5AZFA

Crystal structure of lgg-1 complexed with a weel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lgg-1
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 40
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azfA00
4J6IA 2KDIA 3ZVVA 4ICVA 3ZNZB 1L2NA 3H9DA 3MJWA 1E8WA 2BGFA 1WI0A 2LXCA 4IG7B 3AU4A 2K25A 4KSLC 4E3CA 3I3TB 2JF5A 3VTVA 4URKA 3R3MA 3VQIA 3PLVA 2EMTA 4PS3A 2PEAA 3C0RB 4TV3A 3N30A 5LXIB 4F8CB 4E71A 2DX5B 3CSFA 2MRPA 3MTNB 3VVWB 1P1AA 4WAAA 1MG8A 5AZFA 3L54A 2KMAA 2KC1A 2WX0A 4II3B 2LXAA 3UQAA 3TBLD 3DVGX 2I1JA 2KKCA 4YL8A 1OTRB 5E6OA 4A20A 4MGYE 1WX9A 2I1KA 3M62B 2UWQA 2AYOB 4ANUA 5E6PA 1ZW7A 4HPMB 2LVPA 2Z0DB 1KOTA 3K9OB 4HPLB 3QK0A 4LCDE 4KZCA 3WIMA 4IUMB 4DDID 2PJHA 3R66C 2IO1B 2WYQA 4BBNF 3ZO5B 1KLVA 3RZWC 2KHWB 2KQ7A 2NPTA 2AEHA 3SDLC 2C7NB 1WR1A 2M1MA 1GJZA 4FJZA 3VAWA 4NY0A 3M95A 3GOEA 3JYUA 1WJ6A 3CSTA 4ZRJA 1TZ1A 1RLFA 2BWES 2OJRA 3PPAA 2D10A 4GDLB 2KLCA 2JRHA 3TL5A 1Q1OA 3VUXA 4DBGA 4NQKE 1I35A 3B08A 3L17A 2XEWA 2FUHB 2M4NA 2LGDA 3RCZA 4DK5A 3ONSA 3PRMB 2ZCCA 2WWZA 2NS5A 1WX7A 2ASQA 1SGHA 2HTHA 4GDLA 4IM0A 4FJYA 5GMVA 4MGKE 3HK0A 1IPGA 4GN1A 4EOYA 1V49A 4EKUA 2ZVNA 5BO4B 3IFWB 3PGEA 2FCQA 2L00B 2JZZA 1CMXB 1E8ZA 2ZPNA 2BPSA 4K7UA 2RPQA 4XZ4A 1P3QU 1S1QB 3V60A 2BYEA 2KJ6A 4A3PA 2D11A 5G2NA 1E7VA 1Q5WB 3VXWA 1X1MA 2J0KA 5AEKB 3QC8B 4CHKA 1YX6B 3Q3JA 2DZMA 3QIJA 4E74A 2ZNVC 3L08A 3ML9A 2CKHB 2DAFA 3KW5B 3QJZA 2A4ZA 2IO3B 3V61A 2YLMA 4DHJB 3P2BA 2CS4A 1WFYA 4MM3A 2DAJA 3VTWA 1NI2A 3QCAA 3V62A 1WGGA 1TTNA 2AL6A 3JSVA 4K7SA 3T9LA 4K81A 4DXAB 4W9CA 4MSMB 2KZRA 2KFKB 2CR5A 4KZ0A 3U8ZA 3V6CB 1A5RA 1S3SG 3O65B 2PPHA 2O6VA 3DOWA 4KDIC 4LDTB 5AZHA 1WXAA 2Z59B 3ZUNA 3TCAA 2R2OA 4P7IA 2AL3A 3ZW3A 1K8RB 3IG3A 2KFKA 4FULA 1EO6A 3DBRI 4GGQA 3PRZA 4HDOA 1IYFA 2BYFA 4W9JA 1TGZB 1V5OA 2KLGA 3UINB 2L3ZA 1XQQA 1GNUA 1BT0A 2VRRB 3OAWA 5C23A 3BINA 2GBKA 4IM2A 2MBHA 1UH6A 2N1VA 3PHWB 5DPTA 4FADA 4IM3A 1WR6E 1V5TA 2FIFA 1QZEA 4II2B 4GIVA 3PZDA 2MP2B 2C7MB 2V3SA 4G0NB 1LXDA 3QARA 4GB9A 4ZRKA 3ZNHB 3KUDB 1WE6A 1V86A 1WH3A 3NHEB 3PT2B 4MGIE 1RFAA 2KMCA 2M8SA 3W1SC 3PVLA 4K7WA 2MSED 3X23A 2MP2A 5C1ZA 2K6DB 2KVRA 4PS8A 4EEWA 1J19A 1ZGUB 2W9NA 3BY4B 3A9KB 3LDZE 3ML8A 2DYBA 4EZLA 2KANA 3AULA 2M0XA 3VTUA 3L16A 3UQBA 3ALBA 2M17A 2Y5BB 3DVNV 4WWNA 1WRDB 1H8CA 1KJTA 3A9KA 4W9DA 1E5WA 2L05A 2XBBC 4BKTA 4MDKE 5CHWA 3EFUA 2NCNA 2K8HA 2IY1B 2LRUA 5JHAA 4EFOA 1Z2MA 2KXJA 2DZKA 3A4RA 3V6EB 1V80A 3VH4B 2NPTB 3ZRFA 4BBNC 1WM3A 4M0WB 3KUZA 1YX5B 2MX2A 1P0RA 3A1QB 3OLMD 4GMVA 4WJPA 3RD2A 4BVUC 4BKSA 2LI5A 1YJ1A 4W9LA 4NNJB 4DHJD 3H7PA 4G3XB 4NJ7A 2O6VD 1WGHA 4RM9A 5AZGA 2XK5B 4KDLB 3QWZB 2LRWA 2LVOA 4W9EA 4NQLB 1YD8U 1UBIA 2A5UA 2GBMA 3A1QA 4HJKA 3ZTCA 3EECA 4KIKB 5CTRC 2GOWA 1WIAA 2D2QA 4AP4C 4DHZE 4LJPB 2NVUI 4LDTD 1SE9A 4XX5A 2XK5A 2K39A 3X0WA 4MGZE 1OGWA 3UGBB 3PV1A 4DWFA 1M94A 1V2YA 3L13A 4KIKA 4G11A 2JT4B 3A9JB 3QHTA 4FLHA 5TR5A 3MHSD 4HVBA 1UELA 2KWUB 3HHMA 1GUAB 3DBLI 2KNBA 4FBJB 3ZKJC 2BKFA 4MH0E 3VHTC 1WX8A 2WX1A 4GU2A 4HCPB 2RSUA 3AU5A 3WAMA 2JPHA 1IP9A 4KVGB 3M3JA 2JUOA 2KOXA 4WJQA 3RUIB 4I6PA 3A9JA 4F7ZA 2B3AA 4KV2A 5FR6A 4ZYNA 2J7QB 4HK2A 4I6LB 2RD0A 4AWJA 2FNJB 3JSVB 3DBSA 2L0FA 2N9XA 3A4SC 2IBIB 5CHVC 2KDEB 5G55A 2MLBA 1WXVA 1EUVB 1P9DU 2KFJA 3SD5A 3EC8A 2O6VB 2IZVB 2HD5B 4NPNA 2R2QA 5JH5C 5HKHA 2C60A 3PHXB 2D3GA 2MWSB 2L8JA 2MQJA 2JY6A 5DPRA 2L7RA 1L7YA 2KD0A 2N1WA 4FA6A 3Q3FA 4WJNA 3ECIA 2MW5A 2HE7A 3RYTA 4MEMA 3UIPB 4FJVB 3ZDMC 2K1FA 2G3QB 2JVCA 1V9JA 1SIFA 3DVNU 2O2VA 4BOSC 5J2RA 4CYEA 3RULA 4TQ0A 4BKSD 1WGDA 2K8BA 5CHFA 2KQSA 2BWFA 2BYVE 4WWPA 1RAXA 4AJWA 2L76A 1OQYA 3DQVA 1E8YA 3ENEA 1G6JA 3KVFB 4ANVA 3QA8A 2ZPYA 2MBEA 3PRPB 1WM2A 1YQBA 2REXA 4M8MA 1E8XA 2FCNA 2G4DB 2IO0B 2DYMA 2QHOA 3GZNI 2KO3A 2NBUA 2PE9A 2RGFA 2ZCBA 4EUTA 3WALA 1AARA 3APFA 1GC7A 2HJ8A 2MBBB 2OOBB 1WXSA 2JXXA 3U7DA 1KM7A 2G45B 1T0YA 2KWVB 1EF1A 1WYWB 3WA0A 2CU1A 4IWQA 1U4AA 4IWPA 2FCSA 3CMMB 1RRBA 1P98A 1PQSA 3B1LX 4RMAA 4W9GA 3WAPA 1ISNA 2KJRA 3N3KB 3OJ3A 5KHOA 2RR9A 1WJ4A 3ZTDA 1WY8A 4JQWC 3KH0A 2K6QA 3H6NA 2LGYA 1GG3A 2Z0EB 1C1YB 1WJUA 2C7HA 2KX0A 4TKNA 2N4FA 2NBWB 4WQOB 2CHZA 2CHWA 2N7EA 4G50A 4JGHB 3W1SA 2C9WB 4HLEA 2ZZPB 1WZ3A 3DDCB 1EF5A 5DCNA 2FIDA 3RT3B 2KDFB 4F1SA 3H7PB 2LZ6A 3JW0X 3HM6X 1Y8RC 4OVVA 2DYOA 3RZFA 3W1YA 3TMPB 4AJYB 1Z5SB 3KYCD 4BKGA 4ZRIA 2DENB 2J0JA 3IHPC 4JL9A 3WANA 5IAAC 3WAOA 2EMSA 4DHZB 2L0TA 4JIOU 5L83A 5J18A 1LFDA 2KN5A 3R7RA 4B9KA 2V4LA 4X57B 5DPSA 1R4NI 2IO2B 3LJ3A 1J0GA 1I42A 2D07B 2N9PC 1E90A 1J8CA 4K1RB 3ZNID 2LD9A 4RM8A 1WGYA 3UF8A 2MBOA 3A33B 1UGMA 3NOBA 3H7SA 3IBEA 3QQ8B 1WF9A 2DZJA 2ZEQA 3NZSA 2V1YA 3HIZA 5DPWA 3KYDD 4M8NA 3VUYA 3S2AA 4TUUA 1XD3B 2KJHB 3ZNGC 1WGRA 3IVFA 2GBNA 1ZKHA 2CHXA 2YVCA 3CF6E 1LQBA 3NY5A 3DBHI 3R7QA 3SHQA 3VUWA 3D32A 5JZEB 2MA9B 3VFKA 1WJNA 3NZUA 1R4MI 4MELA 4W9FA 3T8MA 1XT9B 4B95A 1V81A 2K8CA 4ASWC 3AI5A 4IC7B 2BF8B 2JZ3B 3QAQA 1F9JA 4WWOA 1FXTB 3AXCA 3APDA 5D94A 4XC2A 4IWOA 2KC2A 3APCA 2NR2A 1WZ0A 2PE6B 3DVGY 4N9F4 5L95C 3PLUA 3HM3A 2BKRB 4IW0A 2JWZA 3U30A 4B6WA 3SU8X 5LXHA 1OEYJ 2GBRA 4EZJA 3EHVA 2LVQA 3PS6A 4FN2A 4GXBA 4MJSB 4AOFA 4BFRA 1C3TA 1JRUA 2KX3A 2KWCA 4HWIB 2LUEA 2DHZA 3OJ4B 3ZRCA 2UYZB 1LM8B 5CX3A 3PSEB 4AUQC 4ANXA 3VDZA 5IA7A 1WE7A 4GOCA 4HCNB 2DZIA 2WDTB 4MJSA 4MSQB 4NAWB 2O2VB 1VD2A 2ZNVB 4CO7A 4GDKB 4LJOB 4PYUA 4A3OA 3DPDA 2MBQA 3M63B 3L0WB 3ZDTA 2IY0B 2LWPA 4W9HA 1OEYA 2J0MA 4FHKA 4NAWA 5EDSA 2EKEC 3JVZX 4BOZB 1HE8A 4GDKA 2C5LC 3L10B 1NBFC 5D6JB 4EZKA 1WMHB 3B0AA 4W9KA 5E6NA 3ZIMA 4WJOA 2G4SA 4HXDA 3VH3B 2KTFA 2ZJDA 2KK8A 4OVUA 2ZVOA 4GSWA 2LASA 2IYDB 2N9EB 4FHJA 1GC6A 3KUCB 4ANWA 5J17A 1V6EA 2LJ5A 5LLIA 1WMHA 2KTRB 2NBVB 2FAZA 1UZXB 4KSKC 3ZLZA 3TIXA 1H4RA 1TBEA 1Q0WB 4PYZA 3UIOB 4PS7A 4DDGD 5D7GA 3H1UA 4NJ6A 2AWTA 1D3ZA 4W9IA 2KTRA 3TJPA 2JRIB 2LGXA 1VCBA 2MCNB 4I6NB 3NS8A 5D2MB 3N32A 1WXMA 2FCMA 1E7UA 5JHBA 4ZDVA 4HDQA 3QX1A 2GBJA 2GMIC 4ICUA 3PREA 4JLCA 1NDDA 3K9PB 1UBQA 1UD7A 3DCGA 1YIWA 3PTFC 2KDBA 5KHQA 4TQ1A 2N7DA
chains in the Genus database with same CATH superfamily
4AQ7A 2WXIA 3DHIC 1NVID 1WI0A 4IG7B 2WDQB 5BMIA 3AU4A 4KSLC 3I3TB 2EMTA 2K9XA 3C0RB 5LXIB 1FXAA 3NZ3A 2DX5B 3HVZA 4WAAA 3I63C 1XXGA 4HKQA 1V1PB 2WX0A 3TEYA 2LXAA 2I1JA 2AX5A 1OTRB 2J42A 5C3JB 3RNFC 1ZW7A 2LVPA 1N63A 3R66C 1KLVA 1SE4A 2C7NB 5H92C 3VAWA 4NY0A 1C4CA 3Q8AA 3JYUA 1F2RI 1HZ6A 3B9JA 2D10A 2IGGA 5IN7A 1Q1OA 2YEPB 3L17A 2FUHB 2M4NA 4C4VB 3ONSA 3AH7A 1FNWA 4GDLA 3HK0A 3BYYB 1AWDA 4EOYA 4EKUA 2ZVNA 2LGSA 3PZ8A 1CMXB 2WHIA 5IP4D 5JXVA 2YEPF 3V60A 2BYEA 2KJ6A 1B1ZA 5G2NA 2CJOA 1Q5WB 1ZXHA 2E3TA 3QC8B 5TSSA 1FMAD 2H89B 3W2DA 3ZGZA 3KW5B 1EU3A 1I7HA 2IO3B 3P2BA 1TKYA 1WFYA 4MM3A 2DAJA 3VTWA 3V62A 1WGGA 1MI0A 4K7SA 3T9LA 4K81A 2KZRA 4C7YA 1S3SG 1CJEA 3O65B 2PPHA 2ON8A 4LDTB 3SR6A 2PW9A 3ZUNA 1TT5B 4N58A 4P7IA 1SE3A 5AUIA 5HHDG 4GGQA 4L1BA 2INPE 1V5OA 4W9JA 3UINB 3BINA 1XLQA 2N1VA 3PHWB 3N1ZC 5DPTA 1D5ZC 1WR6E 2WXFA 1V5TA 2FIFA 3GP7A 2OEDA 2L83A 4GB9A 3NHEB 3W1SC 2GLSA 1TZOA 2MSED 4DXGA 1J19A 1ZGUB 3GS2A 1PYWD 3BY4B 3AV8A 3LDZE 4YTPB 2KANA 3AULA 2M0XA 4KGSA 4WWNA 3DBRB 2RDGA 4W9DA 1E5WA 1I4GA 1MHHE 3IT6B 5CHWA 1TS2A 5G5GA 3A4RA 2NPTB 1JCKB 3PO0A 1QOGA 1YX5B 3OLMD 4GMVA 3AE1B 3C19A 1UNSA 3EGRA 3OG5A 3L4PA 1PUTA 4RM9A 2L52A 5AZGA 1VJKA 2LVOA 4W9EA 1C4PA 1L6UA 2GOWA 4M02A 2D3AA 4REZA 4LJPB 4KGTA 2KACA 4XX5A 4HKZE 3PV1A 1M94A 3MC0B 4KIKA 5D3DA 2OJWA 2N9LA 3QHTA 4FBJB 2M56B 3VHTC 2WX1A 1IP9A 2JPHA 3M3JA 3RUIB 3A9JA 4Q2JA 4HK2A 5EE3A 4D2KA 3DBSA 2N9XA 3A4SC 2MLBA 2WXHA 2WXOA 1V8CA 2IZVB 2HD5B 4RGMA 2R2QA 1SF0A 3PHXB 2D3GA 5DPRA 4WJNA 2MW5A 2WXLA 1QOFA 2OHFA 1E9MA 3ZDMC 2G3QB 2JVCA 1V9JA 2RPVA 1L0XB 2K8BA 1TS4A 1RAXA 4ZOHC 2KVZA 1D5XC 1OQYA 3DQVA 1G6JA 3QA8A 3PRPB 2RDHA 1ZDVA 1YQBA 2QMTA 2ZCBA 1AW7A 1GC7A 2HJ8A 2OOBB 1HTQA 3WA0A 1N5XA 2CU1A 1U4AA 2FCSA 2MHJA 2ZW0A 1PQSA 3B1LX 4RMAA 3WAPA 2KJRA 1IUEA 3ZTDA 2LGYA 2MH7A 1GG3A 2KDMA 4C80A 2C7HA 1IBXB 1VR9A 2GRIA 4ZHOA 4HLEA 1QQRA 1ROEA 1EF5A 4KKIA 1YQ3B 3H7PB 3RZFA 1YJIA 3KYCD 4BKGA 4JL9A 1QOAA 1PFDA 4DHZB 2L0TA 4B9KA 1MPEA 2IO2B 1XO3A 1EWCA 4JWUC 4K1RB 1JALA 2PTLA 3UF8A 2I2YA 1WF9A 2ZEQA 1ET6A 3VUYA 3IXSA 3S2AA 2FBWB 1KTKA 3IVFA 2GBNA 1ACCA 3CF6E 3NY5A 3SHQA 2IPKD 5JZEB 3T8MA 4ASWC 2MJDA 4WWOA 1FXTB 3AXCA 2W82A 4IWOA 1WZ0A 2PE6B 3RN9C 3HM3A 2JWZA 3U30A 1OEYJ 2IGDA 1PGBA 4AOFA 1C3TA 2KX3A 1R4NB 3OJ4B 3PSEB 3VDZA 4GOCA 4HCNB 1AYFA 4CO7A 4PYUA 3M63B 1N5WA 4W9HA 5EDSA 3AEGB 3JVZX 4BOZB 4GDKA 3UI3A 1NBFC 1RWSA 2GB1A 3RI7C 1R4MB 3AE9B 1QILA 4OVUA 3AE8B 4XWWA 2IYDB 3VR9B 5IOIA 1PDXA 4L23A 1GC6A 5EE9A 5J17A 1STEA 4A6QA 2KN4A 2KMMA 1H4RA 2IGHA 5EE1A 4PS7A 4YTMB 2KWDA 3BK2A 3H1UA 4NJ6A 2AWTA 1UWMA 2VH2A 5BMHA 4A9AA 2HTME 1WXMA 5LNK1 2FCMA 4N6EB 1RFKA 5JHBA 2MEKA 3QX1A 4B0MA 2GMIC 3PREA 1UD7A 3DCGA 3AECB 3EA6A 3ZVVA 3ZNZB 4LNIA 3MJWA 1HXYD 2V0GA 1C79A 5HG2A 1D4BA 3I9V1 3KWLA 4WIPA 2KT7A 4E71A 3CSFA 3MTNB 1YN4A 3VVWB 1TKGA 1MG8A 3NVWA 3R2TA 5AZFA 3L54A 2D3CA 3TBLD 3AM9A 4A20A 4MGYE 1WX9A 2ICIA 4JWSC 4ANUA 3RNAC 3ZYYX 4LCDE 4DDID 4IUMB 2NTSA 2JYEA 2IO1B 3P4QB 3ZO5B 3RZWC 2KHWB 4US9A 2AEHA 1WR1A 1NYQA 4FJZA 1MJDA 3GOEA 3BVMA 1WJ6A 2OJRA 4ARIA 4GDLB 4C00A 3VUXA 4DBGA 2UU7A 4ZRQA 2BYTA 1I35A 4DK5A 2BS2B 3PRMB 2WWZA 1WX7A 3P4RB 1SGHA 2HTHA 5GMVA 1FO4A 4GN1A 2Z8LA 2RMMA 3DHHC 5BO4B 3IFWB 4YXDB 2FCQA 2L00B 1E8ZA 2ZPNA 2BPSA 4K7UA 4XZ4A 1P3QU 1S1QB 3KLSX 2D11A 3VXWA 1X1MA 2D5GA 3BK1A 3Q3JA 4E74A 1Y56A 2ZNVC 1PGAA 3L08A 3ML9A 2CKHB 2DAFA 3V61A 2A4ZA 2YLMA 3QCAA 2BW2A 2AL6A 4MSMB 1A5RA 3V6CB 3ZXRA 1EM7A 3RNBC 5AZHA 4KDIC 1WXAA 4KKJA 1WYGA 1K50A 4XDDA 3ZW3A 2KFKA 1NEKB 4AS1A 1GPXA 2KLGA 1XQQA 5HI1A 2RDBC 2GBKA 4IM2A 2MBHA 1UH6A 3Q14C 3P63A 4GIVA 1DYQA 3PZDA 3QARA 3MJ5A 3DWMA 1ZDXA 4MGIE 1SE2A 4K7WA 3X23A 1GB1A 3V05A 2KVRA 2W9NA 3ML8A 1VRAB 2DYBA 2QSDA 4C7ZA 2QCZA 2QJLA 2QILA 1EU4A 2G9HD 3A9KA 4GLSC 1ZP0B 5IO9A 2K8HA 2IY1B 4RGNA 2DZKA 4K3CA 3V6EB 4BBNC 1WM3A 3KUZA 2PKOA 2MX2A 1P0RA 4WJPA 2LI5A 4DHJD 1YNTE 4YSXB 2J52A 4KDLB 4M0WA 1PGXA 1YD8U 3A1QA 2GBMA 4HJKA 4KIKB 1JWSD 2D2QA 1T0SC 4OW0A 2NVUI 2BB5A 1HZ5A 2XK5A 2K39A 5G5HA 1OGWA 4DWFA 1V2YA 3L13A 4OZCA 3A9JB 1KLGD 3AEDB 1UELA 2R61A 3HHMA 3ZKJC 1WX8A 4GU2A 3OWEB 2JUOA 2BS4B 1P7FA 2W54A 4F7ZA 5FR6A 3FC4A 1ENFA 2K0PA 4CQNA 3JSVB 3NVZA 2IBIB 5G55A 1WXVA 4LK0M 3SD5A 2O6VB 3Q8EA 4NPNA 3V3XA 2MWSB 2WDVB 4LTUA 3AEAB 4XDCA 2L8JA 2MQJA 4US8A 1N61A 1FFUA 1GAQB 3HRDD 4L2YA 4M01A 3B2GA 4LLGM 2HE7A 3ZJUA 3RULA 4TQ0A 2Y5PA 2KQSA 3AMZA 4AJWA 3ENEA 1CQVA 4ANVA 2MBEA 1WM2A 3N1XC 4M8MA 3RFZB 1XLOA 3ZXVA 2W55A 2IO0B 2DYMA 2QHOA 2KO3A 2NBUA 2PE9A 2RGFA 1AARA 3APFA 4ARCA 2MBBB 3U7DA 1KM7A 2KWVB 1T0YA 1EF1A 1WYWB 3CMMB 1E10A 1ZE3D 4W9GA 1ISNA 3N3KB 4JQWC 3KH0A 2K6QA 3H6NA 1C1YB 1WJUA 3KQ4A 4BZAA 2KX0A 4TKNA 2N4FA 2NBWB 2CHWA 2N7EA 2C9WB 3AE6B 2ZZPB 3N20C 2LZ6A 3JW0X 3TMPB 1JWBD 1Z5SB 3WANA 2WXKA 5E6JA 1LFDA 3R7RA 5DPSA 4YSYB 1J0GA 1LO5D 3LJ3A 4MT5A 2D07B 2NTTA 1QOBA 3ZNID 2JQRB 1L0YB 3A33B 1V1PA 3H7SA 2DZJA 3KYDD 4M8NA 5D3IB 1XD3B 2AQ1B 2YVCA 1LQBA 3DBHI 4RF0A 2MA9B 3VFKA 3NZUA 4JE3B 4MELA 1XT9B 2K8CA 2JZ3B 3FAHA 1F9JA 3QAQA 3APDA 4XC2A 2NR2A 2WXJA 5L95C 1E7PB 1I4PA 1TS3A 3SU8X 4EZJA 1ZOYB 2LVQA 2JXTA 1JRUA 1VZ8A 4UDUC 2DHZA 2Q5WD 3SFDB 3ZRCA 2UYZB 1LM8B 4XYCA 5IA7A 3MHZA 4MJSA 4MSQB 2O2VB 1B9RA 1MVKA 1MFWA 2ZNVB 4MACA 4GDKB 1F2RC 2MBQA 3L0WB 1V97A 2INNE 2IY0B 3NVYA 3AN1A 4NAWA 3U2SC 2MJEA 1HE8A 2C5LC 3L10B 4EZKA 3ZIMA 1I4XA 4WJOA 1NENB 4HXDA 2ZJDA 4A90A 1FCLA 2BQQA 4GSWA 2LASA 1K51A 4ANWA 2V3NA 2LJ5A 2NBVB 2WU5B 2FAZA 1UZXB 4KSKC 1I4QA 3ZLZA 3TIXA 1ZXIA 1D6EC 1OQRA 2LGXA 1HEZE 2QIEB 5D2MB 1E7UA 2LHDA 1SIJA 3IT4B 3SFEB 4JLCA 3T3OA 3K9PB 3PTFC 5KHQA 5CTRC 1VZ7A 1L4ZB 4J6IA 2KDIA 3H9DA 2LXCA 4XE0A 2K25A 4E3CA 4M00A 4URKA 4IOIE 4K3BA 2WLBA 3PLVA 2PEAA 4TV3A 2I38A 3N30A 4YWGG 4F8CB 2MJ3A 4IDIA 2WQYB 1RYJA 4WWMA 4P6VF 3AE7B 1NYRA 3UQAA 4OHJA 4YL8A 2KKCA 2GI9A 5E6OA 2I1KA 3M62B 5IKCM 5E6PA 2BBCA 1KOTA 3QK0A 4KZCA 3WIMA 5GXGB 2JZPA 2DWQA 4BBNF 1TY0A 2KQ7A 2NPTA 3SDLC 3I5JC 4ZRJA 1MG4A 1TZ1A 1RLFA 1KF6B 2JRHA 3TL5A 3B08A 3RCZA 1C77A 2ZCCA 3E9SA 1L0VB 2ASQA 4IM0A 4FJYA 4MGKE 3TEZA 2JSVX 1V49A 2W3SA 3PGEA 2JZZA 5BYSA 3W5VB 1V1OA 2IDYA 1IGCA 2LFIA 2V9HA 1E7VA 2J0KA 5AEKB 4CHKA 5FK9C 2AQ2B 1T6BX 3ZJVA 3J9CA 4EE2A 3QJZA 2INCC 1QF6A 4DHJB 3MC9A 1NI2A 4LNFA 4A55A 4W9CA 2KFKB 2CR5A 3HVDA 2V3PA 2Z59B 3TEXA 3TCAA 4RGTA 2AL3A 5C2TB 1ET9A 1K8RB 3IG3A 4FULA 4C56C 4HRSA 1QT9A 3PRZA 2BT6A 4HDOA 1GB4A 4NJCA 3URYA 5C23A 4IM3A 1QZEA 4II2B 2JU6X 4G0NB 2V4IB 1LXDA 4RFBA 4ZRKA 1CZPA 3KUDB 1V86A 1WH3A 1WSPA 1RFAA 2KMCA 2M8SA 4HEA1 2MP2A 5C1ZA 2K6DB 3A9KB 3T3NA 2QC8A 2JX5A 1LGRA 2M17A 2Y5BB 3DVNV 1H8CA 4H2AA 2XBBC 3EFUA 2NCNA 2LRUA 3VRAB 5JHAA 4EFOA 1IGDA 4XGAB 1Z2MA 1L5PA 1QLBB 1TY2A 4KX6B 3VH4B 1IBXA 1V80A 3ZRFA 4M0WB 1N6ZA 2LJIA 3A1QB 4BKSA 1I4RA 1YJ1A 4NNJB 3H7PA 4LNOA 1P7EA 1WGHA 2XK5B 3QWZB 1ZUD2 2LRWA 4NQLB 1UBIA 2EKIA 3NS1A 2DLBA 3P4SB 3TEWA 1WIAA 4AP4C 1JMLA 2LGIA 4LNKA 4XWTA 4MGZE 3FILA 1N60A 4G11A 3MP9A 2JT4B 2BB6A 3MHSD 2WXGA 4HVBA 2KWUB 1GUAB 3DBLI 2KNBA 1C9FA 4MH0E 2LEKA 1GOZA 4DXFA 2RSUA 3AU5A 3WAMA 4KVGB 4WJQA 4I6PA 4KV2A 2J7QB 4TMAB 1FXIA 4ACFA 4MM3B 2N9KA 4I6LB 2PVOD 3ETRA 1VZ6A 4AWJA 3BYTB 2KDEB 1EUVB 4WQMA 3EC8A 3BWUD 5JH5C 5HKHA 3Q6BA 3O13A 1TS5A 2JY6A 1L7YA 2N1WA 2CJNA 3BVGA 3Q3FA 1D5MC 3RYTA 4MEMA 3RNEC 4FJVB 2K1FA 4RH6A 3DVNU 1SEBD 4CYEA 3LXFA 1FIQA 4BKSD 5CHFA 2BWFA 2BYVE 5T8IA 2PLPA 2L76A 3P4PB 3ABVB 1E8XA 2FCNA 2VZKD 2WGSA 3GZNI 3WALA 1UUPA 4NAMA 4IWPA 1RRBA 1P98A 1J7CA 3Q2AC 2D3BA 1WY8A 2Y5CA 3LYYA 2KYWA 4MH8A 3H8HA 2CHZA 4JGHB 1BUIC 3I57A 3W1SA 3Q8CA 1WZ3A 1FNVA 3DDCB 5DCNA 3NUHB 3RT3B 1SXTA 4RNAA 2KDFB 3PZ7A 3HM6X 1Y8RC 4OVVA 2DYOA 1L4DB 2M0AA 2EMSA 4JIOU 5L83A 5J18A 4X57B 1T3QA 3DHGC 1I42A 2WXQA 1XCQL 4RM8A 3BIID 2MBOA 4NZLB 1UGMA 3NOBA 3IBEA 3QQ8B 2QDFA 1FPYA 3NZSA 3HIZA 1R7SA 4TUUA 3N1YC 3E56A 1DOYA 2L1AA 1MHXA 3R7QA 3P42A 3D32A 1FRRA 4HROA 4W9FA 2EELA 2CU3A 1ZPSA 4B95A 1T0RC 2BF8B 2HDEA 1YJJA 3APCA 1JROA 1XCTL 4N9F4 3PLUA 1F77A 2X38A 1XLNA 1L6VA 2BKRB 3AE5B 5LXHA 2GBRA 3EHVA 4MJSB 4GXBA 4LNNA 4BFRA 1WXQA 1VLBA 2KWCA 4HWIB 2LUEA 4AUQC 5CX3A 1WE7A 2DZIA 4NAWB 1VD2A 3IAM1 4A3OA 1OFFA 1C76A 2LWPA 4O1NA 1OEYA 2J0MA 3DBHB 1JQ4A 2WDRB 1FNUA 5E6NA 1RM6C 3VH3B 1FD6A 2ZVOA 3W9CB 3KUCB 5LLIA 1WMHA 1TBEA 4PYZA 1E0ZA 4DDGD 5BMGA 4W9IA 2KTRA 3AEFB 1VCBA 1JRPA 4ITKA 1AN8A 3NS8A 4RGOS 4USAA 4ZDVA 4HDQA 1TYGB 4ICUA 1UBQA 2BS3B 2KDBA 1VDVA 3U4EG 4ICVA 1L2NA 1YOVB 1E8WA 2BGFA 1SBBB 2JF5A 3VTVA 3R3MA 3VQIA 2N0SB 3ZQ4A 4PS3A 4P16A 2JWUA 2MRPA 2FE8A 1P1AA 3AE2B 4YT0B 3Q8FA 1WRIA 2BVCA 2LMCA 2KMAA 3W5UB 2KC1A 1E6EB 4II3B 3SEBA 1CK1A 3DVGX 5EE0A 3AE3B 2LHEA 2UWQA 4J3OD 4RF1A 2AYOB 4HPMB 4B0EA 1F52A 2Z0DB 3GB1A 3K9OB 4HPLB 1FFVA 2PJHA 3VR8B 1I4HA 2WYQA 3TSSA 1HQRD 2M1MA 3CIRB 1GJZA 4N59A 3M95A 1FM0D 3CSTA 2BWES 3PPAA 2KLCA 4RCOA 4NQKE 2M19A 3U7ZA 2XEWA 2JYTA 2LGDA 3P1MA 2NS5A 3NJTA 1IPGA 1SJHD 4C4VA 4TSSA 2WXRA 3HUIA 1KRHA 2RPQA 1YQ4B 4A3PA 3VRBB 2WNMA 3AB5A 1YX6B 2TSSA 2SAKA 2DZMA 3QIJA 3IAS1 2WU2B 2PVGC 1HTOA 1Q10A 2CS4A 1TTNA 3JSVA 3WCQA 1JW9D 2PIAA 4DXAB 1YN3A 3RPFC 4KZ0A 3U8ZA 2Y3AA 4P1CC 2O6VA 3DOWA 3N9YC 2X8XX 1TKEA 2R2OA 2NMQA 1EO6A 3DBRI 1IYFA 2BYFA 1TGZB 3KWVA 2L3ZA 1GNUA 1BT0A 2VRRB 3OAWA 4S17A 2AQ3B 3Q69A 4FADA 4HPPA 1UWXA 2C7MB 2MP2B 2V3SA 4WURA 1YN5A 3ZNHB 2KQ4X 3Q3NC 1WE6A 2DBYA 3PT2B 1K52A 1FEHA 3PVLA 1N62A 4PS8A 4EEWA 4EZLA 4BAXA 3VTUA 3L16A 3UQBA 4HJGE 3AE4B 3ALBA 4OZAA 1XLPA 2IJ0A 1A70A 1WRDB 1KJTA 4OZBA 5BYQA 2L05A 4BKTA 4MDKE 2ONQA 3C8YA 1KH0A 1DGJA 2KXJA 2B76B 4PK1A 4BVUC 3RD2A 2WS3B 4W9LA 3LB8C 4G3XB 4OVZA 4NJ7A 4WH4A 2VZKB 2O6VD 2H88B 3RMKC 5BYRA 3NVVA 2A5UA 3ZTCA 2K5PA 3EECA 3FILB 1XF5L 4DHZE 3TUOA 4LDTD 1SE9A 3R8BA 3X0WA 3UGBB 3NG0A 2W3RA 1BMLC 5I4DA 1DOXA 4JPSA 4FLHA 5TR5A 1SJED 2INDC 2VH1A 3R2IA 4QAYA 3RNCC 3ZJTA 2BKFA 1KFYB 4HCPB 1WGKA 2KOXA 1T0QC 1HA5A 2ZW1A 2B3AA 4ZYNA 1OQQA 1FRDA 3Q3MC 2RD0A 1JWUD 4S0RA 2FNJB 2L0FA 5CHVC 2XN9C 1T5XD 1P9DU 2KFJA 2J4XA 4FXCA 2ACZB 2LUMA 3BZDB 2C60A 1EWYC 2QEJC 1C78A 2L7RA 2KD0A 4FA6A 3U52E 3ECIA 2DNFA 3UIPB 1SIFA 2O2VA 4BOSC 5J2RA 1J7BA 1SSNA 3DBLB 3FKYA 1WGDA 4WWPA 5H8YE 2E6XA 2WP9B 1E8YA 3KVFB 1ESFA 2ZPYA 3MC8A 5FKAC 2REXA 2WXNA 2G4DB 4EUTA 1WXSA 2JXXA 3RNGC 4PT5A 2G45B 1F0ZA 1BXTA 4IWQA 2G1EA 3AEBB 1SB3C 1FCCC 1YMHE 3OJ3A 5KHOA 1UGJA 4JX1C 2RR9A 4YSZB 1WJ4A 2Z0EB 2WXPA 4WQOB 4ZHPA 1TJEA 4G50A 2N7JA 2FIDA 4F1SA 3W1YA 2K22A 4ZYSA 4AJYB 4ZRIA 2DENB 2J0JA 3IHPC 2BTEA 5IAAC 3WAOA 2HJ1A 3GZNB 2KN5A 2V4LA 3Q3OC 1R4NI 2PMVA 1QKZA 1XEEA 2N9PC 1E90A 1J8CA 5AUKA 2LD9A 1WGYA 2SEBD 1TIFA 1NI3A 1KLUD 2V1YA 5DPWA 1DOIA 4KGRA 2KJHB 1JWMD 3ZNGC 1WGRA 1ZKHA 2CHXA 3VUWA 3AEEB 1WJNA 1R4MI 1V81A 3B2FA 3Q8BA 3EFCA 3AI5A 4IC7B 2L32A 2J53A 1WWTA 3CWIA 5D94A 2KC2A 3DVGY 4IW0A 4B6WA 1M4VA 5MPOA 4FN2A 3PS6A 3GE8C 4IKGA 4ANXA 3DWGC 3BVZA 3NRZA 4R3DA 2FUG1 2WDTB 4A8XC 4LJOB 3DPDA 3ZDTA 1UF0A 4FHKA 4YTNB 2EKEC 5D6JB 1WMHB 3B0AA 4W9KA 1F1HA 4DQOC 1C4AA 5FR3A 2G4SA 2KTFA 2KK8A 1K53A 2N9EB 4FHJA 4WAFA 1JWAD 1V6EA 2KTRB 4ZRPA 1Q0WB 3UIOB 5D7GA 1D3ZA 1J7AA 3EUB2 3TJPA 2JRIB 4P1BC 2MCNB 4I6NB 3N32A 2K3UA 5HFYA 2GBJA 2KAJA 1NDDA 1YIWA 3GE3C 3MFGA 2WXMA 2XNAC 4TQ1A 2N7DA
chains in the Genus database with same CATH topology
4J6IA 2KDIA 3ZVVA 4ICVA 3ZNZB 1L2NA 3H9DA 3MJWA 1E8WA 2BGFA 1WI0A 2LXCA 4IG7B 3AU4A 2K25A 4KSLC 4E3CA 3I3TB 2JF5A 3VTVA 4URKA 3R3MA 3VQIA 3PLVA 2EMTA 4PS3A 2PEAA 3C0RB 4TV3A 3N30A 5LXIB 4F8CB 4E71A 2DX5B 3CSFA 2MRPA 3MTNB 3VVWB 1P1AA 4WAAA 1MG8A 5AZFA 3L54A 2KMAA 2KC1A 2WX0A 4II3B 2LXAA 3UQAA 3TBLD 3DVGX 2I1JA 2KKCA 4YL8A 1OTRB 5E6OA 4A20A 4MGYE 1WX9A 2I1KA 3M62B 2UWQA 2AYOB 4ANUA 5E6PA 1ZW7A 4HPMB 2LVPA 2Z0DB 1KOTA 3K9OB 4HPLB 3QK0A 4LCDE 4KZCA 3WIMA 4IUMB 4DDID 2PJHA 3R66C 2IO1B 2WYQA 4BBNF 3ZO5B 1KLVA 3RZWC 2KHWB 2KQ7A 2NPTA 2AEHA 3SDLC 2C7NB 1WR1A 2M1MA 1GJZA 4FJZA 3VAWA 4NY0A 3M95A 3GOEA 3JYUA 1WJ6A 3CSTA 4ZRJA 1TZ1A 1RLFA 2BWES 2OJRA 3PPAA 2D10A 4GDLB 2KLCA 2JRHA 3TL5A 1Q1OA 3VUXA 4DBGA 4NQKE 1I35A 3B08A 3L17A 2XEWA 2FUHB 2M4NA 2LGDA 3RCZA 4DK5A 3ONSA 3PRMB 2ZCCA 2WWZA 2NS5A 1WX7A 2ASQA 1SGHA 2HTHA 4GDLA 4IM0A 4FJYA 5GMVA 4MGKE 3HK0A 1IPGA 4GN1A 4EOYA 1V49A 4EKUA 2ZVNA 5BO4B 3IFWB 3PGEA 2FCQA 2L00B 2JZZA 1CMXB 1E8ZA 2ZPNA 2BPSA 4K7UA 2RPQA 4XZ4A 1P3QU 1S1QB 3V60A 2BYEA 2KJ6A 4A3PA 2D11A 5G2NA 1E7VA 1Q5WB 3VXWA 1X1MA 2J0KA 5AEKB 3QC8B 4CHKA 1YX6B 3Q3JA 2DZMA 3QIJA 4E74A 2ZNVC 3L08A 3ML9A 2CKHB 2DAFA 3KW5B 3QJZA 2A4ZA 2IO3B 3V61A 2YLMA 4DHJB 3P2BA 2CS4A 1WFYA 4MM3A 2DAJA 3VTWA 1NI2A 3QCAA 3V62A 1WGGA 1TTNA 2AL6A 3JSVA 4K7SA 3T9LA 4K81A 4DXAB 4W9CA 4MSMB 2KZRA 2KFKB 2CR5A 4KZ0A 3U8ZA 3V6CB 1A5RA 1S3SG 3O65B 2PPHA 2O6VA 3DOWA 4KDIC 4LDTB 5AZHA 1WXAA 2Z59B 3ZUNA 3TCAA 2R2OA 4P7IA 2AL3A 3ZW3A 1K8RB 3IG3A 2KFKA 4FULA 1EO6A 3DBRI 4GGQA 3PRZA 4HDOA 1IYFA 2BYFA 4W9JA 1TGZB 1V5OA 2KLGA 3UINB 2L3ZA 1XQQA 1GNUA 1BT0A 2VRRB 3OAWA 5C23A 3BINA 2GBKA 4IM2A 2MBHA 1UH6A 2N1VA 3PHWB 5DPTA 4FADA 4IM3A 1WR6E 1V5TA 2FIFA 1QZEA 4II2B 4GIVA 3PZDA 2MP2B 2C7MB 2V3SA 4G0NB 1LXDA 3QARA 4GB9A 4ZRKA 3ZNHB 3KUDB 1WE6A 1V86A 1WH3A 3NHEB 3PT2B 4MGIE 1RFAA 2KMCA 2M8SA 3W1SC 3PVLA 4K7WA 2MSED 3X23A 2MP2A 5C1ZA 2K6DB 2KVRA 4PS8A 4EEWA 1J19A 1ZGUB 2W9NA 3BY4B 3A9KB 3LDZE 3ML8A 2DYBA 4EZLA 2KANA 3AULA 2M0XA 3VTUA 3L16A 3UQBA 3ALBA 2M17A 2Y5BB 3DVNV 4WWNA 1WRDB 1H8CA 1KJTA 3A9KA 4W9DA 1E5WA 2L05A 2XBBC 4BKTA 4MDKE 5CHWA 3EFUA 2NCNA 2K8HA 2IY1B 2LRUA 5JHAA 4EFOA 1Z2MA 2KXJA 2DZKA 3A4RA 3V6EB 1V80A 3VH4B 2NPTB 3ZRFA 4BBNC 1WM3A 4M0WB 3KUZA 1YX5B 2MX2A 1P0RA 3A1QB 3OLMD 4GMVA 4WJPA 3RD2A 4BVUC 4BKSA 2LI5A 1YJ1A 4W9LA 4NNJB 4DHJD 3H7PA 4G3XB 4NJ7A 2O6VD 1WGHA 4RM9A 5AZGA 2XK5B 4KDLB 3QWZB 2LRWA 2LVOA 4W9EA 4NQLB 1YD8U 1UBIA 2A5UA 2GBMA 3A1QA 4HJKA 3ZTCA 3EECA 4KIKB 5CTRC 2GOWA 1WIAA 2D2QA 4AP4C 4DHZE 4LJPB 2NVUI 4LDTD 1SE9A 4XX5A 2XK5A 2K39A 3X0WA 4MGZE 1OGWA 3UGBB 3PV1A 4DWFA 1M94A 1V2YA 3L13A 4KIKA 4G11A 2JT4B 3A9JB 3QHTA 4FLHA 5TR5A 3MHSD 4HVBA 1UELA 2KWUB 3HHMA 1GUAB 3DBLI 2KNBA 4FBJB 3ZKJC 2BKFA 4MH0E 3VHTC 1WX8A 2WX1A 4GU2A 4HCPB 2RSUA 3AU5A 3WAMA 2JPHA 1IP9A 4KVGB 3M3JA 2JUOA 2KOXA 4WJQA 3RUIB 4I6PA 3A9JA 4F7ZA 2B3AA 4KV2A 5FR6A 4ZYNA 2J7QB 4HK2A 4I6LB 2RD0A 4AWJA 2FNJB 3JSVB 3DBSA 2L0FA 2N9XA 3A4SC 2IBIB 5CHVC 2KDEB 5G55A 2MLBA 1WXVA 1EUVB 1P9DU 2KFJA 3SD5A 3EC8A 2O6VB 2IZVB 2HD5B 4NPNA 2R2QA 5JH5C 5HKHA 2C60A 3PHXB 2D3GA 2MWSB 2L8JA 2MQJA 2JY6A 5DPRA 2L7RA 1L7YA 2KD0A 2N1WA 4FA6A 3Q3FA 4WJNA 3ECIA 2MW5A 2HE7A 3RYTA 4MEMA 3UIPB 4FJVB 3ZDMC 2K1FA 2G3QB 2JVCA 1V9JA 1SIFA 3DVNU 2O2VA 4BOSC 5J2RA 4CYEA 3RULA 4TQ0A 4BKSD 1WGDA 2K8BA 5CHFA 2KQSA 2BWFA 2BYVE 4WWPA 1RAXA 4AJWA 2L76A 1OQYA 3DQVA 1E8YA 3ENEA 1G6JA 3KVFB 4ANVA 3QA8A 2ZPYA 2MBEA 3PRPB 1WM2A 1YQBA 2REXA 4M8MA 1E8XA 2FCNA 2G4DB 2IO0B 2DYMA 2QHOA 3GZNI 2KO3A 2NBUA 2PE9A 2RGFA 2ZCBA 4EUTA 3WALA 1AARA 3APFA 1GC7A 2HJ8A 2MBBB 2OOBB 1WXSA 2JXXA 3U7DA 1KM7A 2G45B 1T0YA 2KWVB 1EF1A 1WYWB 3WA0A 2CU1A 4IWQA 1U4AA 4IWPA 2FCSA 3CMMB 1RRBA 1P98A 1PQSA 3B1LX 4RMAA 4W9GA 3WAPA 1ISNA 2KJRA 3N3KB 3OJ3A 5KHOA 2RR9A 1WJ4A 3ZTDA 1WY8A 4JQWC 3KH0A 2K6QA 3H6NA 2LGYA 1GG3A 2Z0EB 1C1YB 1WJUA 2C7HA 2KX0A 4TKNA 2N4FA 2NBWB 4WQOB 2CHZA 2CHWA 2N7EA 4G50A 4JGHB 3W1SA 2C9WB 4HLEA 2ZZPB 1WZ3A 3DDCB 1EF5A 5DCNA 2FIDA 3RT3B 2KDFB 4F1SA 3H7PB 2LZ6A 3JW0X 3HM6X 1Y8RC 4OVVA 2DYOA 3RZFA 3W1YA 3TMPB 4AJYB 1Z5SB 3KYCD 4BKGA 4ZRIA 2DENB 2J0JA 3IHPC 4JL9A 3WANA 5IAAC 3WAOA 2EMSA 4DHZB 2L0TA 4JIOU 5L83A 5J18A 1LFDA 2KN5A 3R7RA 4B9KA 2V4LA 4X57B 5DPSA 1R4NI 2IO2B 3LJ3A 1J0GA 1I42A 2D07B 2N9PC 1E90A 1J8CA 4K1RB 3ZNID 2LD9A 4RM8A 1WGYA 3UF8A 2MBOA 3A33B 1UGMA 3NOBA 3H7SA 3IBEA 3QQ8B 1WF9A 2DZJA 2ZEQA 3NZSA 2V1YA 3HIZA 5DPWA 3KYDD 4M8NA 3VUYA 3S2AA 4TUUA 1XD3B 2KJHB 3ZNGC 1WGRA 3IVFA 2GBNA 1ZKHA 2CHXA 2YVCA 3CF6E 1LQBA 3NY5A 3DBHI 3R7QA 3SHQA 3VUWA 3D32A 5JZEB 2MA9B 3VFKA 1WJNA 3NZUA 1R4MI 4MELA 4W9FA 3T8MA 1XT9B 4B95A 1V81A 2K8CA 4ASWC 3AI5A 4IC7B 2BF8B 2JZ3B 3QAQA 1F9JA 4WWOA 1FXTB 3AXCA 3APDA 5D94A 4XC2A 4IWOA 2KC2A 3APCA 2NR2A 1WZ0A 2PE6B 3DVGY 4N9F4 5L95C 3PLUA 3HM3A 2BKRB 4IW0A 2JWZA 3U30A 4B6WA 3SU8X 5LXHA 1OEYJ 2GBRA 4EZJA 3EHVA 2LVQA 3PS6A 4FN2A 4GXBA 4MJSB 4AOFA 4BFRA 1C3TA 1JRUA 2KX3A 2KWCA 4HWIB 2LUEA 2DHZA 3OJ4B 3ZRCA 2UYZB 1LM8B 5CX3A 3PSEB 4AUQC 4ANXA 3VDZA 5IA7A 1WE7A 4GOCA 4HCNB 2DZIA 2WDTB 4MJSA 4MSQB 4NAWB 2O2VB 1VD2A 2ZNVB 4CO7A 4GDKB 4LJOB 4PYUA 4A3OA 3DPDA 2MBQA 3M63B 3L0WB 3ZDTA 2IY0B 2LWPA 4W9HA 1OEYA 2J0MA 4FHKA 4NAWA 5EDSA 2EKEC 3JVZX 4BOZB 1HE8A 4GDKA 2C5LC 3L10B 1NBFC 5D6JB 4EZKA 1WMHB 3B0AA 4W9KA 5E6NA 3ZIMA 4WJOA 2G4SA 4HXDA 3VH3B 2KTFA 2ZJDA 2KK8A 4OVUA 2ZVOA 4GSWA 2LASA 2IYDB 2N9EB 4FHJA 1GC6A 3KUCB 4ANWA 5J17A 1V6EA 2LJ5A 5LLIA 1WMHA 2KTRB 2NBVB 2FAZA 1UZXB 4KSKC 3ZLZA 3TIXA 1H4RA 1TBEA 1Q0WB 4PYZA 3UIOB 4PS7A 4DDGD 5D7GA 3H1UA 4NJ6A 2AWTA 1D3ZA 4W9IA 2KTRA 3TJPA 2JRIB 2LGXA 1VCBA 2MCNB 4I6NB 3NS8A 5D2MB 3N32A 1WXMA 2FCMA 1E7UA 5JHBA 4ZDVA 4HDQA 3QX1A 2GBJA 2GMIC 4ICUA 3PREA 4JLCA 1NDDA 3K9PB 1UBQA 1UD7A 3DCGA 1YIWA 3PTFC 2KDBA 5KHQA 4TQ1A 2N7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6I A;  2KDI A;  3ZVV A;  4ICV A;  3ZNZ B;  1L2N A;  3H9D A;  3MJW A;  1E8W A;  2BGF A;  1WI0 A;  2LXC A;  4IG7 B;  3AU4 A;  2K25 A;  4KSL C;  4E3C A;  3I3T B;  2JF5 A;  3VTV A;  4URK A;  3R3M A;  3VQI A;  3PLV A;  2EMT A;  4PS3 A;  2PEA A;  3C0R B;  4TV3 A;  3N30 A;  5LXI B;  4F8C B;  4E71 A;  2DX5 B;  3CSF A;  2MRP A;  3MTN B;  3VVW B;  1P1A A;  4WAA A;  1MG8 A;  5AZF A;  3L54 A;  2KMA A;  2KC1 A;  2WX0 A;  4II3 B;  2LXA A;  3UQA A;  3TBL D;  3DVG X;  2I1J A;  2KKC A;  4YL8 A;  1OTR B;  5E6O A;  4A20 A;  4MGY E;  1WX9 A;  2I1K A;  3M62 B;  2UWQ A;  2AYO B;  4ANU A;  5E6P A;  1ZW7 A;  4HPM B;  2LVP A;  2Z0D B;  1KOT A;  3K9O B;  4HPL B;  3QK0 A;  4LCD E;  4KZC A;  3WIM A;  4IUM B;  4DDI D;  2PJH A;  3R66 C;  2IO1 B;  2WYQ A;  4BBN F;  3ZO5 B;  1KLV A;  3RZW C;  2KHW B;  2KQ7 A;  2NPT A;  2AEH A;  3SDL C;  2C7N B;  1WR1 A;  2M1M A;  1GJZ A;  4FJZ A;  3VAW A;  4NY0 A;  3M95 A;  3GOE A;  3JYU A;  1WJ6 A;  3CST A;  4ZRJ A;  1TZ1 A;  1RLF A;  2BWE S;  2OJR A;  3PPA A;  2D10 A;  4GDL B;  2KLC A;  2JRH A;  3TL5 A;  1Q1O A;  3VUX A;  4DBG A;  4NQK E;  1I35 A;  3B08 A;  3L17 A;  2XEW A;  2FUH B;  2M4N A;  2LGD A;  3RCZ A;  4DK5 A;  3ONS A;  3PRM B;  2ZCC A;  2WWZ A;  2NS5 A;  1WX7 A;  2ASQ A;  1SGH A;  2HTH A;  4GDL A;  4IM0 A;  4FJY A;  5GMV A;  4MGK E;  3HK0 A;  1IPG A;  4GN1 A;  4EOY A;  1V49 A;  4EKU A;  2ZVN A;  5BO4 B;  3IFW B;  3PGE A;  2FCQ A;  2L00 B;  2JZZ A;  1CMX B;  1E8Z A;  2ZPN A;  2BPS A;  4K7U A;  2RPQ A;  4XZ4 A;  1P3Q U;  1S1Q B;  3V60 A;  2BYE A;  2KJ6 A;  4A3P A;  2D11 A;  5G2N A;  1E7V A;  1Q5W B;  3VXW A;  1X1M A;  2J0K A;  5AEK B;  3QC8 B;  4CHK A;  1YX6 B;  3Q3J A;  2DZM A;  3QIJ A;  4E74 A;  2ZNV C;  3L08 A;  3ML9 A;  2CKH B;  2DAF A;  3KW5 B;  3QJZ A;  2A4Z A;  2IO3 B;  3V61 A;  2YLM A;  4DHJ B;  3P2B A;  2CS4 A;  1WFY A;  4MM3 A;  2DAJ A;  3VTW A;  1NI2 A;  3QCA A;  3V62 A;  1WGG A;  1TTN A;  2AL6 A;  3JSV A;  4K7S A;  3T9L A;  4K81 A;  4DXA B;  4W9C A;  4MSM B;  2KZR A;  2KFK B;  2CR5 A;  4KZ0 A;  3U8Z A;  3V6C B;  1A5R A;  1S3S G;  3O65 B;  2PPH A;  2O6V A;  3DOW A;  4KDI C;  4LDT B;  5AZH A;  1WXA A;  2Z59 B;  3ZUN A;  3TCA A;  2R2O A;  4P7I A;  2AL3 A;  3ZW3 A;  1K8R B;  3IG3 A;  2KFK A;  4FUL A;  1EO6 A;  3DBR I;  4GGQ A;  3PRZ A;  4HDO A;  1IYF A;  2BYF A;  4W9J A;  1TGZ B;  1V5O A;  2KLG A;  3UIN B;  2L3Z A;  1XQQ A;  1GNU A;  1BT0 A;  2VRR B;  3OAW A;  5C23 A;  3BIN A;  2GBK A;  4IM2 A;  2MBH A;  1UH6 A;  2N1V A;  3PHW B;  5DPT A;  4FAD A;  4IM3 A;  1WR6 E;  1V5T A;  2FIF A;  1QZE A;  4II2 B;  4GIV A;  3PZD A;  2MP2 B;  2C7M B;  2V3S A;  4G0N B;  1LXD A;  3QAR A;  4GB9 A;  4ZRK A;  3ZNH B;  3KUD B;  1WE6 A;  1V86 A;  1WH3 A;  3NHE B;  3PT2 B;  4MGI E;  1RFA A;  2KMC A;  2M8S A;  3W1S C;  3PVL A;  4K7W A;  2MSE D;  3X23 A;  2MP2 A;  5C1Z A;  2K6D B;  2KVR A;  4PS8 A;  4EEW A;  1J19 A;  1ZGU B;  2W9N A;  3BY4 B;  3A9K B;  3LDZ E;  3ML8 A;  2DYB A;  4EZL A;  2KAN A;  3AUL A;  2M0X A;  3VTU A;  3L16 A;  3UQB A;  3ALB A;  2M17 A;  2Y5B B;  3DVN V;  4WWN A;  1WRD B;  1H8C A;  1KJT A;  3A9K A;  4W9D A;  1E5W A;  2L05 A;  2XBB C;  4BKT A;  4MDK E;  5CHW A;  3EFU A;  2NCN A;  2K8H A;  2IY1 B;  2LRU A;  5JHA A;  4EFO A;  1Z2M A;  2KXJ A;  2DZK A;  3A4R A;  3V6E B;  1V80 A;  3VH4 B;  2NPT B;  3ZRF A;  4BBN C;  1WM3 A;  4M0W B;  3KUZ A;  1YX5 B;  2MX2 A;  1P0R A;  3A1Q B;  3OLM D;  4GMV A;  4WJP A;  3RD2 A;  4BVU C;  4BKS A;  2LI5 A;  1YJ1 A;  4W9L A;  4NNJ B;  4DHJ D;  3H7P A;  4G3X B;  4NJ7 A;  2O6V D;  1WGH A;  4RM9 A;  5AZG A;  2XK5 B;  4KDL B;  3QWZ B;  2LRW A;  2LVO A;  4W9E A;  4NQL B;  1YD8 U;  1UBI A;  2A5U A;  2GBM A;  3A1Q A;  4HJK A;  3ZTC A;  3EEC A;  4KIK B;  5CTR C;  2GOW A;  1WIA A;  2D2Q A;  4AP4 C;  4DHZ E;  4LJP B;  2NVU I;  4LDT D;  1SE9 A;  4XX5 A;  2XK5 A;  2K39 A;  3X0W A;  4MGZ E;  1OGW A;  3UGB B;  3PV1 A;  4DWF A;  1M94 A;  1V2Y A;  3L13 A;  4KIK A;  4G11 A;  2JT4 B;  3A9J B;  3QHT A;  4FLH A;  5TR5 A;  3MHS D;  4HVB A;  1UEL A;  2KWU B;  3HHM A;  1GUA B;  3DBL I;  2KNB A;  4FBJ B;  3ZKJ C;  2BKF A;  4MH0 E;  3VHT C;  1WX8 A;  2WX1 A;  4GU2 A;  4HCP B;  2RSU A;  3AU5 A;  3WAM A;  2JPH A;  1IP9 A;  4KVG B;  3M3J A;  2JUO A;  2KOX A;  4WJQ A;  3RUI B;  4I6P A;  3A9J A;  4F7Z A;  2B3A A;  4KV2 A;  5FR6 A;  4ZYN A;  2J7Q B;  4HK2 A;  4I6L B;  2RD0 A;  4AWJ A;  2FNJ B;  3JSV B;  3DBS A;  2L0F A;  2N9X A;  3A4S C;  2IBI B;  5CHV C;  2KDE B;  5G55 A;  2MLB A;  1WXV A;  1EUV B;  1P9D U;  2KFJ A;  3SD5 A;  3EC8 A;  2O6V B;  2IZV B;  2HD5 B;  4NPN A;  2R2Q A;  5JH5 C;  5HKH A;  2C60 A;  3PHX B;  2D3G A;  2MWS B;  2L8J A;  2MQJ A;  2JY6 A;  5DPR A;  2L7R A;  1L7Y A;  2KD0 A;  2N1W A;  4FA6 A;  3Q3F A;  4WJN A;  3ECI A;  2MW5 A;  2HE7 A;  3RYT A;  4MEM A;  3UIP B;  4FJV B;  3ZDM C;  2K1F A;  2G3Q B;  2JVC A;  1V9J A;  1SIF A;  3DVN U;  2O2V A;  4BOS C;  5J2R A;  4CYE A;  3RUL A;  4TQ0 A;  4BKS D;  1WGD A;  2K8B A;  5CHF A;  2KQS A;  2BWF A;  2BYV E;  4WWP A;  1RAX A;  4AJW A;  2L76 A;  1OQY A;  3DQV A;  1E8Y A;  3ENE A;  1G6J A;  3KVF B;  4ANV A;  3QA8 A;  2ZPY A;  2MBE A;  3PRP B;  1WM2 A;  1YQB A;  2REX A;  4M8M A;  1E8X A;  2FCN A;  2G4D B;  2IO0 B;  2DYM A;  2QHO A;  3GZN I;  2KO3 A;  2NBU A;  2PE9 A;  2RGF A;  2ZCB A;  4EUT A;  3WAL A;  1AAR A;  3APF A;  1GC7 A;  2HJ8 A;  2MBB B;  2OOB B;  1WXS A;  2JXX A;  3U7D A;  1KM7 A;  2G45 B;  1T0Y A;  2KWV B;  1EF1 A;  1WYW B;  3WA0 A;  2CU1 A;  4IWQ A;  1U4A A;  4IWP A;  2FCS A;  3CMM B;  1RRB A;  1P98 A;  1PQS A;  3B1L X;  4RMA A;  4W9G A;  3WAP A;  1ISN A;  2KJR A;  3N3K B;  3OJ3 A;  5KHO A;  2RR9 A;  1WJ4 A;  3ZTD A;  1WY8 A;  4JQW C;  3KH0 A;  2K6Q A;  3H6N A;  2LGY A;  1GG3 A;  2Z0E B;  1C1Y B;  1WJU A;  2C7H A;  2KX0 A;  4TKN A;  2N4F A;  2NBW B;  4WQO B;  2CHZ A;  2CHW A;  2N7E A;  4G50 A;  4JGH B;  3W1S A;  2C9W B;  4HLE A;  2ZZP B;  1WZ3 A;  3DDC B;  1EF5 A;  5DCN A;  2FID A;  3RT3 B;  2KDF B;  4F1S A;  3H7P B;  2LZ6 A;  3JW0 X;  3HM6 X;  1Y8R C;  4OVV A;  2DYO A;  3RZF A;  3W1Y A;  3TMP B;  4AJY B;  1Z5S B;  3KYC D;  4BKG A;  4ZRI A;  2DEN B;  2J0J A;  3IHP C;  4JL9 A;  3WAN A;  5IAA C;  3WAO A;  2EMS A;  4DHZ B;  2L0T A;  4JIO U;  5L83 A;  5J18 A;  1LFD A;  2KN5 A;  3R7R A;  4B9K A;  2V4L A;  4X57 B;  5DPS A;  1R4N I;  2IO2 B;  3LJ3 A;  1J0G A;  1I42 A;  2D07 B;  2N9P C;  1E90 A;  1J8C A;  4K1R B;  3ZNI D;  2LD9 A;  4RM8 A;  1WGY A;  3UF8 A;  2MBO A;  3A33 B;  1UGM A;  3NOB A;  3H7S A;  3IBE A;  3QQ8 B;  1WF9 A;  2DZJ A;  2ZEQ A;  3NZS A;  2V1Y A;  3HIZ A;  5DPW A;  3KYD D;  4M8N A;  3VUY A;  3S2A A;  4TUU A;  1XD3 B;  2KJH B;  3ZNG C;  1WGR A;  3IVF A;  2GBN A;  1ZKH A;  2CHX A;  2YVC A;  3CF6 E;  1LQB A;  3NY5 A;  3DBH I;  3R7Q A;  3SHQ A;  3VUW A;  3D32 A;  5JZE B;  2MA9 B;  3VFK A;  1WJN A;  3NZU A;  1R4M I;  4MEL A;  4W9F A;  3T8M A;  1XT9 B;  4B95 A;  1V81 A;  2K8C A;  4ASW C;  3AI5 A;  4IC7 B;  2BF8 B;  2JZ3 B;  3QAQ A;  1F9J A;  4WWO A;  1FXT B;  3AXC A;  3APD A;  5D94 A;  4XC2 A;  4IWO A;  2KC2 A;  3APC A;  2NR2 A;  1WZ0 A;  2PE6 B;  3DVG Y;  4N9F 4;  5L95 C;  3PLU A;  3HM3 A;  2BKR B;  4IW0 A;  2JWZ A;  3U30 A;  4B6W A;  3SU8 X;  5LXH A;  1OEY J;  2GBR A;  4EZJ A;  3EHV A;  2LVQ A;  3PS6 A;  4FN2 A;  4GXB A;  4MJS B;  4AOF A;  4BFR A;  1C3T A;  1JRU A;  2KX3 A;  2KWC A;  4HWI B;  2LUE A;  2DHZ A;  3OJ4 B;  3ZRC A;  2UYZ B;  1LM8 B;  5CX3 A;  3PSE B;  4AUQ C;  4ANX A;  3VDZ A;  5IA7 A;  1WE7 A;  4GOC A;  4HCN B;  2DZI A;  2WDT B;  4MJS A;  4MSQ B;  4NAW B;  2O2V B;  1VD2 A;  2ZNV B;  4CO7 A;  4GDK B;  4LJO B;  4PYU A;  4A3O A;  3DPD A;  2MBQ A;  3M63 B;  3L0W B;  3ZDT A;  2IY0 B;  2LWP A;  4W9H A;  1OEY A;  2J0M A;  4FHK A;  4NAW A;  5EDS A;  2EKE C;  3JVZ X;  4BOZ B;  1HE8 A;  4GDK A;  2C5L C;  3L10 B;  1NBF C;  5D6J B;  4EZK A;  1WMH B;  3B0A A;  4W9K A;  5E6N A;  3ZIM A;  4WJO A;  2G4S A;  4HXD A;  3VH3 B;  2KTF A;  2ZJD A;  2KK8 A;  4OVU A;  2ZVO A;  4GSW A;  2LAS A;  2IYD B;  2N9E B;  4FHJ A;  1GC6 A;  3KUC B;  4ANW A;  5J17 A;  1V6E A;  2LJ5 A;  5LLI A;  1WMH A;  2KTR B;  2NBV B;  2FAZ A;  1UZX B;  4KSK C;  3ZLZ A;  3TIX A;  1H4R A;  1TBE A;  1Q0W B;  4PYZ A;  3UIO B;  4PS7 A;  4DDG D;  5D7G A;  3H1U A;  4NJ6 A;  2AWT A;  1D3Z A;  4W9I A;  2KTR A;  3TJP A;  2JRI B;  2LGX A;  1VCB A;  2MCN B;  4I6N B;  3NS8 A;  5D2M B;  3N32 A;  1WXM A;  2FCM A;  1E7U A;  5JHB A;  4ZDV A;  4HDQ A;  3QX1 A;  2GBJ A;  2GMI C;  4ICU A;  3PRE A;  4JLC A;  1NDD A;  3K9P B;  1UBQ A;  1UD7 A;  3DCG A;  1YIW A;  3PTF C;  2KDB A;  5KHQ A;  4TQ1 A;  2N7D A; 
#chains in the Genus database with same CATH topology
 4AQ7 A;  2WXI A;  3DHI C;  1NVI D;  1WI0 A;  4IG7 B;  2WDQ B;  5BMI A;  3AU4 A;  4KSL C;  3I3T B;  2EMT A;  2K9X A;  3C0R B;  5LXI B;  1FXA A;  3NZ3 A;  2DX5 B;  3HVZ A;  4WAA A;  3I63 C;  1XXG A;  4HKQ A;  1V1P B;  2WX0 A;  3TEY A;  2LXA A;  2I1J A;  2AX5 A;  1OTR B;  2J42 A;  5C3J B;  3RNF C;  1ZW7 A;  2LVP A;  1N63 A;  3R66 C;  1KLV A;  1SE4 A;  2C7N B;  5H92 C;  3VAW A;  4NY0 A;  1C4C A;  3Q8A A;  3JYU A;  1F2R I;  1HZ6 A;  3B9J A;  2D10 A;  2IGG A;  5IN7 A;  1Q1O A;  2YEP B;  3L17 A;  2FUH B;  2M4N A;  4C4V B;  3ONS A;  3AH7 A;  1FNW A;  4GDL A;  3HK0 A;  3BYY B;  1AWD A;  4EOY A;  4EKU A;  2ZVN A;  2LGS A;  3PZ8 A;  1CMX B;  2WHI A;  5IP4 D;  5JXV A;  2YEP F;  3V60 A;  2BYE A;  2KJ6 A;  1B1Z A;  5G2N A;  2CJO A;  1Q5W B;  1ZXH A;  2E3T A;  3QC8 B;  5TSS A;  1FMA D;  2H89 B;  3W2D A;  3ZGZ A;  3KW5 B;  1EU3 A;  1I7H A;  2IO3 B;  3P2B A;  1TKY A;  1WFY A;  4MM3 A;  2DAJ A;  3VTW A;  3V62 A;  1WGG A;  1MI0 A;  4K7S A;  3T9L A;  4K81 A;  2KZR A;  4C7Y A;  1S3S G;  1CJE A;  3O65 B;  2PPH A;  2ON8 A;  4LDT B;  3SR6 A;  2PW9 A;  3ZUN A;  1TT5 B;  4N58 A;  4P7I A;  1SE3 A;  5AUI A;  5HHD G;  4GGQ A;  4L1B A;  2INP E;  1V5O A;  4W9J A;  3UIN B;  3BIN A;  1XLQ A;  2N1V A;  3PHW B;  3N1Z C;  5DPT A;  1D5Z C;  1WR6 E;  2WXF A;  1V5T A;  2FIF A;  3GP7 A;  2OED A;  2L83 A;  4GB9 A;  3NHE B;  3W1S C;  2GLS A;  1TZO A;  2MSE D;  4DXG A;  1J19 A;  1ZGU B;  3GS2 A;  1PYW D;  3BY4 B;  3AV8 A;  3LDZ E;  4YTP B;  2KAN A;  3AUL A;  2M0X A;  4KGS A;  4WWN A;  3DBR B;  2RDG A;  4W9D A;  1E5W A;  1I4G A;  1MHH E;  3IT6 B;  5CHW A;  1TS2 A;  5G5G A;  3A4R A;  2NPT B;  1JCK B;  3PO0 A;  1QOG A;  1YX5 B;  3OLM D;  4GMV A;  3AE1 B;  3C19 A;  1UNS A;  3EGR A;  3OG5 A;  3L4P A;  1PUT A;  4RM9 A;  2L52 A;  5AZG A;  1VJK A;  2LVO A;  4W9E A;  1C4P A;  1L6U A;  2GOW A;  4M02 A;  2D3A A;  4REZ A;  4LJP B;  4KGT A;  2KAC A;  4XX5 A;  4HKZ E;  3PV1 A;  1M94 A;  3MC0 B;  4KIK A;  5D3D A;  2OJW A;  2N9L A;  3QHT A;  4FBJ B;  2M56 B;  3VHT C;  2WX1 A;  1IP9 A;  2JPH A;  3M3J A;  3RUI B;  3A9J A;  4Q2J A;  4HK2 A;  5EE3 A;  4D2K A;  3DBS A;  2N9X A;  3A4S C;  2MLB A;  2WXH A;  2WXO A;  1V8C A;  2IZV B;  2HD5 B;  4RGM A;  2R2Q A;  1SF0 A;  3PHX B;  2D3G A;  5DPR A;  4WJN A;  2MW5 A;  2WXL A;  1QOF A;  2OHF A;  1E9M A;  3ZDM C;  2G3Q B;  2JVC A;  1V9J A;  2RPV A;  1L0X B;  2K8B A;  1TS4 A;  1RAX A;  4ZOH C;  2KVZ A;  1D5X C;  1OQY A;  3DQV A;  1G6J A;  3QA8 A;  3PRP B;  2RDH A;  1ZDV A;  1YQB A;  2QMT A;  2ZCB A;  1AW7 A;  1GC7 A;  2HJ8 A;  2OOB B;  1HTQ A;  3WA0 A;  1N5X A;  2CU1 A;  1U4A A;  2FCS A;  2MHJ A;  2ZW0 A;  1PQS A;  3B1L X;  4RMA A;  3WAP A;  2KJR A;  1IUE A;  3ZTD A;  2LGY A;  2MH7 A;  1GG3 A;  2KDM A;  4C80 A;  2C7H A;  1IBX B;  1VR9 A;  2GRI A;  4ZHO A;  4HLE A;  1QQR A;  1ROE A;  1EF5 A;  4KKI A;  1YQ3 B;  3H7P B;  3RZF A;  1YJI A;  3KYC D;  4BKG A;  4JL9 A;  1QOA A;  1PFD A;  4DHZ B;  2L0T A;  4B9K A;  1MPE A;  2IO2 B;  1XO3 A;  1EWC A;  4JWU C;  4K1R B;  1JAL A;  2PTL A;  3UF8 A;  2I2Y A;  1WF9 A;  2ZEQ A;  1ET6 A;  3VUY A;  3IXS A;  3S2A A;  2FBW B;  1KTK A;  3IVF A;  2GBN A;  1ACC A;  3CF6 E;  3NY5 A;  3SHQ A;  2IPK D;  5JZE B;  3T8M A;  4ASW C;  2MJD A;  4WWO A;  1FXT B;  3AXC A;  2W82 A;  4IWO A;  1WZ0 A;  2PE6 B;  3RN9 C;  3HM3 A;  2JWZ A;  3U30 A;  1OEY J;  2IGD A;  1PGB A;  4AOF A;  1C3T A;  2KX3 A;  1R4N B;  3OJ4 B;  3PSE B;  3VDZ A;  4GOC A;  4HCN B;  1AYF A;  4CO7 A;  4PYU A;  3M63 B;  1N5W A;  4W9H A;  5EDS A;  3AEG B;  3JVZ X;  4BOZ B;  4GDK A;  3UI3 A;  1NBF C;  1RWS A;  2GB1 A;  3RI7 C;  1R4M B;  3AE9 B;  1QIL A;  4OVU A;  3AE8 B;  4XWW A;  2IYD B;  3VR9 B;  5IOI A;  1PDX A;  4L23 A;  1GC6 A;  5EE9 A;  5J17 A;  1STE A;  4A6Q A;  2KN4 A;  2KMM A;  1H4R A;  2IGH A;  5EE1 A;  4PS7 A;  4YTM B;  2KWD A;  3BK2 A;  3H1U A;  4NJ6 A;  2AWT A;  1UWM A;  2VH2 A;  5BMH A;  4A9A A;  2HTM E;  1WXM A;  5LNK 1;  2FCM A;  4N6E B;  1RFK A;  5JHB A;  2MEK A;  3QX1 A;  4B0M A;  2GMI C;  3PRE A;  1UD7 A;  3DCG A;  3AEC B;  3EA6 A;  3ZVV A;  3ZNZ B;  4LNI A;  3MJW A;  1HXY D;  2V0G A;  1C79 A;  5HG2 A;  1D4B A;  3I9V 1;  3KWL A;  4WIP A;  2KT7 A;  4E71 A;  3CSF A;  3MTN B;  1YN4 A;  3VVW B;  1TKG A;  1MG8 A;  3NVW A;  3R2T A;  5AZF A;  3L54 A;  2D3C A;  3TBL D;  3AM9 A;  4A20 A;  4MGY E;  1WX9 A;  2ICI A;  4JWS C;  4ANU A;  3RNA C;  3ZYY X;  4LCD E;  4DDI D;  4IUM B;  2NTS A;  2JYE A;  2IO1 B;  3P4Q B;  3ZO5 B;  3RZW C;  2KHW B;  4US9 A;  2AEH A;  1WR1 A;  1NYQ A;  4FJZ A;  1MJD A;  3GOE A;  3BVM A;  1WJ6 A;  2OJR A;  4ARI A;  4GDL B;  4C00 A;  3VUX A;  4DBG A;  2UU7 A;  4ZRQ A;  2BYT A;  1I35 A;  4DK5 A;  2BS2 B;  3PRM B;  2WWZ A;  1WX7 A;  3P4R B;  1SGH A;  2HTH A;  5GMV A;  1FO4 A;  4GN1 A;  2Z8L A;  2RMM A;  3DHH C;  5BO4 B;  3IFW B;  4YXD B;  2FCQ A;  2L00 B;  1E8Z A;  2ZPN A;  2BPS A;  4K7U A;  4XZ4 A;  1P3Q U;  1S1Q B;  3KLS X;  2D11 A;  3VXW A;  1X1M A;  2D5G A;  3BK1 A;  3Q3J A;  4E74 A;  1Y56 A;  2ZNV C;  1PGA A;  3L08 A;  3ML9 A;  2CKH B;  2DAF A;  3V61 A;  2A4Z A;  2YLM A;  3QCA A;  2BW2 A;  2AL6 A;  4MSM B;  1A5R A;  3V6C B;  3ZXR A;  1EM7 A;  3RNB C;  5AZH A;  4KDI C;  1WXA A;  4KKJ A;  1WYG A;  1K50 A;  4XDD A;  3ZW3 A;  2KFK A;  1NEK B;  4AS1 A;  1GPX A;  2KLG A;  1XQQ A;  5HI1 A;  2RDB C;  2GBK A;  4IM2 A;  2MBH A;  1UH6 A;  3Q14 C;  3P63 A;  4GIV A;  1DYQ A;  3PZD A;  3QAR A;  3MJ5 A;  3DWM A;  1ZDX A;  4MGI E;  1SE2 A;  4K7W A;  3X23 A;  1GB1 A;  3V05 A;  2KVR A;  2W9N A;  3ML8 A;  1VRA B;  2DYB A;  2QSD A;  4C7Z A;  2QCZ A;  2QJL A;  2QIL A;  1EU4 A;  2G9H D;  3A9K A;  4GLS C;  1ZP0 B;  5IO9 A;  2K8H A;  2IY1 B;  4RGN A;  2DZK A;  4K3C A;  3V6E B;  4BBN C;  1WM3 A;  3KUZ A;  2PKO A;  2MX2 A;  1P0R A;  4WJP A;  2LI5 A;  4DHJ D;  1YNT E;  4YSX B;  2J52 A;  4KDL B;  4M0W A;  1PGX A;  1YD8 U;  3A1Q A;  2GBM A;  4HJK A;  4KIK B;  1JWS D;  2D2Q A;  1T0S C;  4OW0 A;  2NVU I;  2BB5 A;  1HZ5 A;  2XK5 A;  2K39 A;  5G5H A;  1OGW A;  4DWF A;  1V2Y A;  3L13 A;  4OZC A;  3A9J B;  1KLG D;  3AED B;  1UEL A;  2R61 A;  3HHM A;  3ZKJ C;  1WX8 A;  4GU2 A;  3OWE B;  2JUO A;  2BS4 B;  1P7F A;  2W54 A;  4F7Z A;  5FR6 A;  3FC4 A;  1ENF A;  2K0P A;  4CQN A;  3JSV B;  3NVZ A;  2IBI B;  5G55 A;  1WXV A;  4LK0 M;  3SD5 A;  2O6V B;  3Q8E A;  4NPN A;  3V3X A;  2MWS B;  2WDV B;  4LTU A;  3AEA B;  4XDC A;  2L8J A;  2MQJ A;  4US8 A;  1N61 A;  1FFU A;  1GAQ B;  3HRD D;  4L2Y A;  4M01 A;  3B2G A;  4LLG M;  2HE7 A;  3ZJU A;  3RUL A;  4TQ0 A;  2Y5P A;  2KQS A;  3AMZ A;  4AJW A;  3ENE A;  1CQV A;  4ANV A;  2MBE A;  1WM2 A;  3N1X C;  4M8M A;  3RFZ B;  1XLO A;  3ZXV A;  2W55 A;  2IO0 B;  2DYM A;  2QHO A;  2KO3 A;  2NBU A;  2PE9 A;  2RGF A;  1AAR A;  3APF A;  4ARC A;  2MBB B;  3U7D A;  1KM7 A;  2KWV B;  1T0Y A;  1EF1 A;  1WYW B;  3CMM B;  1E10 A;  1ZE3 D;  4W9G A;  1ISN A;  3N3K B;  4JQW C;  3KH0 A;  2K6Q A;  3H6N A;  1C1Y B;  1WJU A;  3KQ4 A;  4BZA A;  2KX0 A;  4TKN A;  2N4F A;  2NBW B;  2CHW A;  2N7E A;  2C9W B;  3AE6 B;  2ZZP B;  3N20 C;  2LZ6 A;  3JW0 X;  3TMP B;  1JWB D;  1Z5S B;  3WAN A;  2WXK A;  5E6J A;  1LFD A;  3R7R A;  5DPS A;  4YSY B;  1J0G A;  1LO5 D;  3LJ3 A;  4MT5 A;  2D07 B;  2NTT A;  1QOB A;  3ZNI D;  2JQR B;  1L0Y B;  3A33 B;  1V1P A;  3H7S A;  2DZJ A;  3KYD D;  4M8N A;  5D3I B;  1XD3 B;  2AQ1 B;  2YVC A;  1LQB A;  3DBH I;  4RF0 A;  2MA9 B;  3VFK A;  3NZU A;  4JE3 B;  4MEL A;  1XT9 B;  2K8C A;  2JZ3 B;  3FAH A;  1F9J A;  3QAQ A;  3APD A;  4XC2 A;  2NR2 A;  2WXJ A;  5L95 C;  1E7P B;  1I4P A;  1TS3 A;  3SU8 X;  4EZJ A;  1ZOY B;  2LVQ A;  2JXT A;  1JRU A;  1VZ8 A;  4UDU C;  2DHZ A;  2Q5W D;  3SFD B;  3ZRC A;  2UYZ B;  1LM8 B;  4XYC A;  5IA7 A;  3MHZ A;  4MJS A;  4MSQ B;  2O2V B;  1B9R A;  1MVK A;  1MFW A;  2ZNV B;  4MAC A;  4GDK B;  1F2R C;  2MBQ A;  3L0W B;  1V97 A;  2INN E;  2IY0 B;  3NVY A;  3AN1 A;  4NAW A;  3U2S C;  2MJE A;  1HE8 A;  2C5L C;  3L10 B;  4EZK A;  3ZIM A;  1I4X A;  4WJO A;  1NEN B;  4HXD A;  2ZJD A;  4A90 A;  1FCL A;  2BQQ A;  4GSW A;  2LAS A;  1K51 A;  4ANW A;  2V3N A;  2LJ5 A;  2NBV B;  2WU5 B;  2FAZ A;  1UZX B;  4KSK C;  1I4Q A;  3ZLZ A;  3TIX A;  1ZXI A;  1D6E C;  1OQR A;  2LGX A;  1HEZ E;  2QIE B;  5D2M B;  1E7U A;  2LHD A;  1SIJ A;  3IT4 B;  3SFE B;  4JLC A;  3T3O A;  3K9P B;  3PTF C;  5KHQ A;  5CTR C;  1VZ7 A;  1L4Z B;  4J6I A;  2KDI A;  3H9D A;  2LXC A;  4XE0 A;  2K25 A;  4E3C A;  4M00 A;  4URK A;  4IOI E;  4K3B A;  2WLB A;  3PLV A;  2PEA A;  4TV3 A;  2I38 A;  3N30 A;  4YWG G;  4F8C B;  2MJ3 A;  4IDI A;  2WQY B;  1RYJ A;  4WWM A;  4P6V F;  3AE7 B;  1NYR A;  3UQA A;  4OHJ A;  4YL8 A;  2KKC A;  2GI9 A;  5E6O A;  2I1K A;  3M62 B;  5IKC M;  5E6P A;  2BBC A;  1KOT A;  3QK0 A;  4KZC A;  3WIM A;  5GXG B;  2JZP A;  2DWQ A;  4BBN F;  1TY0 A;  2KQ7 A;  2NPT A;  3SDL C;  3I5J C;  4ZRJ A;  1MG4 A;  1TZ1 A;  1RLF A;  1KF6 B;  2JRH A;  3TL5 A;  3B08 A;  3RCZ A;  1C77 A;  2ZCC A;  3E9S A;  1L0V B;  2ASQ A;  4IM0 A;  4FJY A;  4MGK E;  3TEZ A;  2JSV X;  1V49 A;  2W3S A;  3PGE A;  2JZZ A;  5BYS A;  3W5V B;  1V1O A;  2IDY A;  1IGC A;  2LFI A;  2V9H A;  1E7V A;  2J0K A;  5AEK B;  4CHK A;  5FK9 C;  2AQ2 B;  1T6B X;  3ZJV A;  3J9C A;  4EE2 A;  3QJZ A;  2INC C;  1QF6 A;  4DHJ B;  3MC9 A;  1NI2 A;  4LNF A;  4A55 A;  4W9C A;  2KFK B;  2CR5 A;  3HVD A;  2V3P A;  2Z59 B;  3TEX A;  3TCA A;  4RGT A;  2AL3 A;  5C2T B;  1ET9 A;  1K8R B;  3IG3 A;  4FUL A;  4C56 C;  4HRS A;  1QT9 A;  3PRZ A;  2BT6 A;  4HDO A;  1GB4 A;  4NJC A;  3URY A;  5C23 A;  4IM3 A;  1QZE A;  4II2 B;  2JU6 X;  4G0N B;  2V4I B;  1LXD A;  4RFB A;  4ZRK A;  1CZP A;  3KUD B;  1V86 A;  1WH3 A;  1WSP A;  1RFA A;  2KMC A;  2M8S A;  4HEA 1;  2MP2 A;  5C1Z A;  2K6D B;  3A9K B;  3T3N A;  2QC8 A;  2JX5 A;  1LGR A;  2M17 A;  2Y5B B;  3DVN V;  1H8C A;  4H2A A;  2XBB C;  3EFU A;  2NCN A;  2LRU A;  3VRA B;  5JHA A;  4EFO A;  1IGD A;  4XGA B;  1Z2M A;  1L5P A;  1QLB B;  1TY2 A;  4KX6 B;  3VH4 B;  1IBX A;  1V80 A;  3ZRF A;  4M0W B;  1N6Z A;  2LJI A;  3A1Q B;  4BKS A;  1I4R A;  1YJ1 A;  4NNJ B;  3H7P A;  4LNO A;  1P7E A;  1WGH A;  2XK5 B;  3QWZ B;  1ZUD 2;  2LRW A;  4NQL B;  1UBI A;  2EKI A;  3NS1 A;  2DLB A;  3P4S B;  3TEW A;  1WIA A;  4AP4 C;  1JML A;  2LGI A;  4LNK A;  4XWT A;  4MGZ E;  3FIL A;  1N60 A;  4G11 A;  3MP9 A;  2JT4 B;  2BB6 A;  3MHS D;  2WXG A;  4HVB A;  2KWU B;  1GUA B;  3DBL I;  2KNB A;  1C9F A;  4MH0 E;  2LEK A;  1GOZ A;  4DXF A;  2RSU A;  3AU5 A;  3WAM A;  4KVG B;  4WJQ A;  4I6P A;  4KV2 A;  2J7Q B;  4TMA B;  1FXI A;  4ACF A;  4MM3 B;  2N9K A;  4I6L B;  2PVO D;  3ETR A;  1VZ6 A;  4AWJ A;  3BYT B;  2KDE B;  1EUV B;  4WQM A;  3EC8 A;  3BWU D;  5JH5 C;  5HKH A;  3Q6B A;  3O13 A;  1TS5 A;  2JY6 A;  1L7Y A;  2N1W A;  2CJN A;  3BVG A;  3Q3F A;  1D5M C;  3RYT A;  4MEM A;  3RNE C;  4FJV B;  2K1F A;  4RH6 A;  3DVN U;  1SEB D;  4CYE A;  3LXF A;  1FIQ A;  4BKS D;  5CHF A;  2BWF A;  2BYV E;  5T8I A;  2PLP A;  2L76 A;  3P4P B;  3ABV B;  1E8X A;  2FCN A;  2VZK D;  2WGS A;  3GZN I;  3WAL A;  1UUP A;  4NAM A;  4IWP A;  1RRB A;  1P98 A;  1J7C A;  3Q2A C;  2D3B A;  1WY8 A;  2Y5C A;  3LYY A;  2KYW A;  4MH8 A;  3H8H A;  2CHZ A;  4JGH B;  1BUI C;  3I57 A;  3W1S A;  3Q8C A;  1WZ3 A;  1FNV A;  3DDC B;  5DCN A;  3NUH B;  3RT3 B;  1SXT A;  4RNA A;  2KDF B;  3PZ7 A;  3HM6 X;  1Y8R C;  4OVV A;  2DYO A;  1L4D B;  2M0A A;  2EMS A;  4JIO U;  5L83 A;  5J18 A;  4X57 B;  1T3Q A;  3DHG C;  1I42 A;  2WXQ A;  1XCQ L;  4RM8 A;  3BII D;  2MBO A;  4NZL B;  1UGM A;  3NOB A;  3IBE A;  3QQ8 B;  2QDF A;  1FPY A;  3NZS A;  3HIZ A;  1R7S A;  4TUU A;  3N1Y C;  3E56 A;  1DOY A;  2L1A A;  1MHX A;  3R7Q A;  3P42 A;  3D32 A;  1FRR A;  4HRO A;  4W9F A;  2EEL A;  2CU3 A;  1ZPS A;  4B95 A;  1T0R C;  2BF8 B;  2HDE A;  1YJJ A;  3APC A;  1JRO A;  1XCT L;  4N9F 4;  3PLU A;  1F77 A;  2X38 A;  1XLN A;  1L6V A;  2BKR B;  3AE5 B;  5LXH A;  2GBR A;  3EHV A;  4MJS B;  4GXB A;  4LNN A;  4BFR A;  1WXQ A;  1VLB A;  2KWC A;  4HWI B;  2LUE A;  4AUQ C;  5CX3 A;  1WE7 A;  2DZI A;  4NAW B;  1VD2 A;  3IAM 1;  4A3O A;  1OFF A;  1C76 A;  2LWP A;  4O1N A;  1OEY A;  2J0M A;  3DBH B;  1JQ4 A;  2WDR B;  1FNU A;  5E6N A;  1RM6 C;  3VH3 B;  1FD6 A;  2ZVO A;  3W9C B;  3KUC B;  5LLI A;  1WMH A;  1TBE A;  4PYZ A;  1E0Z A;  4DDG D;  5BMG A;  4W9I A;  2KTR A;  3AEF B;  1VCB A;  1JRP A;  4ITK A;  1AN8 A;  3NS8 A;  4RGO S;  4USA A;  4ZDV A;  4HDQ A;  1TYG B;  4ICU A;  1UBQ A;  2BS3 B;  2KDB A;  1VDV A;  3U4E G;  4ICV A;  1L2N A;  1YOV B;  1E8W A;  2BGF A;  1SBB B;  2JF5 A;  3VTV A;  3R3M A;  3VQI A;  2N0S B;  3ZQ4 A;  4PS3 A;  4P16 A;  2JWU A;  2MRP A;  2FE8 A;  1P1A A;  3AE2 B;  4YT0 B;  3Q8F A;  1WRI A;  2BVC A;  2LMC A;  2KMA A;  3W5U B;  2KC1 A;  1E6E B;  4II3 B;  3SEB A;  1CK1 A;  3DVG X;  5EE0 A;  3AE3 B;  2LHE A;  2UWQ A;  4J3O D;  4RF1 A;  2AYO B;  4HPM B;  4B0E A;  1F52 A;  2Z0D B;  3GB1 A;  3K9O B;  4HPL B;  1FFV A;  2PJH A;  3VR8 B;  1I4H A;  2WYQ A;  3TSS A;  1HQR D;  2M1M A;  3CIR B;  1GJZ A;  4N59 A;  3M95 A;  1FM0 D;  3CST A;  2BWE S;  3PPA A;  2KLC A;  4RCO A;  4NQK E;  2M19 A;  3U7Z A;  2XEW A;  2JYT A;  2LGD A;  3P1M A;  2NS5 A;  3NJT A;  1IPG A;  1SJH D;  4C4V A;  4TSS A;  2WXR A;  3HUI A;  1KRH A;  2RPQ A;  1YQ4 B;  4A3P A;  3VRB B;  2WNM A;  3AB5 A;  1YX6 B;  2TSS A;  2SAK A;  2DZM A;  3QIJ A;  3IAS 1;  2WU2 B;  2PVG C;  1HTO A;  1Q10 A;  2CS4 A;  1TTN A;  3JSV A;  3WCQ A;  1JW9 D;  2PIA A;  4DXA B;  1YN3 A;  3RPF C;  4KZ0 A;  3U8Z A;  2Y3A A;  4P1C C;  2O6V A;  3DOW A;  3N9Y C;  2X8X X;  1TKE A;  2R2O A;  2NMQ A;  1EO6 A;  3DBR I;  1IYF A;  2BYF A;  1TGZ B;  3KWV A;  2L3Z A;  1GNU A;  1BT0 A;  2VRR B;  3OAW A;  4S17 A;  2AQ3 B;  3Q69 A;  4FAD A;  4HPP A;  1UWX A;  2C7M B;  2MP2 B;  2V3S A;  4WUR A;  1YN5 A;  3ZNH B;  2KQ4 X;  3Q3N C;  1WE6 A;  2DBY A;  3PT2 B;  1K52 A;  1FEH A;  3PVL A;  1N62 A;  4PS8 A;  4EEW A;  4EZL A;  4BAX A;  3VTU A;  3L16 A;  3UQB A;  4HJG E;  3AE4 B;  3ALB A;  4OZA A;  1XLP A;  2IJ0 A;  1A70 A;  1WRD B;  1KJT A;  4OZB A;  5BYQ A;  2L05 A;  4BKT A;  4MDK E;  2ONQ A;  3C8Y A;  1KH0 A;  1DGJ A;  2KXJ A;  2B76 B;  4PK1 A;  4BVU C;  3RD2 A;  2WS3 B;  4W9L A;  3LB8 C;  4G3X B;  4OVZ A;  4NJ7 A;  4WH4 A;  2VZK B;  2O6V D;  2H88 B;  3RMK C;  5BYR A;  3NVV A;  2A5U A;  3ZTC A;  2K5P A;  3EEC A;  3FIL B;  1XF5 L;  4DHZ E;  3TUO A;  4LDT D;  1SE9 A;  3R8B A;  3X0W A;  3UGB B;  3NG0 A;  2W3R A;  1BML C;  5I4D A;  1DOX A;  4JPS A;  4FLH A;  5TR5 A;  1SJE D;  2IND C;  2VH1 A;  3R2I A;  4QAY A;  3RNC C;  3ZJT A;  2BKF A;  1KFY B;  4HCP B;  1WGK A;  2KOX A;  1T0Q C;  1HA5 A;  2ZW1 A;  2B3A A;  4ZYN A;  1OQQ A;  1FRD A;  3Q3M C;  2RD0 A;  1JWU D;  4S0R A;  2FNJ B;  2L0F A;  5CHV C;  2XN9 C;  1T5X D;  1P9D U;  2KFJ A;  2J4X A;  4FXC A;  2ACZ B;  2LUM A;  3BZD B;  2C60 A;  1EWY C;  2QEJ C;  1C78 A;  2L7R A;  2KD0 A;  4FA6 A;  3U52 E;  3ECI A;  2DNF A;  3UIP B;  1SIF A;  2O2V A;  4BOS C;  5J2R A;  1J7B A;  1SSN A;  3DBL B;  3FKY A;  1WGD A;  4WWP A;  5H8Y E;  2E6X A;  2WP9 B;  1E8Y A;  3KVF B;  1ESF A;  2ZPY A;  3MC8 A;  5FKA C;  2REX A;  2WXN A;  2G4D B;  4EUT A;  1WXS A;  2JXX A;  3RNG C;  4PT5 A;  2G45 B;  1F0Z A;  1BXT A;  4IWQ A;  2G1E A;  3AEB B;  1SB3 C;  1FCC C;  1YMH E;  3OJ3 A;  5KHO A;  1UGJ A;  4JX1 C;  2RR9 A;  4YSZ B;  1WJ4 A;  2Z0E B;  2WXP A;  4WQO B;  4ZHP A;  1TJE A;  4G50 A;  2N7J A;  2FID A;  4F1S A;  3W1Y A;  2K22 A;  4ZYS A;  4AJY B;  4ZRI A;  2DEN B;  2J0J A;  3IHP C;  2BTE A;  5IAA C;  3WAO A;  2HJ1 A;  3GZN B;  2KN5 A;  2V4L A;  3Q3O C;  1R4N I;  2PMV A;  1QKZ A;  1XEE A;  2N9P C;  1E90 A;  1J8C A;  5AUK A;  2LD9 A;  1WGY A;  2SEB D;  1TIF A;  1NI3 A;  1KLU D;  2V1Y A;  5DPW A;  1DOI A;  4KGR A;  2KJH B;  1JWM D;  3ZNG C;  1WGR A;  1ZKH A;  2CHX A;  3VUW A;  3AEE B;  1WJN A;  1R4M I;  1V81 A;  3B2F A;  3Q8B A;  3EFC A;  3AI5 A;  4IC7 B;  2L32 A;  2J53 A;  1WWT A;  3CWI A;  5D94 A;  2KC2 A;  3DVG Y;  4IW0 A;  4B6W A;  1M4V A;  5MPO A;  4FN2 A;  3PS6 A;  3GE8 C;  4IKG A;  4ANX A;  3DWG C;  3BVZ A;  3NRZ A;  4R3D A;  2FUG 1;  2WDT B;  4A8X C;  4LJO B;  3DPD A;  3ZDT A;  1UF0 A;  4FHK A;  4YTN B;  2EKE C;  5D6J B;  1WMH B;  3B0A A;  4W9K A;  1F1H A;  4DQO C;  1C4A A;  5FR3 A;  2G4S A;  2KTF A;  2KK8 A;  1K53 A;  2N9E B;  4FHJ A;  4WAF A;  1JWA D;  1V6E A;  2KTR B;  4ZRP A;  1Q0W B;  3UIO B;  5D7G A;  1D3Z A;  1J7A A;  3EUB 2;  3TJP A;  2JRI B;  4P1B C;  2MCN B;  4I6N B;  3N32 A;  2K3U A;  5HFY A;  2GBJ A;  2KAJ A;  1NDD A;  1YIW A;  3GE3 C;  3MFG A;  2WXM A;  2XNA C;  4TQ1 A;  2N7D A; 
#chains in the Genus database with same CATH homology
 4J6I A;  2KDI A;  3ZVV A;  4ICV A;  3ZNZ B;  1L2N A;  3H9D A;  3MJW A;  1E8W A;  2BGF A;  1WI0 A;  2LXC A;  4IG7 B;  3AU4 A;  2K25 A;  4KSL C;  4E3C A;  3I3T B;  2JF5 A;  3VTV A;  4URK A;  3R3M A;  3VQI A;  3PLV A;  2EMT A;  4PS3 A;  2PEA A;  3C0R B;  4TV3 A;  3N30 A;  5LXI B;  4F8C B;  4E71 A;  2DX5 B;  3CSF A;  2MRP A;  3MTN B;  3VVW B;  1P1A A;  4WAA A;  1MG8 A;  5AZF A;  3L54 A;  2KMA A;  2KC1 A;  2WX0 A;  4II3 B;  2LXA A;  3UQA A;  3TBL D;  3DVG X;  2I1J A;  2KKC A;  4YL8 A;  1OTR B;  5E6O A;  4A20 A;  4MGY E;  1WX9 A;  2I1K A;  3M62 B;  2UWQ A;  2AYO B;  4ANU A;  5E6P A;  1ZW7 A;  4HPM B;  2LVP A;  2Z0D B;  1KOT A;  3K9O B;  4HPL B;  3QK0 A;  4LCD E;  4KZC A;  3WIM A;  4IUM B;  4DDI D;  2PJH A;  3R66 C;  2IO1 B;  2WYQ A;  4BBN F;  3ZO5 B;  1KLV A;  3RZW C;  2KHW B;  2KQ7 A;  2NPT A;  2AEH A;  3SDL C;  2C7N B;  1WR1 A;  2M1M A;  1GJZ A;  4FJZ A;  3VAW A;  4NY0 A;  3M95 A;  3GOE A;  3JYU A;  1WJ6 A;  3CST A;  4ZRJ A;  1TZ1 A;  1RLF A;  2BWE S;  2OJR A;  3PPA A;  2D10 A;  4GDL B;  2KLC A;  2JRH A;  3TL5 A;  1Q1O A;  3VUX A;  4DBG A;  4NQK E;  1I35 A;  3B08 A;  3L17 A;  2XEW A;  2FUH B;  2M4N A;  2LGD A;  3RCZ A;  4DK5 A;  3ONS A;  3PRM B;  2ZCC A;  2WWZ A;  2NS5 A;  1WX7 A;  2ASQ A;  1SGH A;  2HTH A;  4GDL A;  4IM0 A;  4FJY A;  5GMV A;  4MGK E;  3HK0 A;  1IPG A;  4GN1 A;  4EOY A;  1V49 A;  4EKU A;  2ZVN A;  5BO4 B;  3IFW B;  3PGE A;  2FCQ A;  2L00 B;  2JZZ A;  1CMX B;  1E8Z A;  2ZPN A;  2BPS A;  4K7U A;  2RPQ A;  4XZ4 A;  1P3Q U;  1S1Q B;  3V60 A;  2BYE A;  2KJ6 A;  4A3P A;  2D11 A;  5G2N A;  1E7V A;  1Q5W B;  3VXW A;  1X1M A;  2J0K A;  5AEK B;  3QC8 B;  4CHK A;  1YX6 B;  3Q3J A;  2DZM A;  3QIJ A;  4E74 A;  2ZNV C;  3L08 A;  3ML9 A;  2CKH B;  2DAF A;  3KW5 B;  3QJZ A;  2A4Z A;  2IO3 B;  3V61 A;  2YLM A;  4DHJ B;  3P2B A;  2CS4 A;  1WFY A;  4MM3 A;  2DAJ A;  3VTW A;  1NI2 A;  3QCA A;  3V62 A;  1WGG A;  1TTN A;  2AL6 A;  3JSV A;  4K7S A;  3T9L A;  4K81 A;  4DXA B;  4W9C A;  4MSM B;  2KZR A;  2KFK B;  2CR5 A;  4KZ0 A;  3U8Z A;  3V6C B;  1A5R A;  1S3S G;  3O65 B;  2PPH A;  2O6V A;  3DOW A;  4KDI C;  4LDT B;  5AZH A;  1WXA A;  2Z59 B;  3ZUN A;  3TCA A;  2R2O A;  4P7I A;  2AL3 A;  3ZW3 A;  1K8R B;  3IG3 A;  2KFK A;  4FUL A;  1EO6 A;  3DBR I;  4GGQ A;  3PRZ A;  4HDO A;  1IYF A;  2BYF A;  4W9J A;  1TGZ B;  1V5O A;  2KLG A;  3UIN B;  2L3Z A;  1XQQ A;  1GNU A;  1BT0 A;  2VRR B;  3OAW A;  5C23 A;  3BIN A;  2GBK A;  4IM2 A;  2MBH A;  1UH6 A;  2N1V A;  3PHW B;  5DPT A;  4FAD A;  4IM3 A;  1WR6 E;  1V5T A;  2FIF A;  1QZE A;  4II2 B;  4GIV A;  3PZD A;  2MP2 B;  2C7M B;  2V3S A;  4G0N B;  1LXD A;  3QAR A;  4GB9 A;  4ZRK A;  3ZNH B;  3KUD B;  1WE6 A;  1V86 A;  1WH3 A;  3NHE B;  3PT2 B;  4MGI E;  1RFA A;  2KMC A;  2M8S A;  3W1S C;  3PVL A;  4K7W A;  2MSE D;  3X23 A;  2MP2 A;  5C1Z A;  2K6D B;  2KVR A;  4PS8 A;  4EEW A;  1J19 A;  1ZGU B;  2W9N A;  3BY4 B;  3A9K B;  3LDZ E;  3ML8 A;  2DYB A;  4EZL A;  2KAN A;  3AUL A;  2M0X A;  3VTU A;  3L16 A;  3UQB A;  3ALB A;  2M17 A;  2Y5B B;  3DVN V;  4WWN A;  1WRD B;  1H8C A;  1KJT A;  3A9K A;  4W9D A;  1E5W A;  2L05 A;  2XBB C;  4BKT A;  4MDK E;  5CHW A;  3EFU A;  2NCN A;  2K8H A;  2IY1 B;  2LRU A;  5JHA A;  4EFO A;  1Z2M A;  2KXJ A;  2DZK A;  3A4R A;  3V6E B;  1V80 A;  3VH4 B;  2NPT B;  3ZRF A;  4BBN C;  1WM3 A;  4M0W B;  3KUZ A;  1YX5 B;  2MX2 A;  1P0R A;  3A1Q B;  3OLM D;  4GMV A;  4WJP A;  3RD2 A;  4BVU C;  4BKS A;  2LI5 A;  1YJ1 A;  4W9L A;  4NNJ B;  4DHJ D;  3H7P A;  4G3X B;  4NJ7 A;  2O6V D;  1WGH A;  4RM9 A;  5AZG A;  2XK5 B;  4KDL B;  3QWZ B;  2LRW A;  2LVO A;  4W9E A;  4NQL B;  1YD8 U;  1UBI A;  2A5U A;  2GBM A;  3A1Q A;  4HJK A;  3ZTC A;  3EEC A;  4KIK B;  5CTR C;  2GOW A;  1WIA A;  2D2Q A;  4AP4 C;  4DHZ E;  4LJP B;  2NVU I;  4LDT D;  1SE9 A;  4XX5 A;  2XK5 A;  2K39 A;  3X0W A;  4MGZ E;  1OGW A;  3UGB B;  3PV1 A;  4DWF A;  1M94 A;  1V2Y A;  3L13 A;  4KIK A;  4G11 A;  2JT4 B;  3A9J B;  3QHT A;  4FLH A;  5TR5 A;  3MHS D;  4HVB A;  1UEL A;  2KWU B;  3HHM A;  1GUA B;  3DBL I;  2KNB A;  4FBJ B;  3ZKJ C;  2BKF A;  4MH0 E;  3VHT C;  1WX8 A;  2WX1 A;  4GU2 A;  4HCP B;  2RSU A;  3AU5 A;  3WAM A;  2JPH A;  1IP9 A;  4KVG B;  3M3J A;  2JUO A;  2KOX A;  4WJQ A;  3RUI B;  4I6P A;  3A9J A;  4F7Z A;  2B3A A;  4KV2 A;  5FR6 A;  4ZYN A;  2J7Q B;  4HK2 A;  4I6L B;  2RD0 A;  4AWJ A;  2FNJ B;  3JSV B;  3DBS A;  2L0F A;  2N9X A;  3A4S C;  2IBI B;  5CHV C;  2KDE B;  5G55 A;  2MLB A;  1WXV A;  1EUV B;  1P9D U;  2KFJ A;  3SD5 A;  3EC8 A;  2O6V B;  2IZV B;  2HD5 B;  4NPN A;  2R2Q A;  5JH5 C;  5HKH A;  2C60 A;  3PHX B;  2D3G A;  2MWS B;  2L8J A;  2MQJ A;  2JY6 A;  5DPR A;  2L7R A;  1L7Y A;  2KD0 A;  2N1W A;  4FA6 A;  3Q3F A;  4WJN A;  3ECI A;  2MW5 A;  2HE7 A;  3RYT A;  4MEM A;  3UIP B;  4FJV B;  3ZDM C;  2K1F A;  2G3Q B;  2JVC A;  1V9J A;  1SIF A;  3DVN U;  2O2V A;  4BOS C;  5J2R A;  4CYE A;  3RUL A;  4TQ0 A;  4BKS D;  1WGD A;  2K8B A;  5CHF A;  2KQS A;  2BWF A;  2BYV E;  4WWP A;  1RAX A;  4AJW A;  2L76 A;  1OQY A;  3DQV A;  1E8Y A;  3ENE A;  1G6J A;  3KVF B;  4ANV A;  3QA8 A;  2ZPY A;  2MBE A;  3PRP B;  1WM2 A;  1YQB A;  2REX A;  4M8M A;  1E8X A;  2FCN A;  2G4D B;  2IO0 B;  2DYM A;  2QHO A;  3GZN I;  2KO3 A;  2NBU A;  2PE9 A;  2RGF A;  2ZCB A;  4EUT A;  3WAL A;  1AAR A;  3APF A;  1GC7 A;  2HJ8 A;  2MBB B;  2OOB B;  1WXS A;  2JXX A;  3U7D A;  1KM7 A;  2G45 B;  1T0Y A;  2KWV B;  1EF1 A;  1WYW B;  3WA0 A;  2CU1 A;  4IWQ A;  1U4A A;  4IWP A;  2FCS A;  3CMM B;  1RRB A;  1P98 A;  1PQS A;  3B1L X;  4RMA A;  4W9G A;  3WAP A;  1ISN A;  2KJR A;  3N3K B;  3OJ3 A;  5KHO A;  2RR9 A;  1WJ4 A;  3ZTD A;  1WY8 A;  4JQW C;  3KH0 A;  2K6Q A;  3H6N A;  2LGY A;  1GG3 A;  2Z0E B;  1C1Y B;  1WJU A;  2C7H A;  2KX0 A;  4TKN A;  2N4F A;  2NBW B;  4WQO B;  2CHZ A;  2CHW A;  2N7E A;  4G50 A;  4JGH B;  3W1S A;  2C9W B;  4HLE A;  2ZZP B;  1WZ3 A;  3DDC B;  1EF5 A;  5DCN A;  2FID A;  3RT3 B;  2KDF B;  4F1S A;  3H7P B;  2LZ6 A;  3JW0 X;  3HM6 X;  1Y8R C;  4OVV A;  2DYO A;  3RZF A;  3W1Y A;  3TMP B;  4AJY B;  1Z5S B;  3KYC D;  4BKG A;  4ZRI A;  2DEN B;  2J0J A;  3IHP C;  4JL9 A;  3WAN A;  5IAA C;  3WAO A;  2EMS A;  4DHZ B;  2L0T A;  4JIO U;  5L83 A;  5J18 A;  1LFD A;  2KN5 A;  3R7R A;  4B9K A;  2V4L A;  4X57 B;  5DPS A;  1R4N I;  2IO2 B;  3LJ3 A;  1J0G A;  1I42 A;  2D07 B;  2N9P C;  1E90 A;  1J8C A;  4K1R B;  3ZNI D;  2LD9 A;  4RM8 A;  1WGY A;  3UF8 A;  2MBO A;  3A33 B;  1UGM A;  3NOB A;  3H7S A;  3IBE A;  3QQ8 B;  1WF9 A;  2DZJ A;  2ZEQ A;  3NZS A;  2V1Y A;  3HIZ A;  5DPW A;  3KYD D;  4M8N A;  3VUY A;  3S2A A;  4TUU A;  1XD3 B;  2KJH B;  3ZNG C;  1WGR A;  3IVF A;  2GBN A;  1ZKH A;  2CHX A;  2YVC A;  3CF6 E;  1LQB A;  3NY5 A;  3DBH I;  3R7Q A;  3SHQ A;  3VUW A;  3D32 A;  5JZE B;  2MA9 B;  3VFK A;  1WJN A;  3NZU A;  1R4M I;  4MEL A;  4W9F A;  3T8M A;  1XT9 B;  4B95 A;  1V81 A;  2K8C A;  4ASW C;  3AI5 A;  4IC7 B;  2BF8 B;  2JZ3 B;  3QAQ A;  1F9J A;  4WWO A;  1FXT B;  3AXC A;  3APD A;  5D94 A;  4XC2 A;  4IWO A;  2KC2 A;  3APC A;  2NR2 A;  1WZ0 A;  2PE6 B;  3DVG Y;  4N9F 4;  5L95 C;  3PLU A;  3HM3 A;  2BKR B;  4IW0 A;  2JWZ A;  3U30 A;  4B6W A;  3SU8 X;  5LXH A;  1OEY J;  2GBR A;  4EZJ A;  3EHV A;  2LVQ A;  3PS6 A;  4FN2 A;  4GXB A;  4MJS B;  4AOF A;  4BFR A;  1C3T A;  1JRU A;  2KX3 A;  2KWC A;  4HWI B;  2LUE A;  2DHZ A;  3OJ4 B;  3ZRC A;  2UYZ B;  1LM8 B;  5CX3 A;  3PSE B;  4AUQ C;  4ANX A;  3VDZ A;  5IA7 A;  1WE7 A;  4GOC A;  4HCN B;  2DZI A;  2WDT B;  4MJS A;  4MSQ B;  4NAW B;  2O2V B;  1VD2 A;  2ZNV B;  4CO7 A;  4GDK B;  4LJO B;  4PYU A;  4A3O A;  3DPD A;  2MBQ A;  3M63 B;  3L0W B;  3ZDT A;  2IY0 B;  2LWP A;  4W9H A;  1OEY A;  2J0M A;  4FHK A;  4NAW A;  5EDS A;  2EKE C;  3JVZ X;  4BOZ B;  1HE8 A;  4GDK A;  2C5L C;  3L10 B;  1NBF C;  5D6J B;  4EZK A;  1WMH B;  3B0A A;  4W9K A;  5E6N A;  3ZIM A;  4WJO A;  2G4S A;  4HXD A;  3VH3 B;  2KTF A;  2ZJD A;  2KK8 A;  4OVU A;  2ZVO A;  4GSW A;  2LAS A;  2IYD B;  2N9E B;  4FHJ A;  1GC6 A;  3KUC B;  4ANW A;  5J17 A;  1V6E A;  2LJ5 A;  5LLI A;  1WMH A;  2KTR B;  2NBV B;  2FAZ A;  1UZX B;  4KSK C;  3ZLZ A;  3TIX A;  1H4R A;  1TBE A;  1Q0W B;  4PYZ A;  3UIO B;  4PS7 A;  4DDG D;  5D7G A;  3H1U A;  4NJ6 A;  2AWT A;  1D3Z A;  4W9I A;  2KTR A;  3TJP A;  2JRI B;  2LGX A;  1VCB A;  2MCN B;  4I6N B;  3NS8 A;  5D2M B;  3N32 A;  1WXM A;  2FCM A;  1E7U A;  5JHB A;  4ZDV A;  4HDQ A;  3QX1 A;  2GBJ A;  2GMI C;  4ICU A;  3PRE A;  4JLC A;  1NDD A;  3K9P B;  1UBQ A;  1UD7 A;  3DCG A;  1YIW A;  3PTF C;  2KDB A;  5KHQ A;  4TQ1 A;  2N7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...