXGA 3EUB2 4K3CA 3AE5B 2FCMA 1N61A 1NBFC 3U52E 2N1VA 2L0TA 3W9CB 1MJDA 2DBYA 4FN2A 3AEGB 1PGXA 4C80A 1K8RB 1V2YA 5BMGA 1T3QA 2KWCA 2FBWB 2WLBA 2LJ5A 3CSTA 2KFJA 1YOVB 1EO6A 3N32A 3WAOA 2L83A 3V61A 1H8CA 4USAA 4ZYSA 1JCKB 4PT5A 2QMTA 4B95A 4K81A 3QCAA 3U8ZA 3TEZA 3QWZB 2BB5A 2AX5A 2K8BA 2L8JA 4XGAB 2N0SB 2W3RA 3ML8A 2MBEA 1GG3A 1LO5D 3FC4A 5E6JA 4TKNA 2C60A 2D5GA 4NAWA 2BKRB 2FCQA 1ZOYB 1CZPA 3VDZA 4W9DA 1I7HA 4LCDE 2LFIA 2ZNVC 1N63A 3NJTA 2RD0A 1KFYB 4HWIB 3KVFB 4II3B 1XD3B 4O1NA 4LJPB 5MPOA 4A90A 1KTKA 4CHKA 2MW5A 2WXIA 5J18A 2D10A 1SE9A 2DAFA 4G11A 1XLPA 2PVGC 4TV3A 3RZWC 3A33B 3AU4A 3FAHA 2NCNA 2KAJA 2KYWA 2R61A 5JXVA 1RRBA 4PYZA 3ZNHB 1V86A 1XXGA 2J7QB 3OJ3A 1IBXA 4LDTD 3OLMD 2V3PA 4F7ZA 1LM8B 2WDVB 3MC0B 1U4AA 4II2B 2I38A 1FIQA 3DVNV 1HEZE 1UD7A 1K50A 5AUKA 1NVID 2NPTA 2V3SA 1L0YB 4EEWA 2DZIA 3AE8B 4N59A 1V5TA 5D6JB 4W9FA 2RDHA 4NJCA 2IY0B 2FIDA 1Q0WB 3IAM1 2WX1A 3EFUA 3UIPB 1ZUD2 3AE1B 2NPTB 1HTOA 2LXCA 4FULA 2BS4B 2K6QA 4FXCA 2MLBA 1SJED 3CF6E 1FD6A 4RF1A 3TUOA 2KWDA 3MJWA 1QT9A 3A9KA 3TIXA 3RNFC 1WMHA 3DBLB 4HCPB 2WXPA 4DHJD 1EU4A 2W9NA 3WIMA 4ZRQA 4FHKA 1NYRA 4JE3B 3T9LA 3AEAB 5AZHA 1WH3A 3I5JC 4MT5A 5J17A 1SSNA 2JU6X 5TR5A 2ZW0A 1L4ZB 3LJ3A 3AB5A 2M0AA 2CHZA 4WURA 2IPKD 1WJ6A 2XK5B 2PIAA 2AQ3B 1EF5A 2OHFA 3GZNB 5BYQA 2X8XX 4E3CA 1WM2A 1V1PA 1T5XD 4CQNA 1OEYJ 2Y5BB 3EC8A 3VQIA 3NHEB 3PT2B 4ZHOA 1ZP0B 4BKSA 3QK0A 4YSYB 2KVRA 1OEYA 1NDDA 4I6NB 2BW2A 4HPMB 1ZGUB 1EF1A 2MBQA 5KHQA 4ARIA 3TEXA 1CMXB 1WXSA 1UNSA 2EELA 3QQ8B 1E0ZA 3EA6A 4W9EA 1ZDVA 4P1CC 3MFGA 4W9HA 1LFDA 1WSPA 1YMHE 3NVZA 3SU8X 3FILA 3Q8CA 2IGHA 1K53A 1A5RA 2D07B 4DWFA 2WXKA 3VTUA 1D5MC 2INPE 2E3TA 2LXAA 4LNNA 2KQSA 1ENFA 2BGFA 4WIPA 1F0ZA 1X1MA 2BVCA 4ICUA 2LVQA 1SB3C 4KKJA 2M19A 1J7BA 4DDGD 2NBVB 3SHQA 2AEHA 2D3AA 2HJ1A 3Q8AA 2RR9A 1LXDA 2XK5A 4JL9A 4YTPB 1GOZA 3AEDB 3P1MA 4XDCA 4JGHB 2KX0A 2KJRA 2BYVE 3TCAA 2LGYA 3ZKJC 3DVNU 3RZFA 4GSWA 3KWLA 4DHZB 1FNVA 4FADA 3QA8A 4WAFA 5BMIA 2GLSA 2PJHA 2K3UA 5LXHA 1FMAD 2N1WA 3AE2B 1C9FA 3GB1A 4KV2A 1L0VB 4TUUA 2LGDA 5HI1A 1MFWA 3B08A 2RDBC 1YJJA 3PRZA 3DBRI 4US9A 4A9AA 3ZTCA 1J0GA 1B1ZA 2J0KA 2GI9A 4RFBA 2ONQA 2GOWA 1R4MI 5HHDG 2MSED 3DBHI 4XWTA 4URKA 3DQVA 5BO4B 2KX3A 4BBNC 4F1SA 4AJWA 2ZW1A 4N58A 4GOCA 5D94A 1FEHA 4KX6B 2FCSA 2IBIB 1WXVA 4KDLB 2RSUA 2D3GA 1MG4A 3L54A 2DZJA 3SFEB 4HROA 5E6NA 1F1HA 2FUG1 2WXRA 4LJOB 2V0GA 2RMMA 1TS3A 2IO2B 2I1JA 1D5XC 2WS3B 4F8CB 2WWZA 4M02A 3VAWA 4GDLB 3I63C 4BKGA 2M17A 3AH7A 3ENEA 2WXLA 1WIAA 2GBRA 4HPLB 3HK0A 4GDLA 3AI5A 1RLFA 1TY2A 1C3TA 2A4ZA 3IFWB 5GMVA 1C1YB 1WGRA 1YX6B 3B2FA 3W2DA 2ZVOA 3LXFA 3KH0A 1F2RI 2VRRB 2W55A 2KLCA 4HDOA 1TJEA 4WJNA 1WY8A 3RCZA 3U7ZA 2K6DB 3PZ7A 1V5OA 1WM3A 3GS2A 2NVUI 5T8IA 4W9JA 4MJSB 1KLUD 4C00A 3P2BA 2OJWA 2KLGA 3B0AA 5LLIA 2K5PA 1J19A 2ZPYA 1XLOA 4W9IA 2BS3B 3M3JA 2KMMA 2KO3A 3ZDTA 5FKAC 2O6VD 2WDRB 5IP4D 1MG8A 2WXHA 1GJZA 1YIWA 4W9LA 3A9JA 4HCNB 4M0WB 3I9V1 3BINA 1I42A 2PEAA 2EKEC 2HE7A 5C3JB 3C8YA 3RNCC 1KH0A 2K8CA 3DHHC 3DBSA 4K7UA 3TL5A 1XF5L 1SXTA 1ET6A 5AZFA 1V97A 4A20A 2K25A 2BPSA 3H7SA 4NAMA 2GBMA 2JSVX 3BVMA 1WXMA 3DWMA 1HA5A 3BVGA 2KACA 2LGXA 3Q3JA 2OJRA 3Q69A 2JX5A 4S17A 4YT0B 1S3SG 2J53A 2HDEA 1AYFA 2V4IB 2LRWA 2LJIA 1SEBD 2DYMA 5IO9A 3RN9C 4P7IA 4Q2JA 3Q8BA 3VRAB 1GB4A 5DPRA 1UUPA 3EHVA 1CK1A 2NR2A 5H8YE 3K9PB 2JYEA 4XDDA 2M0XA 3OJ4B 1RFAA 1P7FA 3P4PB 1E8XA 2WXMA 3M95A 3WCQA 5FR6A 4IWQA 1WYGA 1BMLC 2G4SA 1ZDXA 4DXAB 4PK1A 3AE6B 4P6VF 1WGDA 2KWUB 1LQBA 1TYGB 5EE9A 4EKUA 4XYCA 2JT4B 3P4RB 1WR6E 4NZLB 4AUQC 2ICIA 2L00B 2KDIA 2LRUA 2G1EA 3AECB 3HVDA 1EUVB 4K7SA 3ZNID 3W1YA 3NVWA 1WX9A 3W1SA 2J42A 3VR8B 2JZ3B 2KOXA 3ZO5B 2CKHB 2G45B 5IAAC 3RMKC 2YVCA 2TSSA 3IVFA 1NYQA 3PGEA 2KQ7A 1L7YA 1TY0A 4M8NA 1MPEA 4FLHA 4ZRKA 3ZRFA 2BWFA 5HG2A 3ZLZA 3DBHB 4GMVA 3LYYA 3ZXVA 3CMMB 1UWXA 3NVVA 2ASQA 3L16A 3PLVA 1WE6A 3DPDA 5BYRA 1VR9A 1XLQA 3OAWA 2NBWB 3RULA 3U7DA 4US8A 2CJOA 4RGMA 3N1ZC 4HKQA 2VZKD 3BYYB 5G5HA 1QZEA 1AARA 4FA6A 2K8HA 4RGOS 2REXA 2IDYA 1HE8A 1OTRB 2MX2A 3E9SA 4HXDA 2YLMA 2KFKB 2L3ZA 1FFVA 1EWYC 2V1YA 1XCTL 2KJ6A 2KJHB 2L1AA 4B9KA 2A5UA 4W9KA 3ZUNA 3Q2AC 3AN1A 4GN1A 2WQYB 4HJGE 3Q3OC 3KUDB 3MHSD 1A70A 4TSSA 4ZOHC 3GZNI 1V6EA 3FILB 4WH4A 4MJSA 4BOZB 1I4XA 3PZ8A 2ZZPB 4K1RB 1JWSD 1E7PB 2JQRB 3IG3A 3N1XC 1J7AA 3HIZA 4G0NB 2N9EB 4MGYE 3O13A 2BS2B 2KQ4X 3AMZA 1E8WA 2KC2A 2MP2A 3N30A 1XLNA 2CU3A 4HEA1 1P1AA 2H89B 4IG7B 4LDTB 1VZ8A 3AEBB 1STEA 2HD5B 2MP2B 2BF8B 3CIRB 3VHTC 2D11A 4L1BA 1ZE3D 1QILA 4GIVA 3D32A 3ZXRA 1T0QC 3BIID 2C9WB 3ZRCA 3KWVA 3UF8A 2KTFA 1UBQA 2PW9A 4M01A 4OHJA 2W3SA 4E74A 2HTHA 5DPWA 1V1OA 4IUMB 1MVKA 4ICVA 3HUIA 2QSDA 2WGSA 3I3TB 2L7RA 3URYA 4ANVA 5AEKB 2DZMA 4K3BA 4KSLC 2EMTA 3RNAC 4JIOU 2WXQA 2KMCA 3NG0A 4G3XB 5D3DA 4PS7A 2WDQB 4WJPA 3L0WB 2J52A 2LVOA 5AUIA 5DCNA 4I6LB 1WGYA 2AL6A 3ABVB 2DYOA 1M94A 2J0JA 4WJQA 2K9XA 3PREA 4TQ1A 3UQBA 3IXSA 5CX3A 5JHBA 1Y8RC 1UGMA 2CHWA 1TBEA 1JALA 3NUHB 4BAXA 5CHFA 2IGGA 3APDA 1N6ZA 3AE3B 4IW0A 2ZNVB 2K1FA 4A6QA 4MGIE 2N9LA 3RPFC 3Q3MC 1TS2A 3C0RB 2ON8A 2QJLA 3H9DA 4EE2A 3VH3B 3DVGY 3VH4B 3AULA 1YN4A 3DCGA 4FHJA 1FRDA 1RM6C 3U30A 4BZAA 2FUHB 3EFCA 4KDIC 2JVCA 4M00A 3L10B 1WMHB 3BYTB 1WX7A 2V4LA 3BK2A 3DWGC 2Z0DB 4YSZB 3NRZA 2Y3AA 1PYWD 2XNAC 1D5ZC 3ZYYX 1KOTA 2N7EA 3NY5A 1GAQB 3X0WA 3KYDD 2BBCA 4OVVA 1WR1A 4A3PA 2CHXA 4MSMB 1ZKHA 4LK0M 3HVZA 2LD9A 2WXNA 4DBGA 2C7MB 2JUOA 4XE0A 1FCLA 3VVWB 2FAZA 4M8MA 1LGRA 4XZ4A 3ZJVA 5TSSA 1WRIA 1Z2MA 5HKHA 1CJEA 4A3OA 4NY0A 4XWWA 1JW9D 1TTNA 1WJ4A 2LEKA 2MBOA 3RT3B 2KC1A 1PUTA 5G5GA 4FJYA 3AV8A 4HPPA 1OQQA 1JWUD 4AP4C 4KZCA 1WE7A 1F52A 4EUTA 1IGCA 4LTUA 4RCOA 3R2TA 5D3IB 2LUMA 4A8XC 1BXTA 2Y5CA 2KFKA 1P98A 1UZXB 2Z59B 1YD8U 3DOWA 5I4DA 3PSEB 4RMAA 1TGZB 1VRAB 2UU7A 5G2NA 1L6UA 3UGBB 1Y56A 4E71A 1PGBA 4XX5A 3IBEA 1L0XB 4IM2A 1ZPSA 4GDKA 2R2QA 1E6EB 2RDGA 4AWJA 4LNKA 1C77A 3R7RA 4GB9A 4MELA 1GC7A 3QC8B 2BB6A 3SR6A 3KQ4A 2V3NA 1D3ZA 2N7DA 4DK5A 3S2AA 3V60A 4JWSC 4NQLB 2LUEA 2WXJA 4HRSA 4OZCA 1WX8A 1WGHA 3PTFC 4CO7A 1KLGD 3L17A 2SAKA 4MGKE 3M63B 2LHDA 4JWUC 2K39A 2GBNA 1UH6A 3ZDMC 3H1UA 1S1QB 4NPNA 1FFUA 3KLSX 3TJPA 1WF9A 2WXGA 4BOSC 1WRDB 3K9OB 3KYCD 2KHWB 4PS3A 2C7NB 1TIFA 4DQOC 4NJ6A 4ITKA 4JLCA 3AEEB 4OZAA 2GBJA 4IWOA 1NENB 1TZOA 2B76B 4EZJA 3VUXA 1V1PB 3AXCA 1PFDA 1NI2A 2IGDA 1VZ7A 4IKGA 2JYTA 2JZPA 1HZ5A 4H2AA 4N9F4 2WNMA 3BWUD 3KUCB 1YN3A 3RI7C 2O2VB 2J4XA 1FRRA 1DYQA 2L05A 2LI5A 3P4QB 4HKZE 2IZVB 2IO1B 4KVGB 1SE3A 4LNFA 1J8CA 5J2RA 3J9CA 2DAJA 3RYTA 1GB1A 1YQ4B 4LNIA 2INNE 3X23A 2JRHA 2PE9A 3O65B 4WWNA 4NQKE 2I1KA 1H4RA 2KN4A 1HQRD 1HZ6A 3N9YC 1L4DB 4L2YA 2QC8A 3TSSA 3RNBC 2BWES 2JPHA 1GPXA 1IP9A 4YTNB 2D2QA 2M4NA 3AE7B 4ZHPA 1QOGA 4IM0A 1M4VA 3V62A 1JWMD 1TKEA 2L32A 2WDTB 3Q14C 2KTRA 1HXYD 2MJEA 1FNUA 3GE8C 3VFKA 5HFYA 4C4VA 1VJKA 2LGIA 1AW7A 2CS4A 1MI0A 1KRHA 4B6WA 2IO0B 3RNGC 2KTRB 5DPSA 1KJTA 3ZTDA 1VZ6A 3H8HA 4ANWA 4NNJB 1JROA 3MHZA 2KT7A 4X57B 4KGSA 4KZ0A 3T8MA 4KSKC 3DBLI 4YXDB 2KVZA 4IM3A 4MACA 2VH2A 1ZW7A 2IJ0A 1YJ1A 3BZDB 3PRPB 2ZCBA 1NEKB 3EECA 4MH0E 1QOBA 5DPTA 5C2TB 3A4RA 4OVUA 2Z8LA 5D2MB 5CHWA 2INDC 2MJ3A 2ACZB 3C19A 1DOIA 2MQJA 3ONSA 3ZNGC 1EM7A 1HTQA 3MJ5A 1P3QU 2KDEB 2KN5A 2MRPA 2PKOA 3AE9B 3Q8FA 5G55A 4MM3B 2KD0A 4R3DA 3T3NA 2O6VA 4GGQA
chains in the Genus database with same CATH topology
2N9EB 4MGYE 4DDGD 2NBVB 1V9JA 3SDLC 3SHQA 4EZKA 3N3KB 4FBJB 2AEHA 4NJ7A 1VD2A 3W1SC 5CTRC 3PHWB 1JRUA 3UIOB 1E8WA 2KC2A 2ZEQA 4I6PA 1WYWB 4WQOB 2O6VB 2MP2A 3IHPC 3N30A 2RR9A 1LXDA 2XK5A 4JL9A 2DHZA 3JSVA 4IC7B 2XBBC 1P1AA 4ZDVA 4JGHB 4IG7B 4LDTB 2KX0A 3JVZX 2GBKA 2KJRA 2BYVE 3TCAA 2HD5B 2JWZA 2MP2B 3QARA 2BF8B 2LGYA 1KM7A 3VHTC 4BFRA 2KMAA 2D11A 3ZKJC 2NBUA 4JQWC 3DVNU 3ZVVA 3DDCB 2R2OA 3H7PB 4GIVA 3D32A 3RZFA 1I35A 1WI0A 2CU1A 2KDBA 1E8ZA 1GNUA 5C23A 2IO3B 4GSWA 4ANXA 2C9WB 3VUWA 3ZRCA 4HJKA 3UF8A 4DHZB 2KTFA 2LWPA 1UBQA 3UQAA 1G6JA 4HK2A 3ZW3A 3QA8A 4FADA 5L95C 3NZSA 4E74A 2PJHA 3A1QA 2KXJA 2G3QB 2HTHA 5DPWA 5LXHA 4IUMB 4RM9A 2N1WA 2MCNB 2JRIB 4ICVA 5IA7A 3I3TB 4KV2A 2L7RA 4BVUC 4TUUA 3QX1A 4ANVA 5AEKB 2DZMA 3LDZE 2LGDA 3NZUA 2AWTA 3A1QB 2EMSA 2EMTA 4JIOU 2KZRA 4KSLC 5L83A 3B08A 4NAWB 3R7QA 2KMCA 4G3XB 3PRZA 3DBRI 2N9PC 3ZTCA 1J0GA 2WYQA 2J0KA 4PS7A 3UINB 2N9XA 2M8SA 2GOWA 3PV1A 4KIKB 1SIFA 1WZ3A 1R4MI 4WJPA 3L0WB 2IY1B 2LVOA 5DCNA 4GU2A 4I6LB 1WGYA 2AL6A 3VTVA 2MSED 3DBHI 4URKA 1F9JA 2PPHA 3DQVA 2DYOA 5BO4B 3TBLD 4EOYA 1M94A 1V80A 4CYEA 1PQSA 2J0JA 4WJQA 3MTNB 4HVBA 1T0YA 2KX3A 3NOBA 2MBHA 3PREA 4RM8A 2ZPNA 4BBNC 4F1SA 1SGHA 4ZYNA 4AJWA 4TQ1A 4GOCA 5D94A 3UQBA 1YQBA 2KWVB 4W9GA 5E6PA 2DZKA 4K7WA 5D7GA 2FCSA 2IBIB 1P0RA 2MA9B 1WXVA 5CX3A 5JHBA 4KDLB 1Y8RC 3JSVB 2RSUA 2AYOB 1UGMA 2D3GA 5JHAA 1WJUA 2CHWA 1TBEA 3L54A 2DZJA 3QIJA 4HLEA 5CHFA 3ML9A 5E6NA 1Q5WB 3SD5A 1WGGA 2JY6A 2AL3A 3H7PA 1XT9B 3APDA 4FJVB 4LJOB 4IW0A 5JH5C 2IO2B 2I1JA 2ZNVB 1OGWA 2K1FA 4MGIE 3R66C 1E90A 3A4SC 4F8CB 1R4NI 1XQQA 2WWZA 2ZVNA 3C0RB 3H9DA 3A9JB 1Q1OA 3VH3B 3VAWA 2XEWA 3DVGY 1RAXA 4GDLB 3VH4B 1BT0A 3AULA 1E5WA 1UBIA 3DCGA 2M17A 3QJZA 4BKGA 4ANUA 4FHJA 3U30A 3ZIMA 3ENEA 3L13A 4ASWC 2FUHB 4KDIC 2JVCA 1WIAA 2GBRA 1H8CA 3L10B 4HPLB 3HK0A 3AU5A 1WMHB 3A9KB 4GDLA 2L76A 3AI5A 3BY4B 1WX7A 3APCA 2C7HA 1RLFA 2V4LA 3V6EB 1GUAB 2Z0DB 4GDKB 4BKSD 1C3TA 3PRMB 2A4ZA 1UELA 2DENB 3PHXB 3IFWB 1YX5B 3CSFA 2LVPA 4KIKA 3L08A 2ZCCA 2OOBB 5E6OA 5GMVA 1C1YB 1WGRA 1YX6B 1KOTA 2N7EA 3NY5A 2ZVOA 3X0WA 4YL8A 3KH0A 3KYDD 4GXBA 2ZJDA 4OVVA 1WR1A 4A3PA 2C5LC 2CHXA 2RGFA 2KLCA 2VRRB 4MSMB 4HDOA 4ZRIA 1ZKHA 2M1MA 4WJNA 3Q3FA 5KHOA 2JXXA 4PS8A 1WY8A 3RCZA 2KKCA 2LD9A 2K6DB 1V5OA 1WM3A 4DBGA 2FCMA 1NBFC 2C7MB 2JUOA 2N1VA 2NVUI 2L0TA 3VVWB 2FAZA 4M8MA 4W9JA 4MJSB 2JF5A 4FN2A 1E7VA 2CR5A 1K8RB 2B3AA 1V2YA 4EZLA 4XC2A 4XZ4A 2KWCA 3P2BA 3CSTA 2LJ5A 2KFJA 1EO6A 2KLGA 3B0AA 3N32A 5LLIA 1Z2MA 1J19A 2ZPYA 1V81A 5AZGA 3V61A 4A3OA 2BYEA 3B1LX 4NY0A 4AJYB 5HKHA 5LXIB 4W9IA 1TTNA 1WJ4A 2MBOA 3M3JA 3RT3B 4B95A 2KC1A 3PPAA 4K81A 2KO3A 4FJYA 3QCAA 3U8ZA 3QWZB 3ZDTA 2K8BA 2L8JA 3ML8A 2O6VD 2KNBA 2MBEA 1MG8A 4AP4C 4KZCA 1GG3A 1WE7A 1GJZA 4TKNA 4EUTA 2C60A 2N4FA 4NAWA 1YIWA 3A9JA 4HCNB 4M0WB 4W9LA 3DVGX 2BKRB 1FXTB 2FCQA 2G4DB 3BINA 1I42A 3V6CB 2PEAA 2EKEC 2HE7A 3KUZA 4W9DA 3VDZA 4EFOA 2DYBA 4LCDE 2KFKA 1P98A 4WAAA 2K8CA 1IYFA 1UZXB 2BYFA 2FIFA 1YD8U 2Z59B 2ZNVC 3DOWA 3DBSA 3PSEB 4FJZA 4RMAA 3ZNZB 4K7UA 2RD0A 2RPQA 1TGZB 3TL5A 5G2NA 4HWIB 3WAPA 4IWPA 3QHTA 3KVFB 4II3B 1XD3B 5AZFA 3UGBB 4E71A 3HM6X 4LJPB 4XX5A 4A20A 2K25A 3IBEA 4IM2A 2BPSA 3H7SA 4DDID 4GDKA 2R2QA 3HHMA 5C1ZA 4AWJA 2GBMA 3APFA 3R7RA 4GB9A 1WXMA 4CHKA 4MELA 1GC7A 2LASA 2MW5A 3QC8B 3VUYA 5J18A 2D10A 2KDFB 1D3ZA 1GC6A 2LZ6A 4ZRJA 2N7DA 2LGXA 1SE9A 3RUIB 2DAFA 4DK5A 3JYUA 4G11A 3Q3JA 3S2AA 2OJRA 3V60A 4TQ0A 4WWOA 5JZEB 4TV3A 3RZWC 2Z0EB 2WX0A 3A33B 3R3MA 4NQLB 2LUEA 3AU4A 1S3SG 4G50A 3PVLA 4AOFA 2NCNA 2LRWA 1WX8A 1WGHA 2DYMA 3PTFC 3WA0A 4CO7A 3L17A 1RRBA 4PYZA 3ZNHB 2KK8A 3M63B 4MGKE 4P7IA 1V86A 1Z5SB 5DPRA 3WALA 3EHVA 2J7QB 3OJ3A 3PLUA 2NR2A 2K39A 2GBNA 1UH6A 3K9PB 3OLMD 4LDTD 3ZDMC 2M0XA 1P9DU 3H1UA 3OJ4B 4F7ZA 1LM8B 2NS5A 1RFAA 2FNJB 1S1QB 4NPNA 3TJPA 1E8XA 1WF9A 4BOSC 1U4AA 3HM3A 1WRDB 3K9OB 2JZZA 2KHWB 3KYCD 4II2B 4PS3A 3M95A 2C7NB 3DVNV 4NJ6A 4JLCA 2L0FA 5FR6A 3WAMA 4DHJB 4IWQA 1UD7A 2G4SA 4DXAB 2FCNA 2GBJA 4IWOA 5EDSA 4EZJA 3VUXA 3RD2A 1V49A 2NPTA 2V3SA 3AXCA 4EEWA 2DZIA 4MDKE 1NI2A 1WGDA 2KWUB 3TMPB 4DHZE 1V5TA 5D6JB 1LQBA 4W9FA 4N9F4 2IY0B 3JW0X 3KUCB 2FIDA 1Q0WB 4EKUA 2JT4B 2WX1A 3EFUA 2O2VB 3QAQA 3UIPB 5CHVC 2L05A 2LI5A 3ECIA 2NPTB 2LXCA 1WR6E 4FULA 1L2NA 4AUQC 2K6QA 2L00B 2KDIA 2IZVB 2LRUA 2MLBA 2IO1B 4MSQB 4KVGB 2J0MA 3CF6E 1J8CA 5J2RA 2DAJA 3RYTA 3MJWA 1EUVB 3A9KA 3PS6A 3X23A 2JRHA 3TIXA 2PE9A 3O65B 4WWNA 3ALBA 4K7SA 1WMHA 4NQKE 2I1KA 3ZNID 1H4RA 3W1YA 4HCPB 1WX9A 3W1SA 4DHJD 2JZ3B 3WIMA 2W9NA 4FHKA 2KOXA 3ZO5B 2CKHB 2G45B 3T9LA 2BWES 5AZHA 5IAAC 2JPHA 1VCBA 1E7UA 1ISNA 2YVCA 1WH3A 1IP9A 3IVFA 2D2QA 2UYZB 3PGEA 2KQ7A 1L7YA 4MM3A 2M4NA 5J17A 4M8NA 4IM0A 5TR5A 4FLHA 4MEMA 3V62A 4ZRKA 2QHOA 2BWFA 2KANA 3ZLZA 3ZRFA 1KLVA 2WDTB 4GMVA 4W9CA 3CMMB 3LJ3A 2KTRA 2ASQA 2CHZA 3L16A 3PLVA 2BKFA 3M62B 1WJ6A 4WWPA 3VFKA 4J6IA 2XK5B 1WE6A 1EF5A 3DPDA 2CS4A 3H6NA 4E3CA 3OAWA 2NBWB 3RULA 1WM2A 4B6WA 2IO0B 2KTRB 3VXWA 1OEYJ 3U7DA 5DPSA 3PZDA 2Y5BB 3EC8A 1KJTA 3VQIA 3ZTDA 3NHEB 3PT2B 4HDQA 1WFYA 4ANWA 1WXAA 4NNJB 4BKSA 3QK0A 4X57B 4KZ0A 3T8MA 2KVRA 4BBNF 1OEYA 4KSKC 3DBLI 1NDDA 4I6NB 2O2VA 2MBBB 1QZEA 4IM3A 1AARA 4HPMB 4FA6A 4PYUA 1ZGUB 2K8HA 1EF1A 1ZW7A 3PRPB 1YJ1A 2HJ8A 2MBQA 3KW5B 1IPGA 2MWSB 5KHQA 2ZCBA 2REXA 1CMXB 1HE8A 1WXSA 3EECA 1OTRB 2MX2A 4HXDA 4MH0E 3QQ8B 2YLMA 2KFKB 4W9EA 5DPTA 2L3ZA 3WAOA 3A4RA 4OVUA 1OQYA 4W9HA 1LFDA 3VTWA 2DX5B 2V1YA 5D2MB 3SU8X 5CHWA 2KJ6A 2KJHB 4B9KA 2PE6B 2A5UA 4W9KA 4MGZE 3ZUNA 4GN1A 3GOEA 2MQJA 1A5RA 1E8YA 2D07B 3KUDB 3MHSD 3ONSA 3ZNGC 4DWFA 1P3QU 2KDEB 3WANA 1TZ1A 4BKTA 2KN5A 3GZNI 2MRPA 2UWQA 3VTUA 1V6EA 4MJSA 2LXAA 4BOZB 2GMIC 2ZZPB 4K1RB 4WJOA 2IYDB 5G55A 2KD0A 2KQSA 2BGFA 3IG3A 1WJNA 1X1MA 2O6VA 3HIZA 4ICUA 4GGQA 2LVQA 4G0NB 1WZ0A 3NS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9E B;  4MGY E;  4DDG D;  2NBV B;  1V9J A;  3SDL C;  3SHQ A;  4EZK A;  3N3K B;  4FBJ B;  2AEH A;  4NJ7 A;  1VD2 A;  3W1S C;  5CTR C;  3PHW B;  1JRU A;  3UIO B;  1E8W A;  2KC2 A;  2ZEQ A;  4I6P A;  1WYW B;  4WQO B;  2O6V B;  2MP2 A;  3IHP C;  3N30 A;  2RR9 A;  1LXD A;  2XK5 A;  4JL9 A;  2DHZ A;  3JSV A;  4IC7 B;  2XBB C;  1P1A A;  4ZDV A;  4JGH B;  4IG7 B;  4LDT B;  2KX0 A;  3JVZ X;  2GBK A;  2KJR A;  2BYV E;  3TCA A;  2HD5 B;  2JWZ A;  2MP2 B;  3QAR A;  2BF8 B;  2LGY A;  1KM7 A;  3VHT C;  4BFR A;  2KMA A;  2D11 A;  3ZKJ C;  2NBU A;  4JQW C;  3DVN U;  3ZVV A;  3DDC B;  2R2O A;  3H7P B;  4GIV A;  3D32 A;  3RZF A;  1I35 A;  1WI0 A;  2CU1 A;  2KDB A;  1E8Z A;  1GNU A;  5C23 A;  2IO3 B;  4GSW A;  4ANX A;  2C9W B;  3VUW A;  3ZRC A;  4HJK A;  3UF8 A;  4DHZ B;  2KTF A;  2LWP A;  1UBQ A;  3UQA A;  1G6J A;  4HK2 A;  3ZW3 A;  3QA8 A;  4FAD A;  5L95 C;  3NZS A;  4E74 A;  2PJH A;  3A1Q A;  2KXJ A;  2G3Q B;  2HTH A;  5DPW A;  5LXH A;  4IUM B;  4RM9 A;  2N1W A;  2MCN B;  2JRI B;  4ICV A;  5IA7 A;  3I3T B;  4KV2 A;  2L7R A;  4BVU C;  4TUU A;  3QX1 A;  4ANV A;  5AEK B;  2DZM A;  3LDZ E;  2LGD A;  3NZU A;  2AWT A;  3A1Q B;  2EMS A;  2EMT A;  4JIO U;  2KZR A;  4KSL C;  5L83 A;  3B08 A;  4NAW B;  3R7Q A;  2KMC A;  4G3X B;  3PRZ A;  3DBR I;  2N9P C;  3ZTC A;  1J0G A;  2WYQ A;  2J0K A;  4PS7 A;  3UIN B;  2N9X A;  2M8S A;  2GOW A;  3PV1 A;  4KIK B;  1SIF A;  1WZ3 A;  1R4M I;  4WJP A;  3L0W B;  2IY1 B;  2LVO A;  5DCN A;  4GU2 A;  4I6L B;  1WGY A;  2AL6 A;  3VTV A;  2MSE D;  3DBH I;  4URK A;  1F9J A;  2PPH A;  3DQV A;  2DYO A;  5BO4 B;  3TBL D;  4EOY A;  1M94 A;  1V80 A;  4CYE A;  1PQS A;  2J0J A;  4WJQ A;  3MTN B;  4HVB A;  1T0Y A;  2KX3 A;  3NOB A;  2MBH A;  3PRE A;  4RM8 A;  2ZPN A;  4BBN C;  4F1S A;  1SGH A;  4ZYN A;  4AJW A;  4TQ1 A;  4GOC A;  5D94 A;  3UQB A;  1YQB A;  2KWV B;  4W9G A;  5E6P A;  2DZK A;  4K7W A;  5D7G A;  2FCS A;  2IBI B;  1P0R A;  2MA9 B;  1WXV A;  5CX3 A;  5JHB A;  4KDL B;  1Y8R C;  3JSV B;  2RSU A;  2AYO B;  1UGM A;  2D3G A;  5JHA A;  1WJU A;  2CHW A;  1TBE A;  3L54 A;  2DZJ A;  3QIJ A;  4HLE A;  5CHF A;  3ML9 A;  5E6N A;  1Q5W B;  3SD5 A;  1WGG A;  2JY6 A;  2AL3 A;  3H7P A;  1XT9 B;  3APD A;  4FJV B;  4LJO B;  4IW0 A;  5JH5 C;  2IO2 B;  2I1J A;  2ZNV B;  1OGW A;  2K1F A;  4MGI E;  3R66 C;  1E90 A;  3A4S C;  4F8C B;  1R4N I;  1XQQ A;  2WWZ A;  2ZVN A;  3C0R B;  3H9D A;  3A9J B;  1Q1O A;  3VH3 B;  3VAW A;  2XEW A;  3DVG Y;  1RAX A;  4GDL B;  3VH4 B;  1BT0 A;  3AUL A;  1E5W A;  1UBI A;  3DCG A;  2M17 A;  3QJZ A;  4BKG A;  4ANU A;  4FHJ A;  3U30 A;  3ZIM A;  3ENE A;  3L13 A;  4ASW C;  2FUH B;  4KDI C;  2JVC A;  1WIA A;  2GBR A;  1H8C A;  3L10 B;  4HPL B;  3HK0 A;  3AU5 A;  1WMH B;  3A9K B;  4GDL A;  2L76 A;  3AI5 A;  3BY4 B;  1WX7 A;  3APC A;  2C7H A;  1RLF A;  2V4L A;  3V6E B;  1GUA B;  2Z0D B;  4GDK B;  4BKS D;  1C3T A;  3PRM B;  2A4Z A;  1UEL A;  2DEN B;  3PHX B;  3IFW B;  1YX5 B;  3CSF A;  2LVP A;  4KIK A;  3L08 A;  2ZCC A;  2OOB B;  5E6O A;  5GMV A;  1C1Y B;  1WGR A;  1YX6 B;  1KOT A;  2N7E A;  3NY5 A;  2ZVO A;  3X0W A;  4YL8 A;  3KH0 A;  3KYD D;  4GXB A;  2ZJD A;  4OVV A;  1WR1 A;  4A3P A;  2C5L C;  2CHX A;  2RGF A;  2KLC A;  2VRR B;  4MSM B;  4HDO A;  4ZRI A;  1ZKH A;  2M1M A;  4WJN A;  3Q3F A;  5KHO A;  2JXX A;  4PS8 A;  1WY8 A;  3RCZ A;  2KKC A;  2LD9 A;  2K6D B;  1V5O A;  1WM3 A;  4DBG A;  2FCM A;  1NBF C;  2C7M B;  2JUO A;  2N1V A;  2NVU I;  2L0T A;  3VVW B;  2FAZ A;  4M8M A;  4W9J A;  4MJS B;  2JF5 A;  4FN2 A;  1E7V A;  2CR5 A;  1K8R B;  2B3A A;  1V2Y A;  4EZL A;  4XC2 A;  4XZ4 A;  2KWC A;  3P2B A;  3CST A;  2LJ5 A;  2KFJ A;  1EO6 A;  2KLG A;  3B0A A;  3N32 A;  5LLI A;  1Z2M A;  1J19 A;  2ZPY A;  1V81 A;  5AZG A;  3V61 A;  4A3O A;  2BYE A;  3B1L X;  4NY0 A;  4AJY B;  5HKH A;  5LXI B;  4W9I A;  1TTN A;  1WJ4 A;  2MBO A;  3M3J A;  3RT3 B;  4B95 A;  2KC1 A;  3PPA A;  4K81 A;  2KO3 A;  4FJY A;  3QCA A;  3U8Z A;  3QWZ B;  3ZDT A;  2K8B A;  2L8J A;  3ML8 A;  2O6V D;  2KNB A;  2MBE A;  1MG8 A;  4AP4 C;  4KZC A;  1GG3 A;  1WE7 A;  1GJZ A;  4TKN A;  4EUT A;  2C60 A;  2N4F A;  4NAW A;  1YIW A;  3A9J A;  4HCN B;  4M0W B;  4W9L A;  3DVG X;  2BKR B;  1FXT B;  2FCQ A;  2G4D B;  3BIN A;  1I42 A;  3V6C B;  2PEA A;  2EKE C;  2HE7 A;  3KUZ A;  4W9D A;  3VDZ A;  4EFO A;  2DYB A;  4LCD E;  2KFK A;  1P98 A;  4WAA A;  2K8C A;  1IYF A;  1UZX B;  2BYF A;  2FIF A;  1YD8 U;  2Z59 B;  2ZNV C;  3DOW A;  3DBS A;  3PSE B;  4FJZ A;  4RMA A;  3ZNZ B;  4K7U A;  2RD0 A;  2RPQ A;  1TGZ B;  3TL5 A;  5G2N A;  4HWI B;  3WAP A;  4IWP A;  3QHT A;  3KVF B;  4II3 B;  1XD3 B;  5AZF A;  3UGB B;  4E71 A;  3HM6 X;  4LJP B;  4XX5 A;  4A20 A;  2K25 A;  3IBE A;  4IM2 A;  2BPS A;  3H7S A;  4DDI D;  4GDK A;  2R2Q A;  3HHM A;  5C1Z A;  4AWJ A;  2GBM A;  3APF A;  3R7R A;  4GB9 A;  1WXM A;  4CHK A;  4MEL A;  1GC7 A;  2LAS A;  2MW5 A;  3QC8 B;  3VUY A;  5J18 A;  2D10 A;  2KDF B;  1D3Z A;  1GC6 A;  2LZ6 A;  4ZRJ A;  2N7D A;  2LGX A;  1SE9 A;  3RUI B;  2DAF A;  4DK5 A;  3JYU A;  4G11 A;  3Q3J A;  3S2A A;  2OJR A;  3V60 A;  4TQ0 A;  4WWO A;  5JZE B;  4TV3 A;  3RZW C;  2Z0E B;  2WX0 A;  3A33 B;  3R3M A;  4NQL B;  2LUE A;  3AU4 A;  1S3S G;  4G50 A;  3PVL A;  4AOF A;  2NCN A;  2LRW A;  1WX8 A;  1WGH A;  2DYM A;  3PTF C;  3WA0 A;  4CO7 A;  3L17 A;  1RRB A;  4PYZ A;  3ZNH B;  2KK8 A;  3M63 B;  4MGK E;  4P7I A;  1V86 A;  1Z5S B;  5DPR A;  3WAL A;  3EHV A;  2J7Q B;  3OJ3 A;  3PLU A;  2NR2 A;  2K39 A;  2GBN A;  1UH6 A;  3K9P B;  3OLM D;  4LDT D;  3ZDM C;  2M0X A;  1P9D U;  3H1U A;  3OJ4 B;  4F7Z A;  1LM8 B;  2NS5 A;  1RFA A;  2FNJ B;  1S1Q B;  4NPN A;  3TJP A;  1E8X A;  1WF9 A;  4BOS C;  1U4A A;  3HM3 A;  1WRD B;  3K9O B;  2JZZ A;  2KHW B;  3KYC D;  4II2 B;  4PS3 A;  3M95 A;  2C7N B;  3DVN V;  4NJ6 A;  4JLC A;  2L0F A;  5FR6 A;  3WAM A;  4DHJ B;  4IWQ A;  1UD7 A;  2G4S A;  4DXA B;  2FCN A;  2GBJ A;  4IWO A;  5EDS A;  4EZJ A;  3VUX A;  3RD2 A;  1V49 A;  2NPT A;  2V3S A;  3AXC A;  4EEW A;  2DZI A;  4MDK E;  1NI2 A;  1WGD A;  2KWU B;  3TMP B;  4DHZ E;  1V5T A;  5D6J B;  1LQB A;  4W9F A;  4N9F 4;  2IY0 B;  3JW0 X;  3KUC B;  2FID A;  1Q0W B;  4EKU A;  2JT4 B;  2WX1 A;  3EFU A;  2O2V B;  3QAQ A;  3UIP B;  5CHV C;  2L05 A;  2LI5 A;  3ECI A;  2NPT B;  2LXC A;  1WR6 E;  4FUL A;  1L2N A;  4AUQ C;  2K6Q A;  2L00 B;  2KDI A;  2IZV B;  2LRU A;  2MLB A;  2IO1 B;  4MSQ B;  4KVG B;  2J0M A;  3CF6 E;  1J8C A;  5J2R A;  2DAJ A;  3RYT A;  3MJW A;  1EUV B;  3A9K A;  3PS6 A;  3X23 A;  2JRH A;  3TIX A;  2PE9 A;  3O65 B;  4WWN A;  3ALB A;  4K7S A;  1WMH A;  4NQK E;  2I1K A;  3ZNI D;  1H4R A;  3W1Y A;  4HCP B;  1WX9 A;  3W1S A;  4DHJ D;  2JZ3 B;  3WIM A;  2W9N A;  4FHK A;  2KOX A;  3ZO5 B;  2CKH B;  2G45 B;  3T9L A;  2BWE S;  5AZH A;  5IAA C;  2JPH A;  1VCB A;  1E7U A;  1ISN A;  2YVC A;  1WH3 A;  1IP9 A;  3IVF A;  2D2Q A;  2UYZ B;  3PGE A;  2KQ7 A;  1L7Y A;  4MM3 A;  2M4N A;  5J17 A;  4M8N A;  4IM0 A;  5TR5 A;  4FLH A;  4MEM A;  3V62 A;  4ZRK A;  2QHO A;  2BWF A;  2KAN A;  3ZLZ A;  3ZRF A;  1KLV A;  2WDT B;  4GMV A;  4W9C A;  3CMM B;  3LJ3 A;  2KTR A;  2ASQ A;  2CHZ A;  3L16 A;  3PLV A;  2BKF A;  3M62 B;  1WJ6 A;  4WWP A;  3VFK A;  4J6I A;  2XK5 B;  1WE6 A;  1EF5 A;  3DPD A;  2CS4 A;  3H6N A;  4E3C A;  3OAW A;  2NBW B;  3RUL A;  1WM2 A;  4B6W A;  2IO0 B;  2KTR B;  3VXW A;  1OEY J;  3U7D A;  5DPS A;  3PZD A;  2Y5B B;  3EC8 A;  1KJT A;  3VQI A;  3ZTD A;  3NHE B;  3PT2 B;  4HDQ A;  1WFY A;  4ANW A;  1WXA A;  4NNJ B;  4BKS A;  3QK0 A;  4X57 B;  4KZ0 A;  3T8M A;  2KVR A;  4BBN F;  1OEY A;  4KSK C;  3DBL I;  1NDD A;  4I6N B;  2O2V A;  2MBB B;  1QZE A;  4IM3 A;  1AAR A;  4HPM B;  4FA6 A;  4PYU A;  1ZGU B;  2K8H A;  1EF1 A;  1ZW7 A;  3PRP B;  1YJ1 A;  2HJ8 A;  2MBQ A;  3KW5 B;  1IPG A;  2MWS B;  5KHQ A;  2ZCB A;  2REX A;  1CMX B;  1HE8 A;  1WXS A;  3EEC A;  1OTR B;  2MX2 A;  4HXD A;  4MH0 E;  3QQ8 B;  2YLM A;  2KFK B;  4W9E A;  5DPT A;  2L3Z A;  3WAO A;  3A4R A;  4OVU A;  1OQY A;  4W9H A;  1LFD A;  3VTW A;  2DX5 B;  2V1Y A;  5D2M B;  3SU8 X;  5CHW A;  2KJ6 A;  2KJH B;  4B9K A;  2PE6 B;  2A5U A;  4W9K A;  4MGZ E;  3ZUN A;  4GN1 A;  3GOE A;  2MQJ A;  1A5R A;  1E8Y A;  2D07 B;  3KUD B;  3MHS D;  3ONS A;  3ZNG C;  4DWF A;  1P3Q U;  2KDE B;  3WAN A;  1TZ1 A;  4BKT A;  2KN5 A;  3GZN I;  2MRP A;  2UWQ A;  3VTU A;  1V6E A;  4MJS A;  2LXA A;  4BOZ B;  2GMI C;  2ZZP B;  4K1R B;  4WJO A;  2IYD B;  5G55 A;  2KD0 A;  2KQS A;  2BGF A;  3IG3 A;  1WJN A;  1X1M A;  2O6V A;  3HIZ A;  4ICU A;  4GGQ A;  2LVQ A;  4G0N B;  1WZ0 A;  3NS8 A; 
#chains in the Genus database with same CATH topology
 1I4R A;  2MJD A;  3SDL C;  1ZXH A;  4EZK A;  3N3K B;  3NS1 A;  4FBJ B;  4NJ7 A;  1VD2 A;  3W1S C;  1JRU A;  4WQO B;  2O6V B;  3IHP C;  1YJI A;  4C4V B;  2DHZ A;  3JSV A;  5IOI A;  2Q5W D;  1EU3 A;  2LGS A;  3JVZ X;  2GBK A;  1C79 A;  3I57 A;  3AM9 A;  2JWZ A;  4C56 C;  3QAR A;  2KMA A;  4RGT A;  3R8B A;  1I35 A;  4ACF A;  2R2O A;  3Q3N C;  1GNU A;  2AQ1 B;  5C23 A;  4ANX A;  3VUW A;  2BT6 A;  3UQA A;  4UDU C;  5IKC M;  1G6J A;  4JPS A;  3NZS A;  3A1Q A;  2KXJ A;  2G3Q B;  2H88 B;  4AS1 A;  4RM9 A;  2JRI B;  1ZXI A;  1T6B X;  5IA7 A;  2BQQ A;  4BVU C;  3QX1 A;  2WU5 B;  3OG5 A;  3LDZ E;  4D2K A;  1N5X A;  3NZU A;  3A1Q B;  3LB8 C;  5L83 A;  2KZR A;  2N9P C;  2WYQ A;  2N9X A;  2M8S A;  4DXF A;  1PGA A;  1R4N B;  5EE1 A;  2WU2 B;  3PV1 A;  1WZ3 A;  2XN9 C;  1AWD A;  4GU2 A;  2VH1 A;  1F9J A;  4EOY A;  1N5W A;  4CYE A;  1PQS A;  3N1Y C;  4HVB A;  4RM8 A;  1SGH A;  5BMH A;  4ZYN A;  4OW0 A;  1YQB A;  4W9G A;  5E6P A;  5D7G A;  1P0R A;  2MA9 B;  3T3O A;  1IGD A;  1FM0 D;  1C78 A;  3P4S B;  5JHA A;  2QDF A;  3QIJ A;  4HLE A;  4J3O D;  3SD5 A;  1WGG A;  2JY6 A;  3H7P A;  1XT9 B;  3UI3 A;  5JH5 C;  4MH8 A;  1E90 A;  3A4S C;  3FKY A;  1XQQ A;  2GRI A;  2D3B A;  2ZVN A;  3A9J B;  1I4H A;  4M0W A;  2PMV A;  2XEW A;  1RAX A;  1XO3 A;  1BT0 A;  4IOI E;  3VRB B;  1E5W A;  1UBI A;  3MC8 A;  4ANU A;  1N60 A;  3ZIM A;  3ZJU A;  3ZQ4 A;  2KDM A;  1D4B A;  3NZ3 A;  3AU5 A;  2L76 A;  3BY4 B;  1KF6 B;  3APC A;  3W5U B;  3V6E B;  1GUA B;  3PRM B;  2NTT A;  1UEL A;  2DEN B;  3PHX B;  2LVP A;  4KIK A;  5E6O A;  5FK9 C;  2QIE B;  1SE4 A;  2ZJD A;  4QAY A;  1E9M A;  1K51 A;  1JWB D;  1QQR A;  3U4E G;  4ZRI A;  2M1M A;  5KHO A;  1B9R A;  2JXX A;  3AEF B;  4PS8 A;  2N9K A;  1C4A A;  1SJH D;  1K52 A;  2JF5 A;  2DLB A;  1E7V A;  2CR5 A;  2B3A A;  1T0R C;  4XC2 A;  4EZL A;  5FR3 A;  1QLB B;  1V81 A;  2JXT A;  4WQM A;  5AZG A;  2BYE A;  3B1L X;  4AJY B;  5LXI B;  1UGJ A;  4C7Y A;  3EGR A;  3PPA A;  1PDX A;  5H92 C;  4GLS C;  2KNB A;  1TS4 A;  2NTS A;  4B0E A;  2WXO A;  1TT5 B;  1SBB B;  2N4F A;  1WWT A;  3DVG X;  1FXT B;  5GXG B;  2G4D B;  3V6C B;  3KUZ A;  1VLB A;  2DYB A;  1IYF A;  2I2Y A;  4WAA A;  2BYF A;  2FIF A;  4RF0 A;  4FJZ A;  3ZNZ B;  2RPQ A;  3WAP A;  4IWP A;  3QHT A;  3HM6 X;  4RGN A;  4DDI D;  1FPY A;  3HHM A;  5C1Z A;  3APF A;  3P63 A;  4WWM A;  2AQ2 B;  2LAS A;  3VUY A;  1FCC C;  2KDF B;  1GC6 A;  2LZ6 A;  4ZRJ A;  3RUI B;  3ZJT A;  2BTE A;  3JYU A;  4TQ0 A;  4L23 A;  4WWO A;  5JZE B;  5BYS A;  3V3X A;  2Z0E B;  2M56 B;  2WX0 A;  3R3M A;  1ESF A;  1ROE A;  1YNT E;  2OED A;  4G50 A;  3PVL A;  4AOF A;  5LNK 1;  3WA0 A;  1RFK A;  2KK8 A;  1XEE A;  1L6V A;  1Z5S B;  2DWQ A;  2LHE A;  1QKZ A;  3WAL A;  3PLU A;  1C4C A;  4YWG G;  1P9D U;  2NS5 A;  1UF0 A;  2FNJ B;  3R2I A;  2K22 A;  3HM3 A;  2JZZ A;  1VDV A;  3WAM A;  4DHJ B;  2L0F A;  2FCN A;  5EDS A;  2MH7 A;  3RD2 A;  1V49 A;  1F2R C;  4MDK E;  1V8C A;  3TMP B;  4DHZ E;  4KGR A;  1NI3 A;  2WXF A;  1I4G A;  3JW0 X;  1JRP A;  2QIL A;  4KGT A;  4B0M A;  3QAQ A;  5CHV C;  1J7C A;  1C76 A;  3ECI A;  3ZGZ A;  1L2N A;  4OZB A;  1CQV A;  1Q10 A;  2W54 A;  4MSQ B;  1DGJ A;  2J0M A;  2INC C;  4LNO A;  3P42 A;  3MP9 A;  3PS6 A;  1TKY A;  3BK1 A;  3ALB A;  1SIJ A;  4ZRP A;  3U2S C;  2PLP A;  1VCB A;  3TEY A;  1ISN A;  1E7U A;  4KKI A;  2E6X A;  2UYZ B;  4ARC A;  4MM3 A;  4P16 A;  1DOX A;  3VR9 B;  4MEM A;  2QHO A;  2KAN A;  4TMA B;  1KLV A;  2DNF A;  4W9C A;  2BKF A;  1UWM A;  3M62 B;  4WWP A;  4J6I A;  3GP7 A;  1BUI C;  3H6N A;  5EE3 A;  2VZK B;  3BVZ A;  3VXW A;  3RFZ B;  3IT4 B;  3PZD A;  4HDQ A;  1WFY A;  1WXA A;  3AE4 B;  1FO4 A;  4BBN F;  1FNW A;  2O2V A;  2MBB B;  4PYU A;  2HJ8 A;  3KW5 B;  1IPG A;  2MWS B;  1P7E A;  3ETR A;  1OQY A;  2W82 A;  3VTW A;  2DX5 B;  1YQ3 B;  1E10 A;  1R7S A;  2PE6 B;  1AN8 A;  1JWA D;  4MGZ E;  3GOE A;  1E8Y A;  2JWU A;  3WAN A;  1TZ1 A;  4BKT A;  1JQ4 A;  2UWQ A;  2K0P A;  2GMI C;  1MHX A;  4WJO A;  2IYD B;  5EE0 A;  1N62 A;  1WJN A;  1ET9 A;  3NVY A;  1WZ0 A;  3NS8 A;  4S0R A;  3RNE C;  1YN5 A;  1V9J A;  3DBR B;  2EKI A;  3B9J A;  5CTR C;  3PHW B;  3UIO B;  2ZEQ A;  4I6P A;  1WYW B;  3V05 A;  4IC7 B;  2Y5P A;  2XBB C;  4JX1 C;  4ZDV A;  1EWC A;  1TKG A;  1QOF A;  3HRD D;  3IAS 1;  3L4P A;  1KM7 A;  4BFR A;  1OFF A;  2NBU A;  4JQW C;  3ZVV A;  4EFO A;  3DDC B;  3CWI A;  3H7P B;  1WI0 A;  1L5P A;  2CU1 A;  2KDB A;  1E8Z A;  2IO3 B;  4AQ7 A;  3SEB A;  1I4P A;  2YEP F;  4HJK A;  1MHH E;  2LWP A;  4YTM B;  4HK2 A;  3ZW3 A;  1C4P A;  5L95 C;  2MCN B;  1ACC A;  2QCZ A;  4IDI A;  3OWE B;  2X38 A;  1QOA A;  3DHI C;  2AWT A;  2EMS A;  3Q6B A;  4NAW B;  4REZ A;  3R7Q A;  4RH6 A;  2BYT A;  3UIN B;  3DHG C;  1WXQ A;  1DOY A;  2V9H A;  4KIK B;  1SIF A;  2IY1 B;  2MEK A;  4OVZ A;  3MC9 A;  3VTV A;  1WGK A;  3N20 C;  2PPH A;  3TBL D;  1V80 A;  3SFD B;  2N7J A;  3MTN B;  1T0Y A;  3NOB A;  2MBH A;  2ZPN A;  2PVO D;  4C7Z A;  3IT6 B;  1SE2 A;  2KWV B;  1I4Q A;  2QEJ C;  2DZK A;  4K7W A;  3B2G A;  3JSV B;  2PTL A;  1TS5 A;  4P1B C;  2AYO B;  2RPV A;  2MHJ A;  3TEW A;  1WJU A;  4N6E B;  1QF6 A;  1RYJ A;  1FXI A;  3ML9 A;  3PO0 A;  1Q5W B;  1FXA A;  2AL3 A;  1IBX B;  4FJV B;  1T0S C;  3Q8E A;  1OGW A;  2FE8 A;  3R66 C;  3GE3 C;  1R4N I;  4YSX B;  1Q1O A;  2CJN A;  5IN7 A;  2WP9 B;  3QJZ A;  1F77 A;  4RNA A;  2LMC A;  3L13 A;  3E56 A;  2WHI A;  4ASW C;  2G9H D;  2SEB D;  3A9K B;  1XCQ L;  1RWS A;  2C7H A;  1R4M B;  2D3C A;  4GDK B;  4BKS D;  4A55 A;  1JML A;  1YX5 B;  3CSF A;  3L08 A;  1SF0 A;  2OOB B;  2ZCC A;  3W5V B;  2NMQ A;  1IUE A;  2HTM E;  4YL8 A;  4LLG M;  4GXB A;  2GB1 A;  2YEP B;  1D6E C;  2C5L C;  2RGF A;  1OQR A;  3Q3F A;  2L52 A;  2KKC A;  4DXG A;  3EUB 2;  4K3C A;  3AE5 B;  2FCM A;  1N61 A;  1NBF C;  3U52 E;  2N1V A;  2L0T A;  3W9C B;  1MJD A;  2DBY A;  4FN2 A;  3AEG B;  1PGX A;  4C80 A;  1K8R B;  1V2Y A;  5BMG A;  1T3Q A;  2KWC A;  2FBW B;  2WLB A;  2LJ5 A;  3CST A;  2KFJ A;  1YOV B;  1EO6 A;  3N32 A;  3WAO A;  2L83 A;  3V61 A;  1H8C A;  4USA A;  4ZYS A;  1JCK B;  4PT5 A;  2QMT A;  4B95 A;  4K81 A;  3QCA A;  3U8Z A;  3TEZ A;  3QWZ B;  2BB5 A;  2AX5 A;  2K8B A;  2L8J A;  4XGA B;  2N0S B;  2W3R A;  3ML8 A;  2MBE A;  1GG3 A;  1LO5 D;  3FC4 A;  5E6J A;  4TKN A;  2C60 A;  2D5G A;  4NAW A;  2BKR B;  2FCQ A;  1ZOY B;  1CZP A;  3VDZ A;  4W9D A;  1I7H A;  4LCD E;  2LFI A;  2ZNV C;  1N63 A;  3NJT A;  2RD0 A;  1KFY B;  4HWI B;  3KVF B;  4II3 B;  1XD3 B;  4O1N A;  4LJP B;  5MPO A;  4A90 A;  1KTK A;  4CHK A;  2MW5 A;  2WXI A;  5J18 A;  2D10 A;  1SE9 A;  2DAF A;  4G11 A;  1XLP A;  2PVG C;  4TV3 A;  3RZW C;  3A33 B;  3AU4 A;  3FAH A;  2NCN A;  2KAJ A;  2KYW A;  2R61 A;  5JXV A;  1RRB A;  4PYZ A;  3ZNH B;  1V86 A;  1XXG A;  2J7Q B;  3OJ3 A;  1IBX A;  4LDT D;  3OLM D;  2V3P A;  4F7Z A;  1LM8 B;  2WDV B;  3MC0 B;  1U4A A;  4II2 B;  2I38 A;  1FIQ A;  3DVN V;  1HEZ E;  1UD7 A;  1K50 A;  5AUK A;  1NVI D;  2NPT A;  2V3S A;  1L0Y B;  4EEW A;  2DZI A;  3AE8 B;  4N59 A;  1V5T A;  5D6J B;  4W9F A;  2RDH A;  4NJC A;  2IY0 B;  2FID A;  1Q0W B;  3IAM 1;  2WX1 A;  3EFU A;  3UIP B;  1ZUD 2;  3AE1 B;  2NPT B;  1HTO A;  2LXC A;  4FUL A;  2BS4 B;  2K6Q A;  4FXC A;  2MLB A;  1SJE D;  3CF6 E;  1FD6 A;  4RF1 A;  3TUO A;  2KWD A;  3MJW A;  1QT9 A;  3A9K A;  3TIX A;  3RNF C;  1WMH A;  3DBL B;  4HCP B;  2WXP A;  4DHJ D;  1EU4 A;  2W9N A;  3WIM A;  4ZRQ A;  4FHK A;  1NYR A;  4JE3 B;  3T9L A;  3AEA B;  5AZH A;  1WH3 A;  3I5J C;  4MT5 A;  5J17 A;  1SSN A;  2JU6 X;  5TR5 A;  2ZW0 A;  1L4Z B;  3LJ3 A;  3AB5 A;  2M0A A;  2CHZ A;  4WUR A;  2IPK D;  1WJ6 A;  2XK5 B;  2PIA A;  2AQ3 B;  1EF5 A;  2OHF A;  3GZN B;  5BYQ A;  2X8X X;  4E3C A;  1WM2 A;  1V1P A;  1T5X D;  4CQN A;  1OEY J;  2Y5B B;  3EC8 A;  3VQI A;  3NHE B;  3PT2 B;  4ZHO A;  1ZP0 B;  4BKS A;  3QK0 A;  4YSY B;  2KVR A;  1OEY A;  1NDD A;  4I6N B;  2BW2 A;  4HPM B;  1ZGU B;  1EF1 A;  2MBQ A;  5KHQ A;  4ARI A;  3TEX A;  1CMX B;  1WXS A;  1UNS A;  2EEL A;  3QQ8 B;  1E0Z A;  3EA6 A;  4W9E A;  1ZDV A;  4P1C C;  3MFG A;  4W9H A;  1LFD A;  1WSP A;  1YMH E;  3NVZ A;  3SU8 X;  3FIL A;  3Q8C A;  2IGH A;  1K53 A;  1A5R A;  2D07 B;  4DWF A;  2WXK A;  3VTU A;  1D5M C;  2INP E;  2E3T A;  2LXA A;  4LNN A;  2KQS A;  1ENF A;  2BGF A;  4WIP A;  1F0Z A;  1X1M A;  2BVC A;  4ICU A;  2LVQ A;  1SB3 C;  4KKJ A;  2M19 A;  1J7B A;  4DDG D;  2NBV B;  3SHQ A;  2AEH A;  2D3A A;  2HJ1 A;  3Q8A A;  2RR9 A;  1LXD A;  2XK5 A;  4JL9 A;  4YTP B;  1GOZ A;  3AED B;  3P1M A;  4XDC A;  4JGH B;  2KX0 A;  2KJR A;  2BYV E;  3TCA A;  2LGY A;  3ZKJ C;  3DVN U;  3RZF A;  4GSW A;  3KWL A;  4DHZ B;  1FNV A;  4FAD A;  3QA8 A;  4WAF A;  5BMI A;  2GLS A;  2PJH A;  2K3U A;  5LXH A;  1FMA D;  2N1W A;  3AE2 B;  1C9F A;  3GB1 A;  4KV2 A;  1L0V B;  4TUU A;  2LGD A;  5HI1 A;  1MFW A;  3B08 A;  2RDB C;  1YJJ A;  3PRZ A;  3DBR I;  4US9 A;  4A9A A;  3ZTC A;  1J0G A;  1B1Z A;  2J0K A;  2GI9 A;  4RFB A;  2ONQ A;  2GOW A;  1R4M I;  5HHD G;  2MSE D;  3DBH I;  4XWT A;  4URK A;  3DQV A;  5BO4 B;  2KX3 A;  4BBN C;  4F1S A;  4AJW A;  2ZW1 A;  4N58 A;  4GOC A;  5D94 A;  1FEH A;  4KX6 B;  2FCS A;  2IBI B;  1WXV A;  4KDL B;  2RSU A;  2D3G A;  1MG4 A;  3L54 A;  2DZJ A;  3SFE B;  4HRO A;  5E6N A;  1F1H A;  2FUG 1;  2WXR A;  4LJO B;  2V0G A;  2RMM A;  1TS3 A;  2IO2 B;  2I1J A;  1D5X C;  2WS3 B;  4F8C B;  2WWZ A;  4M02 A;  3VAW A;  4GDL B;  3I63 C;  4BKG A;  2M17 A;  3AH7 A;  3ENE A;  2WXL A;  1WIA A;  2GBR A;  4HPL B;  3HK0 A;  4GDL A;  3AI5 A;  1RLF A;  1TY2 A;  1C3T A;  2A4Z A;  3IFW B;  5GMV A;  1C1Y B;  1WGR A;  1YX6 B;  3B2F A;  3W2D A;  2ZVO A;  3LXF A;  3KH0 A;  1F2R I;  2VRR B;  2W55 A;  2KLC A;  4HDO A;  1TJE A;  4WJN A;  1WY8 A;  3RCZ A;  3U7Z A;  2K6D B;  3PZ7 A;  1V5O A;  1WM3 A;  3GS2 A;  2NVU I;  5T8I A;  4W9J A;  4MJS B;  1KLU D;  4C00 A;  3P2B A;  2OJW A;  2KLG A;  3B0A A;  5LLI A;  2K5P A;  1J19 A;  2ZPY A;  1XLO A;  4W9I A;  2BS3 B;  3M3J A;  2KMM A;  2KO3 A;  3ZDT A;  5FKA C;  2O6V D;  2WDR B;  5IP4 D;  1MG8 A;  2WXH A;  1GJZ A;  1YIW A;  4W9L A;  3A9J A;  4HCN B;  4M0W B;  3I9V 1;  3BIN A;  1I42 A;  2PEA A;  2EKE C;  2HE7 A;  5C3J B;  3C8Y A;  3RNC C;  1KH0 A;  2K8C A;  3DHH C;  3DBS A;  4K7U A;  3TL5 A;  1XF5 L;  1SXT A;  1ET6 A;  5AZF A;  1V97 A;  4A20 A;  2K25 A;  2BPS A;  3H7S A;  4NAM A;  2GBM A;  2JSV X;  3BVM A;  1WXM A;  3DWM A;  1HA5 A;  3BVG A;  2KAC A;  2LGX A;  3Q3J A;  2OJR A;  3Q69 A;  2JX5 A;  4S17 A;  4YT0 B;  1S3S G;  2J53 A;  2HDE A;  1AYF A;  2V4I B;  2LRW A;  2LJI A;  1SEB D;  2DYM A;  5IO9 A;  3RN9 C;  4P7I A;  4Q2J A;  3Q8B A;  3VRA B;  1GB4 A;  5DPR A;  1UUP A;  3EHV A;  1CK1 A;  2NR2 A;  5H8Y E;  3K9P B;  2JYE A;  4XDD A;  2M0X A;  3OJ4 B;  1RFA A;  1P7F A;  3P4P B;  1E8X A;  2WXM A;  3M95 A;  3WCQ A;  5FR6 A;  4IWQ A;  1WYG A;  1BML C;  2G4S A;  1ZDX A;  4DXA B;  4PK1 A;  3AE6 B;  4P6V F;  1WGD A;  2KWU B;  1LQB A;  1TYG B;  5EE9 A;  4EKU A;  4XYC A;  2JT4 B;  3P4R B;  1WR6 E;  4NZL B;  4AUQ C;  2ICI A;  2L00 B;  2KDI A;  2LRU A;  2G1E A;  3AEC B;  3HVD A;  1EUV B;  4K7S A;  3ZNI D;  3W1Y A;  3NVW A;  1WX9 A;  3W1S A;  2J42 A;  3VR8 B;  2JZ3 B;  2KOX A;  3ZO5 B;  2CKH B;  2G45 B;  5IAA C;  3RMK C;  2YVC A;  2TSS A;  3IVF A;  1NYQ A;  3PGE A;  2KQ7 A;  1L7Y A;  1TY0 A;  4M8N A;  1MPE A;  4FLH A;  4ZRK A;  3ZRF A;  2BWF A;  5HG2 A;  3ZLZ A;  3DBH B;  4GMV A;  3LYY A;  3ZXV A;  3CMM B;  1UWX A;  3NVV A;  2ASQ A;  3L16 A;  3PLV A;  1WE6 A;  3DPD A;  5BYR A;  1VR9 A;  1XLQ A;  3OAW A;  2NBW B;  3RUL A;  3U7D A;  4US8 A;  2CJO A;  4RGM A;  3N1Z C;  4HKQ A;  2VZK D;  3BYY B;  5G5H A;  1QZE A;  1AAR A;  4FA6 A;  2K8H A;  4RGO S;  2REX A;  2IDY A;  1HE8 A;  1OTR B;  2MX2 A;  3E9S A;  4HXD A;  2YLM A;  2KFK B;  2L3Z A;  1FFV A;  1EWY C;  2V1Y A;  1XCT L;  2KJ6 A;  2KJH B;  2L1A A;  4B9K A;  2A5U A;  4W9K A;  3ZUN A;  3Q2A C;  3AN1 A;  4GN1 A;  2WQY B;  4HJG E;  3Q3O C;  3KUD B;  3MHS D;  1A70 A;  4TSS A;  4ZOH C;  3GZN I;  1V6E A;  3FIL B;  4WH4 A;  4MJS A;  4BOZ B;  1I4X A;  3PZ8 A;  2ZZP B;  4K1R B;  1JWS D;  1E7P B;  2JQR B;  3IG3 A;  3N1X C;  1J7A A;  3HIZ A;  4G0N B;  2N9E B;  4MGY E;  3O13 A;  2BS2 B;  2KQ4 X;  3AMZ A;  1E8W A;  2KC2 A;  2MP2 A;  3N30 A;  1XLN A;  2CU3 A;  4HEA 1;  1P1A A;  2H89 B;  4IG7 B;  4LDT B;  1VZ8 A;  3AEB B;  1STE A;  2HD5 B;  2MP2 B;  2BF8 B;  3CIR B;  3VHT C;  2D11 A;  4L1B A;  1ZE3 D;  1QIL A;  4GIV A;  3D32 A;  3ZXR A;  1T0Q C;  3BII D;  2C9W B;  3ZRC A;  3KWV A;  3UF8 A;  2KTF A;  1UBQ A;  2PW9 A;  4M01 A;  4OHJ A;  2W3S A;  4E74 A;  2HTH A;  5DPW A;  1V1O A;  4IUM B;  1MVK A;  4ICV A;  3HUI A;  2QSD A;  2WGS A;  3I3T B;  2L7R A;  3URY A;  4ANV A;  5AEK B;  2DZM A;  4K3B A;  4KSL C;  2EMT A;  3RNA C;  4JIO U;  2WXQ A;  2KMC A;  3NG0 A;  4G3X B;  5D3D A;  4PS7 A;  2WDQ B;  4WJP A;  3L0W B;  2J52 A;  2LVO A;  5AUI A;  5DCN A;  4I6L B;  1WGY A;  2AL6 A;  3ABV B;  2DYO A;  1M94 A;  2J0J A;  4WJQ A;  2K9X A;  3PRE A;  4TQ1 A;  3UQB A;  3IXS A;  5CX3 A;  5JHB A;  1Y8R C;  1UGM A;  2CHW A;  1TBE A;  1JAL A;  3NUH B;  4BAX A;  5CHF A;  2IGG A;  3APD A;  1N6Z A;  3AE3 B;  4IW0 A;  2ZNV B;  2K1F A;  4A6Q A;  4MGI E;  2N9L A;  3RPF C;  3Q3M C;  1TS2 A;  3C0R B;  2ON8 A;  2QJL A;  3H9D A;  4EE2 A;  3VH3 B;  3DVG Y;  3VH4 B;  3AUL A;  1YN4 A;  3DCG A;  4FHJ A;  1FRD A;  1RM6 C;  3U30 A;  4BZA A;  2FUH B;  3EFC A;  4KDI C;  2JVC A;  4M00 A;  3L10 B;  1WMH B;  3BYT B;  1WX7 A;  2V4L A;  3BK2 A;  3DWG C;  2Z0D B;  4YSZ B;  3NRZ A;  2Y3A A;  1PYW D;  2XNA C;  1D5Z C;  3ZYY X;  1KOT A;  2N7E A;  3NY5 A;  1GAQ B;  3X0W A;  3KYD D;  2BBC A;  4OVV A;  1WR1 A;  4A3P A;  2CHX A;  4MSM B;  1ZKH A;  4LK0 M;  3HVZ A;  2LD9 A;  2WXN A;  4DBG A;  2C7M B;  2JUO A;  4XE0 A;  1FCL A;  3VVW B;  2FAZ A;  4M8M A;  1LGR A;  4XZ4 A;  3ZJV A;  5TSS A;  1WRI A;  1Z2M A;  5HKH A;  1CJE A;  4A3O A;  4NY0 A;  4XWW A;  1JW9 D;  1TTN A;  1WJ4 A;  2LEK A;  2MBO A;  3RT3 B;  2KC1 A;  1PUT A;  5G5G A;  4FJY A;  3AV8 A;  4HPP A;  1OQQ A;  1JWU D;  4AP4 C;  4KZC A;  1WE7 A;  1F52 A;  4EUT A;  1IGC A;  4LTU A;  4RCO A;  3R2T A;  5D3I B;  2LUM A;  4A8X C;  1BXT A;  2Y5C A;  2KFK A;  1P98 A;  1UZX B;  2Z59 B;  1YD8 U;  3DOW A;  5I4D A;  3PSE B;  4RMA A;  1TGZ B;  1VRA B;  2UU7 A;  5G2N A;  1L6U A;  3UGB B;  1Y56 A;  4E71 A;  1PGB A;  4XX5 A;  3IBE A;  1L0X B;  4IM2 A;  1ZPS A;  4GDK A;  2R2Q A;  1E6E B;  2RDG A;  4AWJ A;  4LNK A;  1C77 A;  3R7R A;  4GB9 A;  4MEL A;  1GC7 A;  3QC8 B;  2BB6 A;  3SR6 A;  3KQ4 A;  2V3N A;  1D3Z A;  2N7D A;  4DK5 A;  3S2A A;  3V60 A;  4JWS C;  4NQL B;  2LUE A;  2WXJ A;  4HRS A;  4OZC A;  1WX8 A;  1WGH A;  3PTF C;  4CO7 A;  1KLG D;  3L17 A;  2SAK A;  4MGK E;  3M63 B;  2LHD A;  4JWU C;  2K39 A;  2GBN A;  1UH6 A;  3ZDM C;  3H1U A;  1S1Q B;  4NPN A;  1FFU A;  3KLS X;  3TJP A;  1WF9 A;  2WXG A;  4BOS C;  1WRD B;  3K9O B;  3KYC D;  2KHW B;  4PS3 A;  2C7N B;  1TIF A;  4DQO C;  4NJ6 A;  4ITK A;  4JLC A;  3AEE B;  4OZA A;  2GBJ A;  4IWO A;  1NEN B;  1TZO A;  2B76 B;  4EZJ A;  3VUX A;  1V1P B;  3AXC A;  1PFD A;  1NI2 A;  2IGD A;  1VZ7 A;  4IKG A;  2JYT A;  2JZP A;  1HZ5 A;  4H2A A;  4N9F 4;  2WNM A;  3BWU D;  3KUC B;  1YN3 A;  3RI7 C;  2O2V B;  2J4X A;  1FRR A;  1DYQ A;  2L05 A;  2LI5 A;  3P4Q B;  4HKZ E;  2IZV B;  2IO1 B;  4KVG B;  1SE3 A;  4LNF A;  1J8C A;  5J2R A;  3J9C A;  2DAJ A;  3RYT A;  1GB1 A;  1YQ4 B;  4LNI A;  2INN E;  3X23 A;  2JRH A;  2PE9 A;  3O65 B;  4WWN A;  4NQK E;  2I1K A;  1H4R A;  2KN4 A;  1HQR D;  1HZ6 A;  3N9Y C;  1L4D B;  4L2Y A;  2QC8 A;  3TSS A;  3RNB C;  2BWE S;  2JPH A;  1GPX A;  1IP9 A;  4YTN B;  2D2Q A;  2M4N A;  3AE7 B;  4ZHP A;  1QOG A;  4IM0 A;  1M4V A;  3V62 A;  1JWM D;  1TKE A;  2L32 A;  2WDT B;  3Q14 C;  2KTR A;  1HXY D;  2MJE A;  1FNU A;  3GE8 C;  3VFK A;  5HFY A;  4C4V A;  1VJK A;  2LGI A;  1AW7 A;  2CS4 A;  1MI0 A;  1KRH A;  4B6W A;  2IO0 B;  3RNG C;  2KTR B;  5DPS A;  1KJT A;  3ZTD A;  1VZ6 A;  3H8H A;  4ANW A;  4NNJ B;  1JRO A;  3MHZ A;  2KT7 A;  4X57 B;  4KGS A;  4KZ0 A;  3T8M A;  4KSK C;  3DBL I;  4YXD B;  2KVZ A;  4IM3 A;  4MAC A;  2VH2 A;  1ZW7 A;  2IJ0 A;  1YJ1 A;  3BZD B;  3PRP B;  2ZCB A;  1NEK B;  3EEC A;  4MH0 E;  1QOB A;  5DPT A;  5C2T B;  3A4R A;  4OVU A;  2Z8L A;  5D2M B;  5CHW A;  2IND C;  2MJ3 A;  2ACZ B;  3C19 A;  1DOI A;  2MQJ A;  3ONS A;  3ZNG C;  1EM7 A;  1HTQ A;  3MJ5 A;  1P3Q U;  2KDE B;  2KN5 A;  2MRP A;  2PKO A;  3AE9 B;  3Q8F A;  5G55 A;  4MM3 B;  2KD0 A;  4R3D A;  3T3N A;  2O6V A;  4GGQ A; 
#chains in the Genus database with same CATH homology
 2N9E B;  4MGY E;  4DDG D;  2NBV B;  1V9J A;  3SDL C;  3SHQ A;  4EZK A;  3N3K B;  4FBJ B;  2AEH A;  4NJ7 A;  1VD2 A;  3W1S C;  5CTR C;  3PHW B;  1JRU A;  3UIO B;  1E8W A;  2KC2 A;  2ZEQ A;  4I6P A;  1WYW B;  4WQO B;  2O6V B;  2MP2 A;  3IHP C;  3N30 A;  2RR9 A;  1LXD A;  2XK5 A;  4JL9 A;  2DHZ A;  3JSV A;  4IC7 B;  2XBB C;  1P1A A;  4ZDV A;  4JGH B;  4IG7 B;  4LDT B;  2KX0 A;  3JVZ X;  2GBK A;  2KJR A;  2BYV E;  3TCA A;  2HD5 B;  2JWZ A;  2MP2 B;  3QAR A;  2BF8 B;  2LGY A;  1KM7 A;  3VHT C;  4BFR A;  2KMA A;  2D11 A;  3ZKJ C;  2NBU A;  4JQW C;  3DVN U;  3ZVV A;  3DDC B;  2R2O A;  3H7P B;  4GIV A;  3D32 A;  3RZF A;  1I35 A;  1WI0 A;  2CU1 A;  2KDB A;  1E8Z A;  1GNU A;  5C23 A;  2IO3 B;  4GSW A;  4ANX A;  2C9W B;  3VUW A;  3ZRC A;  4HJK A;  3UF8 A;  4DHZ B;  2KTF A;  2LWP A;  1UBQ A;  3UQA A;  1G6J A;  4HK2 A;  3ZW3 A;  3QA8 A;  4FAD A;  5L95 C;  3NZS A;  4E74 A;  2PJH A;  3A1Q A;  2KXJ A;  2G3Q B;  2HTH A;  5DPW A;  5LXH A;  4IUM B;  4RM9 A;  2N1W A;  2MCN B;  2JRI B;  4ICV A;  5IA7 A;  3I3T B;  4KV2 A;  2L7R A;  4BVU C;  4TUU A;  3QX1 A;  4ANV A;  5AEK B;  2DZM A;  3LDZ E;  2LGD A;  3NZU A;  2AWT A;  3A1Q B;  2EMS A;  2EMT A;  4JIO U;  2KZR A;  4KSL C;  5L83 A;  3B08 A;  4NAW B;  3R7Q A;  2KMC A;  4G3X B;  3PRZ A;  3DBR I;  2N9P C;  3ZTC A;  1J0G A;  2WYQ A;  2J0K A;  4PS7 A;  3UIN B;  2N9X A;  2M8S A;  2GOW A;  3PV1 A;  4KIK B;  1SIF A;  1WZ3 A;  1R4M I;  4WJP A;  3L0W B;  2IY1 B;  2LVO A;  5DCN A;  4GU2 A;  4I6L B;  1WGY A;  2AL6 A;  3VTV A;  2MSE D;  3DBH I;  4URK A;  1F9J A;  2PPH A;  3DQV A;  2DYO A;  5BO4 B;  3TBL D;  4EOY A;  1M94 A;  1V80 A;  4CYE A;  1PQS A;  2J0J A;  4WJQ A;  3MTN B;  4HVB A;  1T0Y A;  2KX3 A;  3NOB A;  2MBH A;  3PRE A;  4RM8 A;  2ZPN A;  4BBN C;  4F1S A;  1SGH A;  4ZYN A;  4AJW A;  4TQ1 A;  4GOC A;  5D94 A;  3UQB A;  1YQB A;  2KWV B;  4W9G A;  5E6P A;  2DZK A;  4K7W A;  5D7G A;  2FCS A;  2IBI B;  1P0R A;  2MA9 B;  1WXV A;  5CX3 A;  5JHB A;  4KDL B;  1Y8R C;  3JSV B;  2RSU A;  2AYO B;  1UGM A;  2D3G A;  5JHA A;  1WJU A;  2CHW A;  1TBE A;  3L54 A;  2DZJ A;  3QIJ A;  4HLE A;  5CHF A;  3ML9 A;  5E6N A;  1Q5W B;  3SD5 A;  1WGG A;  2JY6 A;  2AL3 A;  3H7P A;  1XT9 B;  3APD A;  4FJV B;  4LJO B;  4IW0 A;  5JH5 C;  2IO2 B;  2I1J A;  2ZNV B;  1OGW A;  2K1F A;  4MGI E;  3R66 C;  1E90 A;  3A4S C;  4F8C B;  1R4N I;  1XQQ A;  2WWZ A;  2ZVN A;  3C0R B;  3H9D A;  3A9J B;  1Q1O A;  3VH3 B;  3VAW A;  2XEW A;  3DVG Y;  1RAX A;  4GDL B;  3VH4 B;  1BT0 A;  3AUL A;  1E5W A;  1UBI A;  3DCG A;  2M17 A;  3QJZ A;  4BKG A;  4ANU A;  4FHJ A;  3U30 A;  3ZIM A;  3ENE A;  3L13 A;  4ASW C;  2FUH B;  4KDI C;  2JVC A;  1WIA A;  2GBR A;  1H8C A;  3L10 B;  4HPL B;  3HK0 A;  3AU5 A;  1WMH B;  3A9K B;  4GDL A;  2L76 A;  3AI5 A;  3BY4 B;  1WX7 A;  3APC A;  2C7H A;  1RLF A;  2V4L A;  3V6E B;  1GUA B;  2Z0D B;  4GDK B;  4BKS D;  1C3T A;  3PRM B;  2A4Z A;  1UEL A;  2DEN B;  3PHX B;  3IFW B;  1YX5 B;  3CSF A;  2LVP A;  4KIK A;  3L08 A;  2ZCC A;  2OOB B;  5E6O A;  5GMV A;  1C1Y B;  1WGR A;  1YX6 B;  1KOT A;  2N7E A;  3NY5 A;  2ZVO A;  3X0W A;  4YL8 A;  3KH0 A;  3KYD D;  4GXB A;  2ZJD A;  4OVV A;  1WR1 A;  4A3P A;  2C5L C;  2CHX A;  2RGF A;  2KLC A;  2VRR B;  4MSM B;  4HDO A;  4ZRI A;  1ZKH A;  2M1M A;  4WJN A;  3Q3F A;  5KHO A;  2JXX A;  4PS8 A;  1WY8 A;  3RCZ A;  2KKC A;  2LD9 A;  2K6D B;  1V5O A;  1WM3 A;  4DBG A;  2FCM A;  1NBF C;  2C7M B;  2JUO A;  2N1V A;  2NVU I;  2L0T A;  3VVW B;  2FAZ A;  4M8M A;  4W9J A;  4MJS B;  2JF5 A;  4FN2 A;  1E7V A;  2CR5 A;  1K8R B;  2B3A A;  1V2Y A;  4EZL A;  4XC2 A;  4XZ4 A;  2KWC A;  3P2B A;  3CST A;  2LJ5 A;  2KFJ A;  1EO6 A;  2KLG A;  3B0A A;  3N32 A;  5LLI A;  1Z2M A;  1J19 A;  2ZPY A;  1V81 A;  5AZG A;  3V61 A;  4A3O A;  2BYE A;  3B1L X;  4NY0 A;  4AJY B;  5HKH A;  5LXI B;  4W9I A;  1TTN A;  1WJ4 A;  2MBO A;  3M3J A;  3RT3 B;  4B95 A;  2KC1 A;  3PPA A;  4K81 A;  2KO3 A;  4FJY A;  3QCA A;  3U8Z A;  3QWZ B;  3ZDT A;  2K8B A;  2L8J A;  3ML8 A;  2O6V D;  2KNB A;  2MBE A;  1MG8 A;  4AP4 C;  4KZC A;  1GG3 A;  1WE7 A;  1GJZ A;  4TKN A;  4EUT A;  2C60 A;  2N4F A;  4NAW A;  1YIW A;  3A9J A;  4HCN B;  4M0W B;  4W9L A;  3DVG X;  2BKR B;  1FXT B;  2FCQ A;  2G4D B;  3BIN A;  1I42 A;  3V6C B;  2PEA A;  2EKE C;  2HE7 A;  3KUZ A;  4W9D A;  3VDZ A;  4EFO A;  2DYB A;  4LCD E;  2KFK A;  1P98 A;  4WAA A;  2K8C A;  1IYF A;  1UZX B;  2BYF A;  2FIF A;  1YD8 U;  2Z59 B;  2ZNV C;  3DOW A;  3DBS A;  3PSE B;  4FJZ A;  4RMA A;  3ZNZ B;  4K7U A;  2RD0 A;  2RPQ A;  1TGZ B;  3TL5 A;  5G2N A;  4HWI B;  3WAP A;  4IWP A;  3QHT A;  3KVF B;  4II3 B;  1XD3 B;  5AZF A;  3UGB B;  4E71 A;  3HM6 X;  4LJP B;  4XX5 A;  4A20 A;  2K25 A;  3IBE A;  4IM2 A;  2BPS A;  3H7S A;  4DDI D;  4GDK A;  2R2Q A;  3HHM A;  5C1Z A;  4AWJ A;  2GBM A;  3APF A;  3R7R A;  4GB9 A;  1WXM A;  4CHK A;  4MEL A;  1GC7 A;  2LAS A;  2MW5 A;  3QC8 B;  3VUY A;  5J18 A;  2D10 A;  2KDF B;  1D3Z A;  1GC6 A;  2LZ6 A;  4ZRJ A;  2N7D A;  2LGX A;  1SE9 A;  3RUI B;  2DAF A;  4DK5 A;  3JYU A;  4G11 A;  3Q3J A;  3S2A A;  2OJR A;  3V60 A;  4TQ0 A;  4WWO A;  5JZE B;  4TV3 A;  3RZW C;  2Z0E B;  2WX0 A;  3A33 B;  3R3M A;  4NQL B;  2LUE A;  3AU4 A;  1S3S G;  4G50 A;  3PVL A;  4AOF A;  2NCN A;  2LRW A;  1WX8 A;  1WGH A;  2DYM A;  3PTF C;  3WA0 A;  4CO7 A;  3L17 A;  1RRB A;  4PYZ A;  3ZNH B;  2KK8 A;  3M63 B;  4MGK E;  4P7I A;  1V86 A;  1Z5S B;  5DPR A;  3WAL A;  3EHV A;  2J7Q B;  3OJ3 A;  3PLU A;  2NR2 A;  2K39 A;  2GBN A;  1UH6 A;  3K9P B;  3OLM D;  4LDT D;  3ZDM C;  2M0X A;  1P9D U;  3H1U A;  3OJ4 B;  4F7Z A;  1LM8 B;  2NS5 A;  1RFA A;  2FNJ B;  1S1Q B;  4NPN A;  3TJP A;  1E8X A;  1WF9 A;  4BOS C;  1U4A A;  3HM3 A;  1WRD B;  3K9O B;  2JZZ A;  2KHW B;  3KYC D;  4II2 B;  4PS3 A;  3M95 A;  2C7N B;  3DVN V;  4NJ6 A;  4JLC A;  2L0F A;  5FR6 A;  3WAM A;  4DHJ B;  4IWQ A;  1UD7 A;  2G4S A;  4DXA B;  2FCN A;  2GBJ A;  4IWO A;  5EDS A;  4EZJ A;  3VUX A;  3RD2 A;  1V49 A;  2NPT A;  2V3S A;  3AXC A;  4EEW A;  2DZI A;  4MDK E;  1NI2 A;  1WGD A;  2KWU B;  3TMP B;  4DHZ E;  1V5T A;  5D6J B;  1LQB A;  4W9F A;  4N9F 4;  2IY0 B;  3JW0 X;  3KUC B;  2FID A;  1Q0W B;  4EKU A;  2JT4 B;  2WX1 A;  3EFU A;  2O2V B;  3QAQ A;  3UIP B;  5CHV C;  2L05 A;  2LI5 A;  3ECI A;  2NPT B;  2LXC A;  1WR6 E;  4FUL A;  1L2N A;  4AUQ C;  2K6Q A;  2L00 B;  2KDI A;  2IZV B;  2LRU A;  2MLB A;  2IO1 B;  4MSQ B;  4KVG B;  2J0M A;  3CF6 E;  1J8C A;  5J2R A;  2DAJ A;  3RYT A;  3MJW A;  1EUV B;  3A9K A;  3PS6 A;  3X23 A;  2JRH A;  3TIX A;  2PE9 A;  3O65 B;  4WWN A;  3ALB A;  4K7S A;  1WMH A;  4NQK E;  2I1K A;  3ZNI D;  1H4R A;  3W1Y A;  4HCP B;  1WX9 A;  3W1S A;  4DHJ D;  2JZ3 B;  3WIM A;  2W9N A;  4FHK A;  2KOX A;  3ZO5 B;  2CKH B;  2G45 B;  3T9L A;  2BWE S;  5AZH A;  5IAA C;  2JPH A;  1VCB A;  1E7U A;  1ISN A;  2YVC A;  1WH3 A;  1IP9 A;  3IVF A;  2D2Q A;  2UYZ B;  3PGE A;  2KQ7 A;  1L7Y A;  4MM3 A;  2M4N A;  5J17 A;  4M8N A;  4IM0 A;  5TR5 A;  4FLH A;  4MEM A;  3V62 A;  4ZRK A;  2QHO A;  2BWF A;  2KAN A;  3ZLZ A;  3ZRF A;  1KLV A;  2WDT B;  4GMV A;  4W9C A;  3CMM B;  3LJ3 A;  2KTR A;  2ASQ A;  2CHZ A;  3L16 A;  3PLV A;  2BKF A;  3M62 B;  1WJ6 A;  4WWP A;  3VFK A;  4J6I A;  2XK5 B;  1WE6 A;  1EF5 A;  3DPD A;  2CS4 A;  3H6N A;  4E3C A;  3OAW A;  2NBW B;  3RUL A;  1WM2 A;  4B6W A;  2IO0 B;  2KTR B;  3VXW A;  1OEY J;  3U7D A;  5DPS A;  3PZD A;  2Y5B B;  3EC8 A;  1KJT A;  3VQI A;  3ZTD A;  3NHE B;  3PT2 B;  4HDQ A;  1WFY A;  4ANW A;  1WXA A;  4NNJ B;  4BKS A;  3QK0 A;  4X57 B;  4KZ0 A;  3T8M A;  2KVR A;  4BBN F;  1OEY A;  4KSK C;  3DBL I;  1NDD A;  4I6N B;  2O2V A;  2MBB B;  1QZE A;  4IM3 A;  1AAR A;  4HPM B;  4FA6 A;  4PYU A;  1ZGU B;  2K8H A;  1EF1 A;  1ZW7 A;  3PRP B;  1YJ1 A;  2HJ8 A;  2MBQ A;  3KW5 B;  1IPG A;  2MWS B;  5KHQ A;  2ZCB A;  2REX A;  1CMX B;  1HE8 A;  1WXS A;  3EEC A;  1OTR B;  2MX2 A;  4HXD A;  4MH0 E;  3QQ8 B;  2YLM A;  2KFK B;  4W9E A;  5DPT A;  2L3Z A;  3WAO A;  3A4R A;  4OVU A;  1OQY A;  4W9H A;  1LFD A;  3VTW A;  2DX5 B;  2V1Y A;  5D2M B;  3SU8 X;  5CHW A;  2KJ6 A;  2KJH B;  4B9K A;  2PE6 B;  2A5U A;  4W9K A;  4MGZ E;  3ZUN A;  4GN1 A;  3GOE A;  2MQJ A;  1A5R A;  1E8Y A;  2D07 B;  3KUD B;  3MHS D;  3ONS A;  3ZNG C;  4DWF A;  1P3Q U;  2KDE B;  3WAN A;  1TZ1 A;  4BKT A;  2KN5 A;  3GZN I;  2MRP A;  2UWQ A;  3VTU A;  1V6E A;  4MJS A;  2LXA A;  4BOZ B;  2GMI C;  2ZZP B;  4K1R B;  4WJO A;  2IYD B;  5G55 A;  2KD0 A;  2KQS A;  2BGF A;  3IG3 A;  1WJN A;  1X1M A;  2O6V A;  3HIZ A;  4ICU A;  4GGQ A;  2LVQ A;  4G0N B;  1WZ0 A;  3NS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...